4Q28A

Crystal structure of the plectin 1 and 2 repeats of the human periplakin. northeast structural genomics consortium (nesg) target hr9083a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
110
structure length
110
Chain Sequence
GHHHHHHSHMRRSIVVIHPDTGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISVKGPNGESSVIHDRKSGKKFSIEEALQSGRLTPAQYDRYVNKDMSIQELAVLVSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Periplakin
publication title Crystal Structure of the Plectin 1 and 2 Repeats of Human Periplakin.
rcsb
source organism Homo sapiens
total genus 28
structure length 110
sequence length 110
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.780 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4q28A00
4Q28A
chains in the Genus database with same CATH superfamily
3EPJA 4DV3E 3J80C 4B3TE 5LLQA 2EMYA 5A2QC 2PRTA 1WRJA 3P1XA 2JPAA 2YRKA 4DV2E 4IJDA 4DV1E 4JI7E 4WSPA 3ADJA 1N34E 3VYXA 4DR7E 1ZAAC 1F2IG 1N32E 4DR2E 2EMFA 4YY3E 1SFEA 2L3CA 3DJWA 2RS7A 1ZR9A 4X65E 1PJTA 4MLQA 2DSYA 1UHZA 5A6BA 3HQ1A 2B9DA 1HR0E 1RMDA 4F6MA 2LBSB 1STUA 3AUZA 3J7Yp 2EWLA 1J26A 1G2FC 4WX9A 4RHBB 2ADRA 2YTOA 3KZZA 2V83A 2DGCA 2EPOA 2HC5A 5IXMB 2L33A 3JAMC 5AE1A 1IBLE 2LUPB 2LVHA 2ODRD 1B69A 1X5WA 3JU0A 2EL6A 4WFTA 4R2QA 1X6FA 2L6MA 3OTOE 3TQMA 1YYOA 5KL3A 3LLHA 4O43A 4O4KA 2G7HA 4MLVA 2ENHA 2JP9A 1AAYA 1NEIA 1T4LB 1JK2A 1T4NA 2HHHE 4M9VC 1FJGE 2DIXA 2EM8A 1IBKE 3DF6A 2N3HA 2I13A 2F8BA 2V88A 1AH5A 1NCSA 3IWBA 2E1MA 2RQLA 2MC5A 2VRDA 2M4IA 2VE7C 1A1JA 1MGTA 1RQ0A 3RMPA 2EM9A 4BHBA 4DUYE 3LMLA 2FV4B 1Z1BA 2JXPA 1X49A 4ZYDA 1YFHA 3K6QA 2KHXA 1YZ9A 4Q35B 4LF9E 4Q28A 1ZBQA 2EOOA 2LCEA 4JV5E 4LF7E 2YU5A 2CT1A 2YTIA 3HPSA 4L8NA 2RTXA 4O24A 2GLIA 3ZOQB 1GQEA 2EL5A 2YU8A 2EPCA 2YTDA 2VQEE 2EM2A 3T1HE 4JI3E 2EN6A 2DRPA 3J81C 1SR9A 5A6KA 4P78A 2YTPA 4BS9A 2EM0A 2HJJA 2EOJA 4F9BB 1WXRA 2EORA 2YTFA 4R2AA 3ADGA 1N3GA 2EOHA 4NXNE 1A1IA 4ZYHA 4JYAE 2EMGA 4X62E 3UK3C 2NUGA 4BC9A 5A6BD 1UBDC 3ADIA 2LE2A 3VK6A 2EJ4A 1LLMC 4L5NC 1WHNA 1G2DC 4LU9A 2YWQA 2L3JA 4BC7A 2RSIA 4DR5E 1T39A 2EMCA 2EOFA 4LF8E 2EOZA 1YPNA 2A25A 