4WX9A

Crystal structure of mycobacterium tuberculosis ogt in complex with dna
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
164
structure length
161
Chain Sequence
VHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTSRTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALLELEKSRAPADLTLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA (5'-D(*GP*CP*CP*AP*TP*GP*(E1X)P*CP*TP*AP*GP*TP*A)-3')
publication title Crystal structure of Mycobacterium tuberculosis O6-methylguanine-DNA methyltransferase protein clusters assembled on to damaged DNA.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 42
structure length 161
sequence length 164
chains with identical sequence B, C
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2014-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4wx9A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4wx9A01
2A5YB 5FB2A 1MJAA 3C18A 1TW3A 1DUXC 1CF7B 4BHBA 4D0PA 5AIPA 1X3UA 4WF2A 4PCQA 3WGGA 3RIRA 2HFHA 2TDXA 2JSCA 2H27A 2YPRA 3CUQB 2KJCA 2XKPA 3H92A 3V4GA 3NEUA 2KJBA 3KEOA 5LGUA 3CUQC 2J5PA 4L18B 1IN7A 2GAUA 3TDUC 4NQWA 5CYVA 1U8RA 2QENA 2QQBA 4M71A 2CGPA 4A0YA 4MEYF 3L2CA 1IAWA 2GXBA 5BQTA 2Z3YA 4BYYA 1W5TA 3IKVA 3KEQA 2OQRA 1USSA 1Y0UA 1KU3A 1BC7C 5DUIA 1W7PB 3QAHA 2RN7A 4WXHA 4LD5A 3LSTA 3ZMSA 2BE5F 5JFRA 2OU2A 2EA2A 1B4AA 3HTSB 4XBFA 1J75A 4YFXF 3F23A 5L3EA 1F4KA 3HHHA 1ZYRF 2EJRA 4LG0B 4RB2C 2F5FA 4NB5A 3KCCA 1HQCA 2XRNA 4M9SA 1TQIA 3I4PA 1E17A 2HQRA 4OOIA 3I5UA 5ILUA 2GIVA 4ZYDA 2DBBA 3DXJF 5E8IA 3RKYA 4R79A 1P2FA 3LQQA 1KYZA 2K27A 2MLKA 3EDPA 2ISYA 2J5OA 2WV0A 4KIGA 2ACJA 1G4DA 3RI4A 4ETSA 2C6YA 2QBYB 3LA7A 5AONA 2P7CB 5JHUA 1AOYA 3KETA 5E1WA 5LHGA 4HV6A 5K5RA 3IRQA 2RGVA 1HKQA 4U7DA 4BXUA 2M45A 1YW7A 3M1EA 1HW5A 2A69F 5D5VB 4U7BA 1OPCA 4LJZF 1DPRA 1FYLA 1R5GA 1YQAA 1GXPA 3I59B 3VOEA 2O03A 3GX4X 1ZG1A 2QWWA 1T39A 1R1VA 3I0TA 1DDNA 2B0LA 1R00A 3F8BA 2M5WA 5FD5A 1B9NA 1S3JA 4MTDA 4CO8A 3ABTA 2Z33A 5J6XA 3ERED 4B09A 1ZG5A 4UUVA 1HKSA 1G3WA 4HA8A 3J81Z 3ZMZA 1XGOA 5ILSA 4IVNA 1R58A 2ETHA 4Q48A 4LB5A 2QLZA 3O2PE 4EVIA 1J0RA 4EMSA 4RGXA 2OQGA 4EJVA 5D6EA 3ZMUA 3LFKA 1USTA 4LFUA 2DLLA 2IA1A 5HVQC 1FZPB 3MZYA 4YG2F 4L9VA 5ERIA 2K4JA 3K1MA 1XSDA 2DPUA 1ONVA 3GFJA 3GFIA 5D6FA 3RKXA 2IT0A 1P4WA 1KU7A 5D5WB 1EH7A 2CG4A 2P5VA 1ZG3A 2FBIA 1HKTA 2DQLA 5LLQA 2UZKA 3L00A 4FT8A 3QRFF 5LEKA 2A6HF 1AWCA 1RNLA 4KUMA 1MJBA 3G3ZA 4OIRF 3NRVA 4MHGA 5JVTA 3E5UA 3BPVA 1TNTA 1BM9A 4UVCA 5LRSA 2RKHA 3P9KA 4Y15A 4O6JA 1PP7U 4BNCA 1BBYA 5DUKA 2P4WA 2XASA 2OZ6A 2KIUA 2H09A 1LQ1A 1HBXG 2A68F 3WODF 5HOOA 2A07F 2PJPA 2H94A 4LK1F 4S05A 2Z5UA 2PEXA 4BAYA 2F5EA 2QQAA 1R1UA 3WTWC 1QBJA 1TW2A 4HAMA 4IF4A 2K7LA 1I1GA 2ZMEA 3M8FA 4EJUA 2GA1A 3MZHA 2FEZA 1RUNA 3R6SA 3TQNA 1XGNA 3ZN1A 3BJ6A 1ODDA 2ZO4A 3HSRA 4P96A 5IT9K 2VC1A 1XSXA 1BC8C 4M9XA 1WI9A 4EV0A 2DU9A 2H6CA 3P9CA 2FNPA 3GZ5A 1DPUA 2IRFG 4GCVA 4HX7A 4LGWA 3ELKA 3RPUA 5HLGA 2PI0A 2V1UA 2G7HA 3TO7A 2EFOA 2Y48A 1BI0A 2XKOA 4M72A 5E20A 4R8HA 2W25A 3JAMK 2L4AA 4N9HA 2EV5A 4RB0A 2CSOA 3LAPA 2IPQX 4I2OA 1R36A 4ESBA 1XDUA 4CICA 3ZPLA 2A61A 1QQIA 4Q5SF 1HW1A 4LLLA 3D0SA 3QP6A 5HDGA 3QPHA 2R7DA 4L0YB 4EQQA 1R23A 3C7JA 3WU0A 4GYIA 2HTSA 3COAC 2CFXA 2ZJ2A 1R22A 1O7FA 3MFKA 4U88A 4YIIA 5LGTA 4KYWA 1EH6A 3IL2A 4MGRA 3E6MA 4M6YA 2AS5F 3HYIA 4FX0A 4OMYA 2QM3A 5LEJA 3J80Z 3F8NA 4P9FA 2HZTA 4HQEA 2HYGD 1XMKA 4G8XA 5J8CA 1SD7A 3BDDA 3EQLF 1D8KA 3JTGA 3TDZC 3TGNA 4QLCU 5E17F 3WTSC 2EK5A 3WTYC 4HYEA 2QBYA 3LAJA 1V4RA 1SD6A 1MKMA 3KE2A 1XGSA 2WTEA 2ZNYA 3ZMVA 1O57A 4JQFA 5LHIA 2RNJA 1Z05A 4O3MA 3ECOA 3RDIA 3GFMA 1OYIA 4PDKA 3DV8A 3ECHA 4ON0A 4BHPA 3FMSA 3FZVA 5JR3A 2A6EF 1U5TA 2YX4A 5ILVA 5ICFA 4ENMA 5H20A 4IRHA 3V7RA 2E7WA 5H6QA 4A6DA 1LDKB 2Y75A 4I7HA 5K5OA 1RZ4A 4EGZA 4UNOA 3E97A 4I0BA 2JTVA 2ZMEB 4UHTA 3BP8A 1TQPA 2JPCA 4P9UA 3ISPA 4GXOA 3DP7A 3BJAA 1O3SA 2FRHA 3VB2A 4XSZF 1FT9A 5CVRA 2D1VA 3V8LA 4A0ZA 5DCMA 3ZMTA 1T6SA 2UXXA 3ZQ7A 4N9IA 5A2QZ 2CO5A 1HSJA 4YIFA 2E1NA 3ZP5A 2PQ8A 5JI6A 2VBYA 4EJTA 1KA8A 1OR7A 2QQ9A 2DK8A 4A0XA 2BEOA 3U2RA 4ENJA 2DT5A 2OBPA 2G7UA 4EJWA 2LDUA 4ZYHA 4KT5C 2RV8A 3O3KA 5FLXZ 1BIBA 3MWMA 3N97A 1KGSA 1BI3A 1ON2A 2VC0A 3KP7A 2EV0A 1HXDA 2M1BA 1IF1A 4M6XA 2V79A 2VXZA 1H9GA 1H0MA 1ZARA 2QVOA 1UCRA 2FXAA 3O6BB 5L3FA 2VT2A 2V6CA 3LWFA 2XUBA 3DPTA 1SD5A 2O0YA 5K5QA 2HEOA 2E7XA 3DQVC 1XMAA 3Q9SA 1YW9A 3QOPA 1GHCA 4GGGA 1P92A 4FX4A 4PZJA 1G6NA 2PN6A 4IRGA 1I1SA 1O3QA 2PLYA 4HDVA 3KFWX 1LEAA 1OYYA 3BOQA 2R3SA 4WXDA 4IHTA 3FM5A 3ROUA 1OMIA 1MGTA 3JSOA 1FY7A 1FSHA 1WQ2A 1T98A 1SFXA 3HIFA 3PQKA 2NNYA 4XLNF 4WK8F 2Z9OA 1YTYA 1SFEA 4ESFA 1IXSB 4Z2YA 3FMQA 2QZ8A 2LNBA 4A2UA 1RI7A 4KN4X 5ICEA 1VTNC 1KQ8A 1UB9A 3QU3A 4ZZDA 4IXAA 3FF5A 4ZH4F 4A5MA 2H6BA 2O8XA 2L02A 1U5TB 3W6JB 1BIAA 2OZUA 4M73A 1QGPA 3C3WA 1U5TC 5EEGA 1XN7A 4NHJA 2NRAC 4P55A 4RAZA 3DKWA 1DP7P 3ABUA 3HSFA 3RYPA 1XDSA 1FWZA 4R1HA 2Y0MA 1KU2A 3TOAA 2NS0A 5HDKA 1P4XA 2EFQA 3DF8A 5D8KB 1XCVA 1ZRFA 2XAGA 4P5OA 3T8TA 2QUFA 3V8JA 4RGRA 2ZKZA 3IWFA 5DCMB 4M74A 4BQAA 3TO6A 2FQ3A 4QWQA 2KIFA 1FP1D 3FXUA 2LF7A 4G6DA 3KP3A 2EV6A 3MQ0A 5IT9Z 1XB4A 