4Q28A

Crystal structure of the plectin 1 and 2 repeats of the human periplakin. northeast structural genomics consortium (nesg) target hr9083a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
110
structure length
110
Chain Sequence
GHHHHHHSHMRRSIVVIHPDTGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISVKGPNGESSVIHDRKSGKKFSIEEALQSGRLTPAQYDRYVNKDMSIQELAVLVSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Plectin 1 and 2 Repeats of Human Periplakin.
rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Periplakin
total genus 28
structure length 110
sequence length 110
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.780 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4q28A00
4Q28A
chains in the Genus database with same CATH superfamily
1XMQE 4KZSA 1DI2A 3H09A 4LF8E 3IWCA 2DMIA 2B3TB 2EOZA 2HGHA 2YU5A 2V88A 4WYQB 1HNXE 4F6MA 1AAYA 4LF7E 2B9DA 2L8TA 2EOYA 1PDAA 4HEIA 4DV5E 1UN6B 2RTXA 2JYAA 3IWBA 2LJUA 2LUPB 4GKJE 4IJDA 4B3RE 2UUAE 1ZAAC 2VQFE 2EOSA 2NUGA 2EPAA 2F8BA 2EMXA 2DB2A 3QG5C 4M30A 1FKAE 4GEQB 2MC6A 1JK1A 4GKKE 2YPNA 1SFEA 2HHHE 4X66E 2L6MA 4KWYA 4DV1E 3THOB 4KHPE 2YTNA 1N3GA 5TSEA 3DJWA 1IQOA 4DV2E 3F6HA 2ADRA 1J5EE 4YHHE 4BC7A 2YRHA 4X62E 2YWQA 2EQ0A 5KL6A 2G7HA 2EPMX 4F9BB 1LLMC 4FK5C 4DUZE 3ADLA 2UUCE 5LMUE 2EJ4A 1MEYC 3JTZA 3IWDA 4L5NC 1IBLE 2EOJA 5AE2A 2M1SA 3TQMA 2A25A 5A2QC 1N33E 4WX9A 4AQYE 4J8ZA 3J81C 1YYWA 1N36E 2EQ1A 2EPZA 5FLXC 5A69A 2RPCA 2LTRA 4N4RB 2EZ6A 4O43A 2KONA 2WBUA 2EMYA 1B69A 1JK2A 4WXDA 4JI6E 2UXBE 5LL6R 3DF6A 4JI7E 2YT4A 1G2FC 2ELZA 2B7TA 3HPZA 2EMAA 2EN7A 2EMGA 1N32E 1YYKA 3J7Yp 2EN2A 2DLKA 2M4IA 2NA2A 3KWRA 2L33A 4F6NA 2JOXA 2I13A 1HNWE 2F4VE 2L2MA 3BBGA 2NABA 2RS6A 1PJSA 4DR3E 2EPCA 2JR1A 3FIGA 2YTDA 2UU9E 2EE8A 2VF1A 3L00A 3C6MA 2WZOA 5IT9C 3EPJA 4F2JC 1EH6A 1A1GA 1KYQA 4MLVA 2Q8UA 1T4NA 2YTFA 3VYYA 1YSAC 3UK3C 2LV2A 3BGHA 2L3JA 2LE2A 3EPLA 1IQSA 5IV8B 2EOQA 4DMIA 4JI1E 4GZNC 2N3GA 5AE1A 1TN9A 4NXME 4JI3E 3OTOE 1GTKA 4X65E 4WXCA 3J7AG 5A6JA 2FGGA 2UUBE 2EMCA 2BB8A 4LF9E 2EOXA 1RQ0A 4R2CA 2MKNA 5A6AA 3RMPA 2EPXA 1YPNA 4DV3E 