2JXPA

Solution nmr structure of uncharacterized lipoprotein b from nitrosomonas europaea. northeast structural genomics target ner45a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
155
structure length
155
Chain Sequence
MGFKLRGQVSELPFERVYITAPAGLTIGSDLERVISTHTRAKVVNKAEKSEAIIQIVHAIREKRILSLSESGRVREFELVYRVAARLLDAHNAELASLQEIRLTRILPFLDAQELAKAAEEEMLYKDMQKDAVQQILRQVSAFTSAGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lipoprotein B
publication title Solution NMR structure of uncharacterized lipoprotein B from Nitrosomonas europaea.
rcsb
source organism Nitrosomonas europaea atcc 19718
molecule tags Lipoprotein
total genus 36
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2007-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 2jxpA01
4KWYA 2JXPA 2R76A 4NHRA 5IV8B 3BF2A 5TSEA 4N4RB 4RH8A 5IXMB 4Q35B 4RHBB 2N8XA
chains in the Genus database with same CATH superfamily
2EMBA 4JV5E 1SR9A 1XMOE 4DR3E 4X66E 3IWBA 1GTKA 3VYYA 1ZBQA 5AC5A 2DMIA 1EH6A 2L3JA 2DB2A 1PKPA 1J26A 3C4TA 1HNXE 4DR6E 2EPZA 3DJWA 4L5NC 2EM4A 2CSHA 1IQSA 1N34E 4JI7E 1GQEA 2VRDA 1T39A 3FIGA 1DI2A 2YTFA 4R2EA 4WXDA 2YU5A 1A1IA 2E5LE 2G7HA 2YSPA 4JYAE 2GHFA 5ADZA 4LF7E 1NCSA 4X65E 1X47A 3F6GA 4BMJA 1X6HA 2EOMA 2EWLA 2YTOA 4NXME 2V86A 4DR1E 2LRSA 4F9AB 1TF6A 4NHRA 5IWAE 1F2IG 2WZOA 3EPKA 5IXMB 4DV6E 1YUIA 3ADLA 4M9VC 3EPHA 1A1JA 2EL5A 4KHPE 4LFBE 2R1FA 1ZBTA 4BCAA 2ENAA 5KL7A 4R2RA 4ZYHA 2F8BA 2EM0A 1X48A 2WBUA 2DLKA 1IMUA 2LTSA 3ADGA 5A6JA 2YSOA 2EPLX 2ODRD 1N3GA 4DV0E 1BB8A 4BHBA 2YT4A 4JI5E 4DUZE 4DV3E 1P47A 1BBOA 2YTDA 4LTYA 4BC9A 2LVHA 4JI2E 2GLIA 2CT1A 1QNTA 2EMXA 2EPMX 3C6MA 2JPAA 4R2DA 2EMYA 2CTDA 3VHTB 4O4KA 2EOOA 2WCC3 2EMAA 1WXRA 3T1HE 1RMDA 2EMHA 2EN4A 2DLQA 2UUAE 2EN3A 2EMKA 2EMGA 4K0KE 2V89A 4X9JA 1X6EA 1MEYC 4JI1E 2LCEA 4B3ME 2UU9E 1X6FA 2KHXA 4LF4E 1A1KA 2KOUA 2MC5A 1GZ6A 5AE2A 1UBDC 2EOHA 2ENHA 4F6MA 2V88A 2EPRA 4BHCA 2YTIA 2EPOA 4DV1E 1B69A 2EN7A 4GEQB 5A6KA 2DMYA 2JOBA 2JY9A 5IT9C 1DQ3A 4MLQA 2B3TB 4X64E 2L92A 4J8ZA 5KL2A 2UXCE 5LLQA 4YHHE 2VQFE 2LJHA 1TN9A 2EM6A 2EPXA 5AE3A 3BF2A 5BR8E 2EM9A 1YYWA 2EPUA 