3ZN0A 3I53A 1FSEA 1IN5A 3E6CC 4RGUA 2DAOA 3SFZA 5HLIA 3PFIA 1TNSA 1YW8A 4G9YA 2G9WA 3JSPA 3QU6A 1XSVA 1CGPA 1D5VA 1PUEE 3HRSA 2ELHA 3SQNA 5FGMA 2K86A 1FP2A 3JAMZ 4AIHA 3KZYA 5L3DA 4BHCA 4IRIA 3TOBA 2DQRA 5HS9A 1TQMA 5HDNA 2DI3A 2HOEA 2IA0A 1I5ZA 1JE8A 4LMYA 2DPDA 3MCZA 3GFLA 3H3UA 1T2KA 1P6RA 1JHFA 3HTUA 4UVBA 4UV9A 3ML6A 1ZRDA 2XROA 2DO7A 2FBHA 1REPC 2YU3A 3FXQA 4CGZA 1L3LA 3ULQB 2HQNA 4WXCA 4ZYEA 2MH2A 1J7KA 3Q5FA 2LSOA 5D5XB 3PQJA 4ESJA 4KMUX 4UV8A 1F5TA 4CZZA 2HWVA 3KP2A 3KP6A 2AXLA 5DCFA 2JT1A 5DDGA 1ZAOA 1R7JA 2NYXA 1G3TA 4DNCA 4B8XA 5DV5A 5BOXA 2XVCA 1C0WA 3GW2A 4KDPA 2HTJA 2ZCWA 2ADUA 2YSRA 1JXSA 4AIJA 1Z6TA 3B02A 1PDNC 1YS6A 1IRGA 1IXRC 2VE9A 4KIBA 2ZFWA 2D2WA 3REOA 1D3YA 1S7AA 2W24A 3HRTA 3VODA 1J5YA 2MBFA 3IC7A 2VOOA 3I54A 4BH9A 4OMZA 3WG9A 2L54A 2F5CA 5E1XA 4I09A 5J8FA 4G7HF 1I27A 1J2XA 2HYFA 3HRUA 3WTXC 1LEBA 3L7WA 1K79A 2KIMA 3R0JA 3IKTA 5KK1A 1KYWA 3HUGA 1I6XA 5LHHA 4IPAA 1J59A 4MTEA 3GO5A 4EGYA 1QZYA 4HOBA 4CDGA 2R7FA 4AWXB 4Q4ZF 5D5UB 2W57A 2IP2A 1BOAA 1IXCA 1FBUA 2RDPA 3GWZA 4GYGA 4WX9A 4HF2A 3HSEA 2LF8A 3F21A 3HOTA 4HLYA 2IJLA 3Q9VA 3U9GA 3MEXA 1O7LA 2XIGA 5L3BA 3CO7C 1FBSA 2Q2EA 4RB3C 3TO9A 5K1YA 2PG4A 2W85A 1UFMA 3E3VA 4RB1A 3OV8A 5E8GA 3GUDA 4L0ZB 3ZMDA 2BGCA 3VEPA 2VE8A 3VFZA 3EYYA 5HLHA 1WWXA 3KP4A 1GXQA 3K2ZA 3GVAA 4MQVA 2FOKA 2VN2A 4OIOF 2PMHA 1U78A 1XD7A 3E5XA 1MD0A 4KMFA 5KVRA 2VOPA 3F6VA 5F6FA 2OAZA 1TBXA 3LA3A 4CYDA 5LRRA 2IW5A 2W84A 2WC2A 3I58A 3NQOA 5CVIA 3RPQA 5BPIA 3W6KB 4RS8A 1STZA 4WCGA 1F9NA 4CHUA 3WTTC 2P6TA 4HZFA 4HLXA 2HKXA 5DD8A 1LJ9A 4HBLA 2GA2A 4TV7A 4A6EA 2YR2A 5F1RA 2KRFA 2FA5A 4JBAA 2VT3A 1B9MA 1KQ9A 2RQPA 1BN5A 6PAXA 3IRRA 1YYVA 4E70A 3CDHA 1ZLKA 4AD9A 3S2WA 2FNAA 1FC3A 5D4SA 2ISZA 2NNNA 1B6AA 1XCBA 3WE3A 3E6DA 3R4KA 3WGIA 1TLHB 1ZHFA 5ICGA 1BI2A 4U0YA 1HW2A 4AIKA 1T0FA 3GEZA 5FO5A 2JPBA 3WTUC 3J80K 3SXYA 2OA4A 1RUOA 1OYWA 3WGHA 3H3ZA 1SD4A 3M9AA 2FE3A 3FMRA 3HHGA 3BWGA 2DFIA 1IZ1A 1EH8A 1IUYA 5E18F 3GXOA 2CW0F 3KP5A 4ZZLA 4HV5A 4Y13A 2PMUA 3IWZA 4ENKA 3LQRA 4OIQF 3JTHA 2XAJA 2EWNA 2OD5A 1XGMA 3RKWA 1D8JA 2FSWA 3T0YA 1IN4A 2M30A 2ESHA 4LB6B 3HRMA 2EFPA 1QZZA 2L01A 3F6OA 4HW0A 2CWEA 4OINF 4EM0B 4KN7X 1OKRA 2O6GE 2K4BA 5FFXA 3LA2A 3CLOA 1K7AA 2ZXJA 1A04A 5AIQA 5IT3A 1FNNA 1JHHA 5HS7A 4UVAA 4IJAA 1YG2A 1ON1A 2DK5A 1U6GA 3V8KA 2JZYA 3I64A 3FM3A 3SHFA 2XAHA 5BS6A 4O5VA 2Z99A 4ASNA 4EM2A 1KQ0A 3FXRA 2V1DA 3KZZA 4CXFA 4OU0A 2EFWA 2GQQA 4KFCA 5A2QK 2X4HA 2HS5A 2D1HA 4G94A 5FD6A 1U2WA 3CTAA 4RAYA 1YIOA 4LK0F 1G3YA 3T5XA 2A3SA 4KNYA 5ICCA 2GWRA 4EM1A 3BROA 1QNTA 1ZGJA 4OIPF 3K1NA 5FLXK 4U0VA 2RC4A 3WTZA 3U1DA 2VONA 3F8CA 1FPQA 4MEXF 3GLXA 3GYHX 1Z7UA 1IRFA 5D4RA 1WSUA 1K78A 1MZBA 2MA3A 2FF4A 3BJOA 2BBYA 3OOPA 5ED4A 3M7GA 2EFNA 4MNUA 2DTRA 3K1PA 5CVJA 3P9IA 4FHTA 3N4MA 4HF1A 2O3FA 2ESNA 3QP5A 2UWMA 3SZPA 2MC3A 5L3GA 3D5LA 4HF0A 1NHAA 3FHZA 2XAFA 2MLGA 2FMLA 2WWYA 5BMZA 5CVUA 3DPLC 2NAZA 4KIFA 1S29A 2HDCA 1QPMA 2MD5A 5EEHA 4A5NA 1R1TA 5CVVA 4L5IA 1SMYF 2FU4A 2L3DA 3RYRA 5F64A 2FBKA 3R61A 2V9VA 3FX3A 4DQ2A 3B73A 3RTRA 1W5SA 2DW4A 2M87A 5D8LB 3AAFA 3F22A 4KA4A 5L3CA 4HX4A 3WE2A 5DYMA 3F8FA 5CLSA 1B1BA 2XGXA 5FFZA 3EYIA 1YS7A 2EB7A 3BPXA 3K9TA 2O61A 3IHUA 4YFKF 4I02A 4XLPF 2UXNA 3J81K 1UHWA 3P7NA 1H9TA 1Z9CA 3F8MA 1ZREA 1WRJA 4Q47A 2VBWA 1FOKA 3I71A 3R60A 1MDMA 2ZNZA 1T38A 1RIOH 2COMA 3E6BA 2D45A 2IVMA 1J9IA 1WKMA 3F72A 3GZ6A 1IN8A 2YX7A 3QPTA 2VBXA 1O3RA 1W7PD 3BY6A 1CF7A 1KU9A 1UHMA 2JRTA 1Q1HA 3K0LA 2M8EA 4HDUA 5H6RA 4I01A 2VODA 3FWEA 1ZLJA 3KLOA 2STTA 3CUQA 4K2EA 1FYMA 1S6LA 1IW7F 4KICA 5TRDA 4ZYGA 1Z6RA 1YFHA 1F1ZA 4L9TA 1Z1DA 1S7OA 3TKYA 1TTYA 1BJAA 1P4AA 4M9ZA 1MJ9A 3R0AA 4N0BA 4RGSA 1O3TA 2BV6A 5HS8A 2GXGA 1FBQA 1ZN2A 2FMYA 3F3XA 2QYOA 1LVAA 1G3SA 1K78B 1QO0D 1SFUA 1R5HA 3L9FA 2P6SA 4LLNA 2VBZA 4XSXF 1W7PA 3DEUA 4IHSA 2CYYA 3C1DA 2CQKA 2HKOA 4YFNF 1EV7A 2F2EA 2KKOA 2RVCA 4ENNA 1LDDA 1L0OC 1IN6A 2E1CA 2MH9A 4WWCA 2IA2A 3EETA 3CJNA 3HOSA 4L5JA 1BI1A 1HSTA 4A12A 4G7OF 4EJOA 1LNWA 2PBIA 5BPDA 4LG0A 2Q0OA 4G7ZF 3BZ6A 2P5KA 3E5QA 3T8RA 4I0AA 2HR3A 4S04A 2F5DA 3V7SA 5LGNA 3T1BA 5E1ZB 2XHKA 3J7AO 4PGGA 2P5LC 1SAXA 2K02A 4XRFA 4UXNA 1ZGAA 1ZRCA 5TJJA 1YLFA 1FX7A 1ULYA 4MQ9F 3G73A 3KLNA 3MAJA 1W4MA 2XAQA 4L9NA 2L4MA 1S8NA 2ZBKA 5CJ9A 3JW4A 1JGSA 2XV4S 1E2XA 1Z91A 3K69A 4U0WA 1LB2A 3CO6C 4L9JA 2EA4A 3M8EA 2Q8KA 4Y17A 2GZWA 2P8TA 4LLGF 2P7VB 2V1XA 5LBQA 1GVJA 1B59A 4H0EA 4HQMA 3I59A 4F7ZA 3WU1B 1FLIA 1K6OA 4G6QA 4GO1A 4I98B 1PP8F 3L09A 3WTVC 4AVPA 2PFBA 1SMTA 1V3FA 3SZTA 3V7CA 2BYVE 3DFGA 2STWA 5DD4A 3CUOA 1MDMB 3GF2A 1LDJA 5DEQA 2X0LA 4HX8A 3EUHA 4PGHA 4JK1X 1ZH5A 2HGCA 2LKPA 1FYKA 3RJPA 1U3EM 1YO5C
chains in the Genus database with same CATH superfamily
