2JXPA

Solution nmr structure of uncharacterized lipoprotein b from nitrosomonas europaea. northeast structural genomics target ner45a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
155
structure length
155
Chain Sequence
MGFKLRGQVSELPFERVYITAPAGLTIGSDLERVISTHTRAKVVNKAEKSEAIIQIVHAIREKRILSLSESGRVREFELVYRVAARLLDAHNAELASLQEIRLTRILPFLDAQELAKAAEEEMLYKDMQKDAVQQILRQVSAFTSAGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of uncharacterized lipoprotein B from Nitrosomonas europaea.
rcsb
source organism Nitrosomonas europaea atcc 19718
molecule tags Lipoprotein
molecule keywords Putative lipoprotein B
total genus 36
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2007-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 2jxpA01
5TSEA 4KWYA 2R76A 5IV8B 5IXMB 3BF2A 4NHRA 4RH8A 4Q35B 2N8XA 4N4RB 2JXPA 4RHBB
chains in the Genus database with same CATH superfamily
4DV6E 4R2EA 2EPZA 5LMUE 2CT1A 1WHNA 2DIXA 4F9BB 4NXNE 1WHQA 2DRPA 2UUAE 4ZYEA 4RHBB 4O24A 3K6QA 4BC9A 1IBLE 4LFCE 2JR1A 1PDAA 1T38A 1A1KA 1A1HA 1HNWE 1JK2A 2EPPA 2LVHA 4DUZE 1G2DC 4M2ZA 2JY9A 5LL6R 4L8NA 1J26A 2VE7C 3J81C 3F6GA 3IWBA 3P1XA 2V87A 2YZTA 3IWDA 1PKPA 2V86A 1X6FA 1TF3A 2YTQA 5LMNE 1N36E 3FIGA 4F9AB 3L00A 1EH7A 3J7Yp 1ZBTA 4DKKA 1NCSA 2NABA 3THNA 5AE2A 4JI3E 3T1YE 4L5NC 1A1GA 5A6JA 2RS7A 2YTEA 2RSMA 1XNQE 5A6BD 1N32E 2B7TA 2MKDA 1X48A 2DMIA 1UHZA 3ZOQB 1IQOA 2GLIA 2JVAA 1ZBQA 2EMHA 4R2RA 2GHFA 2F4VE 2L6MA 5IWAE 4DV5E 5IV8B 2DB2A 4LF5E 1UBDC 4DUYE 4LTYA 1X6EA 2YPNA 4AQYE 4B3ME 4DR1E 2YTFA 2YU5A 2L33A 1X5WA 4LFAE 2KHXA 2MC6A 4WFTA 1EH6A 2BBGA 2H36X 4J8ZA 4MLVA 1X3CA 2DMYA 4DMIA 2EMIA 3JAMC 4M30A 4WSPA 1PJQA 2NUGA 5IT9C 4BHBA 2ADRA 3VYYA 3QG5C 2EOEA 2YRMA 1DI2A 2EM0A 1WXRA 2JP9A 4LU9A 1ZU1A 4GEQB 4R2CA 3DJWA 4JI6E 1AH5A 2LBSB 4Q28A 1T39A 5TSEA 2JOBA 4LF7E 1T4OA 3KZZA 2A25A 1TF6A 2YRKA 4DR5E 2I13A 4F54A 1FKAE 2EPLX 2ELYA 2NUFA 1UN6B 2JXPA 4BBYA 3J80C 2UXBE 1PJTA 2YTNA 5A6BA 2L2KB 3RMPA 2VQEE 1I94E 1KYQA 2ENHA 3AUZA 2EN1A 4B3RE 2EPOA 3HXLA 5KL6A 2N3HA 3UK3C 1HNXE 2RTXA 4WXDA 3ADLA 2IHR1 3LLHA 2YSPA 2EN7A 2RS6A 4DR6E 4JYAE 4ZYHA 