4WX9A

Crystal structure of mycobacterium tuberculosis ogt in complex with dna
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
164
structure length
161
Chain Sequence
VHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTSRTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALLELEKSRAPADLTLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*CP*CP*AP*TP*GP*(E1X)P*CP*TP*AP*GP*TP*A)-3')
publication title Crystal structure of Mycobacterium tuberculosis O6-methylguanine-DNA methyltransferase protein clusters assembled on to damaged DNA.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 42
structure length 161
sequence length 164
chains with identical sequence B, C
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2014-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4wx9A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4wx9A01
4L0YB 2VOPA 2NAZA 3KLOA 2K4JA 3I0TA 1G3WA 2STTA 1ZARA 3DKWA 1Z6TA 2P4WA 2XAFA 5FD5A 1WI9A 1JGSA 2G7UA 3HRUA 4O3MA 3LFKA 4Q5SF 2BBYA 2A3SA 1D5VA 1PP8F 2XAJA 2H94A 2HOEA 3VOEA 1J9IA 2VN2A 1BC8C 1QQIA 1G6NA 4ESFA 3V8JA 5DYMA 2EFNA 1T39A 4ON0A 1SD5A 4LFUA 2ZBKA 2QENA 2BEOA 3U2RA 3I64A 3BOQA 5D6EA 3V8LA 5L3GA 1STZA 2UXXA 4G6QA 2PLYA 1GVJA 1X3UA 2OZ6A 2DTRA 2H09A 4CGZA 4A5NA 4K2EA 4RAZA 2EFPA 3OV8A 2HGCA 5E20A 3K2ZA 3CO7C 2ISZA 4ENNA 2MD5A 2COMA 2Z33A 1U8RA 1Z7UA 3ABTA 5LGNA 4R1HA 1I1GA 2L54A 3KEOA 4UNOA 4S05A 3QRFF 3EUHA 2KIUA 4HOBA 4I7HA 4GYGA 4RGRA 4IXAA 2P6TA 2VONA 2XUBA 4EQQA 2WTEA 1B6AA 1D3YA 2R3SA 3QP5A 3E6MA 5HLHA 3BDDA 2HWVA 3L00A 1F1ZA 1SD6A 1O57A 3DEUA 2OZUA 4HX4A 5DUIA 1LEAA 4P55A 1IAWA 3Q5FA 1MKMA 2W25A 1O3SA 3NEUA 2IA2A 2O8XA 4L9TA 1IW7F 3I53A 1JXSA 5JHUA 2HR3A 5ILVA 4HLYA 3R4KA 4KT5C 2IP2A 5HS7A 4ZYGA 4Z2YA 4A2UA 1HKSA 5E8IA 1FNNA 1I27A 1SMYF 5FLXK 3NQOA 1QZZA 5LEJA 2P5KA 3E6DA 2YX4A 3KCCA 1D8KA 5E8GA 1IRGA 2X4HA 3BWGA 3RDIA 2LNBA 2ZO4A 3KZZA 2STWA 2HTSA 2XAGA 3FXRA 1R1UA 2Z5UA 2MH9A 1I1SA 1J0RA 3C1DA 3E6BA 4ESBA 4RGUA 1S3JA 2ACJA 3GZ6A 3BZ6A 3ROUA 4Y15A 5LRRA 2K7LA 3HHGA 1P2FA 2BE5F 2LF8A 4ENJA 1YIOA 4ZH4F 1F9NA 2DO7A 4KMFA 4ZYHA 1QBJA 1DPRA 4G6DA 2P5LC 4KMUX 3HTUA 4YIFA 3RKYA 4MHGA 3KP2A 4M9XA 1L3LA 1BM9A 2WV0A 3D0SA 1U3EM 4BHCA 3SXYA 4JQFA 3HRSA 1ZYRF 3LQRA 1FX7A 3IRQA 1HW2A 5HS8A 1TQMA 4UVCA 2ZXJA 2GXGA 2CW0F 3WTYC 3JAMZ 2MLKA 5BS6A 1OR7A 4WXDA 5FB2A 2RDPA 3K1PA 2XKPA 2P8TA 3V7RA 2D1HA 1RIOH 4I09A 1ZRCA 1B4AA 4M71A 5FD6A 2VE8A 1G3SA 3ECHA 1CF7A 5H6RA 2DK5A 4EJUA 2F2EA 5ICEA 1IN6A 1BOAA 4KA4A 2H6BA 4MTDA 1Q1HA 3GYHX 3J81Z 1YFHA 1TBXA 3DFGA 1KQ9A 1WWXA 4EMSA 3I5UA 3TO9A 1R5HA 2HZTA 4WK8F 2HQNA 4I0AA 3BPVA 5LHGA 3WGIA 2EFOA 4PGGA 2ISYA 5F64A 5F6FA 3F8FA 3I59A 3ML6A 3FZVA 5EEGA 2LSOA 4N0BA 3IWZA 3LSTA 2W57A 4ASNA 1SD4A 1KQ0A 1FYLA 5LBQA 1YW9A 4HX8A 1HQCA 2VODA 4IVNA 3LAPA 2FBIA 5L3CA 1ONVA 2JRTA 1SFEA 3TGNA 3WTTC 1K6OA 4HV5A 1SAXA 4HF1A 2PEXA 5CYVA 2FMLA 1KGSA 4OIRF 4KIBA 4OMZA 5ILSA 3BP8A 1FYMA 2X0LA 4U88A 3ZQ7A 2E1CA 3JSPA 3IHUA 2JPCA 4ZZLA 4CZZA 1YS6A 1LVAA 2XGXA 4OIOF 4LJZF 1HSTA 2Y75A 4WF2A 1QZYA 5CVUA 3L09A 1OPCA 3GXOA 3KFWX 4IHTA 3R61A 2WC2A 4L9VA 4U0VA 4LB6B 1OMIA 5HDKA 4RB1A 2QZ8A 1XDSA 3I4PA 1U6GA 1O3RA 3P9IA 4BYYA 1I5ZA 3KEQA 3WU0A 1O3QA 3KE2A 1D8JA 1L0OC 3WG9A 4NB5A 4JK1X 2P7VB 4ZYDA 4U0YA 3L2CA 2XAHA 2QUFA 1H9GA 1W5TA 3CUQA 3O2PE 1T6SA 3TQNA 3IKTA 2G7HA 3ZMUA 4YIIA 3FMQA 1QGPA 2FSWA 1DP7P 4HZFA 1B9MA 2V79A 2RGVA 3V7CA 4YFKF 1ON1A 2VC0A 2R7FA 2GXBA 1QPMA 1R7JA 3LQQA 1CF7B 2ZKZA 2EV6A 2CO5A 3T1BA 4FT8A 3GFIA 4ESJA 2KRFA 3CJNA 3GF2A 1IN8A 2QM3A 4FX4A 2QBYA 2A61A 4O6JA 3JTHA 3CTAA 4AVPA 1TNTA 1MJBA 1U5TA 4G7HF 4WXHA 1BI1A 1UCRA 4B09A 3H3ZA 2CGPA 5LRSA 4EJWA 2VT2A 1HW1A 4AIKA 4O5VA 4CDGA 3T0YA 1ZH5A 2NNYA 5D5XB 4G7OF 3E5XA 1XN7A 2VXZA 2OBPA 2QQBA 2EK5A 2OAZA 1O3TA 1ZG3A 1W7PA 2R7DA 4A0YA 4YG2F 3J80K 3RIRA 1KQ8A 5TJJA 2GWRA 4MEYF 1P4XA 1BIBA 3HRMA 3WE2A 2Q0OA 1KU7A 3GVAA 2PI0A 3VODA 2FRHA 1J59A 4S04A 5LLQA 2VBYA 3EDPA 2P6SA 3WTWC 2Q2EA 1R58A 1EH8A 2EV5A 3G73A 4YFNF 3F3XA 4AIJA 1KU3A 4RGSA 5ILUA 4PCQA 5ICGA 3D5LA 2CG4A 1IUYA 2PG4A 2F5CA 2GIVA 2KKOA 3KP3A 2DPUA 3U1DA 5ED4A 2EFQA 5BPDA 5LGTA 5JVTA 2JSCA 3Q9VA 1FOKA 1W5SA 3GX4X 2YSRA 4KN4X 4LB5A 5BPIA 5HLIA 1MJAA 2FMYA 3O3KA 4HLXA 3CUQB 1AOYA 2KJBA 2RNJA 1B9NA 5KK1A 1YYVA 1S7OA 2F5DA 2IPQX 2HKOA 5FFZA 2P7CB 2K86A 2A69F 2EJRA 3CLOA 2NYXA 3ZN0A 5J6XA 3BJOA 3EYIA 2DT5A 1FY7A 1ZRDA 2A5YB 1BN5A 3E97A 4GO1A 5ICCA 3VB2A 5D8KB 4EV0A 4RB3C 4H0EA 4UVBA 4UV9A 4OINF 1IXSB 5E1XA 1TTYA 1XDUA 2A6HF 3N4MA 3B02A 2HDCA 2BV6A 2QBYB 2O3FA 4IHSA 5H6QA 4WXCA 4ZYEA 3CUOA 2ESHA 1U5TB 4KN7X 4HF2A 3H3UA 4Y17A 1KU2A 1FYKA 3H92A 3J80Z 1BIAA 3F8NA 4LD5A 3JAMK 2LF7A 1J75A 4ETSA 2KIFA 4XLPF 2HKXA 1SFUA 2RKHA 2J5PA 3T8TA 5AONA 5HS9A 2RQPA 2O6GE 1ZGAA 4LLLA 4CHUA 4A12A 4HQMA 4R8HA 5CVVA 4WX9A 3WTZA 4P5OA 2KJCA 3EETA 1W7PB 1LDJA 2V9VA 4EGYA 4WWCA 1YO5C 1ZAOA 2DI3A 2ETHA 3ZN1A 4B8XA 3HTSB 2Z99A 3ZMTA 3J81K 2O61A 3I71A 2ADUA 1RZ4A 1XGSA 2VE9A 3RKXA 1JHHA 1LNWA 4QWQA 4Q47A 1XCVA 4QLCU 4MEXF 3WE3A 1OYYA 2BGCA 4LG0A 1T0FA 1E17A 1QO0D 2CQKA 2RC4A 1ZRFA 2IT0A 4HAMA 1C0WA 1FC3A 2DPDA 5LGUA 2DQRA 1PP7U 