3FXOA 2A5YB 2L9VA 2WV1A 5FB2A 4D1QA 4IO9F 1MJAA 2RQQA 3C18A 1TW3A 1ETVA 1VQLI 1DUXC 2YZTA 2BBGA 1CF7B 1M1EB 4CZCA 3CCRI 4BHBA 3C6MA 2HI3A 4D0PA 5AIPA 1X3UA 4WF2A 1IV8A 3I4MJ 3JRGA 4XLEA 2H8RA 4PCQA 3WGGA 3PFYA 3RIRA 5CKTA 2MSYA 4I8OA 2EQ1A 4UUSA 4X62E 2HFHA 2F4VE 2TDXA 2EOSA 1FKAE 2JSCA 2F8BA 3W3CA 2H27A 2XGCA 3F0CA 2YPRA 1S9HA 1X1BA 1P7IA 3CUQB 2KJCA 3J7AG 2DT7B 1TWCJ 2XKPA 3HGYA 1D5YA 3BR6A 2ZXIA 3H92A 2V9PA 2HQAA 3V4GA 3DF6A 3NEUA 2EPKX 3SYTA 4BJ5C 4HRIA 2KJBA 3KEOA 5LGUA 2WAEA 3AFHA 4HEIA 3CUQC 3IAM2 2R7RA 2HXOA 2J5PA 4L18B 1IN7A 2ZJPF 1K4TA 2GAUA 3TDUC 4NQWA 5CYVA 4QTRA 1U8RA 4A69C 4C3JJ 1H89C 4PJLA 1NCSA 4L5EA 2HPMA 1X2NA 3J7AY 2ZM6E 2K85A 2QENA 4J8ZA 2QQBA 4M71A 4W1UA 2CGPA 3K4BA 4A0YA 4R2SA 2UXDE 2DGCA 4MEYF 1WFXA 1H8AC 2L33A 2NS7A 3L2CA 1IAWA 2GXBA 5BQTA 2EOJA 2Z3YA 1UAAA 3JREA 2CV0A 3VYUB 4B3RE 5IXMB 4BYYA 2CFOA 1W5TA 1O4XA 2DMNA 1V55H 3IKVA 3KEQA 2OQRA 4BE1A 1USSA 1VQNI 1Y0UA 1KU3A 4E7IA 1BC7C 1LUJB 4ITVA 1W7PB 3QAHA 1GV2A 5DUIA 4CYCB 2L2NA 2K9LA 2RN7A 2JVHA 5J1RA 1CQTA 5C4XJ 4WXHA 4NXNE 4LD5A 3AL0B 3LNQA 4RBOA 1NK2P 2EMFA 3LSTA 1U0JA 3HDDA 3ZMSA 1U8BA 2BE5F 5JFRA 2OU2A 2EA2A 2Y69H 3KZIC 4DZJA 1B4AA 1W5CC 3CCUI 2QEXI 1ZQ3P 3HTSB 1TF6A 1FMVA 4XBFA 5TGTA 1SFKA 3AL0C 4IQ4A 4Y4RA 1J75A 3CCYA 4YFXF 3KYDB 2DYRH 2F4MB 3F23A 4O43A 3HKZN 3CCQI 2WCC3 5IT9C 2JVGA 3RSNA 5L3EA 2DOFA 1F4KA 3HHHA 1ZYRF 2EJRA 2D9HA 1Z77A 5IYBJ 2W4SA 2CUFA 1V5EA 4LG0B 2Q1ZB 4RB2C 2HDDA 4ZDPA 2X9DA 2ELKA 2F5FA 4NB5A 4D5FA 3CCSI 2BB8A 1TN9A 1A1GA 3KCCA 3ZR8X 1N34E 1HQCA 2XRNA 2YUSA 4M9SA 1TQIA 2JWOA 3I4PA 1E17A 2DMYA 1T4NA 1OCPA 2HQRA 4OOIA 3I5UA 2K5CA 5ILUA 3S3OA 2CU7A 1ZR9A 1GV5A 3MZ8A 3K4LA 4PK4A 5E79C 2GIVA 4ZYDA 2DBBA 2FV4B 2OTJI 3DXJF 3JAMC 3OYNA 5E8IA 3V42A 3BR1A 1LE8B 1YX3A 3RKYA 4R79A 3BG7A 4JP0A 2WBSA 1X47A 4A3BJ 2E2JJ 1YHQI 3KYLA 1P2FA 1AKHB 4A3MJ 3T1HE 1YUIA 4R8OA 5KL4A 3DTIA 3LQQA 4KJZA 1KYZA 2K27A 2MLKA 3EDPA 2ISYA 2J5OA 2I13A 2XPVA 3GTGJ 5EG0B 3PUFA 1QRYA 2WV0A 1PYVA 4KIGA 2ACJA 2XSJC 2BY2A 3S1RJ 1MSEC 1G4DA 3RI4A 4ETSA 2QCOA 2C6YA 2QBYB 3OR1C 3LA7A 5AONA 2NABA 2P7CB 4P7DA 2DMPA 5A6AA 5JHUA 1AOYA 2EOYA 3KETA 5E1WA 5JHFA 5LHGA 4HV6A 5K5RA 3IRQA 1I6HJ 1YPNA 4NBQA 2RGVA 3H5AA 1G2DC 3OY9A 1HKQA 2CQQA 2V83A 4U7DA 3ADIA 4BXUA 2M45A 1YW7A 2NA2A 3M1EA 2GOXB 1HW5A 2A69F 1UZCA 5D5VB 2KHXA 4U7BA 2EH3A 1OPCA 4LJZF 1DPRA 1FYLA 2R5ZA 1R5GA 2IGMA 4R2DA 1YQAA 1W0UA 1GXPA 2ECBA 3TEDA 4D5CA 1WH5A 3I59B 3VOEA 2VPRA 2O03A 3GX4X 5GAHJ 1ZG1A 1ZR4A 4MLVA 2QWWA 1T39A 2YTFA 1R1VA 2MD0A 2EMAA 2HU9A 2L2KB 3I0TA 1DDNA 4M0VA 2B0LA 4X65E 1R00A 1FIAA 3DKXA 3F8BA 1ZBTA 2M5WA 5GAEJ 3T1YE 2EOFA 5FD5A 2L2MA 1VQOI 2VI6A 1B9NA 2HOTA 2KDOA 3H1CA 1S3JA 4MTDA 1LFPA 3FHNA 5F1JA 1JKPC 4CO8A 2UXBE 3ABTA 3LMMA 2Z33A 5J6XA 4XOPA 3ERED 4B09A 1K83J 2KDZA 1ZG5A 4UUVA 1HKSA 4RM3A 1G3WA 3AG2H 4HA8A 5J4VA 3J81Z 3BG5A 3ZMZA 1IDZA 3LMLA 1XGOA 3BTIA 1X1AA 5AASA 1TP4A 5ILSA 4IVNA 3I3LA 1R58A 2ETHA 2BXYA 2QGUA 2K9MA 2R4GA 4Q48A 2LBFB 4LB5A 2QLZA 3O2PE 3GTKJ 2LJHA 4EVIA 3PO2J 1J0RA 4EMSA 4RGXA 4C2MJ 4BXXJ 5JLWA 1Z3YA 1XG1A 2OQGA 4XN3A 4EJVA 5D6EA 3ZMUA 3LFKA 3JCUC 1F2IG 1USTA 4LFUA 5B1BH 1A1LA 3HC7A 1BW5A 2DLLA 3S14J 2IA1A 2NOJB 2EPCA 2MG4A 3A0HC 5HVQC 2KZGA 1FZPB 5IY5H 3MZYA 4YG2F 1IJWC 2K4VA 2EPNA 3M07A 3DBRB 2GHFA 2Z1DA 4L9VA 1ENHA 5ERIA 2GOMA 3FXLA 3RCOA 2K4JA 3ZOBA 2DFEA 2LMDA 1ZKGA 3K1MA 1XSDA 4RH8A 1QA6A 2XB5A 4L5NC 4IHVA 5IWAE 2DPUA 1W36C 3BF2A 3KEYA 4ZDLA 1ONVA 2EPFA 2EOZA 4F92B 1GUUA 1FTZA 3GFJA 3GFIA 3TQMA 5D6FA 4NXME 2LVHA 2R76A 2MABA 3RKXA 2IT0A 4I76A 1LKXA 2VRDA 1HNZE 4NQWB 4LIUA 2VL8A 1MW7A 5EGOA 4MO7A 4FQGA 2F6CA 1P4WA 1KU7A 5D5WB 2AHQA 2EM0A 2M9AA 3HJEA 3HTXA 4A3GJ 1FOWA 1EH7A 2CG4A 2CH0A 2E34A 2P5VA 1ZG3A 4RDUA 2FBIA 1HKTA 2DQLA 2EILH 5LLQA 2UZKA 3LSKA 3L00A 4FT8A 9ANTA 3OYCA 4UB6C 2ODRC 2FUG2 2NVYJ 1WJDA 3QRFF 5LEKA 2A6HF 1AWCA 4BDYA 2WZOA 2QKLB 1RNLA 1IG7A 5K7FA 2OPTA 4KUMA 1MJBA 3G3ZA 4OIRF 2EN2A 3LLHA 3NRVA 2WY8Q 4MHGA 5JVTA 2JK3A 1X4OA 2I8DA 4AIDA 4FETA 3E5UA 3BPVA 1TNTA 3IAS2 1B72A 5J1UA 5CPRB 5DNYA 1GT0C 4DR1E 1TF3A 5ADZA 2JSPA 1BM9A 4UB8C 2VIXA 4UVCA 2FJ1A 5LRSA 2CUJA 2YS9A 2RKHA 3H09A 3EUAA 3L2WA 3C2BA 3P9KA 4Y15A 4O6JA 1PP7U 1X3WB 4BNCA 1YSAC 1BBYA 5DUKA 2ELYA 1BJZA 1E3HA 2DN0A 2P4WA 2XASA 4II3A 2VE7C 4C3HJ 2OZ6A 2KIUA 2H09A 5E3NA 3CDIA 4NUBA 1LQ1A 1HBXG 1KONA 2E5LE 2BY0A 1RRJA 3FBIB 2A68F 3G1OA 4XN0A 4XKCA 3WODF 1TWHJ 5IOYA 2EN1A 3MKYB 3NWSA 2N8XA 2X51A 2KZVA 5HOOA 2A07F 1NG6A 2PJPA 2X6OA 5LMNE 5JLXA 2UU9E 2H94A 4LK1F 2EORA 4S05A 2Z5UA 1MH4A 2PEXA 4BAYA 2EZKA 2V6EA 2DSYA 2F5EA 4ZDOA 2OUMA 2QQAA 1MNEA 1R1UA 3BTCA 3WTWC 1QBJA 1TW2A 4HAMA 4XICA 1A1HA 3PL8A 2LC2A 4IF4A 2K7LA 1I1GA 4BCAA 2Z2SB 2ICWG 2ZMEA 2ZJQF 2MYSA 3M8FA 4EJUA 4XNFA 4IZZA 3BLYA 4JI5E 5IP9J 2JMWA 2PMZN 2GA1A 5HNFA 3MZHA 2M9HA 5CQEA 2PX9A 2FEZA 1RUNA 2V9KA 4BXFA 3R6SA 2M7BA 5KL2A 3I9V2 3TQNA 1YJWI 2TRTA 1XGNA 3OL4A 3ZN1A 3BJ6A 3D1NI 1MBFA 3GTOJ 4BMJA 1ZK8A 1ODDA 2ZO4A 3HSRA 4P96A 2M7AA 3SEQA 3GMEA 5IT9K 2VC1A 1XSXA 1BC8C 2EPLX 4B4CA 4M9XA 1WI9A 4Y52J 1GQEA 4EV0A 5EDNA 2DU9A 2H6CA 2CUEA 3P9CA 2FNPA 3TL4X 3GZ5A 1DPUA 2IRFG 5A6BD 1IV6A 4GCVA 1DU6A 2RS7A 4HX7A 3HOVJ 3WG7H 3SEZA 1MSFC 1WJFA 4LGWA 4DJAA 3ELKA 4DR5E 4EATA 3CMYA 2NXNB 3RPUA 1QU6A 5HLGA 2R5ZB 2PI0A 3CCJI 4DV2E 4RAFA 2V1UA 2BOLA 3FK7A 3HBLA 5IPAA 2G7HA 1TC3C 2EL5A 4JX4A 2EFOA 4OWRB 3TO7A 2Y48A 3DLAA 3HPGA 1BI0A 2EL4A 2XKOA 2TCTA 5F0FA 4M72A 5E20A 4R8HA 2W25A 3A02A 2L4AA 2L7MP 4N9HA 3JAMK 2L3JA 2EV5A 4RB0A 4F2JC 2CSOA 2VQGA 3ZGKA 1T4LB 3K6GA 1K61A 3LAPA 4MFEA 4O4KA 2IPQX 