4Q28A

Crystal structure of the plectin 1 and 2 repeats of the human periplakin. northeast structural genomics consortium (nesg) target hr9083a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
110
structure length
110
Chain Sequence
GHHHHHHSHMRRSIVVIHPDTGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISVKGPNGESSVIHDRKSGKKFSIEEALQSGRLTPAQYDRYVNKDMSIQELAVLVSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Plectin 1 and 2 Repeats of Human Periplakin.
rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Periplakin
total genus 28
structure length 110
sequence length 110
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.780 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4q28A00
4Q28A
chains in the Genus database with same CATH superfamily
1UHZA 5KL7A 2LCEA 5IV8B 4JI5E 1AAYA 1N33E 3HTXA 2EMAA 2LJHA 2B9DA 2LO3A 4M30A 4F6NA 4WSGA 3J7AG 1RQ0A 2B7TA 2KONA 2JXPA 3VYXA 1JK2A 2ADRA 2E1MA 3DF6A 4BS9A 4RH8A 2EQ0A 2YU8A 4Q28A 2KOUA 3DJWA 1YSAC 4M2ZA 4GKJE 1A1LA 3C6KA 4DV1E 3IWCA 3EQ1A 1X49A 4DV2E 2UU9E 2EE8A 2HC5A 2CSHA 2EOFA 3BIDA 2UXCE 3KZZA 2JY9A 5A6JA 2JOBA 3TQMA 3JTZA 2EPOA 4LF4E 2MC6A 4IJDA 4X66E 1A1GA 2EPRA 1EH6A 2LTRA 2ENAA 1WXRA 4YY3E 3HQ1A 4LU9A 2EOYA 2EWLA 4MLVA 4WPYA 2EN8A 2WBSA 4K0KE 4DKKA 1GZ6A 1Z1BA 4X65E 4R2CA 4R03A 4BHBA 2NUEA 1ZU1A 2ELYA 4LFCE 3J7Yp 1T4LB 2EMXA 4RHBB 2YTOA 2ODRC 2YTNA 2E5LE 2L2NA 2H36X 4P78A 2EMWA 2B7VA 3F6HA 2L2KB 1FKAE 4JI6E 2RTXA 2YZTA 2ENHA 2K7IA 2EOQA 4OX9E 4ZYHA 1P47A 4DUZE 2MC5A 4DV5E 2DIXA 2YTIA 4GKKE 1KJKA 1HR0E 2L3CA 4J8ZA 2EP3A 2L3JA 4R2QA 1TF6A 2N3HA 1UILA 1DGCA 1WHNA 2EOIA 1XNRE 2YWQA 1MEYC 2EMHA 2LE2A 1IMUA 4MLQA 4BBYA 2UXDE 4WX9A 5LLQA 2LBSB 2E72A 3J80C 4DV7E 3VK6A 2EMKA 2EL6A 4O5GA 4JI0E 2JOXA 2FV4B 3HPSA 2YSPA 3ADGA 1X47A 2EPMX 1N34E 2HHHE 1HNZE 4LF5E 1NCSA 2YRMA 4JI2E 2EN3A 4DR7E 3IWBA 2B3TB 3UK3C 2VQFE 3IWDA 3LMLA 1TN9A 2EMBA 3VYYA 1JK1A 5IWAE 2MDRA 4X64E 2WCC3 2EOXA 2PRTA 2DLKA 2EMZA 1MGTA 2I13A 2HJJA 4R2AA 5IT9C 5LMUE 2M1SA 3JAMC 4LF8E 1YYKA 4DUYE 2GLIA 2RSMA 2JP9A 2EN2A 2FGGA 1NEIA 2EM0A 2LVHA 2RS7A 4I8OA 4LTYA 2G7HA 