2JXPA

Solution nmr structure of uncharacterized lipoprotein b from nitrosomonas europaea. northeast structural genomics target ner45a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
155
structure length
155
Chain Sequence
MGFKLRGQVSELPFERVYITAPAGLTIGSDLERVISTHTRAKVVNKAEKSEAIIQIVHAIREKRILSLSESGRVREFELVYRVAARLLDAHNAELASLQEIRLTRILPFLDAQELAKAAEEEMLYKDMQKDAVQQILRQVSAFTSAGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipoprotein
molecule keywords Putative lipoprotein B
publication title Solution NMR structure of uncharacterized lipoprotein B from Nitrosomonas europaea.
rcsb
source organism Nitrosomonas europaea atcc 19718
total genus 36
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2007-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 2jxpA01
4NHRA 4N4RB 2R76A 3BF2A 5IV8B 4RHBB 5TSEA 2N8XA 4Q35B 5IXMB 4RH8A 4KWYA 2JXPA
chains in the Genus database with same CATH superfamily
5LL6R 1QU6A 5A2QC 1AAYA 2DSYA 4F6NA 2DLQA 1A1HA 1IBME 4F2JC 1X6HA 4RHBB 4DUYE 4B3RE 4DR7E 3VHTB 2GLIA 1IQOA 4LFAE 4M9VC 1HR0E 2N3HA 2LJHA 3T1YE 4LF7E 2N3GA 2YRHA 5AASA 2EN6A 1B69A 3AUZA 4OX9E 4F9BB 2Q8UA 2BB8A 1EH7A 3LLHA 2EN7A 4Q28A 4JI3E 2ENCA 4R8OA 2FTXB 4F6MA 2HJJA 4NZVA 5AC4A 3KZZA 2F4VE 1KJKA 2DIXA 5IT9C 2E72A 4DUZE 3VYXA 4L5NC 2V89A 5DNYA 2CTDA 4WSPA 4BCAA 1X3CA 4JI8E 1A1GA 3FIGA 2GHFA 2EPCA 2EPAA 2EOOA 2ELYA 2JY9A 1I94E 1NCSA 2BBGA 3M99B 2YSOA 3IWDA 3BIDA 2EOFA 2CSHA 2JOXA 4JV5E 1A1FA 3JU0A 3UK3C 4YHHE 4X64E 4P78A 2DMIA 1YYKA 2EOQA 2LCEA 4DV1E 4R2CA 1GZ6A 2N8XA 4ZYEA 1UBDC 4LF6E 2UU9E 2V85A 2EN1A 2EMCA 5A6JA 1ZU1A 4DV3E 3ECRA 1BBGA 3THNA 1YFHA 3JTZA 5AE1A 3HQ1A 4O4KA 1ZBTA 2EM0A 4MLVA 2VQFE 2RTXA 1X5WA 4R2EA 2EMAA 2YU8A 2VE7C 4JI7E 2WZOA 1YYOA 4NXME 4DR6E 2EL5A 2LUQA 4I8OA 2RQLA 4BS9A 2E1MA 3MHHC 2EQ0A 2EPPA 2LTRA 2NUEA 2ENAA 2RS6A 2EM9A 4N4RB 4WXCA 2YZTA 3ADGA 2V83A 2EPNA 4BMJA 4P7DA 1QNTA 5KL7A 2EOHA 2YT4A 1YUIA 3ADIA 2EQ1A 4LFBE 1A1LA 4DMIA 3HTXA 1MEYC 3F6GA 2EORA 1RQ0A 2I13A 4DR5E 3C6KA 1L4SA 4DV4E 1X6EA 2F8BA 2YU5A 2EE8A 2HC5A 2V88A 1UHZA 4X8WA 3TQMA 2R76A 3HPZA 4DV6E 1DGCA 1J26A 2EMFA 2JVAA 2EMWA 