4RA2A 3HKZA 2R7SA 1HC8A 4AM3A 2HYJA 2VB6A 3KPHA 2IS4A 4LF7E 2Y30A 2HVQA 4I2OA 1R36A 4ESBA 1XDUA 3F6GA 1OLTA 4CICA 3ZPLA 4DYQA 3LFUA 4BY1J 2LTRA 2A61A 1QQIA 2W82A 4Q5SF 3THNA 2KRHA 1D0YA 3K4MA 4OOGC 2JVAA 1HW1A 4LLLA 3D0SA 3QP6A 5HDGA 1ZR2A 4D7MA 3QPHA 1YYOA 1L4SA 2R7DA 1QVTA 4L0YB 4PJNA 4F9BB 1N36E 5GPAA 3KWRA 4FE4A 3ZQQA 4EQQA 2UUAE 3JR9A 1X49A 1R23A 2JRMA 3C7JA 2EZ6A 3WU0A 4GYIA 2DJNA 1MMDA 2HTSA 4HNUA 3COAC 5IP6A 2CFXA 2EM9A 2ENHA 2Y9YA 2ZJ2A 1R22A 2CQXA 1FJGE 1UHSA 2ID3A 2OJED 4NC7A 3FK6A 1O7FA 5A6BA 4LOCA 1WJ5A 1R4NB 2ELJA 2YPNA 2KLOA 3MFKA 4U88A 2EJ4A 1E0EA 3H5NA 1SVMA 2CT1A 4YIIA 5LGTA 3ABLH 1EH6A 4KYWA 3K4KA 2BVMA 3IL2A 4MGRA 2NVQJ 3E6MA 2XAUA 4M6YA 3W6VA 2AS5F 3HYIA 4FX0A 3HGGA 4OMYA 2EM6A 2JPAA 3VSLA 2HXIA 2QM3A 5LEJA 1X1CA 2LKSA 5TISC 3J80Z 3HOXJ 1BOBA 1PJSA 3F8NA 3LSMA 3Q0WA 4P9FA 2HZTA 3K2AA 5EGOB 2EBIA 4HQEA 1N32E 1LE8A 2HYGD 1XMKA 4G8XA 2YRHA 2M0CA 5J8CA 1ZU1A 3EPHA 1SD7A 4YHHE 2LKXA 3OYIA 1QVUA 3BDDA 5FKLA 4KWYA 3EQLF 1MBHA 1D8KA 3IH3A 3JTGA 3N05A 4R2RA 2CS3A 3QYEA 5LMUE 3TDZC 3TGNA 4QLCU 5KAIC 5E17F 3WTSC 1XC5A 2EK5A 4W97A 3WTYC 5LL6R 4N4NB 4E7SA 4HYEA 2R7QA 2QBYA 3LAJA 4LTYA 1V4RA 3G71I 1SD6A 3HG9A 1MKMA 3KE2A 1XGSA 4A3IJ 4XLAA 2WTEA 2ZNYA 1B72B 3MMYB 3ZMVA 2DMIA 1O57A 4JQFA 5LHIA 2RNJA 2VKVA 4B44A 1Z05A 2JYAA 4O3MA 1I3QJ 3ECOA 1ITYA 4G12A 3RDIA 2EIJH 3GFMA 4HPQA 1Z1BA 1OYIA 1UBDC 4PDKA 3RZOJ 1G59A 3DV8A 3ECHA 4ON0A 1WXRA 3SDBA 4PJJA 1Y1WJ 1TL8A 3KYCB 1YYWA 4BHPA 2K9QA 3FMSA 1X19A 3FZVA 3OYEA 1Y6IA 1HCRA 3PJRA 1MNMC 5JR3A 2A6EF 3S3NA 1STUA 1G8XA 4AQYE 4BKXA 4FE7A 4XKVA 4R03A 1U5TA 2YX4A 4DR7E 2CPNA 3GLLA 3QPLA 1YJ9I 5ILVA 2K3PA 5ICFA 5HLTA 4ENMA 5H20A 4IRHA 2R1FA 3V7RA 3OYHA 1IQSA 2E7WA 2DODA 5H6QA 4DR2E 2IS2A 4B3SE 2LFBA 4A6DA 4GKKE 1S7EA 1LDKB 2Y75A 1R4MB 2EM8A 2F5VA 4I7HA 3JRDA 5K5OA 1TT0A 1RZ4A 2DA6A 2EPAA 2YRKA 2L2OA 5KL7A 4EGZA 4UNOA 3E97A 3S1MJ 2XDVA 4I0BA 3CCEI 4IHYA 1NEIA 2JTVA 4IL6C 2ZMEB 4A3FJ 4UHTA 1WZ2A 3BP8A 1TQPA 2JPCA 1TWFJ 2M34A 3DTEA 4P9UA 3ISPA 4GXOA 3DP7A 3BJAA 3QWLA 3BC8A 3I56I 3ZRGA 5GAGJ 1O3SA 2FRHA 3QODA 3VB2A 2ZMEC 3GTQJ 4XSZF 2H36X 1FT9A 5CVRA 2VKEA 4IX7A 3CC2I 2D1VA 3V8LA 2V87A 3JTZA 5B5EC 4A0ZA 3NWTA 2B9DA 2VKDA 5DCMA 3ZMTA 4JI0E 2IHR1 1T6SA 1IGNA 1MH3A 2UXXA 2E2IJ 3S2DJ 4E7JA 3ZQ7A 2X6YA 4N9IA 4UY8I 5A2QZ 4BACA 2CO5A 3FISA 1HSJA 1FMWA 2E1NA 2WB1A 2ZB9A 3ERMA 2PQ8A 4YIFA 3ZP5A 4M3FA 3CP2A 5JI6A 1AA7A 2VBYA 4JYKA 3K70D 5KAFC 2XRLA 4EJTA 2JOBA 2H8WA 3CMAI 4DV3E 2DRPA 1KA8A 2LBSB 2Y2ZA 3GTLJ 3FDYA 1XMOE 1OR7A 2QQ9A 1I3AA 2DK8A 4A0XA 4XRSA 2BEOA 4PFPA 3U2RA 4X0GA 3OSGA 4ENJA 2DT5A 2MGQA 2I10A 2OBPA 3J7Yp 5GPCA 2K3FA 1N3GA 2G7UA 4IEJA 4EJWA 2LDUA 4ZYHA 3OYDA 4KT5C 2RV8A 5EYRA 4F6MA 4HSTA 2JR1A 3O3KA 2O7OA 4MIMA 5FLXZ 4A3KJ 1BIBA 3IWDA 1GVDA 3MWMA 4OX9E 3AG1H 3W2WA 3N97A 1KGSA 2VLAA 2XPUA 4HG2A 3UKGA 4X8WA 3EPJA 1BI3A 1ON2A 2DLQA 3A2KA 2R7VA 2VC0A 3KP7A 1B69A 2EV0A 4A3LJ 4PSWA 1HXDA 2M1BA 1IF1A 2VJIA 2EMYA 4M6XA 2V79A 4A3JJ 2VXZA 1H9GA 1X3ZB 3H35A 1OCZH 2RNGA 3A01A 1H0MA 2LK2A 1VNDA 1OJLA 1ZARA 2QVOA 1UCRA 3Q0VA 2DA3A 2N3GA 2FXAA 3QYFA 3O6BB 3AKZA 4A93J 1JUPA 5L3FA 2L8TA 3CF2A 2L7KA 1IO2A 2D5VA 2VT2A 4BL0B 2V6CA 4RMNA 1EKZA 2DB2A 1X2MA 2CUZA 2LCEA 3LWFA 2ELZA 2XUBA 1ETYA 3DPTA 4DW6A 1QZEA 1SD5A 2O0YA 2PMZA 5K5QA 2HEOA 2QQ8A 4AYBN 4ABZA 1DQ3A 4BS9A 2E7XA 3DQVC 1XMAA 3Q9SA 4WPYA 1YW9A 3BCAA 1DGWY 3QOPA 2M1SA 1GHCA 5E3MA 2VJ5A 4GGGA 2CQ7A 2R0QC 2E1MA 4DV4E 2K40A 2HPIA 1P92A 4FX4A 5IYDJ 4PZJA 1G6NA 1N75A 4D9JA 2EM5A 2PN6A 4IRGA 1I1SA 2HGHA 1D1AA 1AH5A 2UXCE 1RC9A 3FXJA 4M9VC 2B3TB 4CSWA 1O3QA 4JI2E 2PLYA 4HDVA 2MKDA 3GTPJ 3KFWX 1LEAA 1OYYA 3BOQA 3TW7A 2R3SA 2N3HA 3LSRA 4WXDA 1Q1VA 1RR8C 1VQ7I 4IHTA 3FM5A 3ROUA 3VYYA 1OMIA 1MGTA 1Y39A 1POGA 2HHHE 3JSOA 1FY7A 1FSHA 4F6NA 1WQ2A 2DYSH 1T98A 2IGKA 3A1YA 1R5ID 2G0EA 1SFXA 3HIFA 3PQKA 2HDWA 3BG6A 1FOYA 2NNYA 4XLNF 4WK8F 2Z9OA 1JI8A 1YTYA 2EL6A 4RHBB 1SFEA 4LFCE 1N33E 1WPKA 3KX2A 1BBGA 4ESFA 1OCTC 5J3LA 2M4IA 3BQZA 1IXSB 4Z2YA 1FJLA 3BR5A 3FMQA 3OYAA 3S93A 2QZ8A 3FXKA 4XLCA 2JN6A 3MSWA 4UUTA 2EMXA 4NNJA 2LNBA 4A2UA 1RI7A 3MKZA 1A5JA 1T56A 4KN4X 2V1NA 2L9SA 1SVOA 5ICEA 1VTNC 1KQ8A 1UB9A 4E7LA 2EMLA 3QU3A 2LP0A 1WI3A 4BU2A 4ZZDA 4XLFA 4IXAA 1TWGJ 2PRTA 1U9OA 2YSPA 1XX5A 3CMEI 1X6FA 2EPOA 3FF5A 1WVRA 4C30A 5AE2A 1FIPA 5IYCJ 4XK4A 4ZH4F 2XSDC 4A5MA 2H6BA 2KFDA 5EEAA 2O8XA 2L02A 2EN6A 4NZVA 1U5TB 3OYLA 1KZHA 3W6JB 4LF8E 3D5RC 1BIAA 2OZUA 3C2HA 4BQQA 4B3TE 4M73A 1HDPA 1QGPA 4DV5E 2E5NA 3G1LA 1VQPI 1PUFA 2EPMX 3C3WA 1RETA 2HVSA 4AC0A 1U5TC 5EEGA 4F91B 2LO3A 1XN7A 4NHJA 3ADLA 3FKIJ 1R6RA 4TUIA 2NRAC 1T8IA 1WGXA 2I5UA 2OF7A 2XF7A 4P55A 4RAZA 3CCLI 3DKWA 1BA5A 1DP7P 3ABUA 3HSFA 3RYPA 3QOEA 1XDSA 3DEEA 1FWZA 3WHCA 4R1HA 2Y0MA 5EJCA 5EF6A 1KU2A 2JA8J 4K0KE 3TOAA 2Q8UA 2NS0A 5HDKA 1P4XA 2HZDA 3DF8A 2EFQA 2KL4A 1DQUA 2M8GX 3CESA 5D8KB 1GZ6A 1YUJA 1XCVA 1V5GA 2BY1A 3LL7A 4J01A 1BL0A 3O8HA 2BVLA 4N4RB 1MBJA 1ZRFA 4HSRA 2XAGA 3GTJJ 2EN4A 4P5OA 3TBIA 3H9JA 4XLHA 5C3EJ 3T8TA 3S1QJ 2QUFA 3F9KA 4M6VA 5IV8B 4DV0E 3V8JA 1RQ0A 4DR6E 1P7JA 4RGRA 1OQYA 1HF0A 2O9LA 3CZ6A 1ZBQA 2ZKZA 3LOCA 5M5XJ 3IWFA 2B63J 5DCMB 2E60A 