2KIMA 3FMSA 3QP6A 2ZMEA 3HOSA 2VBWA 1MDMA 3HUGA 1IRFA 2AS5F 5D4SA 3PFIA 4CO8A 4P9UA 2OA4A 2IVMA 1ODDA 3MFKA 1KU9A 3GEZA 1W7PD 1IZ1A 5D4RA 1KYZA 3IWFA 4IRGA 3RPQA 1FZPB 3I58A 4HDUA 3F8MA 4KFCA 1XSVA 2JZYA 2EWNA 1YTYA 4LMYA 2DQLA 5ERIA 5JR3A 5KVRA 3G3ZA 2FU4A 3RI4A 4L0ZB 1YW7A 2ZCWA 1LB2A 1WQ2A 2JTVA 1FP1D 4LLNA 1FBQA 2TDXA 2GA1A 4MQVA 3HIFA 4XBFA 5L3BA 1I6XA 2P5VA 3TOBA 4I01A 2EV0A 3ZMVA 5DV5A 4EVIA 2YU3A 5K5RA 5CVJA 2M30A 2FOKA 3KLNA 4U7DA 1FBUA 2RN7A 1HKQA 2AXLA 3P9CA 4BXUA 2HQRA 3DXJF 1P4WA 3DPLC 4OU0A 4XSXF 3GUDA 3WGHA 1JHFA 2G9WA 4XSZF 2A68F 4OOIA 3MCZA 4L5IA 3U9GA 2CSOA 3V4GA 1R1TA 2HEOA 3SFZA 4R79A 3WTSC 4BH9A 4A0ZA 2IJLA 3IC7A 1JE8A 5A2QK 3WU1B 2IRFG 3TO7A 2L4MA 5FO5A 2B0LA 3MQ0A 3RJPA 2JT1A 2W24A 3FMRA 1ZN2A 1OYWA 1V3FA 2MLGA 3FHZA 4EJOA 2W84A 3KP4A 3FM3A 1YLFA 4Y13A 4LG0B 5H20A 1ZG5A 2GQQA 1TW2A 2VBZA 1E2XA 1TLHB 1GXPA 4CYDA 1R00A 3F8CA 3K1MA 4AWXB 2ZMEB 5JI6A 2PN6A 5BOXA 2XVCA 4NQWA 4KUMA 4EM2A 1MDMB 3C7JA 3LWFA 4P9FA 4PDKA 1XGOA 1AWCA 3SZTA 5DUKA 2M45A 5D6FA 2J5OA 2JPBA 2RV8A 2XKOA 3QOPA 1OYIA 2W85A 3N97A 3LAJA 1BI0A 3F8BA 1LDDA 3WTUC 2MBFA 3M1EA 2XV4S 3ABUA 1EH7A 5HLGA 1FPQA 1XGMA 1R23A 4IF4A 1GXQA 1IF1A 4L9NA 3S2WA 1XGNA 1A04A 1LQ1A 3MEXA 5ICFA 4UV8A 4M6YA 1VTNC 3HRTA 2DAOA 2QLZA 3PQKA 4D0PA 3ZP5A 3TOAA 5EEHA 1XSDA 4EJTA 1IXCA 3R0JA 4U7BA 1ZREA 2A6EF 3TDUC 4GYIA 4YFXF 3W6JB 4EM0B 3RYPA 1DUXC 4NHJA 1XD7A 4RS8A 1G3YA 3DP7A 1HSJA 3R6SA 1ZGJA 2NNNA 3FF5A 5A2QZ 2L4AA 2ESNA 3RKWA 3ZPLA 4N9HA 3EYYA 1XB4A 1HXDA 2GZWA 4HF0A 1Z6RA 1ULYA 3M7GA 4I02A 2ZNYA 1K78A 4KIFA 1EV7A 5HVQC 2L02A 3BY6A 4MNUA 2XROA 4BHPA 5CLSA 5DCFA 5CVIA 4BQAA 2RVCA 5L3FA 5LHIA 3KP6A 3MAJA 4A6EA 3HHHA 3RTRA 5L3EA 1MJ9A 1WKMA 4Q4ZF 5J8FA 2PFBA 4IPAA 3K69A 4KICA 3WTVC 3FXQA 1YS7A 1R22A 2M8EA 3CUQC 2V1UA 4PGHA 1J7KA 4DNCA 3QAHA 3ECOA 2HYGD 2Z9OA 1SMTA 4UHTA 5IT9Z 4E70A 4UUVA 1QNTA 3WODF 5BMZA 1B1BA 3K1NA 4G8XA 5FFXA 3JW4A 4HQEA 2QQAA 1USSA 3J7AO 2K02A 4GGGA 3TKYA 2HTJA 1HW5A 1FBSA 2FE3A 4L5JA 4M9SA 1K7AA 2HYFA 3SZPA 5D8LB 4RGXA 1U5TC 2K4BA 1XMKA 1T38A 1SD7A 4F7ZA 1UFMA 4PZJA 4UVAA 2O03A 2E1NA 3CO6C 2LDUA 1XMAA 1LEBA 3EQLF 5HDNA 3V7SA 3DPTA 2YX7A 3BPXA 1YW8A 4BNCA 4OIPF 3SHFA 3DQVC 4DQ2A 3E6CC 4A5MA 2MH2A 2IW5A 4M74A 3TO6A 5LEKA 3LA7A 4CICA 3R0AA 1BI2A 2D45A 5BQTA 1KYWA 1MZBA 2VC1A 4HV6A 3WGGA 4MTEA 3K9TA 2K27A 3ZMDA 4U0WA 3TDZC 5D5VB 2FF4A 1FP2A 2MC3A 4RB2C 1S8NA 1NHAA 3F6VA 5D5WB 1K78B 1WRJA 3DV8A 3LA3A 2HFHA 2PBIA 3Q9SA 2EFWA 3ELKA 3KZYA 2D2WA 5LHHA 1EH6A 5FGMA 3KP7A 3OOPA 1LDKB 1T98A 2E7XA 3BROA 4RB0A 5K5OA 3GZ5A 5CVRA 4LGWA 1LJ9A 2VT3A 1B59A 1YG2A 1R5GA 1XSXA 3GWZA 4KIGA 3NRVA 1K79A 3R60A 3GO5A 2F5FA 3ULQB 1ZLKA 1ZLJA 2EA2A 1Z05A 1O7FA 2OD5A 4OIQF 4HA8A 1BJAA 3T5XA 3JSOA 4XRFA 4G94A 3REOA 5L3DA 3BJAA 2DFIA 4ENKA 3M8FA 2OQRA 3V8KA 1R1VA 3BJ6A 4ZZDA 1RUOA 5JFRA 3ZMZA 1FSEA 2DBBA 4EGZA 2PQ8A 1OKRA 2L3DA 3W6KB 2FBKA 2V6CA 4LLGF 3L7WA 1HKTA 1CGPA 3GFLA 4MQ9F 4LK1F 1Z9CA 3MZHA 3I54A 3HOTA 1J5YA 1FSHA 1MD0A 5IT3A 2Y48A 3VFZA 3QPTA 2E7WA 2FNAA 2FA5A 1DPUA 2GAUA 2XHKA 2Q8KA 3E5QA 2H6CA 3GFJA 6PAXA 1S29A 2EB7A 4M73A 2OQGA 3FXUA 3L9FA 4M6XA 1ON2A 3ISPA 1Z91A 1V4RA 5DCMA 2VBXA 2DK8A 5E1WA 3QU3A 1P92A 1YQAA 3MWMA 3IKVA 3COAC 2XRNA 1RUNA 3RPUA 2BYVE 3O6BB 2IA1A 2MA3A 2CWEA 1IN5A 2OU2A 1Y0UA 4AIHA 2FXAA 2ZFWA 3HYIA 1T2KA 1H9TA 2FBHA 4M72A 2VOOA 5DD4A 4KYWA 4GXOA 2XAQA 1BBYA 5FLXZ 3E5UA 4MGRA 2PJPA 4G9YA 4OMYA 1PDNC 1SFXA 2QVOA 4Q48A 4KNYA 1FWZA 1MGTA 2ZNZA 4M9ZA 3HSRA 5J8CA 1S6LA 2XIGA 4EM1A 1USTA 4CXFA 1ZHFA 4TV7A 1DDNA 3JTGA 3SQNA 5D5UB 2CFXA 2V1DA 1UHMA 1BC7C 1FLIA 4LK0F 3F23A 5HDGA 3HSEA 2DW4A 5AIQA 4HDVA 4GCVA 4HBLA 4A0XA 1O7LA 1U2WA 4FHTA 5K5QA 2O0YA 1UB9A 3PQJA 1H0MA 4HX7A 1IN4A 4UXNA 1F5TA 3IRRA 3C18A 3FX3A 1TNSA 4L9JA 3M8EA 3WTXC 1RNLA 3T8RA 2L01A 3P9KA 5F1RA 4IRIA 1RI7A 5IT9K 3HSFA 2FQ3A 1FT9A 3E3VA 1KA8A 4L18B 4N9IA 4I98B 5HOOA 1UHWA 2M5WA 3AAFA 1IN7A 3GLXA 5TRDA 4IRHA 2Y0MA 3KETA 3F72A 5DCMB 2QYOA 4RAYA 3QU6A 3KP5A 1P4AA 3M9AA 1G3TA 1R36A 2UZKA 2A07F 4HYEA 5DD8A 3F22A 2M87A 2QWWA 4I2OA 4IJAA 1Z1DA 4G7ZF 4JBAA 2NRAC 3GW2A 1P6RA 2FEZA 2M1BA 2F5EA 3K0LA 3CDHA 3P7NA 2ZJ2A 3FM5A 2IA0A 2PMHA 4A6DA 1F4KA 4AD9A 2CYYA 3RYRA 1TQPA 4ENMA 1J2XA 2HS5A 1IXRC 3C3WA 4FX0A 4WCGA 5E17F 3ZMSA 2DLLA 5AIPA 3MZYA 5CJ9A 3B73A 4BHBA 2PMUA 2DU9A 4P96A 1U78A 5DDGA 3F6OA 5K1YA 2QQ9A 2UXNA 2YR2A 2C6YA 2EA4A 2FNPA 3VEPA 2V1XA 2GA2A 1TQIA 1W4MA 3FWEA 5E1ZB 3I59B 2ELHA 4I0BA 4XLNF 3LA2A 2D1VA 1GHCA 2H27A 3QPHA 3ERED 3DF8A 1S7AA 1HBXG 4BAYA 4KDPA 5DEQA 2XASA 3GFMA 5E18F 2UWMA 2YPRA 2NS0A 3IL2A 1REPC 4EJVA 1ZG1A 4HW0A 1BI3A 1XCBA 1G4DA 1WSUA 1PUEE 2WWYA 3F21A 2LKPA 2Z3YA 1TW3A
chains in the Genus database with same CATH superfamily