4F54A 4HTGA 1ZAAC 2IHR1 4P7DA 1SFEA 3MSWA 1B69A 2EPCA 4O4KA 3OTOE 1RMDA 1T39A 3J81C 2LMZA 4YHHE 2EPLX 1SR9A 5TSEA 2EN7A 2EMLA 2ODRD 4R2DA 2BBGA 1IBLE 4X62E 2JYAA 3H09A 1WHQA 4DR5E 2ENCA 1X6HA 4R2PA 4DR3E 4KHPE 2N8XA 2YSOA 3ADJA 1A1IA 2MKDA 2V8QB 5AASA 1XMOE 4OOGC 2YTGA 4LFAE 2MKNA 4DV3E 2LJUA 2Q8UA 2EPZA 1YUIA 2NUGA 4JI4E 4JI8E 1PJQA 4F6MA 4LF6E 3JU0A 3VHTB 5AC5A 2EOZA 5A6BD 4F9CB 1IQOA 4DV4E 1IQSA 5A2QC 1A1JA 2DSYA 2LT7A 3EPJA 2EM3A 4X9JA 2CPNA 1X48A 4BCAA 1EKZA 3QG5C 1ZBTA 2V89A 1AH5A 2M4IA 2GHFA 3ADLA 4N4RB 1WRJA 2LTSA 5KL3A 2LV2A 1BB8A 2YT4A 3ZOQB 4GEQB 4ZYDA 1PKPA 4M0VA 4JI1E 4NXME 2EM9A 2L8TA 2EOMA 2EJ4A 2EN1A 5AE2A 5A69A 3THOB 2EQ1A 1G2DC 2UXBE 1N32E 4KWYA 2EPKX 4FK5C 1GTKA 2YTPA 1A1HA 2EQ3A 1TF3A 4B3RE 4TUGA 2EOHA 2YU5A 2N3GA 2R76A 2JVAA 2EMFA 2RS6A 2I9IA 2V83A 5LMNE 2VE7C 2GPIA 3MHHC 4BC7A 2EMGA 2NUFA 1N36E 2YTJA 2EN6A 2L33A 4O43A 2R1FA 4LF9E 5A6AA 5LL6R 3BGHA 1XNQE 3ECRA 2F4VE 2V87A 4AQYE 3BF2A 1UBDC 5AE1A 5CFFE 3EPKA 1F2IG 4NHRA 2EPPA 5A6BA 2A25A 1ZR9A 2V88A 1L4SA 1PDAA 2EM4A 2FTXB 4R8OA 1T38A 5IXMB 4O24A 1X3CA 4DMIA 2EOSA 2WZOA 2EM6A 5A6KA 2DMYA 4BC9A 4F2JC 3C4BA 4KZSA 2YRHA 4L5NC 2JPAA 4DV6E 1YFHA 1HNWE 4L8NA 2BB8A 4Q35B 4ZYGA 1XMQE 4M9VC 2DGCA 3ADIA 2M7QA 3FIGA 2EOOA 1FJGE 3T1HE 2EOEA 1GQEA 2YPNA 2UUCE 1X6FA 1A1FA 1DI2A 2YTEA 4WXCA 4TUIA 3RMPA 3BBGA 2EMIA 2JWOA 3MHSC 2LUQA 5KL5A 2F8BA 2LRSA 2EPNA 3OMLA 2WBTA 3EPHA 1T4OA 2DRPA 1PJTA 2EMCA 2RQLA 3T1YE 2J7JA 2DB2A 4BMJA 1T4NA 2VQEE 2EMYA 2RPCA 2ELZA 1HNXE 4F9AB 2MDGA 4BHCA 1QU6A 2KHXA 4JV5E 2LUPB 5F3WA 2EM5A 4B3TE 3K6QA 2EOJA 3AV0A 2D9HA 2EPXA 4HEIA 2CT1A 5AE3A 1UN6B 1RC7A 1QNTA 2K4VA 3EPLA 4WXDA 2YTFA 3C6MA 1IBME 4JYAE 4WFTA 1PJSA 3HPZA 4WSPA 3AUZA 1X5WA 4JI7E 2L92A 2UUBE 2EM7A 2EL4A 3L00A 1A1KA 2EPUA 2VF1A 3LLHA 1YYWA 2HGHA 2M9AA 3KWRA 2UUAE 4LFBE 4DR1E 1EH7A 3F6GA 1LLMC 1BBOA 2RSIA 1J26A 1ZBQA 4JI3E 4GZNC 2JR1A 2NA2A 1O0WA 1YPNA 2WBUA 1IBKE 4X8WA 5KL4A 2CTDA 2L6MA 2EN4A 4DR4E 4R2SA 2EZ6A 2ZM6E 4DR6E 1BBGA 5T6JA 2EL5A 3M99B 5FLXC 3THNA 1J5EE 4B3SE 2YRKA 1X6EA 4NZVA 5ADZA 4B3ME 1G2FC 5BR8E 1EH8A 1I94E 2EPAA 2VRDA 5KL6A 1N3GA 2YTDA 4DV0E 2EM2A 4F9BB 4R2EA 4IS1C 3P1XA 1YYOA 3KZYA 2V85A 1STUA 5AC4A 4R2RA 4WYQB 1KYQA 2EORA 3C4TA 1YUJA 2DMIA 2V86A 4LF7E 2YTQA 1YZ9A 1WJPA 2DLQA 2EM8A 2NABA 5DNYA 4NXNE 3HXLA 4ZYEA 1DQ3A 4DR2E 2L2MA 5KL2A