5LMUE 2ENAA 2NUEA 2EMIA 2EPLX 4DV6E 2H36X 1A1KA 2I9IA 4X8WA 2Q8UA 2YPNA 4F6NA 2EE8A 2K4VA 1A1LA 2JYAA 2EPZA 1T38A 2JWOA 3J7AG 2F4VE 4NXME 4BBYA 2LJHA 2DMYA 2ELZA 2EPUA 2DB2A 4GKKE 3MHSC 2V8QB 4DUZE 4J8ZA 4F9CB 4NHRA 2BB8A 2WZOA 2VQFE 2ELYA 4JI5E 3KWRA 3EPHA 2EP3A 4F54A 2EZ6A 2UU9E 2EOEA 1X6EA 2EPNA 3C6KA 4WXCA 5KL5A 3BBGA 2BBGA 4B3ME 2EN2A 1I94E 2RPCA 5IT9C 2EOQA 4JI1E 2UUCE 5BR8E 2M7QA 4DR4E 4LTYA 4X9JA 3L00A 2EMBA 3VYYA 5AE3A 2YTNA 4P7DA 1QU6A 3IWDA 1KJKA 2EMKA 2UUBE 2MKDA 3IWCA 2EMLA 4WPYA 2NA2A 4ZYGA 5A6JA 2EPAA 5AC5A 4M0VA 1GTKA 2EMXA 4JI8E 2GHFA 2YTEA 2EQ1A 3H09A 2EMZA 3OMLA 2YTJA 2EPRA 3C4BA 2CTDA 4WYQB 1XMOE 1EH7A 5LL6R 4OX9E 1N36E 3C4TA 4X64E 4GZNC 3BIDA 4R2DA 2VF1A 2ZM6E 3ECRA 2EM4A 4DV0E 1RC7A 4DR6E 4KZSA 5DNYA 2EN1A 2CSHA 2V86A 2E5LE 3QG5C 1IQSA 4TUIA 2UXCE 2NABA 4I8OA 2MDRA 2M1SA 1TN9A 2LTRA 2V89A 4RH8A 2ODRC 2LO3A 4R2EA 4BCAA 2EL4A 5F3WA 2LT7A 4LFCE 4KHPE 1EH6A 1BB8A 1PKPA 2YRMA 2EN3A 4DV7E 2EQ0A 4LFAE 5A6AA 2R1FA 1O0WA 1BBOA 2K7IA 4R8OA 2V87A 4BHCA 1YYKA 4R2RA 2WBSA 4R03A 3JTZA 1XNRE 3AV0A 2LTSA 4N4RB 4ZYEA 1EKZA 4JI4E 5KL7A 2UUAE 5TSEA 5KL6A 1FKAE 5KL2A 4LFBE 4M30A 4NZVA 2JR1A 2KONA 2KOUA 5IV8B 2EN7A 2EPXA 4JI0E 1PJQA 1WJPA 2L2KB 2JOBA 5KL4A 2DMIA 1ZU1A 4GKJE 2LMZA 2WBTA 5AE2A 2E72A 1KYQA 4WXDA 4R2PA 1IBME 3MSWA 4YHHE 1DQ3A 2J7JA 2EOSA 3EQ1A 1PJSA 4BMJA 1IQOA 2UXDE 1L4SA 4O5GA 2EQ3A 2LUQA 3ADLA 2YTQA 3MHHC 3BF2A 4F9AB 1QNTA 1N33E 5T6JA 2EM3A 2MDGA 5IWAE 1X3CA 1X47A 2EM7A 3BGHA 4B3RE 2UXBE 3C6MA 1T4OA 2R76A 5FLXC 2EN4A 2B3TB 1ZBTA 4M2ZA 2B7TA 3HXLA 1X6HA 3EPKA 4GEQB 4IS1C 2WBUA 2RSMA 2LJUA 1MEYC 4K0KE 1HNWE 2WCC3 4OOGC 1X48A 5ADZA 2EOIA 2IHR1 4DV5E 1YYWA 2EMAA 4R2SA 2MC6A 4DR1E 2D9HA 5AC4A 4B3SE 2EM6A 2EN8A 2JOXA 2YSOA 4AQYE 2JVAA 2RS6A 4LF6E 3F6GA 1XMQE 1IMUA 2FTXB 4KWYA 2L92A 4JI6E 4DMIA 1YSAC 4WSGA 3HPZA 1HNZE 2L8TA 2CPNA 2FGGA 2L2NA 1A1FA 4R2CA 1PDAA 2N3GA 1BBGA 2EOYA 3THNA 1XNQE 3THOB 2DLQA 1YUIA 4HTGA 2DLKA 1J5EE 1DGCA 1A1GA 1UILA 4X66E 2YT4A 2EPPA 5LMNE 5A69A 3VHTB 4JI2E 1DI2A 1P47A 4DKKA 2EOXA 2YRHA 2L2MA 2M9AA 1TF3A 2YZTA 2EPKX 2LRSA 3F6HA 2B7VA 2EOMA 2MKNA 5AASA 4F2JC 1WHQA 2EM5A 2YTGA 3EPLA 2V85A 3T1YE 3HTXA 4HEIA 4DR3E 1A1HA 1YUJA 1GZ6A 2HGHA 3FIGA 3M99B 2EPMX 2N8XA 2EMWA 4LF4E 4DV4E 2EMHA 2JY9A 1JK1A 4TUGA 3KZYA 5CFFE 2LV2A 1TF6A 1HNXE 1EH8A 2NUFA 2ENCA 2YSPA 2GPIA 4LF5E 4FK5C 1UN6B
