2JXPA

Solution nmr structure of uncharacterized lipoprotein b from nitrosomonas europaea. northeast structural genomics target ner45a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
155
structure length
155
Chain Sequence
MGFKLRGQVSELPFERVYITAPAGLTIGSDLERVISTHTRAKVVNKAEKSEAIIQIVHAIREKRILSLSESGRVREFELVYRVAARLLDAHNAELASLQEIRLTRILPFLDAQELAKAAEEEMLYKDMQKDAVQQILRQVSAFTSAGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lipoprotein B
publication title Solution NMR structure of uncharacterized lipoprotein B from Nitrosomonas europaea.
rcsb
source organism Nitrosomonas europaea atcc 19718
molecule tags Lipoprotein
total genus 36
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2007-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 2jxpA01
2N8XA 4KWYA 3BF2A 2JXPA 4NHRA 4N4RB 4RHBB 4Q35B 5TSEA 5IXMB 2R76A 5IV8B 4RH8A
chains in the Genus database with same CATH superfamily
4F6MA 2JWOA 5LMNE 4JI5E 1AAYA 3BIDA 4R2RA 2YRMA 3IWCA 2YRKA 1WJPA 2RSMA 2NA2A 4JI0E 2GLIA 2G7HA 2EOMA 4BCAA 4DV7E 4ZYHA 2YRHA 1X47A 5FLXC 2JOBA 1YUJA 4TUGA 2MC6A 4LU9A 5IWAE 2EL6A 2EQ1A 2LVHA 4JI6E 1BB8A 2EM4A 2L2MA 1IBME 3THNA 1LLMC 2UUBE 4HEIA 2LTRA 4RHBB 4L8NA 2LCEA 1L4SA 4NXNE 1YYKA 3MHSC 2RQLA 2EPUA 4LF4E 5A2QC 2WZOA 3J7Yp 4JI3E 2CTDA 1DQ3A 1A1FA 2B3TB 1G2FC 1EH8A 3H09A 2EM8A 1A1LA 2YTDA 3ZOQB 4DV1E 4B3ME 2YTOA 2UXCE 2WBTA 1QU6A 4NXME 1RC7A 2E5LE 3OTOE 2RTXA 4YHHE 2ENHA 1WHNA 4IJDA 1X48A 5LL6R 4WSPA 3HQ1A 4ZYDA 3T1HE 1TF6A 4DV3E 4LF6E 5KL6A 2N3HA 2LO3A 4BBYA 2V85A 1YFHA 2UUAE 5T6JA 1DGCA 2EN3A 3EQ1A 2WBUA 1YPNA 4LF5E 2EOQA 5IT9C 4R2SA 4LF7E 5KL5A 4OOGC 2EMAA 3OMLA 2EPXA 2BB8A 1YYOA 4X8WA 1PDAA 4R2DA 2EPKX 2FTXB 2YU8A 3TQMA 1T39A 2YT4A 2L8TA 3ADLA 4M2ZA 4KHPE 2EPPA 2JR1A 5AE2A 3AV0A 1P47A 1SR9A 2EN1A 1DI2A 1NCSA 2EE8A 1HNZE 2MDRA 4R2PA 1IMUA 1PJSA 2LRSA 2A25A 3HXLA 4F6NA 2UU9E 5BR8E 1FKAE 1O0WA 2LBSB 1YYWA 4M0VA 5AE1A 4LFCE 3UK3C 2J7JA 3J80C 2KHXA 4O24A 3K6QA 4LTYA 4GEQB 3M99B 3ADIA 4BS9A 1UHZA 2MKDA 2VF1A 4JI4E 2V86A 2LV2A 1N3GA 3C4TA 4JI1E 3F6HA 2EMWA 1NEIA 2L33A 1TN9A 2EQ3A 4DV2E 2B7TA 1T4OA 2RPCA 2YTIA 2EMLA 2CSHA 