4DOZA 4L0YB 2VOPA 2NAZA 3KLOA 2L2MA 3LL7A 4Y4RA 2K4JA 3I0TA 1G3WA 2STTA 1UJ8A 4F91B 1DU6A 1ZARA 3DKWA 2EPRA 1Z6TA 2P4WA 2XAFA 5FD5A 4DUZE 1POGA 1WI9A 1JGSA 2G7UA 3HRUA 3W2WA 4O3MA 3LFKA 3H9GA 3DLLF 2HYJA 4M3DA 4Q5SF 1LLMC 2BBYA 2A3SA 4XOPA 1ZR9A 1D5VA 1PP8F 1PJQA 2XAJA 2H94A 4BE0A 1N77A 2HOEA 1VZ0A 4II2A 1G59A 5J3LA 3VOEA 2VLAA 2CV2A 4AQYE 2EIJH 1J9IA 3J7AY 2VN2A 1BC8C 1A1HA 1QQIA 1G6NA 2PMZA 2IXSA 3OIPA 4IEJA 4ESFA 2MDGA 3V8JA 3QYEA 3CMYA 3DU6A 5DYMA 2EFNA 3J81C 2R76A 4QPQA 2EOYA 3UK3C 1T39A 3CCSI 4ON0A 1SD5A 2L0KA 4LFCE 2EWLA 4LFUA 2A25A 2YS9A 2ZBKA 2QENA 2BEOA 4IQ4A 3U2RA 3I64A 3BOQA 3OYBA 5D6EA 3JU0A 3V8LA 4F52A 5L3GA 2ME0A 2EMXA 1W1WE 1STZA 2UXXA 4G6QA 2PLYA 2ZJRF 5E79C 1GVJA 1B72B 5F08A 5KL6A 1X3UA 2OZ6A 3CP2A 4JYAE 2DTRA 2H09A 2YTPA 2VE7C 1MNDA 2N8GA 4CGZA 4A5NA 2JWTA 4DYQA 4K2EA 4RAZA 4XL9A 4YRVA 2EFPA 3L2VA 5KL7A 3OV8A 2HGCA 2V89A 3B6CA 3CCQI 1AKHB 5E20A 1AA7A 3K2ZA 3CO7C 2ISZA 4CCMA 2O9LA 2QSGX 4ENNA 2MD5A 2H1KA 4B44A 1S9HA 2COMA 2Z33A 1U8RA 2MC5A 1Z7UA 3ABTA 3LMLA 5LGNA 5GTHC 2EOJA 4R1HA 1I1GA 2L54A 3KEOA 3CC4I 2LJUA 1TWFJ 1E3OC 2E2HJ 4UNOA 4S05A 3QRFF 3ADLA 3EUHA 1HNWE 2KIUA 4HOBA 4I7HA 2IGKA 4GYGA 3OR1C 1BR4A 1Z1BA 3HB9A 3X2QH 5J1RA 4RGRA 4IXAA 3DWLE 3GBGA 5JHFA 2P6TA 3QYBA 3S1NJ 4M3GA 2VONA 2XUBA 5FLMJ 4EQQA 2ELZA 1VI0A 2WTEA 2YTDA 1B6AA 1D3YA 2YTIA 4IKFA 2KDZA 2R3SA 3QP5A 3E6MA 1BW6A 5HLHA 4QPOA 1LKXA 3BDDA 2HWVA 1MMAA 2NVYJ 3IAM2 4LF8E 3L00A 1F1ZA 5T6JA 1SD6A 4DR4E 1O57A 3DEUA 2M9AA 1ETYA 2OZUA 4HX4A 3QOEA 4L8NA 5DUIA 3CCUI 4X62E 2NVXJ 2WAQA 2Y0SA 2LUPB 4UUTA 4LITA 1ETOA 1LEAA 5E3NA 4Y33A 3W3CA 4P55A 1IAWA 4NC7A 3SDGA 3Q5FA 2ODRC 4B3RE 2NS7A 1MKMA 2W25A 1O3SA 2DMTA 3NEUA 5M5WJ 1LPQA 2IA2A 2GOXB 1ETQA 4ZDPA 4CCOA 2O8XA 1VQMI 4L9TA 1QVUA 5A6BA 5J4VA 2EOOA 4EEFG 5M5XJ 1IW7F 2YTEA 3I53A 1JXSA 2M2EA 4I99C 5JHUA 2HR3A 4M3BA 5ILVA 4CYCA 4HLYA 3R4KA 4KT5C 2IP2A 5HS7A 4ZYGA 1TZLA 4E7HA 3OSFA 2X6YA 4Z2YA 4A2UA 1WH5A 1HKSA 4BL0B 5TGTA 5E8IA 3OYLA 1FNNA 3I9V2 1I27A 1SMYF 2K3PA 5FLXK 1R4NB 3NQOA 1QZZA 5LEJA 2EPNA 2L7KA 2IEKA 2P5KA 4MFEA 2VL8A 2EOHA 1LE8B 3I4MJ 2EN4A 1K6YA 3E6DA 2GHFA 2YX4A 3KCCA 1D8KA 5E8GA 2E5LE 4RAFA 1IRGA 2K7IA 3E7LA 2X4HA 3BWGA 3RDIA 2LNBA 2ZO4A 3KZZA 2STWA 1T95A 3UKGA 1IG7A 4A3DJ 2HTSA 1H8AC 2XAGA 3U1KA 2JA8J 1GZ6A 2DOFA 1X47A 2CUJA 1VNDA 2R5ZA 1TF3A 2QQ8A 3FXRA 1R1UA 3C4BA 3HEFA 3C2GA 2Z5UA 1MNEA 2MH9A 5IWAE 5F27A 3EPHA 1I1SA 1J0RA 3C1DA 3E6BA 4ESBA 1DI2A 3OL4A 3OMLA 3HPZA 4UB6C 3G6EI 4RGUA 3OYJA 1S3JA 2CQNA 2ACJA 4DYRA 4XN3A 4XR6A 3CDIA 2OTLI 3S1MJ 4LF9E 3GZ6A 3BZ6A 3OWTA 3ROUA 2EMGA 4Y15A 5LRRA 1WGXA 4HTGA 1VFCA 2K7LA 3HHGA 3D5SC 2EM0A 2FD5A 1ZR2A 4OOGC 4JI4E 3KYDB 1P2FA 4IHYA 2BE5F 3HKZN 2LF8A 4LG3A 2W1OA 1YIOA 4ENJA 3V42A 2R0QC 4D9JA 5JLWA 1JT6A 4ZH4F 1F9NA 2DCEA 2DO7A 4KMFA 5J40A 4ZYHA 1OJLA 1Y1VJ 1Z77A 4FASD 1QBJA 1DPRA 4G6DA 2KPMA 2V9KA 4DIQA 2P5LC 4KMUX 3HTUA 4YIFA 3RKYA 4BXXJ 1TP4A 4MHGA 3KP2A 2K40A 1MBEA 1RKWA 4M9XA 3S3NA 1L3LA 1F36A 1PUFA 1D1AA 3K4CA 3RQ4A 1BM9A 1B8IA 2WV0A 3D0SA 4AYBN 1U3EM 4BHCA 1NCSA 4DBQA 3SXYA 4JQFA 3H35A 1ZYRF 1P7IA 3HRSA 3LQRA 3IV5A 2GXAA 1UILA 1FX7A 3IRQA 1HW2A 5HS8A 2BVMA 2DJIA 1YJ9I 4RM2A 1YITI 2HVSA 3CJRB 1X5WA 2WBTA 5AC5A 1TQMA 3SZGA 2IAIA 4F92B 3AV0A 4DV6E 4UVCA 3RKQA 1ITYA 2ZXJA 2GXGA 3Q0VA 4JI1E 2CW0F 3WTYC 3ZQGA 3JAMZ 2K9LA 2MLKA 3OIOA 2F48A 3BG7A 5BS6A 1JKRC 2HPMA 1OR7A 5DS9A 3CCEI 3C6MA 2ENAA 3K10A 4WXDA 5FB2A 5J4YA 2RDPA 2QEXI 3K1PA 1J26A 2F4VE 4BS9A 1QVTA 4JV5E 2XKPA 3BCBA 2P8TA 3V7RA 3PNYA 2D1HA 1RIOH 5A6JA 3S2DJ 2LVHA 4I09A 4D7MA 1FTZA 5LFAA 2EPFA 5M3FJ 1ZRCA 1B4AA 4M71A 2R7VA 1I6HJ 1PYVA 2WBMA 3FBNB 3ZXSA 1IBKE 4K0KE 5A6KA 5FD6A 2X6WA 3KEYA 4IS1C 2VE8A 3ZQCA 4R2DA 1FJLA 4CCLA 4JI7E 4D5CA 1G3SA 3ECHA 1CF7A 2EP3A 3H5NA 5H6RA 2CPNA 2DK5A 3D1NI 4EJUA 1ACIA 2F2EA 1ETVA 3BTLA 2CJJA 5ICEA 2R7SA 1BOAA 1IN6A 4A3IJ 4KA4A 2H6BA 1YJWI 4MTDA 2M0CA 3BBGA 1SAUA 1Q1HA 2YTNA 3GYHX 2MDRA 3J81Z 1YFHA 2PX9A 1TBXA 3DFGA 3ZRGA 2DLQA 2YU8A 1VQOI 2L3CA 2EQ3A 1KQ9A 1QZEA 2KT0A 1WWXA 4EMSA 4Y52J 2EPXA 4BQQA 3OS2A 2N8XA 3JTZA 3I5UA 1BA5A 5IP7J 2V83A 1P47A 3TO9A 2L3JA 1PVEA 1R5HA 2HZTA 4WK8F 1S7EA 1X3ZB 1JTXA 2HQNA 1SVOA 2TCTA 4I0AA 1A1FA 2JUCA 3BPVA 5LHGA 3WGIA 2EFOA 4PGGA 2ISYA 5F64A 5F6FA 3KX2A 2VPRA 3F8FA 3I59A 3ML6A 2LBFA 4PK4A 3FZVA 4CYCB 3ZQLA 2V87A 5EEGA 1E0EA 4PUSA 4LF6E 2LSOA 4N0BA 3IWZA 3LSTA 2W57A 2W48A 4KZSA 4ASNA 1MBFA 1SD4A 1KQ0A 2HZDA 3IH4A 2W4SA 1FYLA 3W6VA 1GDTA 5LBQA 1YW9A 4HX8A 3JCUC 2EM4A 1HQCA 5EGOA 2JY9A 4P78A 3VYYA 2VODA 4IVNA 3BC8A 3LAPA 3HL2A 2EPCA 2FBIA 1FOXA 5L3CA 4A93J 1ONVA 4FTHA 2E34A 2JRTA 4IHWA 1SFEA 2EZKA 3TGNA 3WTTC 3W2VA 1K6OA 4HV5A 3HJEA 4E7KA 1SAXA 3WHCA 3ADGA 4HF1A 3L2WA 2PEXA 3S14J 4XRSG 5CYVA 2R5ZB 5GP9A 3CMMA 1RR7A 2E1MA 1AU7A 2FMLA 1YYWA 3A2KA 3BF2A 1KGSA 4OIRF 3RZOJ 4MLQA 4UUSA 3CESA 4LIUA 4KIBA 4OMZA 5ILSA 3BP8A 4A3CJ 3G71I 3DF6A 1FYMA 4R8OA 4KITB 2X0LA 3AG3H 4U88A 3ZQ7A 1XG1A 1SFOJ 2E1CA 2PJRA 3RZDJ 1NEIA 2L9NA 5CKTA 2MC4A 2DMNA 3JSPA 3IHUA 2JPCA 4ZZLA 4CZZA 2CFOA 2F5VA 4E7LA 3MKLA 1YS6A 1LVAA 2XGXA 3TP0A 2Y9YA 3TW6A 4LJZF 2YU9J 1ZR4A 1HSTA 4OIOF 2DXIA 3DJWA 1X2MA 2Y75A 4M3EA 4WF2A 3A02A 4IQJA 3VYXA 2EPOA 1QZYA 5CVUA 3HOVJ 4CZCA 4JI6E 3L09A 2J7JA 1OPCA 3LSGA 3GXOA 4BCAA 3KFWX 1Y6IA 1JJ8C 4DR3E 4IHTA 3R61A 2CS3A 4QIWN 1X48A 1YX3A 2WC2A 4L9VA 4U0VA 1TF6A 1P9QC 5B1BH 1PUFB 3CP8A 1OMIA 4LB6B 5HDKA 1B8IB 1TWAJ 4RB1A 2QZ8A 1XDSA 5M3MJ 2X9DA 3J80C 3I4PA 1U6GA 2K3FA 1X6FA 1O3RA 3P9IA 1JK2A 2CH0A 4D7NA 4BYYA 4ANJA 1I5ZA 3KEQA 3WU0A 1WJCA 1O3QA 3KE2A 1Z3YA 2L9RA 1D8JA 1L0OC 3WG9A 