4WX9A

Crystal structure of mycobacterium tuberculosis ogt in complex with dna
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
164
structure length
161
Chain Sequence
VHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTSRTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALLELEKSRAPADLTLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*CP*CP*AP*TP*GP*(E1X)P*CP*TP*AP*GP*TP*A)-3')
publication title Crystal structure of Mycobacterium tuberculosis O6-methylguanine-DNA methyltransferase protein clusters assembled on to damaged DNA.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 42
structure length 161
sequence length 164
chains with identical sequence B, C
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2014-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4wx9A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4wx9A01
2Z99A 4IRGA 1BBYA 3PQJA 2PQ8A 2DFIA 1W5TA 1AWCA 1QZZA 3E6MA 3I4PA 5LRRA 4ZZDA 2DU9A 3HOTA 4Q4ZF 4LB5A 2Q0OA 2QQBA 2D2WA 2VODA 3H3ZA 3RJPA 2EJRA 3WE2A 3ROUA 2FA5A 2RGVA 2V6CA 3R60A 2QZ8A 4F7ZA 4UHTA 2J5OA 4MEYF 2OQGA 4HX8A 2EK5A 2A68F 3R61A 3FHZA 2NNYA 2FNAA 3P7NA 1B9NA 1ZRDA 3T8RA 3FMQA 3RPQA 3CO7C 2F5DA 3V7SA 3L00A 5H20A 1IN7A 1U8RA 1KQ8A 1WRJA 1T0FA 5DDGA 1Y0UA 1T98A 1DPUA 2FXAA 3P9CA 3TKYA 3ABTA 3IKVA 1PUEE 3QU3A 1D5VA 1H9TA 4NHJA 4ASNA 4MNUA 2QWWA 2M1BA 4RGRA 1XMKA 1LQ1A 2PLYA 4UXNA 1I6XA 4EGZA 2ADUA 3EETA 5DD8A 1VTNC 4QLCU 1OMIA 5D5VB 3WE3A 3HUGA 2R7FA 1P6RA 2OU2A 4KICA 4BAYA 1MDMB 3CO6C 4PDKA 3M7GA 1SAXA 1RZ4A 2STWA 1ZRFA 3PFIA 3JW4A 4CYDA 2AS5F 1ON2A 1AOYA 2CWEA 2Y75A 4EMSA 2IA1A 2H6CA 2DK8A 2VBWA 4HBLA 1FX7A 2FMLA 2EWNA 1W7PD 3HRUA 1KA8A 5IT9Z 1BI0A 2XUBA 1BI1A 3T1BA 3DQVC 4CO8A 3KFWX 4OMZA 4Y13A 3ELKA 4N9IA 3JTGA 1TQIA 4ZYEA 1Z1DA 3ZP5A 2MBFA 5D8LB 1HXDA 4RS8A 4IJAA 2JRTA 2YSRA 4WXCA 1QO0D 2XAHA 4B8XA 1XGSA 4WWCA 1FYMA 2FMYA 4M71A 2BV6A 1OR7A 1WSUA 2HOEA 4XSXF 2HWVA 2UZKA 4FX0A 5ICGA 4ON0A 4JQFA 2ZMEB 3GFMA 4EM2A 4XLPF 2D1HA 2JPBA 1Q1HA 3GF2A 3I5UA 3V8JA 4UVBA 4RAYA 1U5TB 3LAPA 4A5NA 1JE8A 5D5UB 1JHHA 2FBKA 3KP4A 1B9MA 1BI2A 2EA2A 1YIOA 3I54A 1ZARA 1SD5A 1QZYA 3EQLF 2KJCA 3CUOA 3QPTA 2Z5UA 3I59A 4ZYHA 2JSCA 4U0YA 1KU9A 1DP7P 5FFXA 3GO5A 5ED4A 3GUDA 5FLXZ 3KZYA 2L4AA 5L3DA 1R5HA 1QGPA 2CSOA 2X0LA 2P6SA 5J8FA 3KP3A 5HLGA 3MZHA 3K2ZA 2QYOA 3IRRA 2A6HF 2VOPA 1J7KA 1SFUA 1UCRA 1TQMA 2R3SA 2RVCA 1PP8F 1Z9CA 1G3YA 1L0OC 2L3DA 2HYFA 4WX9A 5LEJA 5E8GA 3CJNA 4OIPF 1U5TC 4KYWA 5FB2A 1FT9A 2O0YA 4AD9A 4BH9A 3S2WA 3RPUA 2UWMA 2XRNA 4KMUX 3M9AA 5FD6A 2O6GE 1R7JA 2E1NA 2G9WA 1XSDA 2L4MA 1OYYA 2DQRA 5EEGA 4M6XA 3E6CC 1USTA 3JAMK 2EFPA 1K6OA 1B59A 4I2OA 4CICA 3DEUA 3BWGA 4JBAA 3VEPA 3KETA 2F5CA 2IRFG 4YG2F 1HW1A 1J59A 1ZREA 2A69F 1OPCA 2H09A 4M72A 1OYIA 2ZBKA 4TV7A 2HFHA 2QQ9A 2FE3A 5FGMA 4LGWA 1FBSA 1IRFA 2DO7A 3HRTA 3MZYA 3EYIA 2QBYB 3HTSB 2RNJA 3EUHA 1NHAA 4M9SA 3WTTC 1ONVA 1KGSA 2EV5A 2QBYA 4IPAA 3FMRA 3IC7A 5DCFA 4BYYA 2HEOA 4HF0A 1BI3A 3F8FA 3F8CA 1FZPB 3GVAA 4K2EA 3LSTA 4WK8F 1YQAA 2V1XA 1UFMA 2ZCWA 3KP5A 1T6SA 3QPHA 