chains in the Genus database with same CATH topology
4JI3E 4DV3E 1X47A 3J80C 4B3TE 4B3RE 2UXBE 3J81C 1SR9A 1T4OA 3H09A 5FLXC 1HNZE 4P78A 2B3TB 3OMLA 4BS9A 5A2QC 3C4BA 4WYQB 1XMOE 3P1XA 1ZBTA 4M2ZA 2B7TA 5LL6R 4F9BB 4OX9E 1WXRA 3HXLA 1N36E 3C4TA 4DV1E 4DV2E 4GEQB 4JI7E 3ADGA 4X64E 4NXNE 4WSPA 3ADJA 1N34E 3VYXA 4JYAE 2RSMA 4X62E 4DR7E 2VF1A 2NUGA 4BC9A 4K0KE 2ZM6E 1HNWE 3ADIA 1N32E 4OOGC 2LE2A 3VK6A 4DR2E 1X48A 4YY3E 4L5NC 2L3CA 3DJWA 2RS7A 4X65E 1WHNA 4DV0E 5ADZA 4LU9A 1RC7A 2L3JA 2IHR1 4BC7A 4KZSA 4DR6E 4DR5E 2DSYA 1UHZA 5DNYA 2V86A 2E5LE 3HQ1A 4DV5E 2B9DA 1HR0E 1YYWA 4LF8E 4TUIA 2LBSB 5LMUE 2UXCE 1STUA 3AUZA 3J7Yp 4I8OA 2NUEA 2MC6A 4DV6E 4DR1E 2EWLA 1J26A 2H36X 4B3SE 2MDRA 2M1SA 4X8WA 2LTRA 2V89A 2JOXA 2ODRC 2V83A 4BCAA 4AQYE 5F3WA 2JVAA 2RS6A 2K4VA 4LF6E 3F6GA 1XMQE 4LFCE 4KHPE 2L33A 3JAMC 1PKPA 2FTXB 5AE1A 1IBLE 2LUPB 2L92A 2ODRD 4DV7E 2JWOA 4JI6E 3J7AG 3JU0A 2F4VE 4WFTA 4DMIA 4NXME 4LFAE 3HPZA 4BBYA 2L6MA 2LJHA 2CPNA 2DMYA 2FGGA 2DB2A 2L2NA 2L8TA 3OTOE 1YYOA 4GKKE 2V8QB 3LLHA 1O0WA 4R8OA 2V87A 2G7HA 2N3GA 4J8ZA 4DUZE 4F9CB 1XNQE 1YYKA 1T4LB 2HHHE 1FJGE 1T4NA 2WZOA 2VQFE 2DIXA 4R03A 1IBKE 4JI5E 3JTZA 3KWRA 1J5EE 1XNRE 3AV0A 2LTSA 1UILA 4X66E 4F54A 3DF6A 2EZ6A 2N3HA 2UU9E 1EKZA 2YT4A 4JI4E 2F8BA 2V88A 5LMNE 2UUAE 3IWBA 4JI2E 1DI2A 4B3ME 2E1MA 4DKKA 1FKAE 2MC5A 4LFBE 2M4IA 2VE7C 4M30A 2JR1A 1I94E 2KONA 2KOUA 2L2MA 2YZTA 5IT9C 4JI1E 2LRSA 3F6HA 1RQ0A 3RMPA 4JI0E 2B7VA 2UUCE 2L2KB 5AASA 3LMLA 5BR8E 1WHQA 2FV4B 4DUYE 2M7QA 1X49A 4DR4E 4LTYA 2JOBA 3K6QA 2KHXA 1YZ9A 2V85A 4GKJE 2LMZA 4LF9E 5AE2A 3T1YE 3HTXA 3VYYA 4Q28A 5AE3A 4P7DA 1ZBQA 1IBME 3MSWA 4DR3E 1QU6A 4YHHE 1DQ3A 1GZ6A 3IWDA 3FIGA 4LF7E 4JV5E 2UUBE 4BMJA 3IWCA 2UXDE 4WPYA 2NA2A 3HPSA 2LUQA 4LF4E 3ADLA 4DV4E 4L8NA 2RTXA 2JY9A 4F9AB 4TUGA 5CFFE 1N33E 5T6JA 1HNXE 4M0VA 1GQEA 3ZOQB 2NUFA 4LF5E 5IWAE 4JI8E 2VQEE 3T1HE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q28 A; 