4NB5A 2N3HA 4XLHA 1K4TA 3ZGKA 2VKHA 4NZVA 3GZNB 2P7VB 3FXLA 4JK1X 4ZYDA 4U0YA 1MBJA 2E35A 2XAHA 2QUFA 1H9GA 1W5TA 4XRMA 4F55A 3MKYB 3L2CA 2DGCA 4BBRJ 3CUQA 3SDBA 3BR0A 1X1PA 3O2PE 1R5ID 1T6SA 3PSFA 2DIXA 3TQNA 3IKTA 2G7HA 3ZMUA 4Q35B 4WPYA 4YIIA 3FMQA 1FIAA 1QGPA 2FSWA 3Q3SA 5GAEJ 3PIPF 1TWCJ 4HZFA 1DP7P 1RMDA 1B9MA 1V5FA 2QGUA 2LK2A 2V79A 1NK3P 2RGVA 2LH9A 3V7CA 5AASA 4YFKF 2KZVA 1XNQE 1ON1A 2VC0A 2Y31A 2QSFX 2R7FA 4XLEA 2GXBA 5DTDA 1IQSA 1QPMA 2LC2A 1KJKA 3CDLA 1R7JA 3LQQA 1CF7B 2ZKZA 3NARA 3ZCOA 2EV6A 2CO5A 3T1BA 4AM3A 2EIKH 2XPVA 4FT8A 3GFIA 2KMUA 4P7DA 2KRFA 3CJNA 3G1LA 3GF2A 4ESJA 1IN8A 2WAEA 1UMQA 1R71A 1MNMC 4FE4A 2QM3A 4FX4A 2ZC2A 2QBYA 4IOAF 5IYCJ 1ZQ3P 5C4XJ 2ZSIB 2A61A 4O6JA 1X1AA 3JTHA 2YPNA 2UUAE 3CTAA 4XORA 4BJTA 3OR2C 4AVPA 2K4VA 1ZGWA 2ZSHB 1TNTA 1MJBA 1U5TA 1VQ8I 2X85A 3OYDA 4G7HF 4PFOA 4WXHA 1BI1A 2F6CA 1UCRA 4B09A 2HJJA 5LD2C 3H3ZA 2LTPA 4PSWA 2CGPA 5LRSA 1EKZA 5AE2A 4EJWA 2VT2A 3VYTB 2JQ7A 2E19A 1HW1A 1VQ5I 2O5RA 4AIKA 2LBFB 5LMUE 2CV0A 4O5VA 5E3LA 4F93B 4CDGA 2EM6A 2JVHA 1HR0E 3CMAI 3T0YA 1ZH5A 2NNYA 5D5XB 3Q0WA 4G7OF 3E5XA 1XN7A 2RAEA 2VXZA 1TN9A 2OBPA 4V2GA 3J7Yp 4E7ZA 3M4OJ 4RH8A 5EGOB 3FBIB 2QQBA 2EK5A 4V19K 2OAZA 3I3LA 2XF7A 2K5CA 1O3TA 1ZG3A 3HOYJ 4XK4A 1W7PA 2R7DA 4A0YA 4YG2F 3WG7H 3J80K 2DDAA 3RIRA 1KQ8A 3B6AA 2DT7B 1SFKA 3CMEI 3ADIA 5TJJA 4HNTA 2E1MB 1MSEC 4L5EA 2GWRA 4MEYF 1P4XA 4UUSB 1WFXA 1BIBA 2PMZN 3HRMA 3WE2A 1W0TA 2KQRA 2Q0OA 5FKLA 1KU7A 3GVAA 3CCMI 1E3PA 5BNGA 1VQKI 2IS1A 3WHBA 2EOSA 2PI0A 4DV4E 2IGMA 2PJRB 2ADRA 1SVMA 1Z21A 3CC2I 2JVAA 4O4KA 3VODA 1HLVA 2WBSA 1W36C 1M1EB 2FRHA 3S32A 3BQYA 4S04A 1J59A 3FIWA 4BU2A 5LLQA 2VBYA 3EDPA 3FK6A 4NQWB 2EOIA 4F9CB 2P6SA 3WTWC 1KZHA 2Q2EA 1R58A 1EH8A 4RA2A 2M4KA 3DU5A 2EV5A 4R2CA 3A0BC 1IRXA 1A5JA 2BB8A 3BG3A 3G73A 2GOMA 4YFNF 3GTOJ 3F3XA 3HPSA 3BQZA 4AIJA 1KU3A 2ID3A 2V8QB 4RGSA 5ILUA 4PCQA 3OYGA 3PNVA 4RLQA 3E0JB 4BE1A 2K9SA 4B3XA 2L5QA 2M7BA 1YHQI 5ICGA 2RTXA 3D5LA 1TT0A 2EPUA 2CG4A 5E3MA 1IUYA 2PG4A 3GTLJ 2F5CA 1PJRA 1YRNA 1MMSA 1RC9A 2GIVA 1IGNA 3OYNA 2KKOA 4BC7A 1UN6B 2L2OA 2KP6A 3RMPA 3KP3A 2DPUA 1B69A 1IRZA 1IQOA 4YELA 5FKKA 3FHNA 4S0HB 3U1DA 3H3VK 5ED4A 2EFQA 5BPDA 5LGTA 5JVTA 3AUZA 2JSCA 3Q9VA 2LVSA 1FOKA 3CF5F 2OTJI 1W5SA 3GX4X 1FIPA 1ZBQA 2ELKA 2D5VA 2YSRA 2I9IA 1DQUA 4KN4X 2W00A 2FX0A 4NDLA 2VPLA 4LB5A 5BPIA 3EUAA 4HNUA 3L2QA 2HVRA 2JA2A 1IV6A 5HLIA 4DUYE 2EPLX 1MJAA 1FMWA 2BHYA 2FMYA 3O3KA 4HLXA 4XMYA 3CUQB 1A36A 1AOYA 2KJBA 1I3QJ 2RNJA 5F04A 1B9NA 1R6RA 5KK1A 1YYVA 1S7OA 2F5DA 2IPQX 3JR9A 3PUFA 1O4XA 2HKOA 5FFZA 4YHHE 2E1OA 2TRTA 2LR8A 2YSOA 2P7CB 2WCC3 4C3IJ 2WAQN 2Y0SN 1WJPA 3BG9A 4J8ZA 2KLOA 4IL6C 2ELYA 2CQXA 2K86A 2BOLA 1MMNA 2A69F 1MMGA 2EJRA 1D0ZA 3CLOA 3ABKH 3HOXJ 2LKXA 2JA6J 2NYXA 3GLLA 3ZN0A 5J6XA 1W0UA 3BJOA 3EYIA 1AAYA 2DT5A 3K4NA 1HCRA 1YYOA 1FY7A 5EYRA 1ZRDA 2A5YB 1BN5A 3AG2H 3E97A 3M1CA 2CSHA 2DJNA 4GO1A 1NK2P 5ICCA 3VB2A 5D8KB 4EV0A 4RB3C 3Q0UA 4H0EA 1ETKA 1JUMA 4UVBA 4UV9A 4OINF 3ASNH 1IXSB 5E1XA 2YUSA 1TTYA 1XDUA 2A6HF 3N4MA 3B02A 2HDCA 2BV6A 2QBYB 2O3FA 4IHSA 5H6QA 3PL8A 2ZXWH 4M9VC 2HOTA 4WXCA 4ZYEA 3CUOA 4ZTJA 4FETA 2ESHA 3OYHA 1VQPI 2E72A 2NUGA 2KISA 3J7YJ 1U5TB 4KN7X 1XPXA 4HF2A 4LU9A 3DKXA 3ZOQB 1ZTRA 3H3UA 4Y17A 1KU2A 1FYKA 3H92A 3J80Z 2L9SA 1BIAA 5FROA 3F8NA 4PSXA 1X1DA 3VSKA 2VI6A 4LD5A 3JAMK 1LVKA 2LF7A 4BJ6C 1K4SA 2EM8A 2H8WA 1J75A 4ETSA 2KIFA 4XLPF 2HKXA 1SFUA 5FKNA 1RRJA 2EMBA 2RKHA 3LLHA 4Y7NJ 2J5PA 3T8TA 5AONA 3A1YA 5HS9A 4DR5E 2RQPA 1A31A 2O6GE 1ZGAA 3PFYA 3A0HC 5B5EC 4LLLA 4CHUA 4A12A 4HQMA 4IHXA 4D1QA 4WYQB 1T4LB 2VQCA 1X1CA 1FKAE 1DU0A 4R8HA 3SFIA 5CVVA 2IS4A 4B3AA 2EPMX 4WX9A 3MVPA 4XONA 4RHBB 1MEYC 3WTZA 3JRAA 3OYFA 4GKJE 4PJ0C 1PJTA 4P5OA 2KJCA 3EETA 1XMOE 1TC3C 2VJJA 2VUMJ 1W7PB 1LDJA 2EMHA 2V9VA 3K6GA 3K4BA 2MD0A 4EGYA 5CQEA 4WWCA 1YO5C 3VSLA 5IXMB 3WU2C 1ZAOA 2VKEA 4AIDA 2DI3A 2JWOA 2BY3A 2EZIA 2W82A 2R7RA 2ZXIA 2ETHA 2X48A 2RSIA 3FISA 3ZN1A 1W36D 5EF6A 4B8XA 3HTSB 2MABA 2Z99A 3ZMTA 3J81K 2O61A 4DV3E 2QKLB 3BCAA 3I71A 3G4SI 1D0YA 4B1RA 2ADUA 2DMPA 4JI5E 1Z67A 1RZ4A 4BY1J 4B3TE 3TMOA 1APLC 1OLTA 3EPKA 3BR6A 1XGSA 4X1EA 3RKXA 2VE9A 1JHHA 5EG0A 4MO7A 1LNWA 4QWQA 2MW8A 4R2AA 1JI8A 2Q2EB 1QRYA 4XKBA 2YT4A 2CUFA 4Q47A 1XCVA 4HNVA 4QLCU 4MEXF 3WE3A 1OYYA 4V2FA 1T33A 4MLOA 1R4MB 2BGCA 1EF4A 4LG0A 1T0FA 3DPUA 3EUHC 1E17A 2EQ1A 1QO0D 2CQKA 2RC4A 3I56I 1ZRFA 2IT0A 4HAMA 4RM3A 1C0WA 1HC8A 1FC3A 4XIDA 2GIZA 4DMIA 2EIMH 2DPDA 1ZBTA 5LGUA 2DQRA 1PP7U 4M6VA 4E4HA 2KIMA 2KZGA 1GUUA 3FMSA 3QP6A 5K7FA 4A3KJ 2HGHA 3K70C 2ZMEA 3HOSA 1YRNB 2EN2A 2YRMA 2VBWA 2XGCA 4G6TB 1MDMA 3JRGA 3HUGA 1WJ5A 1IRFA 2EOZA 3MZ8A 2AS5F 5D4SA 3PFIA 4NC8A 4CO8A 2GBYA 2OA4A 4P9UA 1YJNI 3THNA 2ECCA 2JVGA 1D5YA 3H1CA 2DTZA 5FKOA 4WSGA 1BBGA 5A2QC 2IVMA 1X1BA 1ODDA 3MFKA 2RQQA 4YIRX 3S1RJ 4R2SA 1KU9A 3GEZA 2CT1A 1KYQA 1W7PD 2M4IA 2PRTA 3O8GA 1IZ1A 5D4RA 1KYZA 3IWFA 4IRGA 3F6HA 4BEHB 3DLAA 1IBME 3RPQA 1OFCX 1U9OA 1FZPB 1MBGA 2IBDA 1GV2A 2HDDA 1Q1VA 2HQAA 3I58A 3HPGA 2UUBE 4HDUA 3HBLA 3F8MA 4KFCA 5F0CA 1XSVA 2Z2SB 1QPIA 2JZYA 4JI0E 1YOVB 2EWNA 1YTYA 4LMYA 2DQLA 2BXZA 5ERIA 2F4OB 