1KJKA 1UILA 1HR0E 2EN3A 1UHZA 2RSIA 1T4LB 4JI5E 5AC4A 3VYXA 2M7QA 2EN1A 2K7IA 5IWAE 4R2PA 2VE7C 4DR5E 2EPRA 2CSHA 1AH5A 2R76A 3K6QA 2JPAA 4Q28A 3BF2A 1STUA 2LMZA 1IBME 2CPNA 4P7DA 2RS7A 4X8WA 2EL5A 1PKPA 2V87A 2LTSA 3JAMC 1A1KA 3HXLA 2YTGA 2NUFA 1WJPA 3ADJA 4RH8A 2EL6A 1WRJA 3C4BA 2DRPA 2J7JA 2UXDE 2EP3A 2R1FA 3JU0A 4DUYE 4M0VA 1P47A 2LRSA 5BR8E 2L92A 2EOFA 4M9VC 1ZBQA 1YUIA 1X5WA 4YY3E 2EOEA 4BBYA 2V89A 3J80C 3VK6A 2WBTA 3KZYA 1A1IA 1EH8A 4O5GA 4IS1C 1J26A 2NUEA 1WHNA 2E1MA 2EMKA 1XNQE 3ADIA 1RC7A 2EORA 4HTGA 1XNRE 2H36X 4ZYEA 2EOHA 2EM2A 4K0KE 2B7VA 5KL7A 3T1YE 1BBOA 2CTDA 4JI8E 2EOIA 2EPUA 3EPHA 2EMZA 1X6EA 1ZU1A 2EQ3A 5AC5A 2MDRA 5KL3A 2N8XA 3ECRA 5IXMB 1X47A 1RMDA 4JV5E 2LBSB 1DGCA 1DQ3A 2M9AA 2EPNA 2JY9A 1MGTA 1EKZA 2DLQA 2VRDA 1L4SA 4LFCE 1UBDC 4R2SA 2RSMA 4R8OA 4DR2E 1T38A 4DR6E 2N3HA 2UXCE 2K4VA 2MDGA 1A1FA 4BHBA 4DV0E 3MSWA 5F3WA 4NHRA 4R2DA 1EH7A 2V85A 2LO3A 1Z1BA 4L8NA 2YSPA 1PJQA 1ZR9A 2I9IA 2LCEA 2IHR1 5KL4A 1IMUA 1X49A 4BS9A 5KL2A 1BBGA 3AUZA 2EM0A 3EQ1A 1A1HA 2EL4A 1TF6A 4R2RA 3T1HE 4OOGC 4F9CB 1A1LA 2EOMA 4BHCA 1TF3A 3OMLA 2D9HA 2JXPA 4BCAA 2ODRD 1F2IG 3F6GA 2LUQA 3MHHC 4MLQA 4B3SE 4M2ZA 1NCSA 2EN8A 2HC5A 1ZBTA 4JI0E 1YYOA 3HTXA 3THNA 4JI4E 2YSOA 2GLIA 4TUIA 1X48A 1T4OA 3BIDA 4R03A 4P78A 2ENHA 2LJHA 2DSYA 2JWOA 2L2NA 2YRMA 4X64E 2LT7A 2YTOA 2ENCA 2DGCA 4X9JA 3VHTB 2HJJA 2YTJA 2ELYA 2YTQA 2EM5A 2EMBA 4R2QA 5DNYA 5LMNE 4LFBE 4BC9A 4ZYHA 2EM4A 4B3TE 2EWLA 1GZ6A 4O4KA 2EOOA 2RQLA 3M99B 4TUGA 3ZOQB 3ADGA 4ZYGA 2V83A 2EPPA 4NZVA 5CFFE 3EPKA 4B3ME 5ADZA 2YRKA 2GHFA 2ODRC 2L3CA 2MKDA 1A1JA 2WCC3 3LMLA 2FTXB 4Q35B 4LF5E 2GPIA 2JOBA 1QU6A 1YFHA 4DR1E 4LFAE 4JI2E 4I8OA 4BMJA 4WSGA 2E72A 2JP9A 2BBGA 1QNTA 2EM3A 2EN4A 4O24A 4F9AB 4R2AA 2EPOA 1IBKE 2V86A 2EM9A 2VQEE 4LF6E 4WFTA 1GQEA 2WBSA 1YZ9A 3KZZA 2ENAA 5A6BD 2V8QB 2EMFA 3HQ1A 4LTYA 1YUJA 5AASA 2DIXA 1WXRA 4DV6E 3AV0A 2EM7A 2EMHA 2LVHA 4WSPA 2EM8A 3MHSC 1X6HA 4LU9A 2E5LE 4NXNE 4WPYA 2EPLX 2EMWA 4ZYDA 1BB8A 2MC5A 2KOUA 5T6JA 2KHXA 4R2EA 4DV4E 5A6BA 4JYAE 2ZM6E 4OX9E 2CT1A 1NEIA 2YZTA 2YTPA 4LF4E 4DR7E 1X3CA 2YTIA 3C4TA 4DR4E 2EN6A 3LLHA 1G2DC 4DV7E 4DKKA 4F54A 1X6FA 1T39A 1N34E 1I94E 1PJTA 5A6KA 1HNZE 1SR9A 2PRTA 1XMOE 1FJGE 2EM6A 4RHBB 3HPSA 2L2KB 1O0WA 3C6KA 2EMIA 2FV4B 2YTEA 5KL5A 2DMYA 5LLQA 2EMLA 2EPKX 2YU8A 1WHQA 2JVAA 3P1XA 5AE3A