1PDAA 2EOSA 4HEIA 3RMPA 4JI3E 2FTXB 2RQLA 4R2PA 2EM7A 2L6MA 4DR5E 3ECRA 2RSMA 2YU8A 2JXPA 2R76A 4LU9A 1WJPA 2L2MA 4DV5E 4LFAE 1ZU1A 2NUEA 1RC7A 4AQYE 2EMFA 2YRHA 4JI4E 1YSAC 1HNZE 4FK5C 1YZ9A 4BC7A 1AAYA 2EE8A 2EN2A 1IBME 1YYKA 2L2KB 2ZM6E 4WSPA 2EN1A 4M2ZA 2JOXA 2EL4A 3IWDA 4I8OA 3HTXA 5AASA 2EMIA 4R2CA 2EM2A 4Q35B 4DR7E 2ODRC 2J7JA 2VF1A 2FGGA 1NEIA 1JK2A 1AH5A 4B3RE 2RS7A 4ZYDA 2D9HA 2YPNA 2B9DA 2L8TA 4X62E 1X49A 1SFEA 1N32E 1FJGE 3AUZA 2PRTA 2V8QB 1PJQA 1EKZA 2LT7A 4GKJE 1A1HA 5A6AA 2JP9A 2H36X 4WSGA 3KWRA 4L8NA 3KZYA 1IQOA 1EH7A 4DV7E 4WX9A 2ELZA 4RH8A 1XMQE 5KL3A 3C4BA 2EMZA 4F2JC 1WHNA 1HR0E 2YWQA 4IS1C 1UN6B 4YY3E 2LMZA 4NZVA 2A25A 2RS6A 3C6KA 1KYQA 3OTOE 3LMLA 2EN6A 5DNYA 1I94E 2HHHE 2BB8A 2EP3A 3QG5C 2F4VE 2EN8A 1UHZA 1JK1A 2K7IA 1L4SA 2LV2A 2RTXA 3EQ1A 4TUGA 5LMNE 2B7VA 2NABA 4ZYGA 2GPIA 4P78A 1LLMC 2EMWA 4WPYA 3HXLA 2VE7C 2NUGA 4LF6E 2LE2A 4GKKE 4WXCA 2MC6A 4OOGC 3ADJA 3HPZA 2UXBE 2EPNA 1ZR9A 2FV4B 3THNA 4R2AA 3VYXA 2LJUA 3TQMA 2EOQA 1X5WA 1WHQA 5A6BD 3KZZA 3EPJA 2L2NA 2Q8UA 2I13A 2M1SA 2EPCA 3M99B 4R2QA 2N8XA 1STUA 2EM8A 4OX9E 3UK3C 2JR1A 1PJTA 2EJ4A 4BS9A 1YPNA 2NUFA 4O5GA 2EOYA 4X8WA 4IJDA 2EORA 4GZNC 1X3CA 4ZYEA 2EPAA 4HTGA 4RHBB 4DKKA 1T4LB 2WBTA 2JVAA 3J7AG 2WBSA 2MKDA 4TUIA 1T38A 2MDGA 4B3TE 5A2QC 2DIXA 4F6NA 2DSYA 2ENCA 1IBLE 3THOB 5KL4A 4DV4E 2HGHA 5TSEA 2B7TA 4N4RB 2KONA 2L33A 4KZSA 2LO3A 2MDRA 4M0VA 2ADRA 3OMLA 2V83A 4MLVA 2M4IA 2YRKA 3MHSC 4R03A 2UUBE 1RQ0A 1G2DC 2VQEE 2E1MA 4O24A 1YUJA 2EOIA 4Q28A 2ELYA 1WRJA 4DUYE 1ZAAC 4WFTA 1A1FA 2UXDE 2UUCE 4R2SA 4O43A 2DRPA 2YTEA 2L3CA 2EOXA 2E72A 1XNQE 2EQ0A 1A1LA 5AE1A 5FLXC 2N3HA 2N3GA 2EOJA 4LF5E 3MSWA 3ADIA 2EZ6A 2EPPA 2LBSB 3MHHC 2V85A 3DF6A 4P7DA 2HC5A 4F9BB 1XNRE 1TF3A 3JU0A 2YTNA 1MGTA 2EPKX 4LF8E 5LL6R 3LLHA 3VK6A 2YTPA 3F6HA 4F54A 2JWOA 3HPSA 2EOZA 3J80C 1T4NA 1YYOA 3P1XA 3ZOQB 5A69A 4DV2E 2DGCA 1O0WA 1N33E 3J81C 2LUPB 2IHR1 2EOEA 2CPNA 3IWCA 2MKNA 1G2FC 3AV0A 2RPCA 1UILA 2YZTA 2BBGA 4LFCE 1YFHA 4M30A 2EM5A 5LMUE 4DMIA 2EOFA 1A1GA 4KWYA 3BIDA 2EQ3A 4DR4E 3J7Yp 2LUQA 2NA2A 4JI8E 4B3SE 5AC4A 2HJJA 4DR2E 1J5EE 1BBGA 1PJSA 5CFFE 