3MHSC 2KHXA 2L3JA 2M4IA 2EPOA 1WHQA 2EQ3A 2EMZA 5KL5A 2EOSA 4BHCA 4DR4E 2FGGA 2UUCE 5LLQA 3QG5C 1WJPA 1X48A 4F54A 4LFCE 2YPNA 2EMKA 3J7Yp 2JYAA 2KONA 3K6QA 3L00A 4LF9E 2L3CA 4JI1E 1N32E 2EZ6A 1BB8A 2YTPA 1FKAE 4L8NA 1T39A 2LJUA 4FK5C 4HTGA 2ZM6E 4DV2E 2EN4A 1IMUA 3IWCA 2V8QB 2RSIA 3HXLA 1ZAAC 2EN8A 3ADJA 4DV7E 2EM6A 2J7JA 1KYQA 4JI2E 2G7HA 4B3SE 2L33A 2V86A 4JYAE 2EM8A 2MC5A 1UN6B 1UILA 4IS1C 4KWYA 4GKJE 1STUA 5A6AA 2EL4A 2YWQA 5IV8B 2UXCE 4DKKA 2LT7A 1A1KA 2EPUA 2B9DA 1WHNA 2EPLX 2VRDA 2EMYA 4R2SA 1YZ9A 4WXDA 1XNRE 2DMYA 2EN3A 1G2DC 2MC6A 1N3GA 3DF6A 4LF5E 4ZYDA 2EM5A 2K4VA 2HHHE 4GEQB 2NABA 2DRPA 1T4NA 2JWOA 2JXPA 4LU9A 4M2ZA 2L8TA 1YYWA 3J7AG 1GTKA 1FJGE 1BBOA 2K7IA 2YTEA 2EM4A 5KL3A 2EJ4A 4HEIA 1PDAA 4R03A 4R2RA 4KHPE 3EPHA 2YTFA 4TUGA 2M9AA 2EM2A 5KL2A 4B3TE 2YTIA 3KZYA 3OTOE 1N33E 2ODRC 1YUJA 5ADZA 2L2NA 2EN2A 3THOB 4DR2E 2JR1A 1F2IG 4AQYE 4JI4E 2FV4B 4R2AA 2LBSB 3ZOQB 2JP9A 4GKKE 2LRSA 5A6BA 1TF3A 5A69A 1PJSA 1HNWE 2WCC3 1X49A 3P1XA 4DV5E 3RMPA 5FLXC 3MSWA 1PKPA 1P47A 4F9CB 2MKDA 1IBLE 2YTGA 2L2KB 4BHBA 2DLKA 1YSAC 2GPIA 2YTQA 2EPKX 2RSMA 2HGHA 3F6HA 1WXRA 4BBYA 2PRTA 2A25A 1T4OA 4M30A 3HPSA 4JI5E 1RMDA 2LTSA 3J81C 1XNQE 1SR9A 2L2MA 2EMIA 4WFTA 2EOYA 5LMNE 2WBUA 4DR3E 1TN9A 4DR1E 2ODRD 4R2DA 2EOZA 2MDRA 4KZSA 2LUPB 2EL6A 1IQSA 2MDGA 4LF4E 1PJQA 1X6FA 1XMOE 1HNXE 5KL6A 1PJTA 2CT1A 2NUGA 1HNZE 1X47A 2NUFA 1MGTA 2YTOA 2NA2A 3BBGA 3OMLA 1DQ3A 5KL4A 2WBTA 4TUIA 5F3WA 2UXBE 1RC7A 2EM7A 2ENHA 2RPCA 4O43A 2MKNA 3EPKA 2YTDA 1ZBQA 3VK6A 2JPAA 3KWRA 2YRMA 4X9JA 2EPRA 4WX9A 1TF6A 4X65E 3JAMC 2M7QA 4K0KE 3T1HE 3BF2A 2KOUA 2DB2A 4MLQA 4X66E 1A1IA 5CFFE 2LMZA 3EPLA 4M0VA 1Z1BA 2M1SA 4OOGC 4IJDA 3BGHA 5LMUE 4WSGA 2E5LE 3C4BA 1SFEA 1AH5A 4JI0E 2B7VA 1J5EE 2IHR1 2R1FA 5A6KA 3J80C 2UUBE 2WBSA 1O0WA 4F9AB 5AC5A 4BC9A 2B3TB 2YSPA 2EMXA 5AE2A 2LVHA 2EOMA 4O24A 2EPXA 2L6MA 2CPNA 2EOJA 5T6JA 1EH6A 1IBKE 4LF8E 5IWAE 1N36E 4Q35B 1A1JA 1JK2A 1GQEA 3LMLA 3AV0A 5TSEA 2L92A 4ZYGA 4B3ME 2EMBA 4BC7A 2RS7A 2B7TA 3EPJA 2I9IA 4ZYHA 2UXDE 3VYYA 5BR8E 1G2FC 2ADRA 2YRKA 4YY3E 2ELZA 4WYQB 4R2PA 3ADLA 1T38A 2V87A 2EPZA 1NEIA 4NXNE 1EKZA 