chains in the Genus database with same CATH topology
1XMQE 4KZSA 2JOXA 1DI2A 3H09A 4LF8E 1HNWE 3IWCA 2F4VE 4BBYA 2V89A 3J80C 5DNYA 5LMNE 2B3TB 2L2MA 3VK6A 4LFBE 4BC9A 2RS6A 4DR3E 2V88A 4WYQB 1HNXE 4B3TE 2EWLA 1GZ6A 2JR1A 3FIGA 2UU9E 4LF7E 2B9DA 1J26A 2NUEA 4TUGA 1WHNA 2E1MA 3ZOQB 3ADGA 1XNQE 2VF1A 3ADIA 2V83A 2L8TA 5CFFE 4DV5E 1RC7A 2RTXA 2WZOA 2H36X 5ADZA 5IT9C 4B3ME 1XNRE 4K0KE 3IWBA 2B7VA 3T1YE 2LUPB 4GKJE 2ODRC 4JI8E 2L3CA 1T4NA 4B3RE 2MDRA 3LMLA 2FTXB 2UUAE 3VYYA 4LF5E 1X47A 2VQFE 2JOBA 2F8BA 2NUGA 1QU6A 2L3JA 2LBSB 4JV5E 2DB2A 2LE2A 4M30A 1DQ3A 4DR1E 1FKAE 4LFAE 2JY9A 4GEQB 4I8OA 4JI2E 1EKZA 2MC6A 4GKKE 4DMIA 4JI1E 4LFCE 4BMJA 2N3GA 2HHHE 2RSMA 2L6MA 4X66E 4DV1E 4KHPE 4R8OA 5AE1A 4DR2E 4NXME 4JI3E 4DR6E 3OTOE 2N3HA 3DJWA 4F9AB 2UXCE 2K4VA 4DV2E 4X65E 1IBKE 3F6HA 2V86A 2VQEE 1J5EE 3J7AG 4YHHE 2FGGA 3MSWA 4BC7A 4DV0E 2UUBE 4WFTA 1GQEA 4X62E 5F3WA 4LF6E 2G7HA 4LF9E 1YZ9A 2V8QB 2V85A 4F9BB 3HQ1A 4LTYA 1RQ0A 4DUZE 4L8NA 5AASA 2DIXA 1WXRA 3ADLA 2UUCE 3RMPA 4DV6E 3AV0A 5LMUE 2IHR1 4DV3E 1UILA 3JTZA 3IWDA 4L5NC 4WSPA 1IBLE 1HR0E 1UHZA 1X49A 1T4LB 4JI5E 4BS9A 3VYXA 5AE2A 2M7QA 2M1SA 4LU9A 3AUZA 5A2QC 2E5LE 4NXNE 5IWAE 4WPYA 1N33E 2VE7C 4DR5E 2MC5A 2KOUA 5T6JA 2KHXA 3K6QA 4J8ZA 4OOGC 4F9CB 3J81C 4DV4E 4AQYE 3T1HE 1YYWA 4JYAE 2ZM6E 4OX9E 3OMLA 4Q28A 2YZTA 1N36E 4BCAA 2ODRD 1STUA 4LF4E 2LMZA 1IBME 4DR7E 2CPNA 4P7DA 5FLXC 3C4TA 2RS7A 4DR4E 2LTRA 4X8WA 3JAMC 2V87A 1PKPA 2LTSA 3F6GA 2LUQA 3LLHA 4B3SE 4M2ZA 2EZ6A 4DV7E 1ZBTA 2KONA 3HXLA 4DKKA 4F54A 2NUFA 1YYOA 4JI0E 3HTXA 3ADJA 4JI4E 4JI6E 1N34E 2UXBE 1I94E 3C4BA 5LL6R 4TUIA 1SR9A 1HNZE 2UXDE 3JU0A 4DUYE 1X48A 1T4OA 1XMOE 3DF6A 4M0VA 2YT4A 4R03A 4P78A 4JI7E 1FJGE 2LRSA 2B7TA 3HPZA 1O0WA 3HPSA 2L92A 2LJHA 5BR8E 2L2KB 2DSYA 2JWOA 2L2NA 4X64E 1N32E 1ZBQA 2FV4B 1YYKA 3J7Yp 2DMYA 2M4IA 2NA2A 3KWRA 1WHQA 2JVAA 4YY3E 2L33A 3P1XA 5AE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q28 A; 