5JR3A 5KVRA 3G3ZA 2FU4A 4GRIA 3RI4A 4L0ZB 1YW7A 2ZCWA 1LB2A 3MD2A 4ZJZA 4OX9E 2RNGA 1WQ2A 4CCNA 2YTFA 2WY7Q 1UBDC 2JTVA 4X8WA 1FP1D 3HGGA 4DYCA 4LLNA 1ORKA 1FBQA 4XNFA 2DMQA 2FGGA 2NVTJ 2TDXA 2GA1A 2JXPA 4MQVA 2E5ZA 3HIFA 4XBFA 5L3BA 1I6XA 4R03A 2P5VA 3L2RA 3VK6A 4P1WA 5GAHJ 3TOBA 1A1JA 2EN8A 4I01A 3THOB 2EV0A 4O24A 3ZMVA 3S3MA 1MH3A 3BGHA 4RAGA 1RQ0A 4OAYA 1VQ4I 5DV5A 1X6EA 4EVIA 3HOZJ 2YU3A 5K5RA 1GLNA 2EINH 5IV8B 5CVJA 3OYMA 2EL6A 2CUZA 2V88A 2KONA 3C4TA 4WSPA 4JI2E 2M30A 3W2AA 2FOKA 2L8TA 5KL5A 3P1XA 4F3QA 3KLNA 4U7DA 2L7ZA 4UY8I 4NHRA 5GAGJ 1FBUA 4N4RB 3HKZA 4BY7J 2RN7A 2JK3A 1HKQA 5IT9C 1IMUA 2AXLA 3P9CA 4BXUA 2LTSA 1U8BA 4JX5A 2HQRA 4BJ5C 2BZTA 3DXJF 5GPAA 1P4WA 1YE9A 2UUCE 3DPLC 1KONA 2JRMA 4BC9A 5DNYA 2FOWA 4OU0A 3SEQA 1Y56A 4XSXF 3CD6I 2NUEA 3GUDA 1SEUA 3WGHA 2VKDA 5A69A 2BHZA 2FQ4A 1JHFA 3IAS2 4FE7A 2G9WA 3U21A 4XSZF 1ZAAC 5KAFC 2A68F 4OOIA 4DGWB 3MCZA 4L5IA 2Y30A 3U9GA 3ECRA 2VKVA 1QHHD 4MLVA 4XOTA 3JRFA 2MSYA 2O8KA 4X9JA 2CSOA 3V4GA 1R1TA 1WI3A 2XDVA 2HEOA 3G1MA 3SFZA 4FISA 4R79A 3WTSC 4J01A 3H0DA 2EZ6A 4LFAE 3OYIA 3CCYA 2LFBA 4BH9A 4A0ZA 1N78A 3KYLA 5C44J 2IJLA 3BR2A 2JA7J 3IC7A 3LSMA 1JE8A 5A2QK 1VQLI 1AH5A 2HNHA 2EN7A 4CA0A 3WU1B 2IRFG 3TO7A 5H2FC 2L4MA 3IH2A 2E2JJ 5FO5A 2M7QA 3HM5A 2WV1A 1FEXA 2B0LA 3MQ0A 1O0WA 4FQGA 2JT1A 2M8GX 4HG2A 3RJPA 3F6GA 2P0WA 2W24A 4IX7A 3FMRA 5EG0B 1ZN2A 2LY9A 1OYWA 3HC7A 1V3FA 2MLGA 3FHZA 1OR7C 1FMVA 4EJOA 2W84A 4A3BJ 3KP4A 3FM3A 1G2DC 3DTIA 2H36X 2MGQA 1YLFA 4Y13A 4LG0B 5H20A 4XQFA 2IHR1 3K70D 2JR1A 2EMLA 2R7QA 1JKPC 1ZG5A 2GQQA 2GLIA 1SVLA 4KISA 3K6QA 1TW2A 1X58A 2DA1A 2VBZA 5M5YJ 1RKTA 1E2XA 4I6ZA 1TLHB 1GXPA 4YEJA 4DR1E 1N36E 2LE2A 1XC5A 1R49A 3MN2A 3KIOA 4CYDA 1R00A 2BBGA 4J19A 1WPKA 3FK7A 3F8CA 2R7WA 3K1MA 4AWXB 5HLTA 2LMDA 2ZMEB 4BMJA 2VQFE 1DGWY 5JI6A 2PN6A 5BOXA 4BACA 2XVCA 4NQWA 1XNRE 4KUMA 2OV7A 4EM2A 1MDMB 2UXCE 3HUGB 3DBHB 3C7JA 3LWFA 4P9FA 1U9NA 4E7SA 4PDKA 3K4KA 3H5AA 5GPCA 1XGOA 1AWCA 3SZTA 1T56A 3S2HJ 2EN3A 5DUKA 2M45A 5D6FA 2J5OA 2JPBA 4MFDA 2RV8A 4C2TA 2EMZA 3GTKJ 2V86A 2KDOA 4DV5E 2XKOA 3DEEA 2EBIA 2XPWA 3I4NJ 3QOPA 1OYIA 2W85A 3IH3A 5A6BD 3N97A 1N3GA 3LAJA 4FCYA 1WH7A 2OC6A 1BI0A 2B7TA 3F8BA 1LDDA 1STUA 1X49A 3WTUC 2K9NA 2MBFA 3M1EA 2XV4S 2NXNB 1MSFC 5JVGF 3ABUA 1OCCH 1EH7A 2EOFA 2VJ4A 5HLGA 2UUZA 3OOUA 1NH3A 1FPQA 1ZELA 4F6NA 3DBLB 3HPHA 1XGMA 1R23A 4IF4A 1GXQA 2FUG2 1IF1A 3QODA 4L9NA 3S1QJ 2L7FP 1XGNA 3S2WA 1A04A 1LQ1A 2K9QA 4HPQA 4C3JJ 3OYAA 3JRHA 3MEXA 5ICFA 3MKZA 4UV8A 1A35A 4CCJA 4M6YA 1IV8A 1YI2I 2HVQA 2JSPA 4XLFA 3SEZA 1VTNC 1FTTA 2LKSA 3S93A 3HRTA 2DAOA 4ZDLA 2YTGA 2QLZA 3PQKA 4D0PA 3ZP5A 5FRNA 3GTMJ 3OTOE 3TOAA 2LT7A 1WJDA 5EEHA 1XSDA 4XKCA 4EJTA 2P81A 2LRSA 1YUJA 3GTPJ 2QSHX 3LMMA 4B3SE 1LUJB 4JX4A 1IXCA 1HOMA 3R0JA 2FV4B 4U7BA 1VQ6I 1ZREA 1BB8A 2A6EF 1X3WB 2Y9ZA 2DMUA 2V1NA 3PSIA 2WADA 3M3YJ 1BR2A 1ERDA 3AG4H 2YRKA 3TDUC 4GYIA 4YFXF 2CQ7A 2ZFUA 1DQ3A 5B3SH 2E1MC 4NBQA 1J5EE 3VPRA 3L1PA 3W6JB 4EM0B 4DR2E 3RYPA 1DUXC 4NHJA 4HSTA 3MSWA 2VQGA 3DKYA 2DMYA 1XD7A 3LNQA 2JP9A 4DV0E 4RS8A 1G3YA 4DV1E 2I13A 2HI3A 3DP7A 4NUBA 2DFEA 1HA8A 2HDWA 3F0CA 2YSPA 1HSJA 5IOZA 3R6SA 3OSGA 3FKIJ 3AL0B 1JUPA 2WB1A 1ZGJA 2NNNA 1T4OA 2V9PA 4DBRA 3FF5A 5A2QZ 3OS0A 2L4AA 2ESNA 2VQLA 1H88C 1JGGA 3RKWA 3ZPLA 4N9HA 1S5LC 3EYYA 1AHDP 1UZCA 3A4CA 1XB4A 2XB5A 3S3OA 2LO3A 1HXDA 2GZWA 1UHSA 4HF0A 1Z6RA 5EZHA 2MKNA 3GTJJ 1ULYA 3LSJA 3M7GA 4I02A 3ZQQA 2ZNYA 2XC7A 1K78A 4R2QA 1V54H 1HNZE 4KIFA 2UXDE 4H4KC 1EV7A 5HVQC 2L02A 3ABLH 4BDZA 2JA5J 2CRGA 1V5GA 2ME6A 4W97A 2EM9A 4PJLA 1G2HA 3NWSA 3BY6A 4MNUA 2XROA 4X6AJ 4HEIA 4G12A 3I55I 4O43A 4LF5E 4BHPA 5IYBJ 5CLSA 2JN6A 5DCFA 5CVIA 3OYEA 2XRLA 4BQAA 3OY9A 2RVCA 2UV1A 5L3FA 5LHIA 2EJ4A 3C6KA 3KP6A 1FJGE 3MAJA 4F54A 4A6EA 2EPKX 3HHHA 3PNTA 3BIDA 4NC6A 3RTRA 1XTAA 1A1IA 5L3EA 4NNJA 1LFUP 1MJ9A 5AC4A 1WKMA 4GFBA 2EPZA 4Q4ZF 3AFHA 5J8FA 2PFBA 3ZR8X 2R7UA 4IPAA 2VF1A 1YZ9A 3K69A 2EOMA 4KICA 3S17J 3WTVC 4AC0A 2EOQA 3FXQA 4XLCA 1YS7A 3BTIA 2AXTC 2N3GA 1R22A 2M8EA 2KHMA 3CUQC 2DA5A 2V1UA 1WHNA 4PGHA 1J7KA 1BR1A 4DNCA 5C4JJ 3DTKA 1MIJA 3QAHA 1WVRA 1PDAA 2LREA 5EZGA 3ECOA 4LF7E 1DGRM 4L5NC 2HYGD 2Z9OA 2E36A 1SMTA 2VIXA 3TEDA 3ADJA 4UHTA 5IT9Z 2KL4A 4E70A 2M4GA 4UUVA 2DYSH 5J1UA 2CW8A 1BOBA 1WJFA 1Y8RB 1IC8A 1QNTA 4X65E 2BY2A 3WODF 4AU7A 5BMZA 1LFBA 1B1BA 1S72I 3K1NA 1YPNA 2BW3A 2B7EA 2DT6A 2NOJB 2X1EA 4G8XA 5FFXA 1CQTA 2VRDA 3JW4A 1IJWC 1ZKGA 3T1YE 4HQEA 2QQAA 3J7ZI 1HNXE 2LOOA 1USSA 2EMKA 2HOSA 3J7AO 3O8HA 1K61A 1IBLE 5AE3A 2HOAA 2K02A 2NABA 2AQFA 1BBOA 4GGGA 3TKYA 2LLKA 3UNGC 4GZNC 2HTJA 1HW5A 1FBSA 1JKQC 2M34A 2FE3A 4L5JA 3JREA 4CH7A 4M9SA 2HXIA 1K7AA 2YRHA 1VF9A 2HYFA 4HRIA 5IY5H 1RETA 4CUGA 3SZPA 1SC7A 2VJ5A 5D8LB 2CMPA 4RGXA 3GTGJ 4BE2A 1U5TC 2FJ1A 1OCPA 2K4BA 1EJ9A 1W5CC 1XMKA 3HQ1A 1T38A 2EL4A 1SD7A 1WJAA 4F7ZA 1UFMA 2LY1A 4PZJA 3A01A 4LTYA 1NG7A 2NVQJ 4UVAA 2O03A 4A3FJ 4LFBE 2E1NA 4C2UA 3CO6C 2DMIA 2LDUA 3RCOA 1XMAA 1LEBA 2CW7A 4OWRB 1IDZA 1JJ6C 1MBHA 2XF6A 2F8BA 3EQLF 5HDNA 3V7SA 4DZJA 1OCOH 2EQRA 4IOCF 1K83J 3DPTA 2F4IA 2YX7A 3VYUB 3BPXA 1YW8A 2JJ7A 1N32E 4BNCA 4OIPF 3TW7A 4QSHA 