chains in the Genus database with same CATH topology
4LF5E 4F9AB 1UHZA 4JI2E 4JI5E 4DR7E 4JV5E 1QU6A 2KHXA 2B3TB 3IWBA 5AE2A 2VQFE 2LUPB 3IWDA 3LMLA 3HTXA 2LJHA 2B9DA 5F3WA 1N33E 4B3TE 4M30A 3K6QA 3VYYA 2UXBE 3J7AG 1RQ0A 5IWAE 3AV0A 1N32E 2B7TA 2KONA 3VYXA 2MDRA 4X64E 2E1MA 3DF6A 4BS9A 4B3RE 4TUGA 5AE3A 2N3GA 4Q28A 2KOUA 2JVAA 3DJWA 5LMUE 5IT9C 1RC7A 2M1SA 2RS6A 3JAMC 4LF8E 4M2ZA 4DUYE 1YYKA 4GKJE 2V83A 2RSMA 5LMNE 2K4VA 2VE7C 2FGGA 4BC7A 4DV1E 3IWCA 1IBME 1X49A 4DV2E 2UU9E 2NUFA 4JYAE 1N36E 4WFTA 2RS7A 2L33A 4I8OA 2UXCE 4LTYA 2G7HA 4F54A 4LF9E 3HPZA 5LL6R 2IHR1 4WSPA 3AUZA 4P7DA 2JY9A 1XNQE 2JOBA 3MSWA 4JI7E 2L92A 2F4VE 3JTZA 2V87A 4AQYE 2UUBE 4LF4E 2MC6A 5AE1A 5CFFE 4X66E 3OTOE 2VF1A 3LLHA 3J81C 2LTRA 1HNZE 2LMZA 4YHHE 1YYWA 1WXRA 4YY3E 1SR9A 3KWRA 2V88A 3HQ1A 4LU9A 4R8OA 2EWLA 2FTXB 2ODRD 4WPYA 2UUAE 4K0KE 4LFBE 4DKKA 4DR1E 1GZ6A 3F6GA 4X62E 4X65E 1IBLE 4R03A 2NUEA 3H09A 4DMIA 4NXME 4LFCE 3J7Yp 1WHQA 2WZOA 4DR5E 1T4LB 2DMYA 4DR3E 4BC9A 1J26A 1ZBQA 4KHPE 4JI3E 2ODRC 2JR1A 2NA2A 1O0WA 2L2NA 3C4BA 2E5LE 2H36X 4P78A 4KZSA 1IBKE 3ADJA 4X8WA 2B7VA 2L6MA 2V8QB 5AASA 1XMOE 4L5NC 3F6HA 4DR4E 4DV6E 4OOGC 1HNWE 4L8NA 2L2KB 1FKAE 4JI6E 2ZM6E 2RTXA 2YZTA 5T6JA 4LFAE 2EZ6A 4DV3E 1XMQE 4DR6E 5FLXC 3ADIA 2M7QA 3FIGA 1J5EE 4B3SE 1FJGE 3T1HE 4OX9E 2NUGA 4JI4E 1GQEA 4JI8E 5ADZA 4DUZE 2MC5A 4B3ME 4DV5E 4LF6E 2DIXA 3JU0A 4GKKE 1HR0E 5BR8E 2L3CA 4J8ZA 2UUCE 1DI2A 1I94E 2L3JA 4DV0E 4F9CB 4F9BB 4DV4E 4TUIA 3RMPA 5A2QC 1YYOA 3P1XA 2DSYA 2N3HA 2V85A 2JWOA 1UILA 1WHNA 2LUQA 1XNRE 1STUA 2CPNA 3ADGA 1X48A 4BCAA 1EKZA 1ZBTA 2LE2A 2V89A 2F8BA 2LRSA 4WYQB 2HHHE 3OMLA 2M4IA 3C4TA 4BBYA 4LF7E 2V86A 1YZ9A 2UXDE 1T4OA 2LBSB 3ADLA 3J80C 2LTSA 3T1YE 2DB2A 4BMJA 5DNYA 4NXNE 1T4NA 2VQEE 3HXLA 4DV7E 3VK6A 2YT4A 3ZOQB 4GEQB 4JI0E 1HNXE 1PKPA 2JOXA 1DQ3A 2FV4B 3HPSA 1X47A 4M0VA 2L2MA 4DR2E 1N34E 4JI1E 2L8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q28 A; 