2EM3A 2N8XA 4P7DA 5KL4A 4LF6E 4DR4E 2EQ1A 4JI2E 2LE2A 1IQSA 4TUIA 4X9JA 2K7IA 2EMZA 2V85A 1PJSA 4NXME 1YYWA 4X66E 2YU8A 2EM7A 2EOMA 3VYXA 2WZOA 2EPKX 5AE3A 1RC7A 2CSHA 2EPXA 4JI5E 1YPNA 4R03A 4R2AA 5KL3A 1BBOA 2EM6A 4R2QA 2EQ0A 2I9IA 2Q8UA 2EORA 2LT7A 2EMWA 2LUQA 3F6HA 4GKKE 4LFBE 4HEIA 4O4KA 2EOOA 2DSYA 2J7JA 2EMYA 2EP3A 4DV0E 1QU6A 2NA2A 3EPLA 4JI1E 1N34E 4LF8E 3ADJA 5KL7A 1IBME 3J7AG 2EL4A 3OMLA 2MKNA 2B7VA 4WX9A 2UUCE 2EMCA 1YUIA 2EOQA 3DF6A 2EMXA 3M99B 1WJPA 1EKZA 2WBUA 2YRHA 2DLQA 1JK1A 4B3SE 1RMDA 2E72A 3JU0A 2UXCE 2ENAA 2EM5A 2KONA 1DGCA 1O0WA 4KZSA 1QNTA 3THOB 2EPRA 4X65E 2EOJA 3HTXA 1GZ6A 2M9AA 5AE1A 4WXCA 2EMKA 3BF2A 2EOXA 2EOHA 2EM8A 4BMJA 5A2QC 2K4VA 2VQFE 2YTGA 3OTOE 4NHRA 1LLMC 2JOXA 4DV1E 2HHHE 4X64E 2R76A 4DV7E 2R1FA 1YZ9A 3VK6A 4R8OA 3C4BA 1UILA 4BCAA 1TN9A 2LJHA 4WYQB 2WBSA 2EMGA 1YUJA 2V89A 2L2MA 2L3JA 4F2JC 1XMQE 4M9VC 5DNYA 2WBTA 3MSWA 4I8OA 4WSGA 2FTXB 2EOFA 3BIDA 5AC5A 2L92A 1HNZE 4IJDA 5IXMB 3TQMA 2DGCA 2CTDA 2ODRD 2YTOA 1MEYC 4LF4E 2LMZA 4MLQA 5A6AA 2ZM6E 4JV5E 2EN8A 1FJGE 2L8TA 4DV2E 2LRSA 3EPKA 3EPHA 3KZYA 2UUBE 2JWOA 2MDRA 4WPYA 4RH8A 4HTGA 2EN2A 4DR2E 2EN6A 4DR7E 1X49A 3VHTB 3HQ1A 4YY3E 4ZYGA 2N3GA 4F9CB 3C6KA 1XNRE 2UXDE 2VF1A 5A6KA 2WCC3 2V83A 2LTRA 3ADIA 4KWYA 2RSIA 1P47A 2UU9E 4R2DA 3BGHA 2PRTA 4DV3E 5A69A 1X6HA 4YHHE 1YYOA 3ECRA 4M0VA 2DLKA 1BBGA 2VRDA 2YTPA 1NEIA 1ZR9A 2YT4A 4O5GA 1SR9A 2LV2A 4JI7E 3AV0A 5KL2A 3T1HE 1ZAAC 2YTIA 3EQ1A 3BBGA 3KWRA 1STUA 2EJ4A 4P78A 4X8WA 2RPCA 2KOUA 2EN3A 5FLXC 2EL6A 1N3GA 5ADZA 5CFFE 4GZNC 1F2IG 2M7QA 4K0KE 4IS1C 2M1SA 1IBKE 1A1JA 4OX9E 2NUEA 2HJJA 2V8QB 3EPJA 4JI0E 1BB8A 2HC5A 1A1LA 2CPNA 2EQ3A 2MC5A 5AC4A 4DR3E 2D9HA 1YSAC 2ENCA 2EOYA 2EL5A 3C4TA 2JPAA 2EZ6A 1GQEA 4NZVA 1N33E 2EE8A 4N4RB 2FV4B 2RQLA 1GTKA 2F8BA 2LJUA 1B69A 1YYKA 2LUPB 4F6NA 2EPAA 2EM4A 5LLQA 2EM9A 4F6MA 1A1IA 1A1FA 2L3CA 2JYAA 2HGHA 2EPUA 2B9DA 3IWCA 2EN4A 3ADGA 2BB8A 2YSOA 4BS9A 4R2PA 1AAYA 4R2SA 5T6JA 4ZYDA 2EMBA 1G2FC 4KHPE 2L2NA 2EOIA 2LO3A 2EMLA 2FGGA 3H09A 4B3TE 3JTZA 2M4IA 2EPMX 2EPCA 1XMOE 5F3WA 4JI4E 1T4LB 4Q35B 1YFHA 4JI8E 4LF9E 2EM2A 2EPNA 1DQ3A 3LMLA 2LTSA 2ELZA 1RQ0A 1SFEA 2EOSA 1HR0E 5BR8E 2YTJA 1J5EE 1EH8A 3C6MA 5AASA 3HPZA 4FK5C 3MHHC 1L4SA 2YTDA 4GKJE 1X47A 4X62E 2MDGA 1WRJA 4OOGC 1KJKA 2ODRC 2E5LE 1T4NA 4BC7A 2LCEA 3HPSA 4TUGA 4DV4E 2YWQA 2EMAA 1Z1BA 1IMUA 2EWLA 4O43A 2B3TB 3MHSC 5KL5A 2EOZA 4BHCA 2EMFA 2E1MA 1MGTA 2GPIA 2G7HA 2V88A