3M8JA 4RLFA 3SHFA 2R92J 4BEHA 1QHGA 4JP0A 4E6KG 2B9SA 3DQVC 4DQ2A 2MC6A 3E6CC 2ID6A 4A5MA 2MH2A 2VB6A 4JYKA 3QG5C 2IW5A 4M74A 2L6MA 2K85A 1JUSA 3RQIA 3TO6A 2DN0A 5LEKA 5FLXC 3LA7A 3HOWJ 1TWGJ 4IZZA 1RESA 4CICA 2BY0A 5KNLA 1Y39A 5IPAA 2EOXA 3R0AA 2DLKA 1BI2A 4KT6A 2RSMA 2VASA 5FKMA 2D45A 2VJIA 1X3CA 5KAIC 4BBSJ 4XN0A 2EORA 5BQTA 1KYWA 2G0EA 1MZBA 5JLXA 2VC1A 4ABZA 2XAUA 4HV6A 3WGGA 4MTEA 1Z3XA 3K9TA 4DW6A 2RS7A 4PJNA 3JRBA 3KPHA 5TSEA 1TWHJ 4J00A 2K27A 3ZMDA 4DR6E 3FXKA 2LG4A 4U0WA 3TDZC 5D5VB 1HDDC 2FF4A 1FP2A 2MC3A 3C2HA 3K4MA 3PM1A 4C3HJ 4RB2C 4DR7E 3TP3A 2DFFA 1S8NA 4A3JJ 5KL4A 2Q1ZB 2B3TB 1NHAA 3EUKL 4YY3E 3LSHA 3OL3A 4PFPA 3HTXA 3F6VA 5D5WB 1K78B 1WRJA 3DV8A 3M07A 1G8XA 2JMWA 3K2AA 3LA3A 4BGDA 3H9QA 2HFHA 2PBIA 3KYCB 1WZ2A 4RMNA 4BQNA 3TL4X 3Q9SA 2EFWA 2DRPA 4B43A 5IP6A 3ELKA 4IO9F 3KZYA 2D2WA 2A05A 1GTKA 5LHHA 2DA2A 3QWLA 2OF7A 3CC7I 1EH6A 3CCRI 2DA7A 5ADZA 5FGMA 3KP7A 2X1CA 3OOPA 4A3GJ 3A03A 2ENHA 2HQ5A 1OCTC 2I5UA 4GEQB 5J1YA 1LDKB 1T98A 2E7XA 3DEWA 3ZQFA 4XICA 3BROA 4JX6A 2W7NA 3FIGA 4RB0A 3FXJA 1GT0C 4C9YA 5K5OA 2LV2A 3GZ5A 3AKZA 5CVRA 4DV2E 4LGWA 4U87A 1LJ9A 2VT3A 2R1FA 1B59A 3BG6A 4TUGA 1VQ7I 1YG2A 3VWBA 1DGCA 5GTIC 1V55H 1R5GA 1XSXA 3GWZA 4KIGA 3NRVA 4ZYAA 1K79A 2EL5A 3R60A 3GO5A 2EPAA 1BJZA 2F5FA 3ULQB 2LY2A 3FKJA 3IWDA 2ZM6E 1I94E 1ZLKA 1ZLJA 2EA2A 2EM3A 1WCMJ 2CV1A 1Z05A 2LYCA 3H09A 1O7FA 2OD5A 3AG1H 3OMYA 2YZTA 5B66C 3DBRB 4OIQF 4HA8A 4AUXA 2CTDA 3QQAA 4EATA 5DM7F 4JOMA 2IGOA 2I10A 1BJAA 3T5XA 5K7HA 3JSOA 3PJRA 5A6AA 4XRFA 2BW3B 4IJDA 4OAZA 4G94A 2L7MP 2R7TA 3REOA 3EPLA 3FXOA 3MMYB 2X6XA 2AQEA 2JUGA 5L3DA 3BJAA 2EMCA 2L33A 1WXRA 2ZXHA 1RR8C 2DFIA 4ENKA 3M8FA 2XSDC 1NG6A 2GLOA 2Z16A 2OQRA 1A6QA 3MHHC 2V85A 4E7JA 3V8KA 3HOUJ 1R1VA 3BJ6A 2JPAA 4F2JC 3G1OA 3NWTA 2OCEA 4ZZDA 1RUOA 1N33E 5JFRA 3ZMZA 1FSEA 2DBBA 1D1CA 2E60A 4EGZA 3CCVI 2A5WA 2OPTA 3LFUA 2B7VA 5EEAA 2PQ8A 3DCFA 4W1UA 3MKWB 1OKRA 4BXFA 2V6EA 3H36A 4M2ZA 1Y0NA 3A01B 2L3DA 3W6KB 2FBKA 3ESWB 1JT0A 2V6CA 3QPSA 4LLGF 5KL2A 2B9DA 4HEA2 1OCZH 3L7WA 1A1KA 4AVZA 1HKTA 2EM7A 1TT5B 1JTYA 1CGPA 4B48A 3FDYA 3GFLA 2D9HA 4R2PA 1UG0A 4MQ9F 4RBOA 1SR9A 2HPIA 4LK1F 3OS1A 2WY8Q 1Z9CA 3MZHA 3I54A 4II3A 3S15J 3HOTA 1WHUA 4FK5C 1J5YA 4MIMA 1FSHA 4F9AB 2L2NA 1PJSA 1MD0A 1I3AA 3HXLA 5IT3A 2Y48A 1MMDA 3VFZA 2DA6A 2E7WA 3QPTA 5CPRB 2XB0X 2FNAA 2FA5A 2ENCA 2QA4I 2M1SA 1DPUA 2OUMA 2B63J 2NVUB 2GAUA 2YTQA 2XHKA 3H5RA 2YU5A 2WA0A 2Q8KA 2BXYA 5EDNA 4I8OA 3NAUA 1RPWA 2IS6A 1A6IA 1PKPA 3E5QA 2H6CA 3GFJA 6PAXA 1X2NA 1S29A 2EB7A 2L9VA 3BR5A 4M73A 2EZHA 2OQGA 2R5YA 3GMEA 3FXUA 3L9FA 1QA6A 1VQNI 4M6XA 2EILH 4RDUA 5K7ZA 1ON2A 2DDBA 3PIOF 3ISPA 3VYRB 2QF7A 1IDYA 1XX5A 3BT9A 3QYFA 5CFFE 3HZJA 1Z91A 1V4RA 3UR3C 5DCMA 2COBA 2EOEA 2R7OA 2VBXA 2RQLA 1MH4A 4Q28A 4ITVA 2XGDA 4PJMA 2DK8A 5E1WA 3BTCA 3QU3A 2X1DA 4E7IA 3ERMA 3K4LA 1P92A 2Y69H 4BBYA 3KWRA 1T0FC 1YQAA 3MWMA 5FJ8J 2BY1A 1JKOC 3PO3J 3IKVA 4B3ME 3COAC 2R7XA 2XRNA 1RUNA 2LJHA 1YYKA 4LOCA 3RPUA 2BYVE 4WFTA 3O6BB 2EMIA 2M0MA 2IA1A 2ZMEC 2MA3A 3LOCA 2CWEA 2YTJA 3EQ1A 2H1LA 1H89C 1Z7LA 2DYRH 2EE8A 1IN5A 1T08B 1MW7A 9ANTA 4R2EA 2OU2A 3H9JA 1Y0UA 1N75A 4AIHA 1GVDA 2E71A 3ABMH 2FXAA 2ZFWA 3T1HE 1E3HA 3HYIA 3ONQA 3JRCA 3CLQA 3L2UA 3CF2A 4Y3OA 2FTXB 1U0JA 2XSJC 3OYKA 1T2KA 2EM2A 1H9TA 5F0HA 2KHXA 2FBHA 3IUOA 4M72A 3BR3A 4AYBA 2VOOA 2ODRD 3MHSC 4BQOA 1XS9A 5EJCA 1Y1WJ 3BZKA 4I76A 4B47A 4ZDOA 5DD4A 4KYWA 2HC5A 4GXOA 2XAQA 5KCMA 3N05A 2GPIA 1BBYA 5FLXZ 1QU3A 1Z0XA 3HDDA 3E5UA 2JOXA 3SJMA 3ASOH 4MGRA 4C30A 2PJPA 4G9YA 2EN6A 3C2BA 4OMYA 1NTCA 3CZ6A 1SFXA 1PDNC 1YUIA 3K7AJ 1N25A 2DA4A 2QVOA 4Q48A 4C2MJ 4KNYA 1OQYA 2VQHA 5KL3A 2LP0A 3BTJA 2ECBA 1FWZA 1MGTA 2ZNZA 4M9ZA 3F9KA 3HSRA 4IHVA 2H8RA 2DB2A 2MKDA 5J8CA 1S6LA 2YWQA 2XIGA 4TUIA 1ENHA 4EM1A 1USTA 1ETXA 3JRDA 3CCLI 1IUFA 4BKXA 5F1JA 4LIVA 2AO9A 3M99B 4CXFA 1ZHFA 4TV7A 2GM4A 1DDNA 4JI8E 1YX5A 3JTGA 3QPLA 3SQNA 5D5UB 2CFXA 1X6HA 3EPJA 2V1DA 1UHMA 1BC7C 1FLIA 4LK0F 3F23A 1I39A 1ZK8A 2KRHA 1ZU1A 5HDGA 3HSEA 4KHPE 2DW4A 5AIQA 4HDVA 2KOUA 4GCVA 4HBLA 1X19A 3LSRA 1V5EA 1Y8QB 1X4PA 5B1AH 5KHDA 4A0XA 1O7LA 1U2WA 4FHTA 2ZJQF 2UXBE 3IP4B 5K5QA 2O0YA 5AE1A 1UB9A 2WZOA 2Z1DA 4GKKE 3PQJA 1H0MA 2YTOA 4N4NB 2NA2A 2RREA 4HX7A 1IN4A 1UELB 5FLVA 4UXNA 1EKEA 1WJEA 2R93J 3AL0C 2MFZA 2AHQA 1F5TA 2XGEA 3IRRA 3C18A 2VXDA 3FX3A 3KZIC 1HDPA 3JRIA 2EN1A 3G2BA 1TNSA 4L9JA 5HODA 3M8EA 4XRSA 3WTXC 4ZTFA 1RNLA 2R7ZJ 3T8RA 2L01A 3P9KA 2DOAA 4B4CA 5F1RA 4IRIA 1RI7A 4F6MA 1D1BA 5IT9K 3GCMA 2L2KB 3HSFA 2RS6A 4M0VA 2LUQA 2FQ3A 1FT9A 1WJBA 3E3VA 1KA8A 5LL6R 1VQ9I 2WB1N 4CSWA 4L18B 4N9IA 5DM6F 3ZQIA 2Y2ZA 4F9BB 4I98B 5HNFA 3TBIA 1GV5A 2HXOA 3VYSB 1SANA 3IWCA 5HOOA 3CQZJ 2EZLA 5IOYA 2EPPA 1UHWA 1D0XA 2M5WA 1F2IG 2E2IJ 1ETWA 2R5YB 3AAFA 2ICWG 1IN7A 2K9MA 2NUFA 2DSYA 3GLXA 1TL8A 1A1GA 2IS2A 4M3FA 1RC7A 5TRDA 3FXMA 4IRHA 2VQEE 2Y0MA 2JYAA 3KETA 3F72A 3D5RC 5DCMB 2EMYA 2KIQA 3IWBA 2QYOA 2QCOA 4RAYA 2V4JC 2DA3A 3J7AG 4DV7E 4PJJA 3QU6A 3PO2J 3BLYA 2CUEA 3KP5A 1P4AA 2LD5A 4CCKA 2O7OA 3M9AA 1G3TA 1WHQA 1R36A 2UZKA 2A07F 4R2RA 4HYEA 3SYTA 1GQEA 5DD8A 2EH3A 3F22A 2M87A 5TISC 2QWWA 4N4OB 5IP9J 