#chains in the Genus database with same CATH topology
 1UHZ A;  5KL7 A;  2LCE A;  5IV8 B;  4JI5 E;  1AAY A;  1N33 E;  3HTX A;  2EMA A;  2LJH A;  2B9D A;  2LO3 A;  4M30 A;  4F6N A;  4WSG A;  3J7A G;  1RQ0 A;  2B7T A;  2KON A;  2JXP A;  3VYX A;  1JK2 A;  2ADR A;  2E1M A;  3DF6 A;  4BS9 A;  4RH8 A;  2EQ0 A;  2YU8 A;  4Q28 A;  2KOU A;  3DJW A;  1YSA C;  4M2Z A;  4GKJ E;  1A1L A;  3C6K A;  4DV1 E;  3IWC A;  3EQ1 A;  1X49 A;  4DV2 E;  2UU9 E;  2EE8 A;  2HC5 A;  2CSH A;  2EOF A;  3BID A;  2UXC E;  3KZZ A;  2JY9 A;  5A6J A;  2JOB A;  3TQM A;  3JTZ A;  2EPO A;  4LF4 E;  2MC6 A;  4IJD A;  4X66 E;  1A1G A;  2EPR A;  1EH6 A;  2LTR A;  2ENA A;  1WXR A;  4YY3 E;  3HQ1 A;  4LU9 A;  2EOY A;  2EWL A;  4MLV A;  4WPY A;  2EN8 A;  2WBS A;  4K0K E;  4DKK A;  1GZ6 A;  1Z1B A;  4X65 E;  4R2C A;  4R03 A;  4BHB A;  2NUE A;  1ZU1 A;  2ELY A;  4LFC E;  3J7Y p;  1T4L B;  2EMX A;  4RHB B;  2YTO A;  2ODR C;  2YTN A;  2E5L E;  2L2N A;  2H36 X;  4P78 A;  2EMW A;  2B7V A;  3F6H A;  2L2K B;  1FKA E;  4JI6 E;  2RTX A;  2YZT A;  2ENH A;  2K7I A;  2EOQ A;  4OX9 E;  4ZYH A;  1P47 A;  4DUZ E;  2MC5 A;  4DV5 E;  2DIX A;  2YTI A;  4GKK E;  1KJK A;  1HR0 E;  2L3C A;  4J8Z A;  2EP3 A;  2L3J A;  4R2Q A;  1TF6 A;  2N3H A;  1UIL A;  1DGC A;  1WHN A;  2EOI A;  1XNR E;  2YWQ A;  1MEY C;  2EMH A;  2LE2 A;  1IMU A;  4MLQ A;  4BBY A;  2UXD E;  4WX9 A;  5LLQ A;  2LBS B;  2E72 A;  3J80 C;  4DV7 E;  3VK6 A;  2EMK A;  2EL6 A;  4O5G A;  4JI0 E;  2JOX A;  2FV4 B;  3HPS A;  2YSP A;  3ADG A;  1X47 A;  2EPM X;  1N34 E;  2HHH E;  1HNZ E;  4LF5 E;  1NCS A;  2YRM A;  4JI2 E;  2EN3 A;  4DR7 E;  3IWB A;  2B3T B;  3UK3 C;  2VQF E;  3IWD A;  3LML A;  1TN9 A;  2EMB A;  3VYY A;  1JK1 A;  5IWA E;  2MDR A;  4X64 E;  2WCC 3;  2EOX A;  2PRT A;  2DLK A;  2EMZ A;  1MGT A;  2I13 A;  2HJJ A;  4R2A A;  5IT9 C;  5LMU E;  2M1S A;  3JAM C;  4LF8 E;  1YYK A;  4DUY E;  2GLI A;  2RSM A;  2JP9 A;  2EN2 A;  2FGG A;  1NEI A;  2EM0 A;  2LVH A;  2RS7 A;  4I8O A;  4LTY A;  2G7H A;  4F54 A;  4HTG A;  1ZAA C;  