#chains in the Genus database with same CATH topology
 1XMQ E;  4KZS A;  1DI2 A;  3H09 A;  4LF8 E;  3IWC A;  2DMI A;  2B3T B;  2EOZ A;  2HGH A;  2YU5 A;  2V88 A;  4WYQ B;  1HNX E;  4F6M A;  1AAY A;  4LF7 E;  2B9D A;  2L8T A;  2EOY A;  1PDA A;  4HEI A;  4DV5 E;  1UN6 B;  2RTX A;  2JYA A;  3IWB A;  2LJU A;  2LUP B;  4GKJ E;  4IJD A;  4B3R E;  2UUA E;  1ZAA C;  2VQF E;  2EOS A;  2NUG A;  2EPA A;  2F8B A;  2EMX A;  2DB2 A;  3QG5 C;  4M30 A;  1FKA E;  4GEQ B;  2MC6 A;  1JK1 A;  4GKK E;  2YPN A;  1SFE A;  2HHH E;  4X66 E;  2L6M A;  4KWY A;  4DV1 E;  3THO B;  4KHP E;  2YTN A;  1N3G A;  5TSE A;  3DJW A;  1IQO A;  4DV2 E;  3F6H A;  2ADR A;  1J5E E;  4YHH E;  4BC7 A;  2YRH A;  4X62 E;  2YWQ A;  2EQ0 A;  5KL6 A;  2G7H A;  2EPM X;  4F9B B;  1LLM C;  4FK5 C;  4DUZ E;  3ADL A;  2UUC E;  5LMU E;  2EJ4 A;  1MEY C;  3JTZ A;  3IWD A;  4L5N C;  1IBL E;  2EOJ A;  5AE2 A;  2M1S A;  3TQM A;  2A25 A;  5A2Q C;  1N33 E;  4WX9 A;  4AQY E;  4J8Z A;  3J81 C;  1YYW A;  1N36 E;  2EQ1 A;  2EPZ A;  5FLX C;  5A69 A;  2RPC A;  2LTR A;  4N4R B;  2EZ6 A;  4O43 A;  2KON A;  2WBU A;  2EMY A;  1B69 A;  1JK2 A;  4WXD A;  4JI6 E;  2UXB E;  5LL6 R;  3DF6 A;  4JI7 E;  2YT4 A;  1G2F C;  2ELZ A;  2B7T A;  3HPZ A;  2EMA A;  2EN7 A;  2EMG A;  1N32 E;  1YYK A;  3J7Y p;  2EN2 A;  2DLK A;  2M4I A;  2NA2 A;  3KWR A;  2L33 A;  4F6N A;  2JOX A;  2I13 A;  1HNW E;  2F4V E;  2L2M A;  3BBG A;  2NAB A;  2RS6 A;  1PJS A;  4DR3 E;  2EPC A;  2JR1 A;  3FIG A;  2YTD A;  2UU9 E;  2EE8 A;  2VF1 A;  3L00 A;  3C6M A;  2WZO A;  5IT9 C;  3EPJ A;  4F2J C;  1EH6 A;  1A1G A;  1KYQ A;  4MLV A;  2Q8U A;  1T4N A;  2YTF A;  3VYY A;  1YSA C;  3UK3 C;  2LV2 A;  3BGH A;  2L3J A;  2LE2 A;  3EPL A;  1IQS A;  5IV8 B;  2EOQ A;  4DMI A;  4JI1 E;  4GZN C;  2N3G A;  5AE1 A;  1TN9 A;  4NXM E;  4JI3 E;  3OTO E;  1GTK A;  4X65 E;  4WXC A;  3J7A G;  5A6J A;  2FGG A;  2UUB E;  2EMC A;  2BB8 A;  4LF9 E;  2EOX A;  1RQ0 A;  4R2C A;  2MKN A;  5A6A A;  3RMP A;  2EPX A;  1YPN A;  4DV3 E;  1KJK A;  1UIL A;  1HR0 E;  