2RPCA 4GDFA 4I2OA 3CJTB 1T4NA 4IJAA 1FOYA 5BR8E 1JK1A 3S8PA 1UHZA 1Z1DA 3LSKA 4JBAA 3CCJI 4G7ZF 2NRAC 2MYSA 2EQ0A 1OCRH 2MG4A 3GW2A 1IO2A 1OISA 1B72A 2HU9A 1XMQE 2KRCA 1P6RA 2FEZA 3S16J 2M1BA 2R4GA 2F5EA 3K0LA 4A3MJ 3CDHA 2OCCH 2ZJ2A 3P7NA 5IYDJ 4NXNE 3FM5A 2IA0A 2PMHA 4A6DA 1HF0A 1F4KA 4AD9A 2CYYA 3OIQA 1TQPA 3RYRA 4ENMA 1J2XA 4DKKA 2HS5A 1AKHA 4X64E 3K4JA 4X0GA 5C3EJ 1IXRC 2QKMB 3C3WA 4FX0A 2NS8A 1EA3A 4WCGA 5E17F 3VHTB 3H0GJ 4Z6YA 3ZMSA 2DLLA 2JOBA 3CJQB 2LCEA 4JI3E 5AIPA 4A69C 4D5FA 2LRDA 5F3WA 2ELJA 2A6TA 3MZYA 2WAFA 5CJ9A 3B73A 1F43A 4BHBA 4M30A 5F0FA 5GADJ 2PMUA 4ZC3A 2DU9A 2ZJPF 4LF4E 4P96A 1R9TJ 3OYCA 1U78A 4NXME 2X51A 5DDGA 5HNHA 3F6OA 5K1YA 2QQ9A 2DODA 2UXNA 2ZB9A 1G2FC 2YR2A 2M3AA 2C6YA 2EA4A 1P7JA 4KWYA 2E5NA 2FNPA 4DZPA 3VEPA 2V1XA 5LMNE 2GA2A 1TQIA 2X6OA 1MBKA 1W4MA 3FWEA 4DJAA 5E1ZB 3I59B 1L4SA 2ELHA 3ZOBA 2WBUA 4I0BA 2EMAA 2HHHE 2XF5A 4XKVA 4XLNF 5FRMA 3LA2A 2D1VA 4XLAA 3LSIA 1GHCA 2H27A 2DFHA 3TQMA 3BR1A 3QPHA 3DF8A 1XMXA 3ERED 2EM5A 1S7AA 1HBXG 2LBSB 4BAYA 2IGNA 1BW5A 1N34E 4KDPA 4BUPA 1BL0A 3RPUD 4BDYA 5DEQA 1DP3A 1QU6A 2M7AA 2XASA 2BVLA 4XKWA 3GFMA 2KFDA 5E18F 2UWMA 2YPRA 1T8IA 2EMWA 4UB8C 3VDXA 2NS0A 1FOWA 2EMFA 1J09A 1YSAC 3BG5A 4A3EJ 4HSRA 3HGYA 1YIJI 1UAAA 3IL2A 4O5GA 3BZCA 1REPC 2LTRA 2UU9E 4EJVA 2M9HA 3DTEA 4X66E 1ZG1A 2CQQA 2CU7A 5J47A 3ZQHA 2LMZA 3LSPA 3EPZA 4HW0A 1BI3A 5CQGA 1X4OA 3RSNA 2V26A 1XCBA 2DOEA 2NOGA 3HG9A 5E3OA 2OJED 1I50J 4QTRA 4KJZA 1LE8A 1A1LA 1G4DA 2XPUA 3PUBA 2I8DA 2L92A 1WSUA 4XM3A 3P5JA 1LFPA 2WWYA 1PUEE 2V7FA 2Q8UA 3JAMC 4A3LJ 3E1SA 2F4MB 3F21A 2LKPA 2Z3YA 1TW3A 1UG2A 3GTQJ
chains in the Genus database with same CATH topology
4L0YB 2VOPA 2NAZA 3KLOA 2K4JA 3I0TA 1G3WA 2STTA 1ZARA 3DKWA 1Z6TA 2P4WA 2XAFA 5FD5A 1WI9A 1JGSA 2G7UA 3HRUA 4O3MA 3LFKA 4Q5SF 2BBYA 2A3SA 1D5VA 1PP8F 2XAJA 2H94A 2HOEA 3VOEA 1J9IA 2VN2A 1BC8C 1QQIA 1G6NA 4ESFA 3V8JA 5DYMA 2EFNA 1T39A 4ON0A 1SD5A 4LFUA 2ZBKA 2QENA 2BEOA 3U2RA 3I64A 3BOQA 5D6EA 3V8LA 5L3GA 1STZA 2UXXA 4G6QA 2PLYA 1GVJA 1X3UA 2OZ6A 2DTRA 2H09A 4CGZA 4A5NA 4K2EA 4RAZA 2EFPA 3OV8A 2HGCA 5E20A 3K2ZA 3CO7C 2ISZA 4ENNA 2MD5A 2COMA 2Z33A 1U8RA 1Z7UA 3ABTA 5LGNA 4R1HA 1I1GA 2L54A 3KEOA 4UNOA 4S05A 3QRFF 3EUHA 2KIUA 4HOBA 4I7HA 4GYGA 4RGRA 4IXAA 2P6TA 2VONA 2XUBA 4EQQA 2WTEA 1B6AA 1D3YA 2R3SA 3QP5A 3E6MA 5HLHA 3BDDA 2HWVA 3L00A 1F1ZA 1SD6A 1O57A 3DEUA 2OZUA 4HX4A 5DUIA 1LEAA 4P55A 1IAWA 3Q5FA 1MKMA 2W25A 1O3SA 3NEUA 2IA2A 2O8XA 4L9TA 1IW7F 3I53A 1JXSA 5JHUA 2HR3A 5ILVA 4HLYA 3R4KA 4KT5C 2IP2A 5HS7A 4ZYGA 4Z2YA 4A2UA 1HKSA 5E8IA 1FNNA 1I27A 1SMYF 5FLXK 3NQOA 1QZZA 5LEJA 2P5KA 3E6DA 2YX4A 3KCCA 1D8KA 5E8GA 1IRGA 2X4HA 3BWGA 3RDIA 2LNBA 2ZO4A 3KZZA 2STWA 2HTSA 2XAGA 3FXRA 1R1UA 2Z5UA 2MH9A 1I1SA 1J0RA 3C1DA 3E6BA 4ESBA 4RGUA 1S3JA 2ACJA 3GZ6A 3BZ6A 3ROUA 4Y15A 5LRRA 2K7LA 3HHGA 1P2FA 2BE5F 2LF8A 4ENJA 1YIOA 4ZH4F 1F9NA 2DO7A 4KMFA 4ZYHA 1QBJA 1DPRA 4G6DA 2P5LC 4KMUX 3HTUA 4YIFA 3RKYA 4MHGA 3KP2A 4M9XA 1L3LA 1BM9A 2WV0A 3D0SA 1U3EM 4BHCA 3SXYA 4JQFA 3HRSA 1ZYRF 3LQRA 1FX7A 3IRQA 1HW2A 5HS8A 1TQMA 4UVCA 2ZXJA 2GXGA 2CW0F 3WTYC 3JAMZ 2MLKA 5BS6A 1OR7A 4WXDA 5FB2A 2RDPA 3K1PA 2XKPA 2P8TA 3V7RA 2D1HA 1RIOH 4I09A 1ZRCA 1B4AA 4M71A 5FD6A 2VE8A 1G3SA 3ECHA 1CF7A 5H6RA 2DK5A 4EJUA 2F2EA 5ICEA 1IN6A 1BOAA 4KA4A 2H6BA 4MTDA 1Q1HA 3GYHX 3J81Z 1YFHA 1TBXA 3DFGA 1KQ9A 1WWXA 4EMSA 3I5UA 3TO9A 1R5HA 2HZTA 4WK8F 2HQNA 4I0AA 3BPVA 5LHGA 3WGIA 2EFOA 4PGGA 2ISYA 5F64A 5F6FA 3F8FA 3I59A 3ML6A 3FZVA 5EEGA 2LSOA 4N0BA 3IWZA 3LSTA 2W57A 4ASNA 1SD4A 1KQ0A 1FYLA 5LBQA 1YW9A 4HX8A 1HQCA 2VODA 4IVNA 3LAPA 2FBIA 5L3CA 1ONVA 2JRTA 1SFEA 3TGNA 3WTTC 1K6OA 4HV5A 1SAXA 4HF1A 2PEXA 5CYVA 2FMLA 1KGSA 4OIRF 4KIBA 4OMZA 5ILSA 3BP8A 1FYMA 2X0LA 4U88A 3ZQ7A 2E1CA 3JSPA 3IHUA 2JPCA 4ZZLA 4CZZA 1YS6A 1LVAA 2XGXA 4OIOF 4LJZF 1HSTA 2Y75A 4WF2A 1QZYA 5CVUA 3L09A 1OPCA 3GXOA 3KFWX 4IHTA 3R61A 2WC2A 4L9VA 4U0VA 4LB6B 1OMIA 5HDKA 4RB1A 2QZ8A 1XDSA 3I4PA 1U6GA 1O3RA 3P9IA 4BYYA 1I5ZA 3KEQA 3WU0A 1O3QA 3KE2A 1D8JA 1L0OC 3WG9A 4NB5A 4JK1X 2P7VB 4ZYDA 4U0YA 3L2CA 2XAHA 2QUFA 1H9GA 1W5TA 3CUQA 3O2PE 1T6SA 3TQNA 3IKTA 2G7HA 3ZMUA 4YIIA 3FMQA 1QGPA 2FSWA 1DP7P 4HZFA 1B9MA 2V79A 2RGVA 3V7CA 4YFKF 1ON1A 2VC0A 2R7FA 2GXBA 1QPMA 1R7JA 3LQQA 1CF7B 2ZKZA 2EV6A 2CO5A 3T1BA 4FT8A 3GFIA 4ESJA 2KRFA 3CJNA 3GF2A 1IN8A 2QM3A 4FX4A 2QBYA 2A61A 4O6JA 3JTHA 3CTAA 4AVPA 1TNTA 1MJBA 1U5TA 4G7HF 4WXHA 1BI1A 1UCRA 4B09A 3H3ZA 2CGPA 5LRSA 4EJWA 2VT2A 1HW1A 4AIKA 4O5VA 4CDGA 3T0YA 1ZH5A 2NNYA 5D5XB 4G7OF 3E5XA 1XN7A 2VXZA 2OBPA 2QQBA 2EK5A 2OAZA 1O3TA 1ZG3A 1W7PA 2R7DA 4A0YA 4YG2F 3J80K 3RIRA 1KQ8A 5TJJA 2GWRA 4MEYF 1P4XA 1BIBA 3HRMA 3WE2A 2Q0OA 1KU7A 3GVAA 2PI0A 3VODA 2FRHA 1J59A 4S04A 5LLQA 2VBYA 3EDPA 2P6SA 3WTWC 2Q2EA 1R58A 1EH8A 2EV5A 3G73A 4YFNF 3F3XA 4AIJA 1KU3A 4RGSA 5ILUA 4PCQA 5ICGA 3D5LA 2CG4A 1IUYA 2PG4A 2F5CA 2GIVA 2KKOA 3KP3A 2DPUA 3U1DA 5ED4A 2EFQA 5BPDA 5LGTA 5JVTA 2JSCA 3Q9VA 1FOKA 1W5SA 3GX4X 2YSRA 4KN4X 4LB5A 5BPIA 5HLIA 1MJAA 2FMYA 3O3KA 4HLXA 3CUQB 1AOYA 2KJBA 2RNJA 1B9NA 5KK1A 1YYVA 1S7OA 2F5DA 2IPQX 2HKOA 5FFZA 2P7CB 2K86A 2A69F 2EJRA 3CLOA 