3ERED 4HLXA 5E17F 5ICCA 4HX4A 4U88A 3J80K 2GXGA 3TO7A 4PGGA 2MH2A 3EYYA 4M9XA 3CUQB 5L3BA 3F23A 3K1PA 1GXPA 3LFKA 5LRSA 3F6VA 2CG4A 3IRQA 4U0WA 5A2QK 1G4DA 4EVIA 1P2FA 4HX7A 4XSZF 2O8XA 3WTUC 2KRFA 1MJAA 1FY7A 2XVCA 2A6EF 4LLGF 2XAGA 1O3QA 1P4XA 1YW8A 5BMZA 2PI0A 1LNWA 2FRHA 5JI6A 2EV6A 2OQRA 1IN4A 1FSEA 1U6GA 3LQQA 3R0JA 2PMHA 2H6BA 1F5TA 1QPMA 1FBQA 3JTHA 1BC7C 4NB5A 4G7OF 4G94A 5TJJA 4EQQA 2K86A 5LHHA 3C18A 3GLXA 1S29A 4ZYGA 1IXRC 1T39A 1MGTA 2MLKA 3CUQC 2FBHA 1HSJA 1OYWA 1MD0A 3SQNA 3P9IA 1WQ2A 3BY6A 1KU3A 2HTSA 4IF4A 1FNNA 3T8TA 3MFKA 3FXRA 3LA3A 4IRIA 3WTXC 1BJAA 4DNCA 3WTSC 5CLSA 1J2XA 1D8JA 1IZ1A 4BHPA 5JR3A 5FO5A 2ZXJA 5HS7A 2IW5A 1J0RA 4RAZA 3HRMA 1SD6A 1HW5A 2ISYA 2ZKZA 5HDNA 4XRFA 3U1DA 1HBXG 4KIBA 4G9YA 5J8CA 3E6BA 2COMA 4RGXA 1KQ9A 1IN5A 1WI9A 3OV8A 2WTEA 4WF2A 3WG9A 1HKTA 1BC8C 3AAFA 1XDSA 1SFXA 1ZLJA 1LVAA 4P5OA 4KA4A 3FF5A 2Q8KA 4RGSA 3RKWA 3PQKA 2W84A 1PP7U 2BBYA 1J5YA 4R1HA 1XDUA 2UXNA 4AWXB 1IXCA 3DF8A 2KIUA 3IHUA 1IXSB 5ILSA 3ECOA 3E5QA 4IHTA 4UVAA 3GX4X 1ZG5A 2IVMA 4GXOA 1R23A 1O7FA 2NNNA 3TGNA 1GHCA 5AIQA 4B09A 2O3FA 4OU0A 5TRDA 3QP6A 2FSWA 3GEZA 3KLNA 1IN6A 3KEQA 4YIFA 4Q48A 2JT1A 4U7DA 1UHMA 4I02A 3MQ0A 3NRVA 1H9GA 1PDNC 2A3SA 3H3UA 1KQ0A 1ZLKA 1XN7A 4XLNF 2QENA 2FNPA 5HLIA 1G3SA 1RI7A 3K0LA 2ISZA 3WTZA 3F8NA 3C3WA 4P55A 4LG0B 1SFEA 3QOPA 2GXBA 2E1CA 4BHCA 3V7RA 4UV9A 5CVRA 2VE9A 2MC3A 2D1VA 1HQCA 3T5XA 1FP2A 3LAJA 4GGGA 1SMYF 1ZAOA 1XSVA 4LG0A 5KVRA 4MQVA 3WGGA 2EFWA 1ZH5A 5BPDA 3R0AA 2RQPA 2XIGA 2K02A 1S6LA 3E97A 2P4WA 2CW0F 1E17A 3FM3A 4A0XA 5AONA 2ZJ2A 1BOAA 4U7BA 2H94A 1ZN2A 1Z6TA 5E8IA 2G7UA 4HW0A 1GVJA 2NRAC 4L9TA 2VT2A 2Y0MA 4ZYDA 3F8BA 1ZG1A 3CLOA 3Q9SA 4ZZLA 4PGHA 2Q2EA 2QQAA 3M8FA 4MGRA 2RDPA 3OOPA 3P9KA 5LGUA 4M6YA 1YO5C 2V9VA 3VOEA 3E5UA 4ESBA 2LF7A 5CVIA 1R1TA 4G6QA 1Z6RA 5HS8A 2VXZA 1BIBA 1S3JA 1D8KA 4KMFA 1DDNA 4WCGA 4FT8A 4EJVA 2KJBA 2QVOA 5F64A 2EFQA 1KU2A 1FWZA 4HQMA 3I59B 3HIFA 1OKRA 1MKMA 4Z2YA 1IN8A 1YLFA 2FF4A 3U2RA 2WWYA 2OZUA 1Z91A 2MLGA 2IT0A 4ESJA 4L9VA 5D8KB 2IP2A 4LLLA 5IT3A 4IXAA 2OAZA 2IA0A 1W4MA 4EJWA 4HF2A 3B73A 2LDUA 5HVQC 4R79A 1F1ZA 2P5VA 1YW7A 3BPXA 4EJUA 3KP6A 1KYWA 4UV8A 4UVCA 4OIOF 3BP8A 2E7XA 3TQNA 2O03A 4IRHA 4CDGA 3ML6A 5CJ9A 4A2UA 3CDHA 2RC4A 2K7LA 1ZGAA 1U78A 3KP7A 1WKMA 2VE8A 4HV5A 5K5OA 2QLZA 3GZ6A 1STZA 4KN4X 3DP7A 2ACJA 1I27A 1J75A 1V4RA 1TLHB 3E5XA 1RNLA 4HOBA 4CXFA 4HYEA 2L02A 3FMSA 6PAXA 3WODF 3W6KB 5LBQA 3HSFA 4LFUA 1JXSA 1R22A 3SFZA 2M5WA 2YU3A 1P92A 5E18F 2DPDA 1XGMA 3R4KA 3LA7A 2Y48A 1G3TA 4KIGA 4LJZF 1EH8A 4KIFA 5LGNA 5IT9K 3V8LA 3C7JA 1HKSA 2HTJA 3TOBA 5HLHA 1RIOH 3ZMDA 2PMUA 2O61A 1C0WA 2P5KA 3ZQ7A 5E1WA 2VN2A 3WGIA 1O3SA 3ABUA 5L3EA 2NS0A 2A61A 4L0YB 3U9GA 3GYHX 1YS6A 4BQAA 5CVUA 3BJ6A 3O2PE 3QAHA 1IW7F 2VBZA 1FYLA 2RN7A 4MHGA 2JPCA 4JK1X 4EM1A 5DD4A 1XMAA 2R7DA 5KK1A 4ENMA 3EDPA 4YFNF 5ICFA 2GIVA 3GFIA 2DBBA 3ZN1A 3ULQB 3T0YA 2VBXA 2VC0A 2W25A 4HF1A 2W57A 5H6QA 4G7HF 5ICEA 3QP5A 4EJOA 4RB1A 2XASA 3G73A 3H92A 4L18B 2XAFA 2TDXA 2GQQA 3V4GA 2DK5A 3HHHA 4I0BA 2IJLA 3BZ6A 5D6EA 1W7PA 