2EN3 A;  1UHZ A;  2RSI A;  1T4L B;  4JI5 E;  5AC4 A;  3VYX A;  2M7Q A;  2EN1 A;  2K7I A;  5IWA E;  4R2P A;  2VE7 C;  4DR5 E;  2EPR A;  2CSH A;  1AH5 A;  2R76 A;  3K6Q A;  2JPA A;  4Q28 A;  3BF2 A;  1STU A;  2LMZ A;  1IBM E;  2CPN A;  4P7D A;  2RS7 A;  4X8W A;  2EL5 A;  1PKP A;  2V87 A;  2LTS A;  3JAM C;  1A1K A;  3HXL A;  2YTG A;  2NUF A;  1WJP A;  3ADJ A;  4RH8 A;  2EL6 A;  1WRJ A;  3C4B A;  2DRP A;  2J7J A;  2UXD E;  2EP3 A;  2R1F A;  3JU0 A;  4DUY E;  4M0V A;  1P47 A;  2LRS A;  5BR8 E;  2L92 A;  2EOF A;  4M9V C;  1ZBQ A;  1YUI A;  1X5W A;  4YY3 E;  2EOE A;  4BBY A;  2V89 A;  3J80 C;  3VK6 A;  2WBT A;  3KZY A;  1A1I A;  1EH8 A;  4O5G A;  4IS1 C;  1J26 A;  2NUE A;  1WHN A;  2E1M A;  2EMK A;  1XNQ E;  3ADI A;  1RC7 A;  2EOR A;  4HTG A;  1XNR E;  2H36 X;  4ZYE A;  2EOH A;  2EM2 A;  4K0K E;  2B7V A;  5KL7 A;  3T1Y E;  1BBO A;  2CTD A;  4JI8 E;  2EOI A;  2EPU A;  3EPH A;  2EMZ A;  1X6E A;  1ZU1 A;  2EQ3 A;  5AC5 A;  2MDR A;  5KL3 A;  2N8X A;  3ECR A;  5IXM B;  1X47 A;  1RMD A;  4JV5 E;  2LBS B;  1DGC A;  1DQ3 A;  2M9A A;  2EPN A;  2JY9 A;  1MGT A;  1EKZ A;  2DLQ A;  2VRD A;  1L4S A;  4LFC E;  1UBD C;  4R2S A;  2RSM A;  4R8O A;  4DR2 E;  1T38 A;  4DR6 E;  2N3H A;  2UXC E;  2K4V A;  2MDG A;  1A1F A;  4BHB A;  4DV0 E;  3MSW A;  5F3W A;  4NHR A;  4R2D A;  1EH7 A;  2V85 A;  2LO3 A;  1Z1B A;  4L8N A;  2YSP A;  1PJQ A;  1ZR9 A;  2I9I A;  2LCE A;  2IHR 1;  5KL4 A;  1IMU A;  1X49 A;  4BS9 A;  5KL2 A;  1BBG A;  3AUZ A;  2EM0 A;  3EQ1 A;  1A1H A;  2EL4 A;  1TF6 A;  4R2R A;  3T1H E;  4OOG C;  4F9C B;  1A1L A;  2EOM A;  4BHC A;  1TF3 A;  3OML A;  2D9H A;  2JXP A;  4BCA A;  2ODR D;  1F2I G;  3F6G A;  2LUQ A;  3MHH C;  4MLQ A;  4B3S E;  4M2Z A;  1NCS A;  2EN8 A;  2HC5 A;  1ZBT A;  4JI0 E;  1YYO A;  3HTX A;  3THN A;  4JI4 E;  2YSO A;  2GLI A;  4TUI A;  1X48 A;  1T4O A;  3BID A;  4R03 A;  4P78 A;  2ENH A;  2LJH A;  2DSY A;  2JWO A;  2L2N A;  2YRM A;  4X64 E;  2LT7 A;  2YTO A;  2ENC A;  2DGC A;  4X9J A;  3VHT B;  2HJJ A;  2YTJ A;  2ELY A;  2YTQ A;  2EM5 A;  2EMB A;  4R2Q A;  5DNY A;  5LMN E;  4LFB E;  