3RMPA 4H4KC 4M74A 1PVEA 3UR3C 4BQAA 3TO6A 2FQ3A 1A36A 4QWQA 5M5WJ 3M4OJ 2EOEA 4J00A 2KIFA 3DWLE 1FP1D 3FXUA 2LF7A 4G6DA 2EMBA 3KP3A 4X1EA 2EV6A 1TWAJ 3MQ0A 1A1IA 3JRHA 5IT9Z 1XB4A 3ZN0A 3I53A 1FSEA 1IN5A 3OOUA 3E6CC 4AU7A 3DBLB 4RGUA 2DAOA 2NOGA 3SFZA 5HLIA 2NUFA 3PFIA 2LV2A 1TNSA 2MDRA 1YW8A 3K7AJ 4X64E 2EPRA 3H36A 4G9YA 4IHWA 3JU0A 2G9WA 2ID6A 3OYFA 4BUPA 3OTOE 1X3CA 3QYBA 3JSPA 2LR8A 1OR7C 3QU6A 3L2RA 1UG0A 1I50J 1XSVA 2V88A 1CGPA 2R7XA 1D5VA 1ZTRA 5M3MJ 1PUEE 3G6EI 3HRSA 4XORA 1MMGA 3VYSB 2ELHA 2L7FP 5F0HA 3SQNA 2LTSA 2RSMA 5FGMA 2K86A 5H2FC 1VQ8I 1FP2A 4YY3E 3JAMZ 4AIHA 3KZYA 4BJTA 5L3DA 4BHCA 4IRIA 3TOBA 3IWCA 2DQRA 3VDXA 5HS9A 1TQMA 5HDNA 2DI3A 2HOEA 2IA0A 2MDGA 1I5ZA 1SANA 1RR7A 1JE8A 1BB8A 4LMYA 3A01B 2EOMA 4CCNA 2GPIA 2DPDA 3MCZA 3S1NJ 2W7NA 3GFLA 3H3UA 1T2KA 2LJUA 1P6RA 1VQ6I 2JWTA 1IRZA 3BBGA 1WH7A 2EZHA 5IOZA 4N4OB 5B1AH 1JHFA 3HTUA 5KL5A 4UVBA 4UV9A 3ML6A 2UV1A 4I6ZA 1ZRDA 3ZCOA 2XROA 2DO7A 1ETXA 2FBHA 1REPC 1SAUA 2YU3A 3BCBA 3FXQA 5FKOA 2RREA 4CGZA 1L3LA 3ULQB 1HOMA 3U1KA 3PSFA 5FKMA 2HQNA 2PJRA 4WXCA 1OCOH 3W2AA 4ZYEA 2MH2A 1J7KA 2E1MB 2WBUA 2KT0A 4AUXA 2LVSA 4PJ0C 3Q5FA 3J80C 3G2BA 2LSOA 1PJRA 5D5XB 2RAEA 3K70C 1SFOJ 3PQJA 4ESJA 2ECCA 2YTJA 4KMUX 4UV8A 4JI7E 1A1FA 4XL9A 1F5TA 4CZZA 3OYKA 2HWVA 2BHYA 3KP2A 2EMKA 1APLC 3KP6A 2AO9A 2BHZA 3SFIA 2E1MC 3DKYA 2AXLA 2E19A 3ASNH 5DCFA 2E35A 4BC7A 1YZ9A 2JT1A 1XMQE 4O24A 4Y33A 1X1DA 5DDGA 3PM1A 3EUKL 3AV0A 2LD5A 4TUGA 1ZAOA 1R7JA 2NYXA 4Z6YA 3ZQIA 1G3TA 4DNCA 2HQ5A 3HOWJ 3ZQHA 2WADA 4B8XA 5DV5A 5BOXA 2R7ZJ 1LLMC 2XVCA 1C0WA 2EM3A 3GW2A 1MMSA 3PNYA 4KDPA 1Y1VJ 2B7EA 2HTJA 2ZCWA 1PKPA 2M2EA 1SC7A 3VWBA 2A25A 2ADUA 2YSRA 2WY7Q 3C2GA 4AIJA 1JXSA 1WJBA 2DMQA 5CFFE 1Z6TA 3B02A 1PDNC 1YS6A 2VF1A 4C2TA 2ENCA 1IRGA 1IXRC 2VE9A 4KIBA 1X1PA 2ZFWA 1HNXE 1AU7A 4HEA2 2RS6A 4BEHB 3HXLA 2A5WA 2D2WA 3VK6A 3E0JB 3REOA 1S7AA 1D3YA 2W24A 3HRTA 3DU5A 2LY9A 3VODA 2MC5A 3CQZJ 1J5YA 1W0TA 1S72I 3OIPA 2MBFA 2JA6J 2IEKA 2EOOA 3IC7A 1PDAA 2EM7A 2VOOA 5C4JJ 4ZYAA 3I54A 3Q0UA 2OC6A 4HTGA 4BH9A 1VQMI 4OMZA 1JJ8C 3CCMI 2KP6A 3WG9A 2L54A 4OAYA 2F5CA 4X6AJ 1ERDA 3J7ZI 5E1XA 2Z16A 4E7HA 4I09A 2M4KA 5J8FA 4G7HF 1I27A 1J2XA 2EINH 2HYFA 4XRSG 1MIJA 2Y0SN 3HRUA 3WTXC 1LEBA 3FIWA 2E71A 3L7WA 3PIPF 1K79A 2KIMA 2BXZA 1PUFB 3R0JA 2B7VA 1I94E 3QPSA 3IKTA 5KK1A 5T6JA 1KYWA 2LOOA 3HUGA 1I6XA 1WHQA 1GDTA 5LHHA 1D1BA 5LD2C 2F48A 4IPAA 1UILA 1K6YA 4XM3A 1J59A 2LTPA 4MTEA 2V4JC 3C4TA 3GO5A 1ETQA 4EGYA 1QZYA 4HOBA 1ZGWA 4I99C 4CDGA 2R7FA 4AWXB 3LSIA 4GZNC 4Q4ZF 3P5JA 4XMYA 1R9TJ 5D5UB 4Q28A 2W57A 2IP2A 2VJJA 4M3BA 3C4BA 3THOB 1BOAA 1IXCA 1FBUA 2RDPA 4MLQA 2BZTA 5KHDA 4XQFA 5C44J 3GWZA 4GYGA 4WX9A 2E5ZA 2ZC2A 4BBRJ 2DXIA 4HF2A 2WBMA 3HSEA 2AXTC 2V8QB 4Q35B 1V54H 1SEUA 2KOUA 2ZXHA 3ONQA 2LF8A 2V7FA 3F21A 3HOTA 1J5EE 3IUOA 5EZGA 4HLYA 2LREA 2IJLA 3Q9VA 3U9GA 5JVGF 3MEXA 1O7LA 2XIGA 1Z0XA 5L3BA 1YRNA 4U87A 2X6XA 3TW6A 3CO7C 1FBSA 2I9IA 3VYRB 1MBKA 3DTKA 4Y3OA 4F93B 2Q2EA 2R7OA 4RB3C 5AE3A 3TO9A 3M8JA 5K1YA 3IP4B 2PG4A 2W85A 1UFMA 1F43A 3E3VA 2DT6A 3BR2A 3FBNB 4RB1A 1O0WA 3BR3A 3DPUA 1ZAAC 3OV8A 4WYQB 5E8GA 1QU3A 3GUDA 2XC7A 1D0XA 1RKWA 4B3XA 4LF4E 2NS8A 3H9GA 5F27A 3PNVA 5FLXC 3OIOA 1ETWA 3OS1A 4L0ZB 2VQEE 1IUFA 3ZQFA 4AVZA 4B47A 4A3EJ 3ZMDA 2BGCA 2OCEA 2VE8A 3VEPA 2VPLA 3VFZA 3EYYA 1FEXA 5HLHA 1WWXA 3JRAA 4B48A 3KP4A 5FRNA 1GXQA 3TMOA 1Y56A 3K2ZA 2O8KA 3F6HA 3GVAA 2V85A 4MQVA 2HC5A 2FOKA 2EN3A 2VN2A 1DP3A 4OIOF 3ZQCA 2PMHA 1U78A 1XD7A 3E5XA 4JOMA 5B3SH 3H3VK 2EQRA 1MD0A 4ZTFA 4KMFA 5GTIC 2CV1A 5KVRA 2VOPA 2HOAA 2JXPA 1JUMA 3F6VA 4V19K 5F6FA 2OAZA 1JUSA 5DM6F 1TBXA 5IP7J 2EMIA 3LA3A 2VQLA 4CYDA 5LRRA 2R92J 2IW5A 1JT6A 2W84A 2WC2A 3U21A 3I58A 3NQOA 2R5YA 2VUMJ 5CVIA 1Z7LA 3RPQA 5BPIA 3W6KB 4BDZA 1DU0A 4RS8A 2VJ4A 5TSEA 1STZA 4WCGA 1IC8A 1F9NA 4CHUA 1FTTA 3TP3A 3WTTC 3OYGA 4KHPE 2P6TA 2YWQA 3CJTB 4HZFA 1WHNA 2PJRB 2QSHX 2RTXA 4LG3A 3HZJA 4HLXA 3QG5C 2IS6A 4E6KG 2EN7A 3OMYA 1Y8QB 2NVTJ 2HKXA 5DD8A 1LJ9A 1SVLA 2GA2A 4HBLA 4TV7A 1VQ4I 4IHXA 3H0GJ 2LY2A 4A6EA 2YR2A 5F1RA 1X6HA 2MC6A 2CV2A 4IQJA 2KRFA 4DV7E 2FA5A 4DZPA 2EM2A 3IH4A 4JBAA 2EE8A 2DA7A 2VT3A 4KT6A 4NC8A 1B9MA 2VQCA 1KQ9A 2RQPA 2VKHA 1BN5A 6PAXA 5K7HA 2RSIA 3ASOH 4DMIA 4JYAE 2BW3B 3CCVI 1A6QA 3NAUA 5F04A 4DV1E 2KRCA 3GBGA 4CCMA 3IRRA 1YYVA 4IJDA 4CH7A 4E70A 3OMLA 3CDHA 1ZLKA 3L2QA 2KMUA 2ZXWH 4AD9A 3S2WA 2KHMA 2FNAA 4CCLA 1FC3A 5D4SA 2ISZA 3WHBA 2CQNA 3WU2C 4P78A 1X58A 2NNNA 1B6AA 1JKRC 1XCBA 1HLVA 2DA5A 1IBLE 3WE3A 1A1KA 3E6DA 4YRVA 3R4KA 3WGIA 2NVXJ 1KJKA 1TLHB 1KYQA 1ZHFA 2EOQA 2L0KA 3OWTA 3DBHB 2P81A 1FOXA 4II2A 3W2VA 5ICGA 1BI2A 4U0YA 1WJCA 3BZKA 1HW2A 2H1LA 2WAQN 1T0FA 4AIKA 2ZSIB 1LPQA 3M3YJ 3GEZA 5CQGA 5FO5A 2JPBA 4XONA 2EMWA 3WTUC 2LE2A 3J80K 3S15J 3SXYA 4FCYA 2OA4A 2A05A 4V2GA 5J4YA 1K4SA 3K4CA 1YOVB 1JJ6C 2GBYA 1RUOA 2KQRA 1W1WE 2OTLI 1ZELA 1OYWA 5FRMA 2E1OA 3BGHA 3CC7I 3WGHA 2ENAA 2QA4I 5KL6A 3H3ZA 1UJ8A 2GLIA 4M2ZA 1SD4A 3M9AA 3RQIA 2X48A 2EMGA 2FE3A 3FMRA 2DFHA 5FROA 2EQ3A 3M1CA 2W00A 4FTHA 3HHGA 2CW7A 5KCMA 1A35A 3J81C 3BWGA 4LF9E 2X1CA 4F9AB 2DFIA 1N77A 2EM4A 1IZ1A 2R7TA 1EH8A 1BW6A 1VQ9I 