4HAMA 4P9UA 5BS6A 5D5WB 3TDZC 4PCQA 4LD5A 3ZN0A 1G3WA 3ZMUA 1S7AA 2V79A 5H6RA 1FOKA 4HQEA 4EJTA 5FLXK 5DYMA 2MD5A 3TO9A 1JGSA 3WU1B 1ZGJA 3HOSA 1E2XA 5FD5A 1R1UA 2F5FA 3FZVA 1K78A 1BIAA 3CTAA 5HOOA 4OINF 4O3MA 2NYXA 2ZO4A 5E1XA 2BEOA 4EGYA 2FQ3A 3ZMVA 2PFBA 3I64A 1FYKA 3N4MA 3G3ZA 4DQ2A 3RDIA 1SMTA 1KU7A 3KEOA 1B4AA 3NQOA 4MTDA 3HRSA 5F6FA 3NEUA 1HKQA 2G7HA 1H0MA 1O3RA 1TNTA 3F8MA 4RB3C 4MEXF 3WTYC 2WC2A 4M73A 4OIQF 2FU4A 4N9HA 3I71A 2K4JA 3TO6A 4ENKA 2UXXA 4I01A 3BOQA 1TW2A 4ESFA 4YFKF 3HSRA 2V1DA 4CZZA 5CVJA 2DTRA 4A0YA 4AIKA 3LQRA 1XD7A 5LEKA 3O6BB 2CFXA 1FBUA 5ILUA 3MAJA 1IRGA 3I58A 1WWXA 1F4KA 3M1EA 5ERIA 2M8EA 3SXYA 4XBFA 1EV7A 3F72A 4CGZA 4A6DA 1YTYA 5JVTA 3L9FA 4U0VA 3VODA 4GYGA 2HKOA 4I98B 2DLLA 4OOIA 2GWRA 4AIHA 4D0PA 3WU0A 4S05A 3ECHA 3K69A 3DV8A 1T2KA 2X4HA 2LNBA 1XGOA 3REOA 1U2WA 2F5EA 2YX4A 3D5LA 3FWEA 2L54A 1IAWA 1O7LA 2YX7A 2YR2A 3L7WA 5E20A 1Z7UA 3DPLC 4MTEA 4Y17A 1YFHA 2ETHA 3J81Z 4I7HA 1TTYA 4KNYA 3BJAA 4UNOA 4KUMA 5ILVA 1B1BA 2XROA 4LMYA 4GCVA 3DXJF 1DPRA 3GWZA 1XB4A 5DEQA 2LKPA 5D4SA 4AIJA 3ZMZA 4A12A 1MZBA 3WTWC 3B02A 2RKHA 3I53A 4S04A 4IVNA 2B0LA 1XSXA 2IA2A 2P5LC 4LB6B 3BROA 1TW3A 5BPIA 5DUIA 5K5QA 3BJOA 3COAC 4KT5C 1QNTA 2A07F 2W85A 1ZYRF 4EM0B 5D4RA 1HW2A 1LEAA 4A0ZA 4FHTA 3MCZA 1UHWA 3Q9VA 3K9TA 1SD7A 3JAMZ 4ZH4F 2XKPA 2PJPA 4O5VA 1MDMA 2Z33A 2CO5A 2ZNYA 1FSHA 3ZMSA 5HDKA 4G6DA 1P4WA 4HZFA 3SZPA 5D6FA 2Z9OA 1T38A 2IPQX 4L5JA 1V3FA 4QWQA 5LHGA 2VBYA 3R6SA 1R5GA 2H27A 5FFZA 1SD4A 2GZWA 4RB0A 5DUKA 3SHFA 2HZTA 4P9FA 2K4BA 3TDUC 4Q5SF 4I0AA 5JHUA 4FX4A 3VFZA 1YS7A 2MA3A 1MJBA 3KP2A 3FM5A 4HA8A 1I1SA 1IUYA 5L3FA 3IWFA 1HSTA 1FLIA 2M45A 4I09A 1BN5A 3BPVA 3ZPLA 3F3XA 4HLYA 3I0TA 1RUNA 2BGCA 4Y15A 3J80Z 4OMYA 2P8TA 3RIRA 1I1GA 2GA1A 2ZMEA 5L3GA 4RGUA 3KZZA 1XGNA 1CGPA 3GXOA 5K5RA 4KDPA 1R00A 3MWMA 3V7CA 3LWFA 2WV0A 4R8HA 5A2QZ 2XHKA 3HTUA 3GFJA 2XGXA 2P6TA 1USSA 2RV8A 1XCBA 1F9NA 2YPRA 2CQKA 2P7CB 1K7AA 2FEZA 1U5TA 3FXQA 3Q5FA 5DV5A 1IF1A 1BM9A 1RUOA 2EV0A 4CHUA 2BE5F 1R36A 3ZMTA 1QBJA 4MQ9F 4M74A 5BOXA 3QRFF 2HKXA 3J81K 2KKOA 4GYIA 1B6AA 4WXDA 2MH9A 2DPUA 2E7WA 4L0ZB 3KE2A 1U3EM 3K1NA 2HDCA 2QUFA 1QQIA 1TBXA 4YIIA 1TQPA 4LK1F 1R58A 2C6YA 2FOKA 1YYVA 2OBPA 1O57A 2QM3A 4UUVA 5D5XB 2L01A 2XV4S 3D0SA 4H0EA 2ELHA 4O6JA 4A6EA 2XAQA 3L2CA 3F21A 4YFXF 4M9ZA 3GZ5A 1ZRCA 2CGPA 3E6DA 4Q47A 3IKTA 4L9NA 1LDDA 1D3YA 5EEHA 4GO1A 3DPTA 1FPQA 1S8NA 1A04A 1TNSA 1LJ9A 4PZJA 2DAOA 4E70A 2PG4A 1LDKB 3RTRA 3DKWA 3RYRA 2Z3YA 3JSOA 3LA2A 1K79A 2J5PA 2NAZA 3C1DA 3KLOA 1MJ9A 4ENNA 2KIFA 2EFNA 1FC3A 2M87A 1ZHFA 1ZG3A 3V8KA 4KFCA 1YW9A 4A5MA 4WXHA 2XAJA 2F2EA 5F1RA 3JSPA 2HQRA 3W6JB 5HDGA 2VC1A 3VB2A 5HS9A 3RI4A 4HV6A 2KIMA 5LLQA 2PN6A 1EH7A 5JFRA 1G6NA 1JHFA 5J6XA 5L3CA 2DW4A 2HGCA 3FXUA 3FX3A 4IHSA 3HSEA 2STTA 4HDUA 4ENJA 2PBIA 2OZ6A 2LSOA 2JZYA 3F22A 3IWZA 3KCCA 1J9IA 5DCMB 1W7PB 3RKXA 1YG2A 2LF8A 3E3VA 4KN7X 1Z05A 2ZNZA 3GFLA 3IL2A 2EA4A 5AIPA 2VT3A 3QU6A 1LB2A 2JTVA 2M30A 4NQWA 5K1YA 5DCMA 5LGTA 2ZFWA 1O3TA 4LLNA 2HS5A 3J7AO 2V1UA 1CF7B 4RB2C 2GAUA 1FP1D 2ESHA 3CUQA 