4BC9 A;  4ZYH A;  2EM4 A;  4B3T E;  2EWL A;  1GZ6 A;  4O4K A;  2EOO A;  2RQL A;  3M99 B;  4TUG A;  3ZOQ B;  3ADG A;  4ZYG A;  2V83 A;  2EPP A;  4NZV A;  5CFF E;  3EPK A;  4B3M E;  5ADZ A;  2YRK A;  2GHF A;  2ODR C;  2L3C A;  2MKD A;  1A1J A;  2WCC 3;  3LML A;  2FTX B;  4Q35 B;  4LF5 E;  2GPI A;  2JOB A;  1QU6 A;  1YFH A;  4DR1 E;  4LFA E;  4JI2 E;  4I8O A;  4BMJ A;  4WSG A;  2E72 A;  2JP9 A;  2BBG A;  1QNT A;  2EM3 A;  2EN4 A;  4O24 A;  4F9A B;  4R2A A;  2EPO A;  1IBK E;  2V86 A;  2EM9 A;  2VQE E;  4LF6 E;  4WFT A;  1GQE A;  2WBS A;  1YZ9 A;  3KZZ A;  2ENA A;  5A6B D;  2V8Q B;  2EMF A;  3HQ1 A;  4LTY A;  1YUJ A;  5AAS A;  2DIX A;  1WXR A;  4DV6 E;  3AV0 A;  2EM7 A;  2EMH A;  2LVH A;  4WSP A;  2EM8 A;  3MHS C;  1X6H A;  4LU9 A;  2E5L E;  4NXN E;  4WPY A;  2EPL X;  2EMW A;  4ZYD A;  1BB8 A;  2MC5 A;  2KOU A;  5T6J A;  2KHX A;  4R2E A;  4DV4 E;  5A6B A;  4JYA E;  2ZM6 E;  4OX9 E;  2CT1 A;  1NEI A;  2YZT A;  2YTP A;  4LF4 E;  4DR7 E;  1X3C A;  2YTI A;  3C4T A;  4DR4 E;  2EN6 A;  3LLH A;  1G2D C;  4DV7 E;  4DKK A;  4F54 A;  1X6F A;  1T39 A;  1N34 E;  1I94 E;  1PJT A;  5A6K A;  1HNZ E;  1SR9 A;  2PRT A;  1XMO E;  1FJG E;  2EM6 A;  4RHB B;  3HPS A;  2L2K B;  1O0W A;  3C6K A;  2EMI A;  2FV4 B;  2YTE A;  5KL5 A;  2DMY A;  5LLQ A;  2EML A;  2EPK X;  2YU8 A;  1WHQ A;  2JVA A;  3P1X A;  5AE3 A; 
#chains in the Genus database with same CATH homology
 1XMQ E;  4KZS A;  2JOX A;  1DI2 A;  3H09 A;  4LF8 E;  1HNW E;  3IWC A;  2F4V E;  4BBY A;  2V89 A;  3J80 C;  5DNY A;  5LMN E;  2B3T B;  2L2M A;  3VK6 A;  4LFB E;  4BC9 A;  2RS6 A;  4DR3 E;  2V88 A;  4WYQ B;  1HNX E;  4B3T E;  2EWL A;  1GZ6 A;  2JR1 A;  3FIG A;  2UU9 E;  4LF7 E;  2B9D A;  1J26 A;  2NUE A;  4TUG A;  1WHN A;  2E1M A;  3ZOQ B;  3ADG A;  1XNQ E;  2VF1 A;  3ADI A;  2V83 A;  2L8T A;  5CFF E;  4DV5 E;  1RC7 A;  2RTX A;  2WZO A;  2H36 X;  5ADZ A;  5IT9 C;  4B3M E;  1XNR E;  4K0K E;  3IWB A;  2B7V A;  3T1Y E;  2LUP B;  4GKJ E;  2ODR C;  4JI8 E;  2L3C A;  1T4N A;  4B3R E;  2MDR A;  3LML A;  2FTX B;  2UUA E;  3VYY A;  4LF5 E;  1X47 A;  2VQF