#chains in the Genus database with same CATH topology
 3EPJ A;  4DV3 E;  3J80 C;  4B3T E;  5LLQ A;  2EMY A;  5A2Q C;  2PRT A;  1WRJ A;  3P1X A;  2JPA A;  2YRK A;  4DV2 E;  4IJD A;  4DV1 E;  4JI7 E;  4WSP A;  3ADJ A;  1N34 E;  3VYX A;  4DR7 E;  1ZAA C;  1F2I G;  1N32 E;  4DR2 E;  2EMF A;  4YY3 E;  1SFE A;  2L3C A;  3DJW A;  2RS7 A;  1ZR9 A;  4X65 E;  1PJT A;  4MLQ A;  2DSY A;  1UHZ A;  5A6B A;  3HQ1 A;  2B9D A;  1HR0 E;  1RMD A;  4F6M A;  2LBS B;  1STU A;  3AUZ A;  3J7Y p;  2EWL A;  1J26 A;  1G2F C;  4WX9 A;  4RHB B;  2ADR A;  2YTO A;  3KZZ A;  2V83 A;  2DGC A;  2EPO A;  2HC5 A;  5IXM B;  2L33 A;  3JAM C;  5AE1 A;  1IBL E;  2LUP B;  2LVH A;  2ODR D;  1B69 A;  1X5W A;  3JU0 A;  2EL6 A;  4WFT A;  4R2Q A;  1X6F A;  2L6M A;  3OTO E;  3TQM A;  1YYO A;  5KL3 A;  3LLH A;  4O43 A;  4O4K A;  2G7H A;  4MLV A;  2ENH A;  2JP9 A;  1AAY A;  1NEI A;  1T4L B;  1JK2 A;  1T4N A;  2HHH E;  4M9V C;  1FJG E;  2DIX A;  2EM8 A;  1IBK E;  3DF6 A;  2N3H A;  2I13 A;  2F8B A;  2V88 A;  1AH5 A;  1NCS A;  3IWB A;  2E1M A;  2RQL A;  2MC5 A;  2VRD A;  2M4I A;  2VE7 C;  1A1J A;  1MGT A;  1RQ0 A;  3RMP A;  2EM9 A;  4BHB A;  4DUY E;  3LML A;  2FV4 B;  1Z1B A;  2JXP A;  1X49 A;  4ZYD A;  1YFH A;  3K6Q A;  2KHX A;  1YZ9 A;  4Q35 B;  4LF9 E;  4Q28 A;  1ZBQ A;  2EOO A;  2LCE A;  4JV5 E;  4LF7 E;  2YU5 A;  2CT1 A;  2YTI A;  3HPS A;  4L8N A;  2RTX A;  4O24 A;  2GLI A;  3ZOQ B;  1GQE A;  2EL5 A;  2YU8 A;  2EPC A;  2YTD A;  2VQE E;  2EM2 A;  3T1H E;  4JI3 E;  2EN6 A;  2DRP A;  3J81 C;  1SR9 A;  5A6K A;  4P78 A;  2YTP A;  4BS9 A;  2EM0 A;  2HJJ A;  2EOJ A;  4F9B B;  1WXR A;  2EOR A;  2YTF A;  4R2A A;  3ADG A;  1N3G A;  2EOH A;  4NXN E;  1A1I A;  4ZYH A;  4JYA E;  2EMG A;  4X62 E;  3UK3 C;  2NUG A;  4BC9 A;  5A6B D;  1UBD C;  3ADI A;  2LE2 A;  3VK6 A;  2EJ4 A;  1LLM C;  4L5N C;  1WHN A;  1G2D C;  4LU9 A;  2YWQ A;  2L3J A;  4BC7 A;  2RSI A;  4DR5 E;  1T39 A;  2EMC A;  2EOF A;  4LF8 E;  2EOZ A;  1YPN A;  2A25 A;  5LMU E;  2ENA A;  2NUE A;  2EMI A;  2EPL X;  