1K78B 4G7ZF 5BQTA 2ESNA 4L5IA 5LHIA 1LEBA 2W24A 1W5SA 2HQNA 4BHBA 1P4AA 2K27A 2HR3A 3HHGA 3GW2A 1CF7A 2P7VB 3M8EA 3RYPA 2DQLA 2BYVE 1XCVA 2XKOA 3DFGA 4P96A 1S7OA 2EB7A 4AVPA 5CVVA 2VOOA 3HYIA 1UB9A 1EH6A 4L9JA 3ISPA 4N0BA 4OIRF 4G8XA 2GA2A 1I5ZA 1L3LA 2OD5A 2A5YB 3BDDA 3F6OA 1ODDA 2VONA 2CYYA 1LDJA 2HYGD 3WGHA 4EV0A 3MEXA 4HDVA 1DUXC 5CYVA 2FBIA 4BXUA 5E1ZB 1ULYA 2OA4A 2DI3A 2DT5A 3RKYA 1R1VA 1REPC 3L09A 2AXLA 3O3KA 1KYZA 3TOAA 1GXQA 1X3UA 4LK0F 3SZTA 2PEXA 4ETSA 4BNCA 3WTVC 3K1MA 2EFOA 3N97A 1ON1A 2D45A
chains in the Genus database with same CATH superfamily
2Z99A 2IBDA 4IRGA 5EF6A 3FIGA 1BBYA 3PQJA 2UUBE 2PQ8A 4I99C 2DFIA 1W5TA 1AWCA 1QZZA 2MABA 2OV7A 3AG2H 3E6MA 4HEA2 3I4PA 5LRRA 1W36D 3ECRA 4ZZDA 2DU9A 2L3CA 1SFKA 3I3LA 2FJ1A 3HOTA 3PJRA 4Q4ZF 1ORKA 4C30A 1K4SA 4LB5A 3S16J 2EM4A 2LBFB 4DZPA 2Q0OA 1VQ5I 2D9HA 2QQBA 1OCOH 5HLTA 4F9BB 5EEAA 2D2WA 2VODA 3H3ZA 4I76A 3RJPA 2EJRA 3CCYA 3WE2A 2ZM6E 3LOCA 3ROUA 2FA5A 2RGVA 4WPYA 2V6CA 2VI6A 3R60A 5FKKA 4B3AA 2QZ8A 4F7ZA 2CV0A 2M9HA 3KPHA 4GKKE 3CC2I 4UHTA 3LSGA 4XICA 2J5OA 3P5JA 4NDLA 1TWFJ 2LBFA 4MEYF 2OQGA 2LK2A 4HX8A 2EK5A 2A68F 4XKWA 1XNRE 3R61A 3FHZA 1X3CA 1XMXA 3I55I 2NNYA 3BF2A 1G8XA 2FNAA 3S3OA 2ECBA 3P7NA 2EN4A 3L2UA 1B9NA 3MKZA 1ZRDA 3T8RA 2RS7A 1UG2A 4DMIA 1I3AA 3FMQA 3RPQA 4C3JJ 3CO7C 2QSHX 2F5DA 5CPRB 3V7SA 2LV2A 2VKDA 1A36A 2NUGA 2VB6A 3L00A 1BR4A 5H20A 2NVTJ 5KNLA 1IN7A 4A69C 2EMZA 2EN7A 2NOGA 1U8RA 1KQ8A 1WRJA 2EOXA 1T0FA 5DDGA 1XNQE 3QPLA 1Y0UA 1QHHD 2DJIA 1T98A 2CT1A 1DPUA 2FXAA 4B3TE 3P9CA 5GP9A 3TKYA 2FQ4A 1GV2A 2EINH 2F6CA 2R7RA 3ABTA 4Y52J 4R2QA 2L6MA 3IKVA 2X85A 1PUEE 2Q8UA 4F3QA 3T1YE 3VYXA 1MMAA 3QU3A 3LNQA 2GM4A 1D5VA 2DSYA 4B3RE 1H9TA 1OCCH 3LSMA 4NHJA 4ASNA 1IQOA 2CU7A 2XPVA 4MNUA 2ENHA 2ODRD 2M4GA 2QWWA 1TWAJ 2M1BA 4RGRA 1XMKA 3LMMA 1LQ1A 1VQMI 3HL2A 2PLYA 4UXNA 1I6XA 4BL0B 2M7BA 3SFIA 4EGZA 4RMNA 4D9JA 2ADUA 3CCSI 2R7ZJ 3EETA 3PM1A 5DD8A 3MN2A 1VZ0A 5K7FA 4QLCU 5FLMJ 1VTNC 4R2CA 4JI5E 3EPKA 1OMIA 5D5VB 4R2RA 4BE2A 1I39A 3WE3A 5DS9A 5IV8B 2V7FA 1ZK8A 3HUGA 2R7FA 2WBMA 4DBQA 5A6KA 2V26A 1P6RA 1ETYA 5LD2C 1X48A 2OU2A 4KITB 4BBYA 5AASA 2Q1ZB 1BJZA 1U9OA 2K85A 1N32E 1V5FA 4KICA 4BAYA 3IV5A 1MDMB 2OTLI 3CO6C 4I6ZA 4PDKA 3S3MA 3W6VA 3IAM2 2EM5A 3M7GA 3NARA 1SAXA 2V85A 2L7MP 1RZ4A 2BW3B 2EMAA 2XC7A 2STWA 1ZRFA 3JRIA 3JR9A 1MNMC 1X6HA 3PFIA 2DDAA 5K7ZA 2EPKX 1EA3A 3FXLA 3JW4A 3L2RA 1UG0A 2LRDA 4CYDA 2AS5F 1MBJA 1ON2A 1AOYA 1Y56A 2EMBA 2CWEA 3DTKA 2E2HJ 2Y75A 4EMSA 4P78A 2IA1A 1XMOE 3DLAA 2WZOA 4DV4E 1X3WB 2H6CA 2DK8A 2VBWA 4HBLA 4XK4A 4DJAA 1FX7A 1HCRA 1YYOA 3G1LA 2FMLA 1VQ7I 2EWNA 2KPMA 1JJ6C 1W7PD 3HRUA 2VE7C 1KA8A 3S2HJ 5IT9Z 2H8RA 5J47A 1BI0A 2XUBA 2L9NA 1DU0A 1QPIA 4DKKA 2MD0A 3M3YJ 3I4MJ 1PJTA 1BI1A 5T6JA 2XB5A 3DQVC 3T1BA 4CO8A 3KFWX 4OMZA 2JOBA 1OFCX 1MSFC 1DGWY 4Y13A 5J4VA 2R4GA 3H9QA 2JP9A 4AYBA 5JVGF 3BTJA 1X1AA 4M6VA 3ELKA 3H0DA 5J3LA 3J81C 4F6NA 2K5CA 4N9IA 4V2FA 3JTGA 2CUEA 2EPPA 4BC9A 1TQIA 3S17J 2KLOA 4ZYEA 1D5YA 2LOOA 3A01A 2RQQA 3DEEA 1Z1DA 3H5RA 1GVDA 3EPJA 5D8LB 2MBFA 3ZP5A 