2IHR 1;  4P7D A;  1SFE A;  3MSW A;  1B69 A;  2EPC A;  4O4K A;  3OTO E;  1RMD A;  1T39 A;  3J81 C;  2LMZ A;  4YHH E;  2EPL X;  1SR9 A;  5TSE A;  2EN7 A;  2EML A;  2ODR D;  4R2D A;  2BBG A;  1IBL E;  4X62 E;  2JYA A;  3H09 A;  1WHQ A;  4DR5 E;  2ENC A;  1X6H A;  4R2P A;  4DR3 E;  4KHP E;  2N8X A;  2YSO A;  3ADJ A;  1A1I A;  2MKD A;  2V8Q B;  5AAS A;  1XMO E;  4OOG C;  2YTG A;  4LFA E;  2MKN A;  4DV3 E;  2LJU A;  2Q8U A;  2EPZ A;  1YUI A;  2NUG A;  4JI4 E;  4JI8 E;  1PJQ A;  4F6M A;  4LF6 E;  3JU0 A;  3VHT B;  5AC5 A;  2EOZ A;  5A6B D;  4F9C B;  1IQO A;  4DV4 E;  1IQS A;  5A2Q C;  1A1J A;  2DSY A;  2LT7 A;  3EPJ A;  2EM3 A;  4X9J A;  2CPN A;  1X48 A;  4BCA A;  1EKZ A;  3QG5 C;  1ZBT A;  2V89 A;  1AH5 A;  2M4I A;  2GHF A;  3ADL A;  4N4R B;  1WRJ A;  2LTS A;  5KL3 A;  2LV2 A;  1BB8 A;  2YT4 A;  3ZOQ B;  4GEQ B;  4ZYD A;  1PKP A;  4M0V A;  4JI1 E;  4NXM E;  2EM9 A;  2L8T A;  2EOM A;  2EJ4 A;  2EN1 A;  5AE2 A;  5A69 A;  3THO B;  2EQ1 A;  1G2D C;  2UXB E;  1N32 E;  4KWY A;  2EPK X;  4FK5 C;  1GTK A;  2YTP A;  1A1H A;  2EQ3 A;  1TF3 A;  4B3R E;  4TUG A;  2EOH A;  2YU5 A;  2N3G A;  2R76 A;  2JVA A;  2EMF A;  2RS6 A;  2I9I A;  2V83 A;  5LMN E;  2VE7 C;  2GPI A;  3MHH C;  4BC7 A;  2EMG A;  2NUF A;  1N36 E;  2YTJ A;  2EN6 A;  2L33 A;  4O43 A;  2R1F A;  4LF9 E;  5A6A A;  5LL6 R;  3BGH A;  1XNQ E;  3ECR A;  2F4V E;  2V87 A;  4AQY E;  3BF2 A;  1UBD C;  5AE1 A;  5CFF E;  3EPK A;  1F2I G;  4NHR A;  2EPP A;  5A6B A;  2A25 A;  1ZR9 A;  2V88 A;  1L4S A;  1PDA A;  2EM4 A;  2FTX B;  4R8O A;  1T38 A;  5IXM B;  4O24 A;  1X3C A;  4DMI A;  2EOS A;  2WZO A;  2EM6 A;  5A6K A;  2DMY A;  4BC9 A;  4F2J C;  3C4B A;  4KZS A;  2YRH A;  4L5N C;  2JPA A;  4DV6 E;  1YFH A;  1HNW E;  4L8N A;  2BB8 A;  4Q35 B;  4ZYG A;  1XMQ E;  4M9V C;  2DGC A;  3ADI A;  2M7Q A;  3FIG A;  2EOO A;  1FJG E;  3T1H E;  2EOE A;  1GQE A;  2YPN A;  2UUC E;  1X6F A;  1A1F A;  1DI2 A;  2YTE A;  4WXC A;  4TUI A;  3RMP A;  3BBG A;  2EMI A;  2JWO A;  3MHS C;  2LUQ A;  5KL5 A;  2F8B A;  2LRS A;  2EPN A;  3OML A;  2WBT A;  3EPH A;  1T4O A;  2DRP A;  