2NYXA 3ZN0A 5J6XA 3BJOA 3EYIA 2DT5A 1FY7A 1ZRDA 2A5YB 1BN5A 3E97A 4GO1A 5ICCA 3VB2A 5D8KB 4EV0A 4RB3C 4H0EA 4UVBA 4UV9A 4OINF 1IXSB 5E1XA 1TTYA 1XDUA 2A6HF 3N4MA 3B02A 2HDCA 2BV6A 2QBYB 2O3FA 4IHSA 5H6QA 4WXCA 4ZYEA 3CUOA 2ESHA 1U5TB 4KN7X 4HF2A 3H3UA 4Y17A 1KU2A 1FYKA 3H92A 3J80Z 1BIAA 3F8NA 4LD5A 3JAMK 2LF7A 1J75A 4ETSA 2KIFA 4XLPF 2HKXA 1SFUA 2RKHA 2J5PA 3T8TA 5AONA 5HS9A 2RQPA 2O6GE 1ZGAA 4LLLA 4CHUA 4A12A 4HQMA 4R8HA 5CVVA 4WX9A 3WTZA 4P5OA 2KJCA 3EETA 1W7PB 1LDJA 2V9VA 4EGYA 4WWCA 1YO5C 1ZAOA 2DI3A 2ETHA 3ZN1A 4B8XA 3HTSB 2Z99A 3ZMTA 3J81K 2O61A 3I71A 2ADUA 1RZ4A 1XGSA 2VE9A 3RKXA 1JHHA 1LNWA 4QWQA 4Q47A 1XCVA 4QLCU 4MEXF 3WE3A 1OYYA 2BGCA 4LG0A 1T0FA 1E17A 1QO0D 2CQKA 2RC4A 1ZRFA 2IT0A 4HAMA 1C0WA 1FC3A 2DPDA 5LGUA 2DQRA 1PP7U 2KIMA 3FMSA 3QP6A 2ZMEA 3HOSA 2VBWA 1MDMA 3HUGA 1IRFA 2AS5F 5D4SA 3PFIA 4CO8A 4P9UA 2OA4A 2IVMA 1ODDA 3MFKA 1KU9A 3GEZA 1W7PD 1IZ1A 5D4RA 1KYZA 3IWFA 4IRGA 3RPQA 1FZPB 3I58A 4HDUA 3F8MA 4KFCA 1XSVA 2JZYA 2EWNA 1YTYA 4LMYA 2DQLA 5ERIA 5JR3A 5KVRA 3G3ZA 2FU4A 3RI4A 4L0ZB 1YW7A 2ZCWA 1LB2A 1WQ2A 2JTVA 1FP1D 4LLNA 1FBQA 2TDXA 2GA1A 4MQVA 3HIFA 4XBFA 5L3BA 1I6XA 2P5VA 3TOBA 4I01A 2EV0A 3ZMVA 5DV5A 4EVIA 2YU3A 5K5RA 5CVJA 2M30A 2FOKA 3KLNA 4U7DA 1FBUA 2RN7A 1HKQA 2AXLA 3P9CA 4BXUA 2HQRA 3DXJF 1P4WA 3DPLC 4OU0A 4XSXF 3GUDA 3WGHA 1JHFA 2G9WA 4XSZF 2A68F 4OOIA 3MCZA 4L5IA 3U9GA 2CSOA 3V4GA 1R1TA 2HEOA 3SFZA 4R79A 3WTSC 4BH9A 4A0ZA 2IJLA 3IC7A 1JE8A 5A2QK 3WU1B 2IRFG 3TO7A 2L4MA 5FO5A 2B0LA 3MQ0A 3RJPA 2JT1A 2W24A 3FMRA 1ZN2A 1OYWA 1V3FA 2MLGA 3FHZA 4EJOA 2W84A 3KP4A 3FM3A 1YLFA 4Y13A 4LG0B 5H20A 1ZG5A 2GQQA 1TW2A 2VBZA 1E2XA 1TLHB 1GXPA 4CYDA 1R00A 3F8CA 3K1MA 4AWXB 2ZMEB 5JI6A 2PN6A 5BOXA 2XVCA 4NQWA 4KUMA 4EM2A 1MDMB 3C7JA 3LWFA 4P9FA 4PDKA 1XGOA 1AWCA 3SZTA 5DUKA 2M45A 5D6FA 2J5OA 2JPBA 2RV8A 2XKOA 3QOPA 1OYIA 2W85A 3N97A 3LAJA 1BI0A 3F8BA 1LDDA 3WTUC 2MBFA 3M1EA 2XV4S 3ABUA 1EH7A 5HLGA 1FPQA 1XGMA 1R23A 4IF4A 1GXQA 1IF1A 4L9NA 3S2WA 1XGNA 1A04A 1LQ1A 3MEXA 5ICFA 4UV8A 4M6YA 1VTNC 3HRTA 2DAOA 2QLZA 3PQKA 4D0PA 3ZP5A 3TOAA 5EEHA 1XSDA 4EJTA 1IXCA 3R0JA 4U7BA 1ZREA 2A6EF 3TDUC 4GYIA 4YFXF 3W6JB 4EM0B 3RYPA 1DUXC 4NHJA 1XD7A 4RS8A 1G3YA 3DP7A 1HSJA 3R6SA 1ZGJA 2NNNA 3FF5A 5A2QZ 2L4AA 2ESNA 3RKWA 3ZPLA 4N9HA 3EYYA 1XB4A 1HXDA 2GZWA 4HF0A 1Z6RA 1ULYA 3M7GA 4I02A 2ZNYA 1K78A 4KIFA 1EV7A 5HVQC 2L02A 3BY6A 4MNUA 2XROA 4BHPA 5CLSA 5DCFA 5CVIA 4BQAA 2RVCA 5L3FA 5LHIA 3KP6A 3MAJA 4A6EA 3HHHA 3RTRA 5L3EA 1MJ9A 1WKMA 4Q4ZF 5J8FA 2PFBA 4IPAA 3K69A 4KICA 3WTVC 3FXQA 1YS7A 1R22A 2M8EA 3CUQC 2V1UA 4PGHA 1J7KA 4DNCA 3QAHA 3ECOA 2HYGD 2Z9OA 1SMTA 4UHTA 5IT9Z 4E70A 4UUVA 1QNTA 3WODF 5BMZA 1B1BA 3K1NA 4G8XA 5FFXA 3JW4A 4HQEA 2QQAA 1USSA 3J7AO 2K02A 4GGGA 3TKYA 2HTJA 1HW5A 1FBSA 2FE3A 4L5JA 4M9SA 1K7AA 2HYFA 3SZPA 5D8LB 4RGXA 1U5TC 2K4BA 1XMKA 1T38A 1SD7A 4F7ZA 1UFMA 4PZJA 4UVAA 2O03A 2E1NA 3CO6C 2LDUA 1XMAA 1LEBA 3EQLF 5HDNA 3V7SA 3DPTA 2YX7A 3BPXA 1YW8A 4BNCA 4OIPF 3SHFA 3DQVC 4DQ2A 3E6CC 4A5MA 2MH2A 2IW5A 4M74A 3TO6A 5LEKA 3LA7A 4CICA 3R0AA 1BI2A 2D45A 5BQTA 1KYWA 1MZBA 2VC1A 4HV6A 3WGGA 4MTEA 3K9TA 2K27A 3ZMDA 4U0WA 3TDZC 5D5VB 2FF4A 1FP2A 2MC3A 4RB2C 1S8NA 1NHAA 3F6VA 5D5WB 1K78B 1WRJA 3DV8A 3LA3A 2HFHA 2PBIA 3Q9SA 2EFWA 3ELKA 3KZYA 2D2WA 5LHHA 1EH6A 5FGMA 3KP7A 3OOPA 1LDKB 1T98A 2E7XA 3BROA 4RB0A 5K5OA 3GZ5A 5CVRA 4LGWA 1LJ9A 2VT3A 1B59A 1YG2A 1R5GA 1XSXA 3GWZA 4KIGA 3NRVA 1K79A 3R60A 3GO5A 2F5FA 3ULQB 1ZLKA 1ZLJA 2EA2A 1Z05A 1O7FA 2OD5A 4OIQF 4HA8A 1BJAA 3T5XA 3JSOA 4XRFA 4G94A 3REOA 5L3DA 3BJAA 2DFIA 4ENKA 3M8FA 2OQRA 3V8KA 1R1VA 3BJ6A 4ZZDA 1RUOA 5JFRA 3ZMZA 1FSEA 2DBBA 4EGZA 2PQ8A 1OKRA 2L3DA 3W6KB 2FBKA 2V6CA 4LLGF 3L7WA 1HKTA 1CGPA 3GFLA 4MQ9F 4LK1F 1Z9CA 3MZHA 3I54A 3HOTA 1J5YA 1FSHA 1MD0A 5IT3A 2Y48A 3VFZA 3QPTA 2E7WA 2FNAA 2FA5A 1DPUA 2GAUA 2XHKA 2Q8KA 3E5QA 2H6CA 3GFJA 6PAXA 1S29A 2EB7A 4M73A 2OQGA 3FXUA 3L9FA 4M6XA 1ON2A 3ISPA 1Z91A 1V4RA 5DCMA 2VBXA 2DK8A 5E1WA 3QU3A 1P92A 1YQAA 3MWMA 3IKVA 3COAC 2XRNA 1RUNA 3RPUA 2BYVE 3O6BB 2IA1A 2MA3A 2CWEA 1IN5A 2OU2A 1Y0UA 4AIHA 2FXAA 2ZFWA 3HYIA 1T2KA 1H9TA 2FBHA 4M72A 2VOOA 5DD4A 4KYWA 4GXOA 2XAQA 1BBYA 5FLXZ 3E5UA 4MGRA 2PJPA 4G9YA 4OMYA 1PDNC 1SFXA 2QVOA 4Q48A 4KNYA 1FWZA 1MGTA 2ZNZA 4M9ZA 3HSRA 5J8CA 1S6LA 2XIGA 4EM1A 1USTA 4CXFA 1ZHFA 4TV7A 1DDNA 3JTGA 3SQNA 5D5UB 2CFXA 2V1DA 1UHMA 1BC7C 1FLIA 4LK0F 3F23A 5HDGA 3HSEA 2DW4A 5AIQA 4HDVA 4GCVA 4HBLA 4A0XA 1O7LA 1U2WA 4FHTA 5K5QA 2O0YA 1UB9A 3PQJA 1H0MA 4HX7A 1IN4A 4UXNA 1F5TA 3IRRA 3C18A 3FX3A 1TNSA 4L9JA 3M8EA 3WTXC 1RNLA 3T8RA 2L01A 3P9KA 5F1RA 4IRIA 1RI7A 5IT9K 3HSFA 2FQ3A 1FT9A 3E3VA 1KA8A 4L18B 4N9IA 4I98B 5HOOA 1UHWA 2M5WA 3AAFA 1IN7A 3GLXA 5TRDA 4IRHA 2Y0MA 3KETA 3F72A 5DCMB 2QYOA 4RAYA 3QU6A 3KP5A 1P4AA 3M9AA 1G3TA 1R36A 2UZKA 2A07F 4HYEA 5DD8A 3F22A 2M87A 2QWWA 4I2OA 4IJAA 1Z1DA 4G7ZF 4JBAA 2NRAC 3GW2A 1P6RA 2FEZA 2M1BA 2F5EA 3K0LA 3CDHA 3P7NA 2ZJ2A 3FM5A 2IA0A 2PMHA 4A6DA 1F4KA 4AD9A 2CYYA 3RYRA 1TQPA 4ENMA 1J2XA 2HS5A 1IXRC 3C3WA 4FX0A 4WCGA 5E17F 3ZMSA 2DLLA 5AIPA 3MZYA 5CJ9A 3B73A 4BHBA 2PMUA 2DU9A 4P96A 1U78A 5DDGA 3F6OA 5K1YA 2QQ9A 2UXNA 2YR2