1IUYA 1YIJI 5E18F 4QSHA 3GXOA 3HUGB 1VF9A 4C2UA 2CW0F 4KISA 2LY1A 3KP5A 2MKNA 4ZZLA 2Y9ZA 4HV5A 1MBGA 4Y13A 2PMUA 1DGRM 3IWZA 2EMZA 4NDLA 2UUCE 2EN8A 1XS9A 4FISA 4ENKA 3CD6I 3LQRA 3OYBA 4OIQF 3JTHA 2EWLA 2XAJA 2L92A 3P1XA 2EWNA 2OD5A 1VFCA 1UG2A 4DKKA 1XGMA 3RKWA 2DCEA 1D8JA 2FSWA 3T0YA 3PUBA 2DMTA 2L6MA 1IN4A 2M30A 2ESHA 3K10A 4LB6B 2LG4A 3HRMA 2EFPA 4ZJZA 1GTKA 1QHHD 1QZZA 5FLVA 2L01A 3F6OA 4HW0A 2JQ7A 2BY3A 2CWEA 2M7QA 2QSFX 5FLMJ 4OINF 5A69A 4EM0B 4KN7X 1OKRA 4QPOA 3RKQA 2FD5A 3ZQGA 4B43A 2K4BA 1YRNB 2O6GE 2YTIA 5FFXA 4YIRX 3CJQB 1XTAA 3LA2A 2Q2EB 1A1JA 3CLOA 4FASD 1K7AA 2EQ0A 2ZXJA 1A04A 4GEQB 2K9NA 4BE0A 3ZQLA 5AIQA 5IT3A 1FNNA 1JKQC 2EOIA 4ZTJA 3EPKA 2VASA 1H88C 1JHHA 5BNGA 1QPIA 5HS7A 2M0MA 2QF7A 3EQ1A 1MMNA 4JI8E 3BT9A 4UVAA 3HL2A 2M4GA 4DR3E 2CJJA 4IJAA 1UN6B 3CC4I 1YG2A 4B1RA 3B6AA 1ON1A 2LYCA 2DK5A 3CP8A 1JTYA 1U6GA 4JI6E 3HEFA 3DEWA 2FOWA 3V8KA 5FKNA 3BG9A 2JZYA 3I64A 3FM3A 2F4OB 3G1MA 3SHFA 2P0WA 2L3CA 4A3CJ 2XAHA 3A0BC 5GP9A 4LU9A 5M5YJ 2YT4A 5BS6A 4OAZA 5FKKA 2FX0A 4O5VA 2Z99A 5F0CA 4V2FA 4ASNA 4GDFA 4EM2A 1KQ0A 2Y0SA 3RQ4A 3FXRA 2V1DA 3KZZA 1EF4A 4BEHA 4CXFA 2VQHA 4OU0A 2EFWA 2GQQA 4KFCA 5A2QK 1UELB 2X4HA 2V89A 3L2VA 1UMQA 2LT7A 4M3DA 3E7LA 2HS5A 3PNTA 4G6TB 2D1HA 5DS9A 5E3OA 4G94A 5FD6A 1R71A 3SJMA 1LFUP 2JA7J 2DIXA 2JUGA 1ACIA 2FGGA 1P47A 1DI2A 1U2WA 3JRCA 3CTAA 4RAYA 2IAIA 1UHZA 1RC7A 1PJQA 4GRIA 1YIOA 5KNLA 4LK0F 2R5YB 2JP9A 1G3YA 2KPMA 3T5XA 2NUGA 3CDLA 2K7IA 2A3SA 2MC4A 2XGEA 4KNYA 5ICCA 1NK3P 4WSPA 2GWRA 4IS1C 3I4NJ 4EM1A 3FKJA 3BROA 1X48A 1QNTA 2LUQA 1ZGJA 3O8GA 4NC6A 4OIPF 2RQLA 3UNGC 1HR0E 3K1NA 1NTCA 5FLXK 4U0VA 4XIDA 2XB0X 2XGDA 1AHDP 2RC4A 4PSXA 1IDYA 4CCJA 3UK3C 3WTZA 3U1DA 4BJ6C 2L9RA 2VONA 3C6KA 4QPQA 2MW8A 3F8CA 1AAYA 1FPQA 2DFFA 4MEXF 1MNDA 3GLXA 3GYHX 1Z7UA 4F55A 1IRFA 1OFCX 4L8NA 2J7JA 1B8IA 3S32A 5D4RA 1WSUA 1K78A 1MZBA 1XPXA 2MA3A 3LSGA 3PO3J 2R7WA 2FF4A 3BJOA 2BBYA 3OOPA 1HDDC 1Z67A 3ABKH 4BQOA 1Z3XA 5ED4A 3M7GA 4WFTA 2KIQA 2JOXA 2JY9A 2EFNA 4MNUA 1IRXA 4B3AA 1Z21A 4LITA 2DTRA 1WHUA 3K1PA 5CVJA 2EMCA 3P9IA 4FHTA 3N4MA 4DOZA 1R49A 2O3FA 4HF1A 2ESNA 2EOXA 2LRSA 3QP5A 2UWMA 2FTXB 2LMZA 2Y31A 3SZPA 2MC3A 5L3GA 2YU5A 2XF5A 3ZXSA 3D5LA 3EUHC 2RPCA 4HF0A 2YU9J 1JT0A 1NHAA 2V86A 2HJJA 3AG4H 3FHZA 1D1CA 2W1OA 1WJEA 2XAFA 4XRMA 2MLGA 1BR2A 1YX5A 2FMLA 3IWBA 3HPZA 1RMDA 2WWYA 2X1DA 3OS0A 4UUSB 4JI4E 3A4CA 1IMUA 5BMZA 5CVUA 3DPLC 2NAZA 1TZLA 1U9NA 2YTEA 4R2PA 4DUZE 2DMUA 3ABMH 4GKJE 4KIFA 3FXMA 5A6KA 1S29A 1T0FC 2VXDA 2HDCA 4KITB 1QPMA 2HVRA 4RLQA 3H5RA 1WCMJ 2MD5A 5EEHA 4BBYA 5GTHC 4A5NA 5AC5A 2AQEA 1J26A 1R1TA 4X9JA 5CVVA 4L5IA 1PJTA 1N25A 1SMYF 2FU4A 2L3DA 1EA3A 2X85A 3RYRA 5F64A 4DYRA 2FBKA 2ZJRF 3HOZJ 3R61A 1YYKA 4MFDA 2ADRA 2V9VA 4BE2A 1ETOA 4BC9A 3FX3A 4HNVA 3PIOF 3BR0A 1X4PA 4PFOA 2YTGA 4DQ2A 4C9YA 3B73A 3HQ1A 3RTRA 1W5SA 2COBA 2LRDA 2ME0A 3Q3SA 2DW4A 2JUCA 1QHGA 3S16J 3J7YJ 4F52A 2M87A 5D8LB 4LF6E 3AAFA 3F22A 4F9CB 5L3CA 4KA4A 1IBKE 4HX4A 3WE2A 4DBRA 4JX5A 5DYMA 4QIWN 2DA2A 1A31A 2EP3A 2N8GA 3LSJA 3LSPA 2YTOA 3F8FA 5CLSA 1B1BA 2WB1N 4DGWB 3VPRA 2XGXA 5FFZA 3K6QA 4M3GA 3EYIA 2JA2A 5AC4A 1YS7A 4S0HB 2V26A 2DDBA 1VQ5I 2IGNA 3VSKA 2GLOA 2WBTA 2EB7A 1YITI 3H0DA 3D5SC 3BPXA 3K9TA 2O61A 4CCOA 1J09A 3MHHC 3K4JA 3IHUA 4EEFG 4R2EA 4YFKF 1XMXA 1BR4A 1I39A 1BBOA 2HNHA 5DTDA 1F36A 2EIKH 1LVKA 3JRBA 4IKFA 2MFZA 3BQYA 1YJNI 4I02A 5M3FJ 2UUBE 1D0ZA 3ADGA 4XLPF 2UXNA 3BIDA 1BR1A 3J81K 3ADJA 1JK1A 1UHWA 3IH2A 2LH9A 4YELA 3P7NA 1H9TA 1SR9A 2EPXA 1Z9CA 2L5QA 3F8MA 4JX6A 3RPUD 1ZREA 3MKWB 4JI1E 3CJRB 1WRJA 4XKWA 4DYCA 3OYJA 3IV5A 3EPLA 4Q47A 5BR8E 2WAQA 3VYTB 2VBWA 2BW3A 3S3MA 1RESA 2EZLA 1FOKA 4RLFA 2CMPA 3I71A 2M3AA 3R60A 1MDMA 2QKMB 5HNHA 1OISA 2ZNZA 4LIVA 3GCMA 1T38A 1RIOH 4A3DJ 2EPZA 4JV5E 2COMA 3E6BA 4X66E 2D45A 2E2HJ 1NH3A 1ORKA 2IVMA 3TP0A 1WKMA 3F72A 1J9IA 3GZ6A 1V5FA 2QSGX 2YTPA 4KZSA 2CTDA 4ZC3A 1IN8A 2YX7A 3QPTA 2VBXA 1O3RA 4WSGA 1W7PD 3BY6A 3SZGA 3VHTB 2YRMA 1CF7A 3MD2A 1JK2A 4R2CA 1KU9A 3MKLA 2YU8A 3G4SI 1UHMA 3ECRA 3MN2A 2JRTA 1DGCA 1Q1HA 2OCCH 1ETKA 3K0LA 4D7NA 3DJWA 4LF5E 2M8EA 4HDUA 1X6EA 5H6RA 4I01A 5FJ8J 2VODA 3AUZA 4M30A 4DV6E 2R93J 2R7UA 3FWEA 1ZLJA 3KLOA 2STTA 1X5WA 5F3WA 3CMMA 3CUQA 4K2EA 1XNQE 4BBSJ 1FYMA 1S6LA 2WAFA 2CW8A 1IW7F 2E72A 1JGGA 4R2QA 4KICA 5TRDA 2DLKA 4ZYGA 3HM5A 4XKBA 1Z6RA 1YFHA 1XNRE 1WJPA 1F1ZA 3S2HJ 4L9TA 4BGDA 1Z1DA 3HOUJ 4NHRA 1S7OA 5J47A 3TKYA 2EMHA 2DTZA 4YEJA 2WA0A 1TTYA 2YTDA 1BJAA 1P4AA 4M9ZA 1MJ9A 1LFBA 3R0AA 2VQFE 2GM4A 2ZSHB 3NARA 1T95A 2EZIA 4AYBA 4N0BA 2DDAA 2LLKA 2L7ZA 2E36A 4RGSA 3CF5F 3BTLA 3RZDJ 1O3TA 3H9QA 4E7KA 4E7ZA 4MLOA 2BV6A 5HS8A 2GXGA 1FBQA 4BQNA 3DCFA 2X1EA 1ZN2A 3OL3A 1HA8A 2FMYA 3F3XA 3K4NA 1IBME 2EIMH 4P1WA 2QYOA 1LVAA 1B8IB 1G3SA 1K78B 3L1PA 1QO0D 1SFUA 1T33A 1R5HA 2XF6A 3OIQA 3L9FA 4XOTA 2P6SA 4LLNA 2VBZA 4XSXF 1W7PA 4CYCA 1OCRH 3DEUA 3DLLF 2F4IA 3BZCA 4IHSA 1IQOA 1JKOC 3GTMJ 5EZHA 2CYYA 2B7TA 2HOSA 2YTNA 2KONA 3C1DA 1G2HA 2W48A 2CQKA 4HNTA 2HKOA 4YFNF 1EV7A 2F2EA 2KKOA 2RVCA 1Y0NA 4ENNA 5K7ZA 1LDDA 1L0OC 2DOEA 2CSHA 5HODA 1IN6A 3OYMA 5A2QC 2E1CA 2MH9A 4WWCA 1E3OC 1MBEA 2LUPB 1HNWE 