1PJT A;  2EMC A;  2RQL A;  3T1Y E;  2J7J A;  2DB2 A;  4BMJ A;  1T4N A;  2VQE E;  2EMY A;  2RPC A;  2ELZ A;  1HNX E;  4F9A B;  2MDG A;  4BHC A;  1QU6 A;  2KHX A;  4JV5 E;  2LUP B;  5F3W A;  2EM5 A;  4B3T E;  3K6Q A;  2EOJ A;  3AV0 A;  2D9H A;  2EPX A;  4HEI A;  2CT1 A;  5AE3 A;  1UN6 B;  1RC7 A;  1QNT A;  2K4V A;  3EPL A;  4WXD A;  2YTF A;  3C6M A;  1IBM E;  4JYA E;  4WFT A;  1PJS A;  3HPZ A;  4WSP A;  3AUZ A;  1X5W A;  4JI7 E;  2L92 A;  2UUB E;  2EM7 A;  2EL4 A;  3L00 A;  1A1K A;  2EPU A;  2VF1 A;  3LLH A;  1YYW A;  2HGH A;  2M9A A;  3KWR A;  2UUA E;  4LFB E;  4DR1 E;  1EH7 A;  3F6G A;  1LLM C;  1BBO A;  2RSI A;  1J26 A;  1ZBQ A;  4JI3 E;  4GZN C;  2JR1 A;  2NA2 A;  1O0W A;  1YPN A;  2WBU A;  1IBK E;  4X8W A;  5KL4 A;  2CTD A;  2L6M A;  2EN4 A;  4DR4 E;  4R2S A;  2EZ6 A;  2ZM6 E;  4DR6 E;  1BBG A;  5T6J A;  2EL5 A;  3M99 B;  5FLX C;  3THN A;  1J5E E;  4B3S E;  2YRK A;  1X6E A;  4NZV A;  5ADZ A;  4B3M E;  1G2F C;  5BR8 E;  1EH8 A;  1I94 E;  2EPA A;  2VRD A;  5KL6 A;  1N3G A;  2YTD A;  4DV0 E;  2EM2 A;  4F9B B;  4R2E A;  4IS1 C;  3P1X A;  1YYO A;  3KZY A;  2V85 A;  1STU A;  5AC4 A;  4R2R A;  4WYQ B;  1KYQ A;  2EOR A;  3C4T A;  1YUJ A;  2DMI A;  2V86 A;  4LF7 E;  2YTQ A;  1YZ9 A;  1WJP A;  2DLQ A;  2EM8 A;  2NAB A;  5DNY A;  4NXN E;  3HXL A;  4ZYE A;  1DQ3 A;  4DR2 E;  2L2M A;  5KL2 A; 
#chains in the Genus database with same CATH homology
 4LF5 E;  4F9A B;  1UHZ A;  4JI2 E;  4JI5 E;  4DR7 E;  4JV5 E;  1QU6 A;  2KHX A;  2B3T B;  3IWB A;  5AE2 A;  2VQF E;  2LUP B;  3IWD A;  3LML A;  3HTX A;  2LJH A;  2B9D A;  5F3W A;  1N33 E;  4B3T E;  4M30 A;  3K6Q A;  3VYY A;  2UXB E;  3J7A G;  1RQ0 A;  5IWA E;  3AV0 A;  1N32 E;  2B7T A;  2KON A;  3VYX A;  2MDR A;  4X64 E;  2E1M A;  3DF6 A;  4BS9 A;  4B3R E;  4TUG A;  5AE3 A;  2N3G A;  4Q28 A;  2KOU A;  2JVA A;  3DJW A;  5LMU E;  5IT9 C;  1RC7 A;  2M1S A;  2RS6 A;  3JAM C;  4LF8 E;  4M2Z A;  4DUY E;  1YYK A;  4GKJ E;  2V83 A;  2RSM A;  5LMN E;  2K4V A;  2VE7 C;  2FGG A;  4BC7 A;  4DV1 E;  3IWC A;  1IBM E;  1X49 A;  4DV2 E;  2UU9 E;  2NUF A;  4JYA E;  1N36 E;  4WFT A;  2RS7 A;  2L33 A;  4I8O A;  2UXC E;  4LTY A;  2G7H A;  4F54 A;  4LF9 E;  3HPZ A;  5LL6 R;  2IHR 1;  4WSP A;  3AUZ A;  4P7D A;  2JY9 A;  1XNQ E;  2JOB A;  3MSW A;  4JI7 E;  2L92 A;  2F4V E;  3JTZ A;  2V87 A;  4AQY E;  2UUB E;  4LF4 E;  2MC6 A;  5AE1 A;  5CFF E;  4X66 E;  3OTO E;  2VF1 A;  3LLH A;  3J81 C;  2LTR A;  1HNZ E;  2LMZ A;  4YHH E;  1YYW A;  1WXR A;  4YY3 E;  1SR9 A;  3KWR A;  2V88 A;  3HQ1 A;  4LU9 A;  4R8O A;  2EWL A;  2FTX B;  2ODR D;  4WPY A;  2UUA E;  4K0K E;  4LFB E;  4DKK A;  4DR1 E;  1GZ6 A;  3F6G A;  4X62 E;  4X65 E;  1IBL E;  4R03 A;  2NUE A;  3H09 A;  4DMI A;  4NXM E;  4LFC E;  3J7Y p;  1WHQ A;  2WZO A;  4DR5 E;  1T4L B;  2DMY A;  4DR3 E;  4BC9 A;  1J26 A;  1ZBQ A;  4KHP E;  4JI3 E;  2ODR C;  2JR1 A;  2NA2 A;  1O0W A;  2L2N A;  3C4B A;  2E5L E;  2H36 X;  4P78 A;  4KZS A;  1IBK E;  3ADJ A;  4X8W A;  2B7V A;  2L6M A;  2V8Q B;  5AAS A;  1XMO E;  4L5N C;  3F6H A;  4DR4 E;  4DV6 E;  4OOG C;  1HNW E;  4L8N A;  2L2K B;  1FKA E;  4JI6 E;  2ZM6 E;  2RTX A;  2YZT A;  5T6J A;  4LFA E;  2EZ6 A;  4DV3 E;  1XMQ E;  4DR6 E;  5FLX C;  3ADI A;  2M7Q A;  3FIG A;  1J5E E;  4B3S E;  1FJG E;  3T1H E;  4OX9 E;  2NUG A;  4JI4 E;  1GQE A;  4JI8 E;  5ADZ A;  4DUZ E;  2MC5 A;  4B3M E;  4DV5 E;  4LF6 E;  2DIX A;  3JU0 A;  4GKK E;  1HR0 E;  5BR8 E;  2L3C A;  4J8Z A;  2UUC E;  1DI2 A;  1I94 E;  2L3J A;  4DV0 E;  4F9C B;  4F9B B;  4DV4 E;  4TUI A;  3RMP A;  5A2Q C;  1YYO A;  3P1X A;  2DSY A;  2N3H A;  2V85 A;  2JWO A;  1UIL A;  1WHN A;  2LUQ A;  1XNR E;  1STU A;  2CPN A;  3ADG A;  1X48 A;  4BCA A;  1EKZ A;  1ZBT A;  2LE2 A;  2V89 A;  2F8B A;  2LRS A;  4WYQ B;  2HHH E;  3OML A;  2M4I A;  3C4T A;  4BBY A;  4LF7 E;  2V86 A;  1YZ9 A;  2UXD E;  1T4O A;  2LBS B;  3ADL A;  3J80 C;  2LTS A;  3T1Y E;  2DB2 A;  4BMJ A;  5DNY A;  4NXN E;  1T4N A;  2VQE E;  3HXL A;  4DV7 E;  3VK6 A;  2YT4 A;  3ZOQ B;  4GEQ B;  4JI0 E;  1HNX E;  1PKP A;  2JOX A;  1DQ3 A;  2FV4 B;  3HPS A;  1X47 A;  4M0V A;  2L2M A;  4DR2 E;  1N34 E;  4JI1 E;  2L8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...