1YPNA 4RH8A 4X62E 1DI2A 4J8ZA 4DV0E 5IXMB 4WPYA 1ZR9A 2DGCA 1N34E 3EQ1A 2YTJA 1EH8A 5AE3A 2VQEE 4GZNC 2YTNA 1JK1A 2LE2A 4R2QA 5A6BD 4O5GA 3IWBA 2H36X 2EOIA 2VF1A 3C6MA 2EPMX 2EMHA 1WRJA 2LV2A 2D9HA 1T4LB 4NHRA 2EMLA 1LLMC 3H09A 3DJWA 2EP3A 2EM3A 3C4TA 2EMGA 1XMQE 2LO3A 2UUAE 2EOEA 2JOBA 4LTYA 2EWLA 2EOXA 4JI6E
chains in the Genus database with same CATH topology
4NHRA 4N4RB 2R76A 3BF2A 5IV8B 4RHBB 5TSEA 2N8XA 4Q35B 5IXMB 4RH8A 4KWYA 2JXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NHR A;  4N4R B;  2R76 A;  3BF2 A;  5IV8 B;  4RHB B;  5TSE A;  2N8X A;  4Q35 B;  5IXM B;  4RH8 A;  4KWY A;  2JXP A; 
#chains in the Genus database with same CATH topology
 5LL6 R;  1QU6 A;  5A2Q C;  1AAY A;  2DSY A;  4F6N A;  2DLQ A;  1A1H A;  1IBM E;  4F2J C;  1X6H A;  4RHB B;  4DUY E;  4B3R E;  4DR7 E;  3VHT B;  2GLI A;  1IQO A;  4LFA E;  4M9V C;  1HR0 E;  2N3H A;  2LJH A;  3T1Y E;  4LF7 E;  2N3G A;  2YRH A;  5AAS A;  2EN6 A;  1B69 A;  3AUZ A;  4OX9 E;  4F9B B;  2Q8U A;  2BB8 A;  1EH7 A;  3LLH A;  2EN7 A;  4Q28 A;  4JI3 E;  2ENC A;  4R8O A;  2FTX B;  4F6M A;  2HJJ A;  4NZV A;  5AC4 A;  3KZZ A;  2F4V E;  1KJK A;  2DIX A;  5IT9 C;  2E72 A;  4DUZ E;  3VYX A;  4L5N C;  2V89 A;  5DNY A;  2CTD A;  4WSP A;  4BCA A;  1X3C A;  4JI8 E;  1A1G A;  3FIG A;  2GHF A;  2EPC A;  2EPA A;  2EOO A;  2ELY A;  2JY9 A;  1I94 E;  1NCS A;  2BBG A;  3M99 B;  2YSO A;  3IWD A;  3BID A;  2EOF A;  2CSH A;  2JOX A;  4JV5 E;  1A1F A;  3JU0 A;  3UK3 C;  4YHH E;  4X64 E;  4P78 A;  2DMI A;  1YYK A;  2EOQ A;  2LCE A;  4DV1 E;  4R2C A;  1GZ6 A;  2N8X A;  4ZYE A;  1UBD C;  4LF6 E;  2UU9 E;  2V85 A;  2EN1 A;  2EMC A;  5A6J A;  1ZU1 A;  4DV3 E;  3ECR A;  1BBG A;  3THN A;  1YFH A;  3JTZ A;  5AE1 A;  3HQ1 A;  4O4K A;  1ZBT A;  2EM0 A;  4MLV A;  2VQF E;  2RTX A;  1X5W A;  4R2E A;  2EMA A;  2YU8 A;  2VE7 C;  4JI7 E;  2WZO A;  1YYO A;  4NXM E;  4DR6 E;  2EL5 A;  2LUQ A;  4I8O A;  2RQL A;  4BS9 A;  2E1M A;  3MHH C;  2EQ0 A;  2EPP A;  2LTR A;  2NUE A;  2ENA A;  2RS6 A;  2EM9 A;  4N4R B;  4WXC A;  2YZT A;  3ADG A;  2V83 A;  2EPN A;  4BMJ A;  4P7D A;  1QNT A;  