chains in the Genus database with same CATH topology
5TSEA 4KWYA 2R76A 5IV8B 5IXMB 3BF2A 4NHRA 4RH8A 4Q35B 2N8XA 4N4RB 2JXPA 4RHBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TSE A;  4KWY A;  2R76 A;  5IV8 B;  5IXM B;  3BF2 A;  4NHR A;  4RH8 A;  4Q35 B;  2N8X A;  4N4R B;  2JXP A;  4RHB B; 
#chains in the Genus database with same CATH topology
 4DV6 E;  4R2E A;  2EPZ A;  5LMU E;  2CT1 A;  1WHN A;  2DIX A;  4F9B B;  4NXN E;  1WHQ A;  2DRP A;  2UUA E;  4ZYE A;  4RHB B;  4O24 A;  3K6Q A;  4BC9 A;  1IBL E;  4LFC E;  2JR1 A;  1PDA A;  1T38 A;  1A1K A;  1A1H A;  1HNW E;  1JK2 A;  2EPP A;  2LVH A;  4DUZ E;  1G2D C;  4M2Z A;  2JY9 A;  5LL6 R;  4L8N A;  1J26 A;  2VE7 C;  3J81 C;  3F6G A;  3IWB A;  3P1X A;  2V87 A;  2YZT A;  3IWD A;  1PKP A;  2V86 A;  1X6F A;  1TF3 A;  2YTQ A;  5LMN E;  1N36 E;  3FIG A;  4F9A B;  3L00 A;  1EH7 A;  3J7Y p;  1ZBT A;  4DKK A;  1NCS A;  2NAB A;  3THN A;  5AE2 A;  4JI3 E;  3T1Y E;  4L5N C;  1A1G A;  5A6J A;  2RS7 A;  2YTE A;  2RSM A;  1XNQ E;  5A6B D;  1N32 E;  2B7T A;  2MKD A;  1X48 A;  2DMI A;  1UHZ A;  3ZOQ B;  1IQO A;  2GLI A;  2JVA A;  1ZBQ A;  2EMH A;  4R2R A;  2GHF A;  2F4V E;  2L6M A;  5IWA E;  4DV5 E;  5IV8 B;  2DB2 A;  4LF5 E;  1UBD C;  4DUY E;  4LTY A;  1X6E A;  2YPN A;  4AQY E;  4B3M E;  4DR1 E;  2YTF A;  2YU5 A;  2L33 A;  1X5W A;  4LFA E;  2KHX A;  2MC6 A;  4WFT A;  1EH6 A;  2BBG A;  2H36 X;  4J8Z A;  4MLV A;  1X3C A;  2DMY A;  4DMI A;  2EMI A;  3JAM C;  4M30 A;  4WSP A;  1PJQ A;  2NUG A;  5IT9 C;  4BHB A;  2ADR A;  3VYY A;  3QG5 C;  2EOE A;  2YRM A;  1DI2 A;  2EM0 A;  1WXR A;  2JP9 A;  4LU9 A;  1ZU1 A;  4GEQ B;  4R2C A;  3DJW A;  4JI6 E;  1AH5 A;  2LBS B;  4Q28 A;  1T39 A;  5TSE A;  2JOB A;  4LF7 E;  1T4O A;  3KZZ A;  2A25 A;  1TF6 A;  2YRK A;  4DR5 E;  2I13 A;  4F54 