2JY9A 1XNQE 2V83A 1BBOA 1GTKA 2I13A 4BC9A 2ENCA 4Q28A 2EMFA 2LJHA 4Q35B 2DMYA 2KOUA 2EPRA 2CT1A 1A1GA 2MKNA 4R2AA 4ZYGA 2EZ6A 3EPLA 2L92A 2ENAA 1FJGE 1JK1A 2ELZA 4M9VC 2EL5A 2L2NA 1IBKE 2RSIA 1ZR9A 2YWQA 2B7VA 5IXMB 4MLQA 2KONA 4X66E 2N8XA 2YZTA 2CPNA 2F8BA 4GZNC 4DMIA 2UXDE 5KL2A 2VQFE 2LJUA 5LMUE 1F2IG 5AE3A 2EPZA 2EOZA 1N33E 1T4LB 1T4NA 3LLHA 2EOIA 2VRDA 5KL7A 2EM3A 2V8QB 2WBSA 4IS1C 4LFAE 1UILA 3L00A 2LUPB 2EPAA 2R76A 3C6MA 3JTZA 4ZYEA 2M7QA 3HPZA 4KZSA 2EM0A 1X6FA 3MHHC 2EPMX 5CFFE 2EM5A 2Q8UA 5AASA 1N34E 3THOB 2EN4A 4MLVA 1X6HA 4OX9E 4B3RE 5F3WA 4R2EA 2EPLX 3IWDA 3VYYA 2L6MA 2DB2A 1XMOE 2RS7A 3DJWA 2L2KB 3HPSA 5ADZA 1B69A 1GQEA 2HGHA 5LLQA 1UN6B 4DR7E 4LFBE 4KWYA 4JV5E 2EP3A 2EOEA 1ZBTA 5A6BD 4R2CA 4JYAE 2EM9A 1MGTA 2EQ0A 4JI7E 2VQEE 2YSPA 1HNWE 2EMIA 3VK6A 1PKPA 4X62E 4RH8A 2WCC3 4WSGA 1WRJA 1X49A 2MC5A 4R2QA 3LMLA 1WXRA 2MDGA 2DLQA 2E72A 2ZM6E 1HR0E 1STUA 2EN2A 3ADGA 4TUIA 2YU5A 2LTSA 4DR4E 3P1XA 1N36E 4DR2E 2R1FA 1QNTA 4DR6E 3EPJA 2YTPA 5A6JA 3ADJA 2EMYA 4WXDA 2M1SA 5IV8B 3T1YE 3C4BA 4X9JA 1WHQA 2D9HA 2EORA 2H36X 3VHTB 3J81C 4GKKE 3MSWA 1Z1BA 1KJKA 4F9CB 4DR1E 1ZU1A 4DR5E 1UBDC 2K4VA 2YTEA 1ZBQA 2DSYA 2E1MA 4BHBA 1T38A 4WXCA 2EMGA 1YZ9A 4L5NC 2EWLA 1KYQA 2EOXA 2NUGA 2PRTA 2NUFA 4BMJA 2HC5A 5KL3A 2EMBA 2FV4B 2EL4A 2UXBE 4DKKA 2M4IA 2YPNA 2UUCE 1IQSA 2FGGA 4O43A 1G2DC 2RS6A 3KZZA 3QG5C 4JI8E 4R8OA 2K7IA 4P7DA 1XMQE 4LF9E 4B3SE 3C6KA 5TSEA 5KL4A 1HNXE 5A6KA 1EH7A 4JI2E 4N4RB 2EOFA 2EMHA 4P78A 4DV5E 2HHHE 1SFEA 4FK5C 2V89A 2EPCA 3VYXA 4O4KA 1X6EA 3KWRA 2JP9A 4LF8E 2V88A 1J26A 2EOSA 2YTJA 4GKJE 2YTQA 5AC5A 4B3TE 3KZYA 3IWBA 2DRPA 1YUIA 2DMIA 4WX9A 4NHRA 4DV6E 2EM2A 1EH6A 2JOXA 2LE2A 2B9DA 1PJTA 2EMZA 2YTGA 1RMDA 1BBGA 4F9AB 2GPIA 3JU0A 2ODRD 2EOHA 2EOJA 2EMXA 2M9AA 4DUYE 1TF3A 4DV4E 4DUZE 2EOYA 4K0KE 3F6GA 2L3CA 2EM6A 4F2JC 2EPOA 5DNYA 2JYAA 2ELYA 4WYQB 2EN7A 3HTXA 2EN6A 3FIGA 2I9IA 2HJJA 4NZVA 4DV0E 3ECRA 5A69A 3JAMC 4O5GA 5A6AA 2LT7A 1A1HA 2LUQA 2ODRC 2EM7A 2BBGA 1JK2A 1MEYC 4F54A 1X3CA 1A1KA 2V87A 3EPHA 2YTNA 3J7AG 2DIXA 3BF2A 2JVAA 2N3GA 2L3JA 3EPKA 1ZAAC 2NABA 1A1JA 3BBGA 2EOOA 4X64E 1IQOA 