1HXDA 4RS8A 3I56I 4IJAA 2JRTA 1EF4A 2YSRA 4WXCA 3BG3A 1QO0D 2XAHA 1ZAAC 4E7KA 4GKJE 2ME6A 4B8XA 1XGSA 4WWCA 2RQLA 1FYMA 2FMYA 4M71A 2BV6A 2EQ1A 2DT7B 2Z1DA 1EKZA 1OR7A 1WSUA 2V6EA 1S72I 2X9DA 5KAFC 2HOEA 3PUBA 4XSXF 2HWVA 2KRCA 3KIOA 4FX0A 1D0YA 2UZKA 3FDYA 4FCYA 2JA8J 3C6MA 5ICGA 5EZHA 4ON0A 3LLHA 4UB6C 4JQFA 2ZMEB 3GFMA 1GZ6A 2KIQA 4EM2A 4XLPF 2ZXHA 1TT5B 2JVAA 2VQGA 2D1HA 1K4TA 2JPBA 2LMZA 1Q1HA 4DZJA 3GF2A 4BE0A 2X1EA 4EATA 2K40A 4CSWA 2YTNA 3ASNH 3I5UA 3FKIJ 3V8JA 2XSDC 4UVBA 3PIPF 4RAYA 1U5TB 3TBIA 3LAPA 1APLC 4A5NA 1JE8A 2EORA 2CJJA 5D5UB 4OAZA 1JHHA 2FBKA 3KP4A 1B9MA 1BI2A 2CUJA 2F4MB 1OCZH 3JREA 1N25A 3LSKA 1Y8RB 2ID3A 3A0BC 5GAEJ 2EA2A 1VQ9I 2W4SA 1YIOA 3I54A 1ZARA 3CCEI 2EOHA 5FKMA 1SD5A 2JN6A 1QZYA 2LY1A 2E1MA 2YTDA 4GZNC 3EQLF 2KJCA 3CUOA 5E3LA 2X6WA 3QPTA 3ADIA 3BLYA 3CCMI 1WFXA 3GTPJ 2Z5UA 2L2KB 3I59A 2K3FA 2ZFUA 2P0WA 5LMNE 4ZYHA 2JSCA 4U0YA 1KU9A 1DP7P 5FFXA 2B7TA 3GO5A 4FETA 5ED4A 3GUDA 1JJ8C 5FLXZ 3FXJA 2L7KA 3KZYA 2L4AA 5L3DA 4ZDOA 1BB8A 1R5HA 1QGPA 2CSOA 2IGKA 5EYRA 4FQGA 2X0LA 4XONA 3OL4A 1ZBTA 3GTOJ 2CV2A 3J7YJ 2E72A 5C4XJ 2NOJB 2DOFA 2P6SA 5J8FA 3KP3A 5HLGA 3MZHA 3HM5A 3FBNB 2ZMEC 3K2ZA 3K4KA 2QYOA 3IRRA 2A6HF 2VOPA 1J7KA 1SFUA 3OIOA 2VPLA 4A3MJ 1UCRA 3AUZA 2EMHA 1TQMA 5FRNA 2R3SA 2M7QA 2DMNA 2RVCA 1PP8F 4X62E 2DMPA 4LIUA 1NG6A 4XOTA 4BDYA 2ZJRF 1Z9CA 1VQKI 3TL4X 1G3YA 1L0OC 2L3DA 2HYFA 4HTGA 1ZR4A 4WX9A 2KHMA 5LEJA 4KT6A 1GT0C 5E8GA 3CJNA 4OIPF 2AO9A 1VFCA 1U5TC 4KYWA 2EWLA 5FB2A 1FT9A 4HSRA 1HR0E 2O0YA 1SVLA 4AD9A 4BH9A 3S2WA 2HVSA 1K83J 3RPUA 1NEIA 2VIXA 5A6JA 2WBUA 1A1FA 2UWMA 2VJIA 3JRDA 1T56A 4LITA 2XRNA 4KMUX 3M9AA 2NXNB 5FD6A 4XLEA 2O6GE 1R7JA 2M0MA 1O0WA 2CUFA 3FISA 2E1NA 3DBRB 2G9WA 2YTGA 1XSDA 1JUPA 5F04A 2CTDA 2L4MA 3QQAA 4XKVA 4DV1E 1OYYA 2R5YA 3MZ8A 4IOCF 2CW7A 4PJ0C 2DQRA 2IGOA 2QQ8A 3ZRGA 5EEGA 4M6XA 3OYMA 3E6CC 2EM6A 4LU9A 4UUTA 1USTA 2HDWA 4PFPA 3JAMK 3JRHA 1F2IG 2EFPA 5JLWA 1K6OA 1B59A 5IYCJ 4I2OA 2MKDA 4CICA 1IQSA 2JYAA 4II3A 3KYLA 4B3SE 3DEUA 3BWGA 4JBAA 2N3HA 4PJJA 3BQYA 3HGYA 3VEPA 3KETA 2F5CA 1MNDA 3CMAI 2IRFG 2BY2A 4DR5E 2E5LE 4YG2F 1HW1A 3PSIA 1J59A 2EN8A 2R7OA 5J1RA 1T33A 3EUKL 5TSEA 2DODA 1ZREA 1TZLA 2A69F 4O24A 4KHPE 1OPCA 2DA3A 1MIJA 2H09A 3NAUA 4M72A 1OYIA 4HNUA 2ZBKA 1V5GA 4QTRA 4TV7A 2EPCA 2HFHA 2QQ9A 2FE3A 4DV6E 5FGMA 4LGWA 4I8OA 1WXRA 1FBSA 1IRFA 2DO7A 3HRTA 3MZYA 2ZB9A 3EYIA 3M4OJ 2HGHA 2UUCE 2QBYB 2A6TA 3E1SA 1A1KA 3FXKA 4DR1E 2YUSA 4BS9A 2RNJA 3HTSB 2R7VA 3Q0VA 3F6HA 4CCNA 2R76A 3HPGA 3M07A 3EUHA 4JP0A 1NHAA 2JUCA 4M9SA 3WTTC 1ONVA 3IAS2 1KGSA 1ETOA 4RH8A 2IXSA 2EV5A 2A5WA 2DMYA 1MBEA 4A3IJ 1IV6A 5FKNA 3ABLH 2QBYA 3ABMH 4IPAA 4S0HB 1FJLA 3FMRA 3DKYA 3IC7A 3QPSA 4LIVA 4IX7A 2HOSA 1IBME 3FKJA 5DCFA 4BYYA 2HEOA 3W2WA 4HF0A 1BI3A 2R7UA 3KYCB 3UK3C 2EMYA 2BY0A 5FJ8J 4JI2E 5B1AH 4DR3E 3F8FA 4OAYA 3F8CA 1FZPB 3GVAA 2LT7A 4K2EA 3LSTA 2VJ4A 1J26A 4WK8F 3HPZA 3OYEA 1YQAA 2V1XA 5KL2A 1UFMA 4YIRX 5E79C 2L2NA 2ZCWA 3KP5A 1T6SA 3QPHA 2EMIA 3ERED 4HLXA 1RKWA 2W48A 3ERMA 5E17F 1MNEA 1SR9A 2YTQA 4NQWB 1T95A 1MMGA 5ICCA 