4DV6 E;  2H36 X;  1A1K A;  2I9I A;  4X8W A;  2Q8U A;  2YPN A;  4F6N A;  2EE8 A;  2K4V A;  1A1L A;  2JYA A;  2EPZ A;  1T38 A;  2JWO A;  3J7A G;  2F4V E;  4NXM E;  4BBY A;  2LJH A;  2DMY A;  2ELZ A;  2EPU A;  2DB2 A;  4GKK E;  3MHS C;  2V8Q B;  4DUZ E;  4J8Z A;  4F9C B;  4NHR A;  2BB8 A;  2WZO A;  2VQF E;  2ELY A;  4JI5 E;  3KWR A;  3EPH A;  2EP3 A;  4F54 A;  2EZ6 A;  2UU9 E;  2EOE A;  1X6E A;  2EPN A;  3C6K A;  4WXC A;  5KL5 A;  3BBG A;  2BBG A;  4B3M E;  2EN2 A;  1I94 E;  2RPC A;  5IT9 C;  2EOQ A;  4JI1 E;  2UUC E;  5BR8 E;  2M7Q A;  4DR4 E;  4LTY A;  4X9J A;  3L00 A;  2EMB A;  3VYY A;  5AE3 A;  2YTN A;  4P7D A;  1QU6 A;  3IWD A;  1KJK A;  2EMK A;  2UUB E;  2MKD A;  3IWC A;  2EML A;  4WPY A;  2NA2 A;  4ZYG A;  5A6J A;  2EPA A;  5AC5 A;  4M0V A;  1GTK A;  2EMX A;  4JI8 E;  2GHF A;  2YTE A;  2EQ1 A;  3H09 A;  2EMZ A;  3OML A;  2YTJ A;  2EPR A;  3C4B A;  2CTD A;  4WYQ B;  1XMO E;  1EH7 A;  5LL6 R;  4OX9 E;  1N36 E;  3C4T A;  4X64 E;  4GZN C;  3BID A;  4R2D A;  2VF1 A;  2ZM6 E;  3ECR A;  2EM4 A;  4DV0 E;  1RC7 A;  4DR6 E;  4KZS A;  5DNY A;  2EN1 A;  2CSH A;  2V86 A;  2E5L E;  3QG5 C;  1IQS A;  4TUI A;  2UXC E;  2NAB A;  4I8O A;  2MDR A;  2M1S A;  1TN9 A;  2LTR A;  2V89 A;  4RH8 A;  2ODR C;  2LO3 A;  4R2E A;  4BCA A;  2EL4 A;  5F3W A;  2LT7 A;  4LFC E;  4KHP E;  1EH6 A;  1BB8 A;  1PKP A;  2YRM A;  2EN3 A;  4DV7 E;  2EQ0 A;  4LFA E;  5A6A A;  2R1F A;  1O0W A;  1BBO A;  2K7I A;  4R8O A;  2V87 A;  4BHC A;  1YYK A;  4R2R A;  2WBS A;  4R03 A;  3JTZ A;  1XNR E;  3AV0 A;  2LTS A;  4N4R B;  4ZYE A;  1EKZ A;  4JI4 E;  5KL7 A;  2UUA E;  5TSE A;  5KL6 A;  1FKA E;  5KL2 A;  4LFB E;  4M30 A;  4NZV A;  2JR1 A;  2KON A;  2KOU A;  5IV8 B;  2EN7 A;  2EPX A;  4JI0 E;  1PJQ A;  1WJP A;  2L2K B;  2JOB A;  5KL4 A;  2DMI A;  1ZU1 A;  4GKJ E;  2LMZ A;  2WBT A;  5AE2 A;  2E72 A;  1KYQ A;  4WXD A;  4R2P A;  1IBM E;  3MSW A;  4YHH E;  1DQ3 A;  2J7J A;  2EOS A;  3EQ1 A;  1PJS A;  4BMJ A;  1IQO A;  2UXD E;  1L4S A;  4O5G A;  2EQ3 A;  2LUQ A;  3ADL A;  2YTQ A;  3MHH C;  3BF2 A;  4F9A B;  1QNT A;  1N33 E;  5T6J A;  2EM3 