4NXNE 5IV8B 1HNWE 2M7QA 5KL6A 3BBGA 2EMCA 2K4VA 2EM3A 3JTZA 2EQ1A 2LTRA 1N36E 4JI0E 4LF9E 4BBYA 4R8OA 5KL5A 2V87A 2YTQA 2EL6A 3K6QA 3BGHA 2JYAA 4F9CB 1Z1BA 2RSIA 2I9IA 1KJKA 4JI6E 1EH8A 3T1YE 1FKAE 5F3WA 2YTGA 1T4OA 2YTJA 2YRMA 5A6BA 2EMLA 4WYQB 3HQ1A 3EPLA 1IBKE 5T6JA 3L00A 2M9AA 3H09A 1DGCA 1QU6A 3JAMC
chains in the Genus database with same CATH topology
4KWYA 2JXPA 2R76A 4NHRA 5IV8B 3BF2A 5TSEA 4N4RB 4RH8A 5IXMB 4Q35B 4RHBB 2N8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KWY A;  2JXP A;  2R76 A;  4NHR A;  5IV8 B;  3BF2 A;  5TSE A;  4N4R B;  4RH8 A;  5IXM B;  4Q35 B;  4RHB B;  2N8X A; 
#chains in the Genus database with same CATH topology
 2EMB A;  4JV5 E;  1SR9 A;  1XMO E;  4DR3 E;  4X66 E;  3IWB A;  1GTK A;  3VYY A;  1ZBQ A;  5AC5 A;  2DMI A;  1EH6 A;  2L3J A;  2DB2 A;  1PKP A;  1J26 A;  3C4T A;  1HNX E;  4DR6 E;  2EPZ A;  3DJW A;  4L5N C;  2EM4 A;  2CSH A;  1IQS A;  1N34 E;  4JI7 E;  1GQE A;  2VRD A;  1T39 A;  3FIG A;  1DI2 A;  2YTF A;  4R2E A;  4WXD A;  2YU5 A;  1A1I A;  2E5L E;  2G7H A;  2YSP A;  4JYA E;  2GHF A;  5ADZ A;  4LF7 E;  1NCS A;  4X65 E;  1X47 A;  3F6G A;  4BMJ A;  1X6H A;  2EOM A;  2EWL A;  2YTO A;  4NXM E;  2V86 A;  4DR1 E;  2LRS A;  4F9A B;  1TF6 A;  4NHR A;  5IWA E;  1F2I G;  2WZO A;  3EPK A;  5IXM B;  4DV6 E;  1YUI A;  3ADL A;  4M9V C;  3EPH A;  1A1J A;  2EL5 A;  4KHP E;  4LFB E;  2R1F A;  1ZBT A;  4BCA A;  2ENA A;  5KL7 A;  4R2R A;  4ZYH A;  2F8B A;  2EM0 A;  1X48 A;  2WBU A;  2DLK A;  1IMU A;  2LTS A;  3ADG A;  5A6J A;  2YSO A;  2EPL X;  2ODR D;  1N3G A;  4DV0 E;  1BB8 A;  4BHB A;  2YT4 A;  4JI5 E;  4DUZ E;  4DV3 E;  1P47 A;  1BBO A;  2YTD A;  4LTY A;  4BC9 A;  2LVH A;  4JI2 E;  2GLI A;  2CT1 A;  1QNT A;  2EMX A;  2EPM X;  3C6M A;  2JPA A;  4R2D A;  2EMY A;  2CTD A;  3VHT B;  4O4K A;  2EOO A;  2WCC 3;  2EMA A;  1WXR A;  3T1H E;  1RMD A;  2EMH A;  2EN4 A;  2DLQ A;  2UUA E;  2EN3 A;  2EMK A;  2EMG A;  4K0K E;  2V89 A;  4X9J A;  1X6E A;  1MEY C;  4JI1 E;  2LCE A;  4B3M E;  2UU9 E;  1X6F A;  2KHX A;  4LF4 E;  1A1K A;  2KOU A;  2MC5 A;  1GZ6 A;  5AE2 A;  1UBD C;  2EOH A;  