3S15J 1P9QC 1J09A 4HX4A 3HOZJ 3DEWA 4U88A 4AYBN 2DA1A 2VASA 4F93B 3J80K 2GXGA 2B9SA 2WY7Q 3TO7A 4LOCA 4BQNA 3VYYA 1ZELA 1ETWA 4PGGA 4B3XA 2MH2A 2XRLA 3EYYA 4MLQA 4M9XA 1L4SA 2NVUB 4M3FA 3CUQB 5L3BA 5LMUE 1G2HA 1UAAA 3F23A 3K1PA 2X48A 1GXPA 3LFKA 5LRSA 3F6VA 5HODA 2CG4A 3IRQA 1ZKGA 1OCTC 2GHFA 4U0WA 4BJ6C 5A2QK 1G4DA 4PJMA 3SDBA 4ZJZA 1N33E 2YRKA 4EVIA 2BXZA 3IP4B 1P2FA 1WJCA 4HX7A 4P1WA 1VQ6I 9ANTA 4XSZF 2YSOA 3OYKA 4BEHB 3S3NA 2PJRB 1JI8A 2NABA 2N8XA 2O8XA 2E71A 2XDVA 2KRFA 3WTUC 1MJAA 1FY7A 2XVCA 2A6EF 1RR7A 5GPCA 3RZDJ 1MBFA 2LKXA 3NWTA 2LR8A 5J4YA 1ETKA 4LLGF 3LSHA 2XAGA 1O3QA 1MSEC 1P4XA 2V86A 3FHNA 1KONA 2I9IA 1YW8A 5JLXA 3G2BA 1LNWA 4BEHA 5BMZA 2PI0A 2PJRA 3PO3J 5B3SH 4DV7E 2FRHA 5JI6A 2EV6A 2NUFA 2OQRA 1IN4A 1ZTRA 2DTZA 2Y30A 3VHTB 1FSEA 2CRGA 1MMDA 1R4MB 1U6GA 3LQQA 1M1EB 2PMHA 3R0JA 2JRMA 2H6BA 1F5TA 1QPMA 3JCUC 1FBQA 3KYDB 3JTHA 1RPWA 2EM3A 2KONA 1BC7C 2M4KA 4NB5A 4LF9E 4G7OF 4G94A 1MH3A 3OS0A 5TJJA 4EQQA 4B48A 2W1OA 1PVEA 3BR0A 1K6YA 2K86A 2Y2ZA 4LF5E 5LHHA 5KL6A 1B69A 1JTXA 2GLOA 3C18A 3GLXA 3ZQQA 1S29A 4ZYGA 3HKZA 4XKCA 1FEXA 1IXRC 1YRNA 1T39A 1MGTA 2MLKA 3BR5A 3CUQC 2FBHA 1HSJA 1OYWA 2HOAA 5EDNA 2LMDA 2EP3A 1IUFA 1MD0A 2I10A 1LKXA 3SQNA 3ESWB 3P9IA 2ZC2A 1WQ2A 1X2NA 3BY6A 1KU3A 5FKLA 2IS2A 2HTSA 3BC8A 4IF4A 1FNNA 3S1NJ 2CMPA 3T8TA 3MFKA 3FXRA 1GV5A 2N8GA 3LA3A 3CCLI 4GDFA 4IRIA 2CPNA 2LJHA 2LP0A 3ZOBA 3WTXC 2VLAA 1AU7A 2YU5A 1BJAA 2QGUA 2EOYA 3CCJI 4DNCA 3TEDA 4UUSA 2GPIA 4V2GA 1YSAC 3WTSC 5IP6A 5CLSA 1J2XA 2EOMA 1X1PA 1S9HA 1D8JA 4CYCB 1UELB 1IZ1A 4BHPA 1VQNI 3KX2A 1D1BA 4UY8I 3BGHA 4DUYE 4MIMA 3H0GJ 1QHGA 4PK4A 1WHNA 1V55H 2HU9A 4ANJA 1ETVA 5JR3A 4RM3A 2ENAA 5FO5A 1YPNA 2M8GX 2W00A 1XMQE 2ZXJA 3CESA 2K9LA 5HS7A 3FXOA 3JRAA 2L8TA 1F43A 2IW5A 2MFZA 1J0RA 2EZIA 4RAZA 3HRMA 2EQ0A 4XMYA 3IH2A 2IHR1 1SD6A 1S7EA 4CYCA 1R49A 2M9AA 1HDPA 1HW5A 3U1KA 2ISYA 2HPMA 2ZKZA 2HXOA 4HSTA 4RM2A 5HDNA 5E3MA 4DR2E 4XRFA 2R5ZB 3WHCA 2E19A 3U1DA 1HBXG 4XRMA 2NA2A 4X64E 3SJMA 1N77A 2UUZA 3K4CA 2KMUA 4KIBA 1QU3A 1SVOA 1QZEA 4G9YA 4E6KG 5C4JJ 5J8CA 3E6BA 4JI0E 1FMWA 2COMA 4RGXA 2KDZA 4BC7A 2L2OA 2DLQA 1KQ9A 2XAUA 1IN5A 1KZHA 1IBLE 1D1AA 1WI9A 1Z7LA 3OV8A 2R5ZA 3MSWA 2WTEA 4WF2A 4E7JA 1OLTA 3WG9A 1HKTA 1VF9A 4Y4RA 1RC7A 4U87A 3IWCA 3AG1H 1BC8C 3AAFA 1XDSA 2JMWA 1N3GA 1SFXA 1ZLJA 1LVAA 4P5OA 4KA4A 2EM8A 3FF5A 2Q8KA 4AM3A 2HJJA 4AQYE 3QYFA 2MC4A 3EPLA 4RGSA 2E2JJ 3GTGJ 3PFYA 3RKWA 2GIZA 3PQKA 2NS8A 2Z16A 3VYUB 2EZHA 3L1PA 2W84A 5TGTA 3HJEA 3BG7A 2LBSB 2YWQA 1PP7U 2BBYA 1J5YA 3FBIB 3JRFA 4RHBB 4R1HA 2GXAA 2ECCA 3CMEI 2K7IA 2Y69H 4A3DJ 1LFUP 1TC3C 1XDUA 5F1JA 2EIJH 2UXNA 1HF0A 3C2BA 3MKYB 3LSIA 2MDGA 3BBGA 4UB8C 1R6RA 3K2AA 4IHXA 2EL6A 2LTSA 4AWXB 1IXCA 3DF8A 3QODA 2KIUA 3IHUA 1IXSB 1MMNA 1X5WA 3OWTA 5ILSA 1HOMA 1Z3XA 2HNHA 3ECOA 3E5QA 4IHTA 1I6HJ 4UVAA 3GX4X 4ZTFA 3ZQGA 2OTJI 1U9NA 1Z1BA 1ZG5A 2EOJA 3JTZA 2IVMA 3AG4H 3W3CA 2IEKA 4GXOA 1R23A 2WY8Q 1O7FA 2I8DA 2NNNA 3HUGB 3O8GA 3TGNA 1GHCA 2BVMA 5AIQA 4F9CB 4B09A 2O3FA 5DNYA 4OU0A 1YOVB 3ZQHA 2EM2A 3BR3A 4GRIA 3QP6A 5TRDA 