4AQYE 3DF6A 3RMPA 2EN8A 2LMZA 1GZ6A 4F9BB 4DR3E 4R03A 1YSAC 4HTGA 2F4VE 5AC4A 1N32E 2DLKA 2ADRA 2EMCA 4I8OA 2YTFA 2DGCA 2NUEA 4BHCA 1AH5A 1RQ0A 1PJQA 3AUZA 1X5WA 4J8ZA 2JPAA 2EMKA 4X65E 2IHR1 1EKZA 5A6BA 1A1IA 4WFTA 2EPNA 4YY3E 4BC7A 2JXPA 4M30A 1I94E 1XNRE 2YSOA 3BGHA 2GHFA 4WPYA 2EJ4A 2VE7C 1J5EE 1IBLE
chains in the Genus database with same CATH topology
2N8XA 4KWYA 3BF2A 2JXPA 4NHRA 4N4RB 4RHBB 4Q35B 5TSEA 5IXMB 2R76A 5IV8B 4RH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N8X A;  4KWY A;  3BF2 A;  2JXP A;  4NHR A;  4N4R B;  4RHB B;  4Q35 B;  5TSE A;  5IXM B;  2R76 A;  5IV8 B;  4RH8 A; 
#chains in the Genus database with same CATH topology
 4F6M A;  2JWO A;  5LMN E;  4JI5 E;  1AAY A;  3BID A;  4R2R A;  2YRM A;  3IWC A;  2YRK A;  1WJP A;  2RSM A;  2NA2 A;  4JI0 E;  2GLI A;  2G7H A;  2EOM A;  4BCA A;  4DV7 E;  4ZYH A;  2YRH A;  1X47 A;  5FLX C;  2JOB A;  1YUJ A;  4TUG A;  2MC6 A;  4LU9 A;  5IWA E;  2EL6 A;  2EQ1 A;  2LVH A;  4JI6 E;  1BB8 A;  2EM4 A;  2L2M A;  1IBM E;  3THN A;  1LLM C;  2UUB E;  4HEI A;  2LTR A;  4RHB B;  4L8N A;  2LCE A;  1L4S A;  4NXN E;  1YYK A;  3MHS C;  2RQL A;  2EPU A;  4LF4 E;  5A2Q C;  2WZO A;  3J7Y p;  4JI3 E;  2CTD A;  1DQ3 A;  1A1F A;  2B3T B;  1G2F C;  1EH8 A;  3H09 A;  2EM8 A;  1A1L A;  2YTD A;  3ZOQ B;  4DV1 E;  4B3M E;  2YTO A;  2UXC E;  2WBT A;  1QU6 A;  4NXM E;  1RC7 A;  2E5L E;  3OTO E;  2RTX A;  4YHH E;  2ENH A;  1WHN A;  4IJD A;  1X48 A;  5LL6 R;  4WSP A;  3HQ1 A;  4ZYD A;  3T1H E;  1TF6 A;  4DV3 E;  4LF6 E;  5KL6 A;  2N3H A;  2LO3 A;  4BBY A;  2V85 A;  1YFH A;  2UUA E;  5T6J A;  1DGC A;  2EN3 A;  3EQ1 A;  2WBU A;  1YPN A;  4LF5 E;  2EOQ A;  5IT9 C;  4R2S A;  4LF7 E;  5KL5 A;  4OOG C;  2EMA A;  3OML A;  2EPX A;  2BB8 A;  1YYO A;  4X8W A;  1PDA A;  4R2D A;  2EPK X;  2FTX B;  2YU8 A;  3TQM A;  1T39 A;  2YT4 A;  2L8T A;  3ADL A;  4M2Z A;  4KHP E;  2EPP A;  2JR1 A;  5AE2 A;  3AV0 A;  1P47 A;  1SR9 A;  2EN1 A;  1DI2 A;  1NCS A;  2EE8 A;  1HNZ E;  2MDR A;  4R2P A;  1IMU A;  1PJS A;  2LRS A;  2A25 A;  3HXL A;  4F6N A;  2UU9 E;  5BR8 E;  1FKA E;  1O0W A;  2LBS B;  