A;  1FKA E;  2EPL X;  2ELY A;  2NUF A;  1UN6 B;  2JXP A;  4BBY A;  3J80 C;  2UXB E;  1PJT A;  2YTN A;  5A6B A;  2L2K B;  3RMP A;  2VQE E;  1I94 E;  1KYQ A;  2ENH A;  3AUZ A;  2EN1 A;  4B3R E;  2EPO A;  3HXL A;  5KL6 A;  2N3H A;  3UK3 C;  1HNX E;  2RTX A;  4WXD A;  3ADL A;  2IHR 1;  3LLH A;  2YSP A;  2EN7 A;  2RS6 A;  4DR6 E;  4JYA E;  4ZYH A;  2EM3 A;  2N8X A;  4P7D A;  5KL4 A;  4LF6 E;  4DR4 E;  2EQ1 A;  4JI2 E;  2LE2 A;  1IQS A;  4TUI A;  4X9J A;  2K7I A;  2EMZ A;  2V85 A;  1PJS A;  4NXM E;  1YYW A;  4X66 E;  2YU8 A;  2EM7 A;  2EOM A;  3VYX A;  2WZO A;  2EPK X;  5AE3 A;  1RC7 A;  2CSH A;  2EPX A;  4JI5 E;  1YPN A;  4R03 A;  4R2A A;  5KL3 A;  1BBO A;  2EM6 A;  4R2Q A;  2EQ0 A;  2I9I A;  2Q8U A;  2EOR A;  2LT7 A;  2EMW A;  2LUQ A;  3F6H A;  4GKK E;  4LFB E;  4HEI A;  4O4K A;  2EOO A;  2DSY A;  2J7J A;  2EMY A;  2EP3 A;  4DV0 E;  1QU6 A;  2NA2 A;  3EPL A;  4JI1 E;  1N34 E;  4LF8 E;  3ADJ A;  5KL7 A;  1IBM E;  3J7A G;  2EL4 A;  3OML A;  2MKN A;  2B7V A;  4WX9 A;  2UUC E;  2EMC A;  1YUI A;  2EOQ A;  3DF6 A;  2EMX A;  3M99 B;  1WJP A;  1EKZ A;  2WBU A;  2YRH A;  2DLQ A;  1JK1 A;  4B3S E;  1RMD A;  2E72 A;  3JU0 A;  2UXC E;  2ENA A;  2EM5 A;  2KON A;  1DGC A;  1O0W A;  4KZS A;  1QNT A;  3THO B;  2EPR A;  4X65 E;  2EOJ A;  3HTX A;  1GZ6 A;  2M9A A;  5AE1 A;  4WXC A;  2EMK A;  3BF2 A;  2EOX A;  2EOH A;  2EM8 A;  4BMJ A;  5A2Q C;  2K4V A;  2VQF E;  2YTG A;  3OTO E;  4NHR A;  1LLM C;  2JOX A;  4DV1 E;  2HHH E;  4X64 E;  2R76 A;  4DV7 E;  2R1F A;  1YZ9 A;  3VK6 A;  4R8O A;  3C4B A;  1UIL A;  4BCA A;  1TN9 A;  2LJH A;  4WYQ B;  2WBS A;  2EMG A;  1YUJ A;  2V89 A;  2L2M A;  2L3J A;  4F2J C;  1XMQ E;  4M9V C;  5DNY A;  2WBT A;  3MSW A;  4I8O A;  4WSG A;  2FTX B;  2EOF A;  3BID A;  5AC5 A;  2L92 A;  1HNZ E;  4IJD A;  5IXM B;  3TQM A;  2DGC A;  2CTD A;  2ODR D;  2YTO A;  1MEY C;  4LF4 E;  2LMZ A;  4MLQ A;  5A6A A;  2ZM6 E;  4JV5 E;  2EN8 A;  1FJG E;  2L8T A;  4DV2 E;  2LRS A;  3EPK A;  3EPH A;  3KZY A;  2UUB E;  2JWO A;  2MDR A;  4WPY A;  4RH8 A;  4HTG A;  2EN2 A;  4DR2 E;  2EN6 A;  4DR7 E;  1X49 A;  3VHT B;  