2FSWA 3GEZA 3KLNA 2N3GA 1Z21A 1TWCJ 1IN6A 1X1CA 3KEQA 3AL0B 4YIFA 4Q48A 2JT1A 4U7DA 1GQEA 2GBYA 1UHMA 4I02A 3MQ0A 1YIJI 1ZBQA 1PJRA 2L9SA 3NRVA 1H9GA 5M5YJ 1PDNC 2A3SA 2L33A 3H3UA 1KQ0A 4RA2A 1ZLKA 1VQ4I 2ELJA 2VQFE 1XN7A 4M3GA 4XLNF 2QENA 4IL6C 2JSPA 3G1OA 2FNPA 4HG2A 5HLIA 1A1IA 4BGDA 3OS2A 1DP3A 2O8KA 1G3SA 3HC7A 1T0FC 2LUQA 1RI7A 3K0LA 4NC7A 4W1UA 3S2DJ 2ISZA 3WTZA 3F8NA 3C3WA 4JYKA 4P55A 5GAHJ 4LG0B 2KHXA 1SFEA 3QOPA 2GXBA 5K7HA 2E1CA 2YTEA 4BHCA 3L2WA 5M5WJ 3V7RA 3WHBA 2FD5A 1TL8A 4UV9A 1GDTA 5CVRA 3M8JA 2VE9A 4A3FJ 1H8AC 2FOWA 2MC3A 3UKGA 2MDRA 2D1VA 1HQCA 3T5XA 2YS9A 1FP2A 5KHDA 3LAJA 1XX5A 1SMYF 1ZAOA 3LFUA 1XSVA 4GGGA 4LG0A 4F54A 4G12A 4P7DA 1Z77A 3CP8A 2B3TB 5IPAA 1IGNA 5IYBJ 5KVRA 1NH3A 4MQVA 3DTIA 3WGGA 2EFWA 1ZH5A 2WV1A 4RBOA 3DCFA 5BPDA 5E3OA 2E36A 3R0AA 2LH9A 3ABKH 2RQPA 2ZSHB 4M3EA 2XIGA 1RRJA 2UUAE 2K02A 4F52A 1S6LA 3A01B 2HOTA 3E97A 4PUSA 1P7JA 1E3OC 2RSIA 2P4WA 4IEJA 2CUZA 4QPQA 2CW0F 1E17A 1WJ5A 2L2MA 2XGDA 3FM3A 4XLFA 4A0XA 5AONA 2ZJ2A 1FJGE 2VQLA 2WAQN 2KZGA 3G1MA 1BOAA 4U7BA 3H9GA 1E3PA 2EPXA 2L7FP 2ID6A 2H94A 1ZN2A 4J01A 2F8BA 1Z6TA 4AC0A 5E8IA 2G7UA 1STUA 4HW0A 3BG6A 1GVJA 2Q2EB 3ZOQB 3OYHA 2NRAC 4L9TA 1OCRH 2VT2A 2B7VA 4KWYA 1FIPA 2Y0MA 4ZYDA 2DGCA 3F8BA 3GZNB 3CJQB 1ZG1A 3CLOA 2WADA 1R4NB 1Y1VJ 2F48A 3K7AJ 1X6EA 1ZGWA 3Q9SA 4JX4A 4ZZLA 1HDDC 5DTDA 2EJ4A 2IGMA 4OWRB 4PGHA 2Q2EA 5EG0B 1T4OA 1D0ZA 2LFBA 2QQAA 4XN0A 2BB8A 2J7JA 1UZCA 4A3LJ 3M8FA 4MFDA 4MGRA 3PUFA 3HKZN 2O7OA 2RDPA 3OOPA 3P9KA 2I5UA 5LGUA 3WU2C 2K9SA 4M6YA 3HOWJ 1YO5C 2V9VA 2JOXA 3VOEA 3E5UA 4ESBA 2LF7A 1B8IA 5CVIA 4BY7J 2AQFA 2BHZA 1WH7A 5EG0A 1UBDC 1Y39A 1R1TA 4JX6A 1J5EE 2UXDE 3DLLF 3DU5A 4G6QA 1Z6RA 5HS8A 3OYAA 2VXZA 1BIBA 2XF5A 1S3JA 3BR6A 3K4BA 3K6QA 5AC5A 1D8KA 2E1MB 1DDNA 3TP0A 4KMFA 4WCGA 3C6KA 4FT8A 4EJVA 4PSWA 2GLIA 2KJBA 2QVOA 1RC9A 1BOBA 2EFQA 1KU2A 3C2HA 5F64A 1FWZA 5FROA 2WBSA 4HQMA 3I59B 3ZGKA 2JY9A 3TP3A 4IZZA 4BXXJ 3JAMC 3HIFA 4LF6E 1OKRA 2DOEA 2LLKA 3K6GA 1UILA 1MKMA 4FASD 2JPAA 4JYAE 1XPXA 5IY5H 4Z2YA 1IN8A 1UHZA 4DV3E 1YLFA 1EKEA 2FF4A 4A93J 3U2RA 5J1UA 3BZKA 2MC6A 2CQ7A 2WWYA 2DMIA 2OZUA 1IO2A 1Z91A 2MLGA 4C2UA 2IT0A 1WCMJ 4ESJA 3DPUA 2EILH 4PSXA 4BE1A 4Y33A 4L9VA 5D8KB 1E3HA 4Y3OA 2IP2A 1DQUA 1B72A 3ADGA 4LLLA 5IT3A 4IXAA 2OAZA 1SANA 1W4MA 2IA0A 4EJWA 3RSNA 2ZSIB 3D5SC 1AKHA 3FXMA 4HF2A 3MHHC 1NTCA 3B73A 3NWSA 2LDUA 5HVQC 2M7AA 2IS1A 1PJQA 2YU8A 2JA2A 4R79A 1F1ZA 2P5VA 2EM9A 1YW7A 3BPXA 1W0TA 2JWTA 2V1NA 3OYGA 3CMMA 3KP6A 1KYWA 3PNVA 4UV8A 4EJUA 4DR7E 2DFEA 1T08B 4UVCA 2WB1N 4JI7E 4OIOF 4AIDA 3Q0WA 5M3MJ 3BP8A 1LVKA 2E7XA 3TQNA 2O03A 1PUFA 4IRHA 4ZDPA 4CDGA 3ML6A 2Z2SB 5CJ9A 4A2UA 2MSYA 3OYNA 4JI8E 5IOZA 3CDHA 4J19A 1VQPI 2RC4A 2K7LA 4LTYA 3ZQIA 1ZGAA 3HG9A 1U78A 2R5YB 2M3AA 2VQCA 1XC5A 3KP7A 4X66E 1XG1A 3BG9A 1WKMA 2B7EA 4IHWA 4WYQB 2VE8A 2H8WA 4HV5A 2K4VA 3ZQCA 5K5OA 4M3DA 2EN6A 4BBRJ 1NCSA 5E3NA 3GTJJ 1D0XA 2DA2A 2QLZA 5C3EJ 3GZ6A 2UXCE 1STZA 4KN4X 3DP7A 1N78A 2ACJA 4AU7A 4LF4E 1YUJA 1I27A 2DT6A 1J75A 1V4RA 2F4IA 3UR3C 1TLHB 3E5XA 5IXMB 1RNLA 4HOBA 