2ENH A;  4F6M A;  2V88 A;  2EPR A;  4BHC A;  2YTI A;  2EPO A;  4DV1 E;  1B69 A;  2EN7 A;  4GEQ B;  5A6K A;  2DMY A;  2JOB A;  2JY9 A;  5IT9 C;  1DQ3 A;  4MLQ A;  2B3T B;  4X64 E;  2L92 A;  4J8Z A;  5KL2 A;  2UXC E;  5LLQ A;  4YHH E;  2VQF E;  2LJH A;  1TN9 A;  2EM6 A;  2EPX A;  5AE3 A;  3BF2 A;  5BR8 E;  2EM9 A;  1YYW A;  2EPU A;  1PDA A;  2EOS A;  4HEI A;  3RMP A;  4JI3 E;  2FTX B;  2RQL A;  4R2P A;  2EM7 A;  2L6M A;  4DR5 E;  3ECR A;  2RSM A;  2YU8 A;  2JXP A;  2R76 A;  4LU9 A;  1WJP A;  2L2M A;  4DV5 E;  4LFA E;  1ZU1 A;  2NUE A;  1RC7 A;  4AQY E;  2EMF A;  2YRH A;  4JI4 E;  1YSA C;  1HNZ E;  4FK5 C;  1YZ9 A;  4BC7 A;  1AAY A;  2EE8 A;  2EN2 A;  1IBM E;  1YYK A;  2L2K B;  2ZM6 E;  4WSP A;  2EN1 A;  4M2Z A;  2JOX A;  2EL4 A;  3IWD A;  4I8O A;  3HTX A;  5AAS A;  2EMI A;  4R2C A;  2EM2 A;  4Q35 B;  4DR7 E;  2ODR C;  2J7J A;  2VF1 A;  2FGG A;  1NEI A;  1JK2 A;  1AH5 A;  4B3R E;  2RS7 A;  4ZYD A;  2D9H A;  2YPN A;  2B9D A;  2L8T A;  4X62 E;  1X49 A;  1SFE A;  1N32 E;  1FJG E;  3AUZ A;  2PRT A;  2V8Q B;  1PJQ A;  1EKZ A;  2LT7 A;  4GKJ E;  1A1H A;  5A6A A;  2JP9 A;  2H36 X;  4WSG A;  3KWR A;  4L8N A;  3KZY A;  1IQO A;  1EH7 A;  4DV7 E;  4WX9 A;  2ELZ A;  4RH8 A;  1XMQ E;  5KL3 A;  3C4B A;  2EMZ A;  4F2J C;  1WHN A;  1HR0 E;  2YWQ A;  4IS1 C;  1UN6 B;  4YY3 E;  2LMZ A;  4NZV A;  2A25 A;  2RS6 A;  3C6K A;  1KYQ A;  3OTO E;  3LML A;  2EN6 A;  5DNY A;  1I94 E;  2HHH E;  2BB8 A;  2EP3 A;  3QG5 C;  2F4V E;  2EN8 A;  1UHZ A;  1JK1 A;  2K7I A;  1L4S A;  2LV2 A;  2RTX A;  3EQ1 A;  4TUG A;  5LMN E;  2B7V A;  2NAB A;  4ZYG A;  2GPI A;  4P78 A;  1LLM C;  2EMW A;  4WPY A;  3HXL A;  2VE7 C;  2NUG A;  4LF6 E;  2LE2 A;  4GKK E;  4WXC A;  2MC6 A;  4OOG C;  3ADJ A;  3HPZ A;  2UXB E;  2EPN A;  1ZR9 A;  2FV4 B;  3THN A;  4R2A A;  3VYX A;  2LJU A;  3TQM A;  2EOQ A;  1X5W A;  1WHQ A;  5A6B D;  3KZZ A;  3EPJ A;  2L2N A;  2Q8U A;  2I13 A;  2M1S A;  2EPC A;  3M99 B;  4R2Q A;  2N8X A;  1STU A;  2EM8 A;  4OX9 E;  3UK3 C;  2JR1 A;  1PJT A;  2EJ4 A;  4BS9 A;  1YPN A;  2NUF A;  4O5G A;  2EOY A;  4X8W A;  4IJD A;  2EOR A;  4GZN