1YYW A;  4M0V A;  5AE1 A;  4LFC E;  3UK3 C;  2J7J A;  3J80 C;  2KHX A;  4O24 A;  3K6Q A;  4LTY A;  4GEQ B;  3M99 B;  3ADI A;  4BS9 A;  1UHZ A;  2MKD A;  2VF1 A;  4JI4 E;  2V86 A;  2LV2 A;  1N3G A;  3C4T A;  4JI1 E;  3F6H A;  2EMW A;  1NEI A;  2L33 A;  1TN9 A;  2EQ3 A;  4DV2 E;  2B7T A;  1T4O A;  2RPC A;  2YTI A;  2EML A;  2CSH A;  2JY9 A;  1XNQ E;  2V83 A;  1BBO A;  1GTK A;  2I13 A;  4BC9 A;  2ENC A;  4Q28 A;  2EMF A;  2LJH A;  4Q35 B;  2DMY A;  2KOU A;  2EPR A;  2CT1 A;  1A1G A;  2MKN A;  4R2A A;  4ZYG A;  2EZ6 A;  3EPL A;  2L92 A;  2ENA A;  1FJG E;  1JK1 A;  2ELZ A;  4M9V C;  2EL5 A;  2L2N A;  1IBK E;  2RSI A;  1ZR9 A;  2YWQ A;  2B7V A;  5IXM B;  4MLQ A;  2KON A;  4X66 E;  2N8X A;  2YZT A;  2CPN A;  2F8B A;  4GZN C;  4DMI A;  2UXD E;  5KL2 A;  2VQF E;  2LJU A;  5LMU E;  1F2I G;  5AE3 A;  2EPZ A;  2EOZ A;  1N33 E;  1T4L B;  1T4N A;  3LLH A;  2EOI A;  2VRD A;  5KL7 A;  2EM3 A;  2V8Q B;  2WBS A;  4IS1 C;  4LFA E;  1UIL A;  3L00 A;  2LUP B;  2EPA A;  2R76 A;  3C6M A;  3JTZ A;  4ZYE A;  2M7Q A;  3HPZ A;  4KZS A;  2EM0 A;  1X6F A;  3MHH C;  2EPM X;  5CFF E;  2EM5 A;  2Q8U A;  5AAS A;  1N34 E;  3THO B;  2EN4 A;  4MLV A;  1X6H A;  4OX9 E;  4B3R E;  5F3W A;  4R2E A;  2EPL X;  3IWD A;  3VYY A;  2L6M A;  2DB2 A;  1XMO E;  2RS7 A;  3DJW A;  2L2K B;  3HPS A;  5ADZ A;  1B69 A;  1GQE A;  2HGH A;  5LLQ A;  1UN6 B;  4DR7 E;  4LFB E;  4KWY A;  4JV5 E;  2EP3 A;  2EOE A;  1ZBT A;  5A6B D;  4R2C A;  4JYA E;  2EM9 A;  1MGT A;  2EQ0 A;  4JI7 E;  2VQE E;  2YSP A;  1HNW E;  2EMI A;  3VK6 A;  1PKP A;  4X62 E;  4RH8 A;  2WCC 3;  4WSG A;  1WRJ A;  1X49 A;  2MC5 A;  4R2Q A;  3LML A;  1WXR A;  2MDG A;  2DLQ A;  2E72 A;  2ZM6 E;  1HR0 E;  1STU A;  2EN2 A;  3ADG A;  4TUI A;  2YU5 A;  2LTS A;  4DR4 E;  3P1X A;  1N36 E;  4DR2 E;  2R1F A;  1QNT A;  4DR6 E;  3EPJ A;  2YTP A;  5A6J A;  3ADJ A;  2EMY A;  4WXD A;  2M1S A;  5IV8 B;  3T1Y E;  3C4B A;  4X9J A;  1WHQ A;  2D9H A;  2EOR A;  2H36 X;  3VHT B;  3J81 C;  4GKK E;  3MSW A;  1Z1B A;  1KJK A;  4F9C B;  4DR1 E;  1ZU1 A;  4DR5 E;  1UBD C;  2K4V A;  2YTE A;  1ZBQ A;  2DSY A;  2E1M