1MMAA 2IA2A 3CJNA 3EETA 3HOSA 1GLNA 3VYXA 4L5JA 2GIZA 1BI1A 1HSTA 2FQ4A 4A12A 1A6IA 1N78A 4G7OF 4EJOA 3OSFA 4J19A 1LNWA 3QQAA 2PBIA 5BPDA 4LG0A 3OS2A 4CUGA 2Q0OA 4G7ZF 2IS1A 3BZ6A 5LFAA 2P5KA 3AG3H 3E5QA 1TT5B 3LSHA 5J40A 3T8RA 4M3EA 2EOHA 4RAGA 3MHSC 2L9NA 5KL3A 4I0AA 2HR3A 4C3IJ 4JI3E 4S04A 1MEYC 1JTXA 2F5DA 4LFAE 3V7SA 5LGNA 4DR4E 4BY7J 4PJMA 5E1ZB 2XHKA 3T1BA 4PGGA 1P9QC 3J7AO 2X6WA 2DOAA 2P5LC 2K9SA 2ZFUA 1SAXA 3KIOA 2K02A 4XRFA 4UXNA 1ZGAA 1ZRCA 5TJJA 2IGOA 4O5GA 1YLFA 1FX7A 1ULYA 4MQ9F 3G73A 2H1KA 3KLNA 2IXSA 3MVPA 1T08B 3L2UA 3HB9A 2IBDA 3MAJA 1W4MA 2XAQA 2A6TA 4L9NA 3HPSA 2L4MA 1S8NA 1G2FC 2ZBKA 1VQKI 4R2AA 4CCKA 2B9SA 5CJ9A 3X2QH 3JW4A 3B6CA 1JGSA 3BTJA 2XV4S 5J1YA 1E2XA 1Z91A 1AKHA 3K69A 4U0WA 4F54A 4F3QA 1EKEA 1WJAA 3OR2C 5EG0A 2ME6A 4Y7NJ 1LB2A 3CO6C 2UUZA 4L9JA 2EA4A 3M8EA 2GXAA 2Q8KA 4Y17A 2GZWA 3M99B 4DBQA 5GADJ 5DM7F 1RPWA 2OV7A 3EPZA 3FIGA 4LFBE 1YE9A 4FK5C 2DJIA 3I55I 1NG7A 1VI0A 4RM2A 5B66C 2P8TA 4LLGF 3JRFA 3CLQA 1W36D 3BG3A 1VZ0A 2P7VB 3S8PA 2V1XA 3E1SA 4B3ME 2XPWA 4CA0A 5LBQA 1GVJA 4GFBA 1B59A 4H0EA 1RKTA 4HQMA 3I59A 4DIQA 4F7ZA 3WU1B 2NVUB 5E3LA 1FLIA 2JA5J 4DUYE 1K6OA 4G6QA 4IOAF 1Y8RB 2YTQA 3GZNB 3ZOQB 1T4OA 1EJ9A 4GO1A 3HPHA 2AQFA 4I98B 1PP8F 3L09A 4ANJA 4AVPA 3WTVC 2EPPA 2PFBA 1OCCH 2KISA 4E4HA 1SMTA 1V3FA 3SZTA 1YI2I 3V7CA 2BYVE 3DFGA 3JRIA 3S17J 2EPUA 3A03A 4XR6A 2ODRD 1S5LC 5F08A 2STWA 5DD4A 1E3PA 3CUOA 3ESWB 2NUEA 5AE1A 5A6JA 2DA1A 1MDMB 2O5RA 3GF2A 1LDJA 3PSIA 5DEQA 2X0LA 2CRGA 2YSOA 4HX8A 2LBFA 3EUHA 4PGHA 4JK1X 4IOCF 1ZH5A 2HGCA 2LKPA 3SDGA 2DA4A 1FYKA 3RJPA 3HOYJ 4PUSA 2JJ7A 1U3EM 1YO5C 3DU6A
chains in the Genus database with same CATH topology
2A5YB 5FB2A 1MJAA 3C18A 1TW3A 1DUXC 1CF7B 4BHBA 4D0PA 5AIPA 1X3UA 4WF2A 4PCQA 3WGGA 3RIRA 2HFHA 2TDXA 2JSCA 2H27A 2YPRA 3CUQB 2KJCA 2XKPA 3H92A 3V4GA 3NEUA 2KJBA 3KEOA 5LGUA 3CUQC 2J5PA 4L18B 1IN7A 2GAUA 3TDUC 4NQWA 5CYVA 1U8RA 2QENA 2QQBA 4M71A 2CGPA 4A0YA 4MEYF 3L2CA 1IAWA 2GXBA 5BQTA 2Z3YA 4BYYA 1W5TA 3IKVA 3KEQA 2OQRA 1USSA 1Y0UA 1KU3A 1BC7C 5DUIA 1W7PB 3QAHA 2RN7A 4WXHA 4LD5A 3LSTA 3ZMSA 2BE5F 5JFRA 2OU2A 2EA2A 1B4AA 3HTSB 4XBFA 1J75A 4YFXF 3F23A 5L3EA 1F4KA 3HHHA 1ZYRF 2EJRA 4LG0B 4RB2C 2F5FA 4NB5A 3KCCA 1HQCA 2XRNA 4M9SA 1TQIA 3I4PA 1E17A 2HQRA 4OOIA 3I5UA 5ILUA 2GIVA 4ZYDA 2DBBA 3DXJF 5E8IA 3RKYA 4R79A 1P2FA 3LQQA 1KYZA 2K27A 2MLKA 3EDPA 2ISYA 2J5OA 2WV0A 4KIGA 2ACJA 1G4DA 3RI4A 4ETSA 2C6YA 2QBYB 3LA7A 5AONA 2P7CB 5JHUA 1AOYA 3KETA 5E1WA 5LHGA 4HV6A 5K5RA 3IRQA 2RGVA 1HKQA 4U7DA 4BXUA 2M45A 1YW7A 3M1EA 1HW5A 2A69F 5D5VB 4U7BA 1OPCA 4LJZF 1DPRA 1FYLA 1R5GA 1YQAA 1GXPA 3I59B 3VOEA 2O03A 3GX4X 1ZG1A 2QWWA 1T39A 1R1VA 3I0TA 1DDNA 2B0LA 1R00A 3F8BA 2M5WA 5FD5A 1B9NA 1S3JA 4MTDA 4CO8A 3ABTA 2Z33A 5J6XA 3ERED 4B09A 1ZG5A 4UUVA 1HKSA 1G3WA 4HA8A 3J81Z 3ZMZA 1XGOA 5ILSA 4IVNA 1R58A 2ETHA 4Q48A 4LB5A 2QLZA 3O2PE 4EVIA 1J0RA 4EMSA 4RGXA 2OQGA 4EJVA 5D6EA 3ZMUA 3LFKA 1USTA 4LFUA 2DLLA 2IA1A 5HVQC 1FZPB 3MZYA 4YG2F 4L9VA 5ERIA 2K4JA 3K1MA 1XSDA 2DPUA 1ONVA 3GFJA 3GFIA 5D6FA 3RKXA 2IT0A 1P4WA 1KU7A 5D5WB 1EH7A 2CG4A 2P5VA 1ZG3A 2FBIA 1HKTA 2DQLA 5LLQA 2UZKA 3L00A 4FT8A 3QRFF 5LEKA 2A6HF 1AWCA 1RNLA 4KUMA 1MJBA 3G3ZA 4OIRF 3NRVA 4MHGA 5JVTA 3E5UA 3BPVA 1TNTA 1BM9A 4UVCA 5LRSA 2RKHA 3P9KA 4Y15A 4O6JA 1PP7U 4BNCA 1BBYA 5DUKA 2P4WA 2XASA 2OZ6A 2KIUA 2H09A 1LQ1A 1HBXG 2A68F 3WODF 5HOOA 2A07F 2PJPA 2H94A 4LK1F 4S05A 2Z5UA 2PEXA 4BAYA 2F5EA 2QQAA 1R1UA 3WTWC 1QBJA 1TW2A 4HAMA 4IF4A 2K7LA 1I1GA 2ZMEA 3M8FA 4EJUA 2GA1A 3MZHA 2FEZA 1RUNA 3R6SA 3TQNA 1XGNA 3ZN1A 3BJ6A 1ODDA 2ZO4A 3HSRA 4P96A 5IT9K 2VC1A 1XSXA 1BC8C 4M9XA 1WI9A 4EV0A 2DU9A 2H6CA 3P9CA 2FNPA 3GZ5A 1DPUA 2IRFG 4GCVA 4HX7A 4LGWA 3ELKA 3RPUA 5HLGA 2PI0A 2V1UA 2G7HA 3TO7A 2EFOA 2Y48A 1BI0A 2XKOA 4M72A 5E20A 4R8HA 2W25A 3JAMK 2L4AA 4N9HA 2EV5A 4RB0A 2CSOA 3LAPA 2IPQX 4I2OA 1R36A 4ESBA 1XDUA 4CICA 3ZPLA 2A61A 1QQIA 4Q5SF 1HW1A 4LLLA 3D0SA 3QP6A 5HDGA 3QPHA 2R7DA 4L0YB 4EQQA 1R23A 3C7JA 3WU0A 4GYIA 2HTSA 3COAC 2CFXA 2ZJ2A 1R22A 1O7FA 3MFKA 4U88A 4YIIA 5LGTA 4KYWA 1EH6A 3IL2A 4MGRA 3E6MA 4M6YA 2AS5F 3HYIA 4FX0A 4OMYA 2QM3A 5LEJA 3J80Z 3F8NA 4P9FA 2HZTA 4HQEA 2HYGD 1XMKA 4G8XA 5J8CA 1SD7A 3BDDA 3EQLF 1D8KA 3JTGA 3TDZC 3TGNA 4QLCU 5E17F 3WTSC 2EK5A 3WTYC 4HYEA 2QBYA 3LAJA 1V4RA 1SD6A 1MKMA 3KE2A 1XGSA 2WTEA 2ZNYA 3ZMVA 1O57A 4JQFA 5LHIA 2RNJA 1Z05A 4O3MA 3ECOA 3RDIA 3GFMA 1OYIA 4PDKA 3DV8A 3ECHA 4ON0A 4BHPA 3FMSA 3FZVA 5JR3A 2A6EF 1U5TA 2YX4A 5ILVA 5ICFA 4ENMA 5H20A 4IRHA 3V7RA 2E7WA 5H6QA 4A6DA 1LDKB 2Y75A 4I7HA 5K5OA 1RZ4A 4EGZA 4UNOA 3E97A 4I0BA 2JTVA 2ZMEB 4UHTA 3BP8A 1TQPA 2JPCA 4P9UA 3ISPA 4GXOA 3DP7A 3BJAA 1O3SA 2FRHA 3VB2A 4XSZF 1FT9A 5CVRA 2D1VA 3V8LA 4A0ZA 5DCMA 3ZMTA 1T6SA 2UXXA 3ZQ7A 4N9IA 5A2QZ 2CO5A 1HSJA 4YIFA 2E1NA 3ZP5A 2PQ8A 5JI6A 2VBYA 4EJTA 1KA8A 1OR7A 2QQ9A 2DK8A 4A0XA 2BEOA 3U2RA 4ENJA 2DT5A 2OBPA 2G7UA 4EJWA 2LDUA 4ZYHA 4KT5C 2RV8A 3O3KA 5FLXZ 1BIBA 3MWMA 3N97A 1KGSA 1BI3A 1ON2A 2VC0A 3KP7A 2EV0A 1HXDA 2M1BA 1IF1A 4M6XA 2V79A 2VXZA 1H9GA 1H0MA 1ZARA 2QVOA 1UCRA 2FXAA 3O6BB 5L3FA 2VT2A 2V6CA 3LWFA 2XUBA 3DPTA 1SD5A 2O0YA 5K5QA 