E;  2JOB A;  2F8B A;  2NUG A;  1QU6 A;  2L3J A;  2LBS B;  4JV5 E;  2DB2 A;  2LE2 A;  4M30 A;  1DQ3 A;  4DR1 E;  1FKA E;  4LFA E;  2JY9 A;  4GEQ B;  4I8O A;  4JI2 E;  1EKZ A;  2MC6 A;  4GKK E;  4DMI A;  4JI1 E;  4LFC E;  4BMJ A;  2N3G A;  2HHH E;  2RSM A;  2L6M A;  4X66 E;  4DV1 E;  4KHP E;  4R8O A;  5AE1 A;  4DR2 E;  4NXM E;  4JI3 E;  4DR6 E;  3OTO E;  2N3H A;  3DJW A;  4F9A B;  2UXC E;  2K4V A;  4DV2 E;  4X65 E;  1IBK E;  3F6H A;  2V86 A;  2VQE E;  1J5E E;  3J7A G;  4YHH E;  2FGG A;  3MSW A;  4BC7 A;  4DV0 E;  2UUB E;  4WFT A;  1GQE A;  4X62 E;  5F3W A;  4LF6 E;  2G7H A;  4LF9 E;  1YZ9 A;  2V8Q B;  2V85 A;  4F9B B;  3HQ1 A;  4LTY A;  1RQ0 A;  4DUZ E;  4L8N A;  5AAS A;  2DIX A;  1WXR A;  3ADL A;  2UUC E;  3RMP A;  4DV6 E;  3AV0 A;  5LMU E;  2IHR 1;  4DV3 E;  1UIL A;  3JTZ A;  3IWD A;  4L5N C;  4WSP A;  1IBL E;  1HR0 E;  1UHZ A;  1X49 A;  1T4L B;  4JI5 E;  4BS9 A;  3VYX A;  5AE2 A;  2M7Q A;  2M1S A;  4LU9 A;  3AUZ A;  5A2Q C;  2E5L E;  4NXN E;  5IWA E;  4WPY A;  1N33 E;  2VE7 C;  4DR5 E;  2MC5 A;  2KOU A;  5T6J A;  2KHX A;  3K6Q A;  4J8Z A;  4OOG C;  4F9C B;  3J81 C;  4DV4 E;  4AQY E;  3T1H E;  1YYW A;  4JYA E;  2ZM6 E;  4OX9 E;  3OML A;  4Q28 A;  2YZT A;  1N36 E;  4BCA A;  2ODR D;  1STU A;  4LF4 E;  2LMZ A;  1IBM E;  4DR7 E;  2CPN A;  4P7D A;  5FLX C;  3C4T A;  2RS7 A;  4DR4 E;  2LTR A;  4X8W A;  3JAM C;  2V87 A;  1PKP A;  2LTS A;  3F6G A;  2LUQ A;  3LLH A;  4B3S E;  4M2Z A;  2EZ6 A;  4DV7 E;  1ZBT A;  2KON A;  3HXL A;  4DKK A;  4F54 A;  2NUF A;  1YYO A;  4JI0 E;  3HTX A;  3ADJ A;  4JI4 E;  4JI6 E;  1N34 E;  2UXB E;  1I94 E;  3C4B A;  5LL6 R;  4TUI A;  1SR9 A;  1HNZ E;  2UXD E;  3JU0 A;  4DUY E;  1X48 A;  1T4O A;  1XMO E;  3DF6 A;  4M0V A;  2YT4 A;  4R03 A;  4P78 A;  4JI7 E;  1FJG E;  2LRS A;  2B7T A;  3HPZ A;  1O0W A;  3HPS A;  2L92 A;  2LJH A;  5BR8 E;  2L2K B;  2DSY A;  2JWO A;  2L2N A;  4X64 E;  1N32 E;  1ZBQ A;  2FV4 B;  1YYK A;  3J7Y p;  2DMY A;  2M4I A;  2NA2 A;  3KWR A;  1WHQ A;  2JVA A;  4YY3 E;  2L33 A;  3P1X A;  5AE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...