A;  2MDG A;  5IWA E;  1X3C A;  1X47 A;  2EM7 A;  3BGH A;  4B3R E;  2UXB E;  3C6M A;  1T4O A;  2R76 A;  5FLX C;  2EN4 A;  2B3T B;  1ZBT A;  4M2Z A;  2B7T A;  3HXL A;  1X6H A;  3EPK A;  4GEQ B;  4IS1 C;  2WBU A;  2RSM A;  2LJU A;  1MEY C;  4K0K E;  1HNW E;  2WCC 3;  4OOG C;  1X48 A;  5ADZ A;  2EOI A;  2IHR 1;  4DV5 E;  1YYW A;  2EMA A;  4R2S A;  2MC6 A;  4DR1 E;  2D9H A;  5AC4 A;  4B3S E;  2EM6 A;  2EN8 A;  2JOX A;  2YSO A;  4AQY E;  2JVA A;  2RS6 A;  4LF6 E;  3F6G A;  1XMQ E;  1IMU A;  2FTX B;  4KWY A;  2L92 A;  4JI6 E;  4DMI A;  1YSA C;  4WSG A;  3HPZ A;  1HNZ E;  2L8T A;  2CPN A;  2FGG A;  2L2N A;  1A1F A;  4R2C A;  1PDA A;  2N3G A;  1BBG A;  2EOY A;  3THN A;  1XNQ E;  3THO B;  2DLQ A;  1YUI A;  4HTG A;  2DLK A;  1J5E E;  1DGC A;  1A1G A;  1UIL A;  4X66 E;  2YT4 A;  2EPP A;  5LMN E;  5A69 A;  3VHT B;  4JI2 E;  1DI2 A;  1P47 A;  4DKK A;  2EOX A;  2YRH A;  2L2M A;  2M9A A;  1TF3 A;  2YZT A;  2EPK X;  2LRS A;  3F6H A;  2B7V A;  2EOM A;  2MKN A;  5AAS A;  4F2J C;  1WHQ A;  2EM5 A;  2YTG A;  3EPL A;  2V85 A;  3T1Y E;  3HTX A;  4HEI A;  4DR3 E;  1A1H A;  1YUJ A;  1GZ6 A;  2HGH A;  3FIG A;  3M99 B;  2EPM X;  2N8X A;  2EMW A;  4LF4 E;  4DV4 E;  2EMH A;  2JY9 A;  1JK1 A;  4TUG A;  3KZY A;  5CFF E;  2LV2 A;  1TF6 A;  1HNX E;  1EH8 A;  2NUF A;  2ENC A;  2YSP A;  2GPI A;  4LF5 E;  4FK5 C;  1UN6 B; 
#chains in the Genus database with same CATH homology
 4JI3 E;  4DV3 E;  1X47 A;  3J80 C;  4B3T E;  4B3R E;  2UXB E;  3J81 C;  1SR9 A;  1T4O A;  3H09 A;  5FLX C;  1HNZ E;  4P78 A;  2B3T B;  3OML A;  4BS9 A;  5A2Q C;  3C4B A;  4WYQ B;  1XMO E;  3P1X A;  1ZBT A;  4M2Z A;  2B7T A;  5LL6 R;  4F9B B;  4OX9 E;  1WXR A;  3HXL A;  1N36 E;  3C4T A;  4DV1 E;  4DV2 E;  4GEQ B;  4JI7 E;  3ADG A;  4X64 E;  4NXN E;  4WSP A;  3ADJ A;  1N34 E;  3VYX A;  4JYA E;  2RSM A;  4X62 E;  4DR7 E;  2VF1 A;  2NUG A;  4BC9 A;  4K0K E;  2ZM6 E;  1HNW E;  3ADI A;  1N32 E;  4OOG C;  2LE2 A;  3VK6 A;  4DR2 E;  1X48 A;  4YY3 E;  4L5N C;  2L3C A;  3DJW A;  2RS7 A;  4X65 E;  1WHN A;  4DV0 E;  5ADZ A;  4LU9 A;  1RC7 A;  2L3J A;  2IHR 