A;  4BHB A;  1T38 A;  4WXC A;  2EMG A;  1YZ9 A;  4L5N C;  2EWL A;  1KYQ A;  2EOX A;  2NUG A;  2PRT A;  2NUF A;  4BMJ A;  2HC5 A;  5KL3 A;  2EMB A;  2FV4 B;  2EL4 A;  2UXB E;  4DKK A;  2M4I A;  2YPN A;  2UUC E;  1IQS A;  2FGG A;  4O43 A;  1G2D C;  2RS6 A;  3KZZ A;  3QG5 C;  4JI8 E;  4R8O A;  2K7I A;  4P7D A;  1XMQ E;  4LF9 E;  4B3S E;  3C6K A;  5TSE A;  5KL4 A;  1HNX E;  5A6K A;  1EH7 A;  4JI2 E;  4N4R B;  2EOF A;  2EMH A;  4P78 A;  4DV5 E;  2HHH E;  1SFE A;  4FK5 C;  2V89 A;  2EPC A;  3VYX A;  4O4K A;  1X6E A;  3KWR A;  2JP9 A;  4LF8 E;  2V88 A;  1J26 A;  2EOS A;  2YTJ A;  4GKJ E;  2YTQ A;  5AC5 A;  4B3T E;  3KZY A;  3IWB A;  2DRP A;  1YUI A;  2DMI A;  4WX9 A;  4NHR A;  4DV6 E;  2EM2 A;  1EH6 A;  2JOX A;  2LE2 A;  2B9D A;  1PJT A;  2EMZ A;  2YTG A;  1RMD A;  1BBG A;  4F9A B;  2GPI A;  3JU0 A;  2ODR D;  2EOH A;  2EOJ A;  2EMX A;  2M9A A;  4DUY E;  1TF3 A;  4DV4 E;  4DUZ E;  2EOY A;  4K0K E;  3F6G A;  2L3C A;  2EM6 A;  4F2J C;  2EPO A;  5DNY A;  2JYA A;  2ELY A;  4WYQ B;  2EN7 A;  3HTX A;  2EN6 A;  3FIG A;  2I9I A;  2HJJ A;  4NZV A;  4DV0 E;  3ECR A;  5A69 A;  3JAM C;  4O5G A;  5A6A A;  2LT7 A;  1A1H A;  2LUQ A;  2ODR C;  2EM7 A;  2BBG A;  1JK2 A;  1MEY C;  4F54 A;  1X3C A;  1A1K A;  2V87 A;  3EPH A;  2YTN A;  3J7A G;  2DIX A;  3BF2 A;  2JVA A;  2N3G A;  2L3J A;  3EPK A;  1ZAA C;  2NAB A;  1A1J A;  3BBG A;  2EOO A;  4X64 E;  1IQO A;  4AQY E;  3DF6 A;  3RMP A;  2EN8 A;  2LMZ A;  1GZ6 A;  4F9B B;  4DR3 E;  4R03 A;  1YSA C;  4HTG A;  2F4V E;  5AC4 A;  1N32 E;  2DLK A;  2ADR A;  2EMC A;  4I8O A;  2YTF A;  2DGC A;  2NUE A;  4BHC A;  1AH5 A;  1RQ0 A;  1PJQ A;  3AUZ A;  1X5W A;  4J8Z A;  2JPA A;  2EMK A;  4X65 E;  2IHR 1;  1EKZ A;  5A6B A;  1A1I A;  4WFT A;  2EPN A;  4YY3 E;  4BC7 A;  2JXP A;  4M30 A;  1I94 E;  1XNR E;  2YSO A;  3BGH A;  2GHF A;  4WPY A;  2EJ4 A;  2VE7 C;  1J5E E;  1IBL E; 
#chains in the Genus database with same CATH homology
 2N8X A;  4KWY A;  3BF2 A;  2JXP A;  4NHR A;  4N4R B;  4RHB B;  4Q35 B;  5TSE A;  5IXM B;  2R76 A;  5IV8 B;  4RH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...