5KL7 A;  2EOH A;  2YT4 A;  1YUI A;  3ADI A;  2EQ1 A;  4LFB E;  1A1L A;  4DMI A;  3HTX A;  1MEY C;  3F6G A;  2EOR A;  1RQ0 A;  2I13 A;  4DR5 E;  3C6K A;  1L4S A;  4DV4 E;  1X6E A;  2F8B A;  2YU5 A;  2EE8 A;  2HC5 A;  2V88 A;  1UHZ A;  4X8W A;  3TQM A;  2R76 A;  3HPZ A;  4DV6 E;  1DGC A;  1J26 A;  2EMF A;  2JVA A;  2EMW A;  3MHS C;  2KHX A;  2L3J A;  2M4I A;  2EPO A;  1WHQ A;  2EQ3 A;  2EMZ A;  5KL5 A;  2EOS A;  4BHC A;  4DR4 E;  2FGG A;  2UUC E;  5LLQ A;  3QG5 C;  1WJP A;  1X48 A;  4F54 A;  4LFC E;  2YPN A;  2EMK A;  3J7Y p;  2JYA A;  2KON A;  3K6Q A;  3L00 A;  4LF9 E;  2L3C A;  4JI1 E;  1N32 E;  2EZ6 A;  1BB8 A;  2YTP A;  1FKA E;  4L8N A;  1T39 A;  2LJU A;  4FK5 C;  4HTG A;  2ZM6 E;  4DV2 E;  2EN4 A;  1IMU A;  3IWC A;  2V8Q B;  2RSI A;  3HXL A;  1ZAA C;  2EN8 A;  3ADJ A;  4DV7 E;  2EM6 A;  2J7J A;  1KYQ A;  4JI2 E;  2G7H A;  4B3S E;  2L33 A;  2V86 A;  4JYA E;  2EM8 A;  2MC5 A;  1UN6 B;  1UIL A;  4IS1 C;  4KWY A;  4GKJ E;  1STU A;  5A6A A;  2EL4 A;  2YWQ A;  5IV8 B;  2UXC E;  4DKK A;  2LT7 A;  1A1K A;  2EPU A;  2B9D A;  1WHN A;  2EPL X;  2VRD A;  2EMY A;  4R2S A;  1YZ9 A;  4WXD A;  1XNR E;  2DMY A;  2EN3 A;  1G2D C;  2MC6 A;  1N3G A;  3DF6 A;  4LF5 E;  4ZYD A;  2EM5 A;  2K4V A;  2HHH E;  4GEQ B;  2NAB A;  2DRP A;  1T4N A;  2JWO A;  2JXP A;  4LU9 A;  4M2Z A;  2L8T A;  1YYW A;  3J7A G;  1GTK A;  1FJG E;  1BBO A;  2K7I A;  2YTE A;  2EM4 A;  5KL3 A;  2EJ4 A;  4HEI A;  1PDA A;  4R03 A;  4R2R A;  4KHP E;  3EPH A;  2YTF A;  4TUG A;  2M9A A;  2EM2 A;  5KL2 A;  4B3T E;  2YTI A;  3KZY A;  3OTO E;  1N33 E;  2ODR C;  1YUJ A;  5ADZ A;  2L2N A;  2EN2 A;  3THO B;  4DR2 E;  2JR1 A;  1F2I G;  4AQY E;  4JI4 E;  2FV4 B;  4R2A A;  2LBS B;  3ZOQ B;  2JP9 A;  4GKK E;  2LRS A;  5A6B A;  1TF3 A;  5A69 A;  1PJS A;  1HNW E;  2WCC 3;  1X49 A;  3P1X A;  4DV5 E;  3RMP A;  5FLX C;  3MSW A;  1PKP A;  1P47 A;  4F9C B;  2MKD A;  1IBL E;  2YTG A;  2L2K B;  4BHB A;  2DLK A;  1YSA C;  2GPI A;  2YTQ A;  2EPK X;  2RSM A;  2HGH A;  3F6H A;  1WXR A;  4BBY A;  2PRT A;  2A25 A;  1T4O A;  4M30 A;  3HPS A;  4JI5 E;  1RMD A;  2LTS A;  3J81 C;  1XNQ E;  1SR9 A;  2L2M A;  2EMI A;  4WFT A;  2EOY A;  5LMN E;  2WBU A;  4DR3 E;  1TN9 A;  4DR1 E;  2ODR D;  4R2D A;  2EOZ A;  2MDR A;  4KZS A;  2LUP B;  2EL6 A;  1IQS A;  2MDG A;  4LF4 E;  1PJQ A;  1X6F A;  1XMO E;  1HNX E;  5KL6 A;  1PJT A;  2CT1 A;  2NUG A;  1HNZ E;  1X47 A;  2NUF A;  1MGT A;  2YTO A;  2NA2 A;  3BBG A;  3OML A;  1DQ3 A;  5KL4 A;  2WBT A;  4TUI A;  5F3W A;  2UXB E;  1RC7 A;  2EM7 A;  2ENH A;  2RPC A;  4O43 A;  2MKN A;  3EPK A;  2YTD A;  1ZBQ A;  3VK6 A;  2JPA A;  3KWR A;  2YRM A;  4X9J A;  2EPR A;  4WX9 A;  1TF6 A;  4X65 E;  3JAM C;  2M7Q A;  4K0K E;  3T1H E;  3BF2 A;  2KOU A;  2DB2 A;  4MLQ A;  4X66 E;  1A1I A;  5CFF E;  2LMZ A;  3EPL A;  4M0V A;  1Z1B A;  2M1S A;  4OOG C;  4IJD A;  3BGH A;  5LMU E;  4WSG A;  2E5L E;  3C4B A;  1SFE A;  1AH5 A;  4JI0 E;  2B7V A;  1J5E E;  2IHR 1;  2R1F A;  5A6K A;  3J80 C;  2UUB E;  2WBS A;  1O0W A;  4F9A B;  5AC5 A;  4BC9 A;  2B3T B;  2YSP A;  2EMX A;  5AE2 A;  2LVH A;  2EOM A;  4O24 A;  2EPX A;  2L6M A;  2CPN A;  2EOJ A;  5T6J A;  1EH6 A;  1IBK E;  4LF8 E;  5IWA E;  1N36 E;  4Q35 B;  1A1J A;  1JK2 A;  1GQE A;  3LML A;  3AV0 A;  5TSE A;  2L92 A;  4ZYG A;  4B3M E;  2EMB A;  4BC7 A;  2RS7 A;  2B7T A;  3EPJ A;  2I9I A;  4ZYH A;  2UXD E;  3VYY A;  5BR8 E;  1G2F C;  2ADR A;  2YRK A;  4YY3 E;  2ELZ A;  4WYQ B;  4R2P A;  3ADL A;  1T38 A;  2V87 A;  2EPZ A;  1NEI A;  4NXN E;  1EKZ A;  1YPN A;  4RH8 A;  4X62 E;  1DI2 A;  4J8Z A;  4DV0 E;  5IXM B;  4WPY A;  1ZR9 A;  2DGC A;  1N34 E;  3EQ1 A;  2YTJ A;  1EH8 A;  5AE3 A;  2VQE E;  4GZN C;  2YTN A;  1JK1 A;  2LE2 A;  4R2Q A;  5A6B D;  4O5G A;  3IWB A;  2H36 X;  2EOI A;  2VF1 A;  3C6M A;  2EPM X;  2EMH A;  1WRJ A;  2LV2 A;  2D9H A;  1T4L B;  4NHR A;  2EML A;  1LLM C;  3H09 A;  3DJW A;  2EP3 A;  2EM3 A;  3C4T A;  2EMG A;  1XMQ E;  2LO3 A;  2UUA E;  2EOE A;  2JOB A;  4LTY A;  2EWL A;  2EOX A;  4JI6 E; 
#chains in the Genus database with same CATH homology
 4NHR A;  4N4R B;  2R76 A;  3BF2 A;  5IV8 B;  4RHB B;  5TSE A;  2N8X A;  4Q35 B;  5IXM B;  4RH8 A;  4KWY A;  2JXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...