1;  4BC7 A;  4KZS A;  4DR6 E;  4DR5 E;  2DSY A;  1UHZ A;  5DNY A;  2V86 A;  2E5L E;  3HQ1 A;  4DV5 E;  2B9D A;  1HR0 E;  1YYW A;  4LF8 E;  4TUI A;  2LBS B;  5LMU E;  2UXC E;  1STU A;  3AUZ A;  3J7Y p;  4I8O A;  2NUE A;  2MC6 A;  4DV6 E;  4DR1 E;  2EWL A;  1J26 A;  2H36 X;  4B3S E;  2MDR A;  2M1S A;  4X8W A;  2LTR A;  2V89 A;  2JOX A;  2ODR C;  2V83 A;  4BCA A;  4AQY E;  5F3W A;  2JVA A;  2RS6 A;  2K4V A;  4LF6 E;  3F6G A;  1XMQ E;  4LFC E;  4KHP E;  2L33 A;  3JAM C;  1PKP A;  2FTX B;  5AE1 A;  1IBL E;  2LUP B;  2L92 A;  2ODR D;  4DV7 E;  2JWO A;  4JI6 E;  3J7A G;  3JU0 A;  2F4V E;  4WFT A;  4DMI A;  4NXM E;  4LFA E;  3HPZ A;  4BBY A;  2L6M A;  2LJH A;  2CPN A;  2DMY A;  2FGG A;  2DB2 A;  2L2N A;  2L8T A;  3OTO E;  1YYO A;  4GKK E;  2V8Q B;  3LLH A;  1O0W A;  4R8O A;  2V87 A;  2G7H A;  2N3G A;  4J8Z A;  4DUZ E;  4F9C B;  1XNQ E;  1YYK A;  1T4L B;  2HHH E;  1FJG E;  1T4N A;  2WZO A;  2VQF E;  2DIX A;  4R03 A;  1IBK E;  4JI5 E;  3JTZ A;  3KWR A;  1J5E E;  1XNR E;  3AV0 A;  2LTS A;  1UIL A;  4X66 E;  4F54 A;  3DF6 A;  2EZ6 A;  2N3H A;  2UU9 E;  1EKZ A;  2YT4 A;  4JI4 E;  2F8B A;  2V88 A;  5LMN E;  2UUA E;  3IWB A;  4JI2 E;  1DI2 A;  4B3M E;  2E1M A;  4DKK A;  1FKA E;  2MC5 A;  4LFB E;  2M4I A;  2VE7 C;  4M30 A;  2JR1 A;  1I94 E;  2KON A;  2KOU A;  2L2M A;  2YZT A;  5IT9 C;  4JI1 E;  2LRS A;  3F6H A;  1RQ0 A;  3RMP A;  4JI0 E;  2B7V A;  2UUC E;  2L2K B;  5AAS A;  3LML A;  5BR8 E;  1WHQ A;  2FV4 B;  4DUY E;  2M7Q A;  1X49 A;  4DR4 E;  4LTY A;  2JOB A;  3K6Q A;  2KHX A;  1YZ9 A;  2V85 A;  4GKJ E;  2LMZ A;  4LF9 E;  5AE2 A;  3T1Y E;  3HTX A;  3VYY A;  4Q28 A;  5AE3 A;  4P7D A;  1ZBQ A;  1IBM E;  3MSW A;  4DR3 E;  1QU6 A;  4YHH E;  1DQ3 A;  1GZ6 A;  3IWD A;  3FIG A;  4LF7 E;  4JV5 E;  2UUB E;  4BMJ A;  3IWC A;  2UXD E;  4WPY A;  2NA2 A;  3HPS A;  2LUQ A;  4LF4 E;  3ADL A;  4DV4 E;  4L8N A;  2RTX A;  2JY9 A;  4F9A B;  4TUG A;  5CFF E;  1N33 E;  5T6J A;  1HNX E;  4M0V A;  1GQE A;  3ZOQ B;  2NUF A;  4LF5 E;  5IWA E;  4JI8 E;  2VQE E;  3T1H E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...