C;  1X3C A;  4ZYE A;  2EPA A;  4HTG A;  4RHB B;  4DKK A;  1T4L B;  2WBT A;  2JVA A;  3J7A G;  2WBS A;  2MKD A;  4TUI A;  1T38 A;  2MDG A;  4B3T E;  5A2Q C;  2DIX A;  4F6N A;  2DSY A;  2ENC A;  1IBL E;  3THO B;  5KL4 A;  4DV4 E;  2HGH A;  5TSE A;  2B7T A;  4N4R B;  2KON A;  2L33 A;  4KZS A;  2LO3 A;  2MDR A;  4M0V A;  2ADR A;  3OML A;  2V83 A;  4MLV A;  2M4I A;  2YRK A;  3MHS C;  4R03 A;  2UUB E;  1RQ0 A;  1G2D C;  2VQE E;  2E1M A;  4O24 A;  1YUJ A;  2EOI A;  4Q28 A;  2ELY A;  1WRJ A;  4DUY E;  1ZAA C;  4WFT A;  1A1F A;  2UXD E;  2UUC E;  4R2S A;  4O43 A;  2DRP A;  2YTE A;  2L3C A;  2EOX A;  2E72 A;  1XNQ E;  2EQ0 A;  1A1L A;  5AE1 A;  5FLX C;  2N3H A;  2N3G A;  2EOJ A;  4LF5 E;  3MSW A;  3ADI A;  2EZ6 A;  2EPP A;  2LBS B;  3MHH C;  2V85 A;  3DF6 A;  4P7D A;  2HC5 A;  4F9B B;  1XNR E;  1TF3 A;  3JU0 A;  2YTN A;  1MGT A;  2EPK X;  4LF8 E;  5LL6 R;  3LLH A;  3VK6 A;  2YTP A;  3F6H A;  4F54 A;  2JWO A;  3HPS A;  2EOZ A;  3J80 C;  1T4N A;  1YYO A;  3P1X A;  3ZOQ B;  5A69 A;  4DV2 E;  2DGC A;  1O0W A;  1N33 E;  3J81 C;  2LUP B;  2IHR 1;  2EOE A;  2CPN A;  3IWC A;  2MKN A;  1G2F C;  3AV0 A;  2RPC A;  1UIL A;  2YZT A;  2BBG A;  4LFC E;  1YFH A;  4M30 A;  2EM5 A;  5LMU E;  4DMI A;  2EOF A;  1A1G A;  4KWY A;  3BID A;  2EQ3 A;  4DR4 E;  3J7Y p;  2LUQ A;  2NA2 A;  4JI8 E;  4B3S E;  5AC4 A;  2HJJ A;  4DR2 E;  1J5E E;  1BBG A;  1PJS A;  5CFF E;  4NXN E;  5IV8 B;  1HNW E;  2M7Q A;  5KL6 A;  3BBG A;  2EMC A;  2K4V A;  2EM3 A;  3JTZ A;  2EQ1 A;  2LTR A;  1N36 E;  4JI0 E;  4LF9 E;  4BBY A;  4R8O A;  5KL5 A;  2V87 A;  2YTQ A;  2EL6 A;  3K6Q A;  3BGH A;  2JYA A;  4F9C B;  1Z1B A;  2RSI A;  2I9I A;  1KJK A;  4JI6 E;  1EH8 A;  3T1Y E;  1FKA E;  5F3W A;  2YTG A;  1T4O A;  2YTJ A;  2YRM A;  5A6B A;  2EML A;  4WYQ B;  3HQ1 A;  3EPL A;  1IBK E;  5T6J A;  3L00 A;  2M9A A;  3H09 A;  1DGC A;  1QU6 A;  3JAM C; 
#chains in the Genus database with same CATH homology
 4KWY A;  2JXP A;  2R76 A;  4NHR A;  5IV8 B;  3BF2 A;  5TSE A;  4N4R B;  4RH8 A;  5IXM B;  4Q35 B;  4RHB B;  2N8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...