3HQ1 A;  4YY3 E;  4ZYG A;  2N3G A;  4F9C B;  3C6K A;  1XNR E;  2UXD E;  2VF1 A;  5A6K A;  2WCC 3;  2V83 A;  2LTR A;  3ADI A;  4KWY A;  2RSI A;  1P47 A;  2UU9 E;  4R2D A;  3BGH A;  2PRT A;  4DV3 E;  5A69 A;  1X6H A;  4YHH E;  1YYO A;  3ECR A;  4M0V A;  2DLK A;  1BBG A;  2VRD A;  2YTP A;  1NEI A;  1ZR9 A;  2YT4 A;  4O5G A;  1SR9 A;  2LV2 A;  4JI7 E;  3AV0 A;  5KL2 A;  3T1H E;  1ZAA C;  2YTI A;  3EQ1 A;  3BBG A;  3KWR A;  1STU A;  2EJ4 A;  4P78 A;  4X8W A;  2RPC A;  2KOU A;  2EN3 A;  5FLX C;  2EL6 A;  1N3G A;  5ADZ A;  5CFF E;  4GZN C;  1F2I G;  2M7Q A;  4K0K E;  4IS1 C;  2M1S A;  1IBK E;  1A1J A;  4OX9 E;  2NUE A;  2HJJ A;  2V8Q B;  3EPJ A;  4JI0 E;  1BB8 A;  2HC5 A;  1A1L A;  2CPN A;  2EQ3 A;  2MC5 A;  5AC4 A;  4DR3 E;  2D9H A;  1YSA C;  2ENC A;  2EOY A;  2EL5 A;  3C4T A;  2JPA A;  2EZ6 A;  1GQE A;  4NZV A;  1N33 E;  2EE8 A;  4N4R B;  2FV4 B;  2RQL A;  1GTK A;  2F8B A;  2LJU A;  1B69 A;  1YYK A;  2LUP B;  4F6N A;  2EPA A;  2EM4 A;  5LLQ A;  2EM9 A;  4F6M A;  1A1I A;  1A1F A;  2L3C A;  2JYA A;  2HGH A;  2EPU A;  2B9D A;  3IWC A;  2EN4 A;  3ADG A;  2BB8 A;  2YSO A;  4BS9 A;  4R2P A;  1AAY A;  4R2S A;  5T6J A;  4ZYD A;  2EMB A;  1G2F C;  4KHP E;  2L2N A;  2EOI A;  2LO3 A;  2EML A;  2FGG A;  3H09 A;  4B3T E;  3JTZ A;  2M4I A;  2EPM X;  2EPC A;  1XMO E;  5F3W A;  4JI4 E;  1T4L B;  4Q35 B;  1YFH A;  4JI8 E;  4LF9 E;  2EM2 A;  2EPN A;  1DQ3 A;  3LML A;  2LTS A;  2ELZ A;  1RQ0 A;  1SFE A;  2EOS A;  1HR0 E;  5BR8 E;  2YTJ A;  1J5E E;  1EH8 A;  3C6M A;  5AAS A;  3HPZ A;  4FK5 C;  3MHH C;  1L4S A;  2YTD A;  4GKJ E;  1X47 A;  4X62 E;  2MDG A;  1WRJ A;  4OOG C;  1KJK A;  2ODR C;  2E5L E;  1T4N A;  4BC7 A;  2LCE A;  3HPS A;  4TUG A;  4DV4 E;  2YWQ A;  2EMA A;  1Z1B A;  1IMU A;  2EWL A;  4O43 A;  2B3T B;  3MHS C;  5KL5 A;  2EOZ A;  4BHC A;  2EMF A;  2E1M A;  1MGT A;  2GPI A;  2G7H A;  2V88 A; 
#chains in the Genus database with same CATH homology
 5TSE A;  4KWY A;  2R76 A;  5IV8 B;  5IXM B;  3BF2 A;  4NHR A;  4RH8 A;  4Q35 B;  2N8X A;  4N4R B;  2JXP A;  4RHB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...