2HEOA 2E7XA 3DQVC 1XMAA 3Q9SA 1YW9A 3QOPA 1GHCA 4GGGA 1P92A 4FX4A 4PZJA 1G6NA 2PN6A 4IRGA 1I1SA 1O3QA 2PLYA 4HDVA 3KFWX 1LEAA 1OYYA 3BOQA 2R3SA 4WXDA 4IHTA 3FM5A 3ROUA 1OMIA 1MGTA 3JSOA 1FY7A 1FSHA 1WQ2A 1T98A 1SFXA 3HIFA 3PQKA 2NNYA 4XLNF 4WK8F 2Z9OA 1YTYA 1SFEA 4ESFA 1IXSB 4Z2YA 3FMQA 2QZ8A 2LNBA 4A2UA 1RI7A 4KN4X 5ICEA 1VTNC 1KQ8A 1UB9A 3QU3A 4ZZDA 4IXAA 3FF5A 4ZH4F 4A5MA 2H6BA 2O8XA 2L02A 1U5TB 3W6JB 1BIAA 2OZUA 4M73A 1QGPA 3C3WA 1U5TC 5EEGA 1XN7A 4NHJA 2NRAC 4P55A 4RAZA 3DKWA 1DP7P 3ABUA 3HSFA 3RYPA 1XDSA 1FWZA 4R1HA 2Y0MA 1KU2A 3TOAA 2NS0A 5HDKA 1P4XA 2EFQA 3DF8A 5D8KB 1XCVA 1ZRFA 2XAGA 4P5OA 3T8TA 2QUFA 3V8JA 4RGRA 2ZKZA 3IWFA 5DCMB 4M74A 4BQAA 3TO6A 2FQ3A 4QWQA 2KIFA 1FP1D 3FXUA 2LF7A 4G6DA 3KP3A 2EV6A 3MQ0A 5IT9Z 1XB4A 3ZN0A 3I53A 1FSEA 1IN5A 3E6CC 4RGUA 2DAOA 3SFZA 5HLIA 3PFIA 1TNSA 1YW8A 4G9YA 2G9WA 3JSPA 3QU6A 1XSVA 1CGPA 1D5VA 1PUEE 3HRSA 2ELHA 3SQNA 5FGMA 2K86A 1FP2A 3JAMZ 4AIHA 3KZYA 5L3DA 4BHCA 4IRIA 3TOBA 2DQRA 5HS9A 1TQMA 5HDNA 2DI3A 2HOEA 2IA0A 1I5ZA 1JE8A 4LMYA 2DPDA 3MCZA 3GFLA 3H3UA 1T2KA 1P6RA 1JHFA 3HTUA 4UVBA 4UV9A 3ML6A 1ZRDA 2XROA 2DO7A 2FBHA 1REPC 2YU3A 3FXQA 4CGZA 1L3LA 3ULQB 2HQNA 4WXCA 4ZYEA 2MH2A 1J7KA 3Q5FA 2LSOA 5D5XB 3PQJA 4ESJA 4KMUX 4UV8A 1F5TA 4CZZA 2HWVA 3KP2A 3KP6A 2AXLA 5DCFA 2JT1A 5DDGA 1ZAOA 1R7JA 2NYXA 1G3TA 4DNCA 4B8XA 5DV5A 5BOXA 2XVCA 1C0WA 3GW2A 4KDPA 2HTJA 2ZCWA 2ADUA 2YSRA 1JXSA 4AIJA 1Z6TA 3B02A 1PDNC 1YS6A 1IRGA 1IXRC 2VE9A 4KIBA 2ZFWA 2D2WA 3REOA 1D3YA 1S7AA 2W24A 3HRTA 3VODA 1J5YA 2MBFA 3IC7A 2VOOA 3I54A 4BH9A 4OMZA 3WG9A 2L54A 2F5CA 5E1XA 4I09A 5J8FA 4G7HF 1I27A 1J2XA 2HYFA 3HRUA 3WTXC 1LEBA 3L7WA 1K79A 2KIMA 3R0JA 3IKTA 5KK1A 1KYWA 3HUGA 1I6XA 5LHHA 4IPAA 1J59A 4MTEA 3GO5A 4EGYA 1QZYA 4HOBA 4CDGA 2R7FA 4AWXB 4Q4ZF 5D5UB 2W57A 2IP2A 1BOAA 1IXCA 1FBUA 2RDPA 3GWZA 4GYGA 4WX9A 4HF2A 3HSEA 2LF8A 3F21A 3HOTA 4HLYA 2IJLA 3Q9VA 3U9GA 3MEXA 1O7LA 2XIGA 5L3BA 3CO7C 1FBSA 2Q2EA 4RB3C 3TO9A 5K1YA 2PG4A 2W85A 1UFMA 3E3VA 4RB1A 3OV8A 5E8GA 3GUDA 4L0ZB 3ZMDA 2BGCA 3VEPA 2VE8A 3VFZA 3EYYA 5HLHA 1WWXA 3KP4A 1GXQA 3K2ZA 3GVAA 4MQVA 2FOKA 2VN2A 4OIOF 2PMHA 1U78A 1XD7A 3E5XA 1MD0A 4KMFA 5KVRA 2VOPA 3F6VA 5F6FA 2OAZA 1TBXA 3LA3A 4CYDA 5LRRA 2IW5A 2W84A 2WC2A 3I58A 3NQOA 5CVIA 3RPQA 5BPIA 3W6KB 4RS8A 1STZA 4WCGA 1F9NA 4CHUA 3WTTC 2P6TA 4HZFA 4HLXA 2HKXA 5DD8A 1LJ9A 4HBLA 2GA2A 4TV7A 4A6EA 2YR2A 5F1RA 2KRFA 2FA5A 4JBAA 2VT3A 1B9MA 1KQ9A 2RQPA 1BN5A 6PAXA 3IRRA 1YYVA 4E70A 3CDHA 1ZLKA 4AD9A 3S2WA 2FNAA 1FC3A 5D4SA 2ISZA 2NNNA 1B6AA 1XCBA 3WE3A 3E6DA 3R4KA 3WGIA 1TLHB 1ZHFA 5ICGA 1BI2A 4U0YA 1HW2A 4AIKA 1T0FA 3GEZA 5FO5A 2JPBA 3WTUC 3J80K 3SXYA 2OA4A 1RUOA 1OYWA 3WGHA 3H3ZA 1SD4A 3M9AA 2FE3A 3FMRA 3HHGA 3BWGA 2DFIA 1IZ1A 1EH8A 1IUYA 5E18F 3GXOA 2CW0F 3KP5A 4ZZLA 4HV5A 4Y13A 2PMUA 3IWZA 4ENKA 3LQRA 4OIQF 3JTHA 2XAJA 2EWNA 2OD5A 1XGMA 3RKWA 1D8JA 2FSWA 3T0YA 1IN4A 2M30A 2ESHA 4LB6B 3HRMA 2EFPA 1QZZA 2L01A 3F6OA 4HW0A 2CWEA 4OINF 4EM0B 4KN7X 1OKRA 2O6GE 2K4BA 5FFXA 3LA2A 3CLOA 1K7AA 2ZXJA 1A04A 5AIQA 5IT3A 1FNNA 1JHHA 5HS7A 4UVAA 4IJAA 1YG2A 1ON1A 2DK5A 1U6GA 3V8KA 2JZYA 3I64A 3FM3A 3SHFA 2XAHA 5BS6A 4O5VA 2Z99A 4ASNA 4EM2A 1KQ0A 3FXRA 2V1DA 3KZZA 4CXFA 4OU0A 2EFWA 2GQQA 4KFCA 5A2QK 2X4HA 2HS5A 2D1HA 4G94A 5FD6A 1U2WA 3CTAA 4RAYA 1YIOA 4LK0F 1G3YA 3T5XA 2A3SA 4KNYA 5ICCA 2GWRA 4EM1A 3BROA 1QNTA 1ZGJA 4OIPF 3K1NA 5FLXK 4U0VA 2RC4A 3WTZA 3U1DA 2VONA 3F8CA 1FPQA 4MEXF 3GLXA 3GYHX 1Z7UA 1IRFA 5D4RA 1WSUA 1K78A 1MZBA 2MA3A 2FF4A 3BJOA 2BBYA 3OOPA 5ED4A 3M7GA 2EFNA 4MNUA 2DTRA 3K1PA 5CVJA 3P9IA 4FHTA 3N4MA 4HF1A 2O3FA 2ESNA 3QP5A 2UWMA 3SZPA 2MC3A 5L3GA 3D5LA 4HF0A 1NHAA 3FHZA 2XAFA 2MLGA 2FMLA 2WWYA 5BMZA 5CVUA 3DPLC 2NAZA 4KIFA 1S29A 2HDCA 1QPMA 2MD5A 5EEHA 4A5NA 1R1TA 5CVVA 4L5IA 1SMYF 2FU4A 2L3DA 3RYRA 5F64A 2FBKA 3R61A 2V9VA 3FX3A 4DQ2A 3B73A 3RTRA 1W5SA 2DW4A 2M87A 5D8LB 3AAFA 3F22A 4KA4A 5L3CA 4HX4A 3WE2A 5DYMA 3F8FA 5CLSA 1B1BA 2XGXA 5FFZA 3EYIA 1YS7A 2EB7A 3BPXA 3K9TA 2O61A 3IHUA 4YFKF 4I02A 4XLPF 2UXNA 3J81K 1UHWA 3P7NA 1H9TA 1Z9CA 3F8MA 1ZREA 1WRJA 4Q47A 2VBWA 1FOKA 3I71A 3R60A 1MDMA 2ZNZA 1T38A 1RIOH 2COMA 3E6BA 2D45A 2IVMA 1J9IA 1WKMA 3F72A 3GZ6A 1IN8A 2YX7A 3QPTA 2VBXA 1O3RA 1W7PD 3BY6A 1CF7A 1KU9A 1UHMA 2JRTA 1Q1HA 3K0LA 2M8EA 4HDUA 5H6RA 4I01A 2VODA 3FWEA 1ZLJA 3KLOA 2STTA 3CUQA 4K2EA 1FYMA 1S6LA 1IW7F 4KICA 5TRDA 4ZYGA 1Z6RA 1YFHA 1F1ZA 4L9TA 1Z1DA 1S7OA 3TKYA 1TTYA 1BJAA 1P4AA 4M9ZA 1MJ9A 3R0AA 4N0BA 4RGSA 1O3TA 2BV6A 5HS8A 2GXGA 1FBQA 1ZN2A 2FMYA 3F3XA 2QYOA 1LVAA 1G3SA 1K78B 1QO0D 1SFUA 1R5HA 3L9FA 2P6SA 4LLNA 2VBZA 4XSXF 1W7PA 3DEUA 4IHSA 2CYYA 3C1DA 2CQKA 2HKOA 4YFNF 1EV7A 2F2EA 2KKOA 2RVCA 4ENNA 1LDDA 1L0OC 1IN6A 2E1CA 2MH9A 4WWCA 2IA2A 3EETA 3CJNA 3HOSA 4L5JA 1BI1A 1HSTA 4A12A 4G7OF 4EJOA 1LNWA 2PBIA 5BPDA 4LG0A 2Q0OA 4G7ZF 3BZ6A 2P5KA 3E5QA 3T8RA 4I0AA 2HR3A 4S04A 2F5DA 3V7SA 5LGNA 3T1BA 5E1ZB 2XHKA 3J7AO 4PGGA 2P5LC 1SAXA 2K02A 4XRFA 4UXNA 1ZGAA 1ZRCA 5TJJA 1YLFA 1FX7A 1ULYA 4MQ9F 3G73A 3KLNA 3MAJA 1W4MA 2XAQA 4L9NA 2L4MA 1S8NA 2ZBKA 5CJ9A 3JW4A 1JGSA 2XV4S 1E2XA 1Z91A 3K69A 4U0WA 1LB2A 3CO6C 4L9JA 2EA4A 3M8EA 2Q8KA 4Y17A