1U8BA 4CXFA 4HYEA 2RREA 2EL4A 4YHHE 1MW7A 2L02A 3J80C 3FMSA 6PAXA 2EMXA 4II2A 2EZLA 3WODF 1YHQI 2CS3A 3W6KB 5LBQA 3HSFA 4LFUA 2AHQA 4L5NC 1JXSA 2QF7A 4E7LA 1R22A 3SFZA 4PFOA 2EIMH 2RS6A 2M5WA 2H1KA 4DUZE 2YU3A 3K70C 3QWLA 1P92A 1UJ8A 2DB2A 1TWGJ 2M0CA 2EPOA 3HQ1A 1XTAA 2Y9ZA 2QSGX 2V87A 3EPZA 5E18F 3RCOA 1IDZA 5A2QC 4FK5C 2DPDA 4ZC3A 1YI2I 1XGMA 4LG3A 2R93J 3R4KA 3VK6A 3LA7A 2Y48A 1WHQA 2ENCA 2KP6A 1G3TA 2H1LA 1HNXE 3PNTA 5F0CA 2W82A 4KIGA 1QA6A 3OYJA 3BR2A 2E2IJ 1MEYC 2OCEA 1W0UA 4LJZF 1EH8A 4KIFA 5LGNA 5IT9K 3V8LA 3C7JA 2OJED 3I4NJ 1HKSA 2HTJA 3TOBA 1JKOC 3THNA 4K0KE 2ME0A 3FK7A 5HLHA 3GMEA 1RIOH 5H2FC 1FTTA 3ZMDA 2PMUA 2EOZA 3OYLA 2O61A 4N4OB 3IH4A 3OMLA 1C0WA 2YTIA 2FV4B 2OCCH 4HNTA 4KZSA 2P5KA 2R0QC 3J7AY 3ZQ7A 5E1WA 2X6YA 2VN2A 4IQJA 3WGIA 1O3SA 5A6BD 1X3ZB 2E60A 3ABUA 3QYEA 5L3EA 2HC5A 2L5QA 2VKVA 2NS0A 4BDZA 2A61A 4L0YB 1DGCA 4NHRA 2IAIA 3U9GA 3GYHX 1YS6A 4B44A 1TT0A 2FUG2 2H36X 4BQAA 2V88A 2UU9E 5CVUA 3BJ6A 3O2PE 3QAHA 1IW7F 2VBZA 1FYLA 3AV0A 2RN7A 4MHGA 3X2QH 2EIKH 3K10A 1WH5A 2JPCA 3QYBA 3AG3H 4JK1X 4B1RA 1RKTA 2GOXB 2BY1A 4EM1A 1G2DC 5DD4A 1XMAA 3DF6A 1BR1A 2UXBE 2R7DA 4DIQA 2PMZN 4R2DA 5KK1A 4NZVA 5J40A 4ENMA 3A02A 3BT9A 5EGOA 5IP7J 3I9V2 3EDPA 3BCBA 3PSFA 2LG4A 4YFNF 1IC8A 5ICFA 2GIVA 2X1DA 1UMQA 3GFIA 2DBBA 2DRPA 1FOXA 2BZTA 2CQQA 3ZN1A 1BBGA 2QCOA 3ULQB 2DXIA 3T0YA 2FX0A 2VBXA 2VC0A 3BTLA 2W25A 4HF1A 3Q3SA 3EUHC 2W57A 5H6QA 4YY3E 4CH7A 3E7LA 4G7HF 2EPZA 2W7NA 3ONQA 5ICEA 3QP5A 3CCRI 4GEQB 5AC4A 4EJOA 4RB1A 1E0EA 2XASA 1WPKA 1OCPA 3G73A 3H92A 4L18B 3S1MJ 2XAFA 2TDXA 1A5JA 2IS6A 4X8WA 2D5VA 2YPNA 2GQQA 3V4GA 2DK5A 3HHHA 3MKWB 1IBKE 4FISA 1IJWC 4I0BA 5HNHA 3HZJA 2IJLA 3BZ6A 5D6EA 1JTYA 2CW8A 1W7PA 4HAMA 4P9UA 1T4LB 5BS6A 1JKPC 5GTIC 5D5WB 2DFHA 1A1HA 2EPAA 3TDZC 4OOGC 4PCQA 2WAQA 4LD5A 3ZN0A 4C2TA 1G3WA 3ZMUA 4LF8E 1AAYA 1S7AA 2V79A 5H6RA 3WG7H 1FOKA 2PRTA 4HQEA 2MGQA 2R1FA 2BY3A 4EJTA 5FLXK 1LFBA 2YU9J 2B63J 2F4OB 2LRSA 4A3KJ 5DYMA 2DA5A 4PJNA 5CQGA 1JUMA 2MD5A 4M0VA 2MC5A 2X6XA 1JGSA 3TO9A 3WU1B 1A31A 3C4BA 4Q28A 1ZGJA 2LJUA 3HOSA 3RZOJ 1YRNB 1E2XA 1I94E 1R1UA 2KFDA 2F5FA 3FZVA 5FD5A 1BIAA 3CTAA 5HOOA 1K78A 3S14J 4XLCA 4X9JA 4R2PA 3OYDA 1EJ9A 1GUUA 4OINF 3TQMA 4O3MA 2NYXA 2ZO4A 4M9VC 5KAIC 5E1XA 2BEOA 2HVRA 4DV0E 3BG5A 3TW7A 5CFFE 2TRTA 5KL7A 3MMYB 4IO9F 1Y8QB 3DU6A 4FE7A 2FQ3A 3ZMVA 4AVZA 4J00A 4EGYA 2PFBA 4XR6A 2DCEA 3I64A 4OX9E 2LKSA 1FYKA 2HI3A 1SC7A 3G71I 2L7ZA 3N4MA 3G3ZA 2EOQA 4DQ2A 3RDIA 1P47A 4NXME 3OYFA 4UUSB 2E5NA 1ENHA 1SMTA 1KU7A 1ERDA 3KEOA 1B4AA 3NQOA 4MTDA 3HRSA 5F6FA 3P1XA 3H5NA 4XLAA 3NEUA 2QKLB 2YTJA 1HKQA 3HBLA 2G7HA 1H0MA 3QOEA 1TNTA 4A3EJ 5GPAA 1O3RA 1I50J 2KZVA 3F8MA 2L0KA 4X6AJ 4RAFA 1VQOI 5IYDJ 4RB3C 4MEXF 2CFOA 3WTYC 3W2AA 2EOSA 2EMKA 4J8ZA 3EUAA 1WJFA 1T8IA 2V9KA 1X1DA 2WC2A 4M73A 1NK2P 3CD6I 3T1HE 5F3WA 4OIQF 3SDGA 2FU4A 2DIXA 4N9HA 1Y0NA 2EPLX 3I71A 4HPQA 4X0GA 2K4JA 2CQXA 3TO6A 4B47A 4ENKA 3OIQA 2UXXA 4I01A 3K4JA 3BOQA 1TW2A 4ESFA 4YFKF 3HSRA 2V1DA 4CZZA 5CVJA 2DTRA 1Z0XA 3O8HA 4A0YA 3K70D 1DQ3A 4IQ4A 4AIKA 3LQRA 1XD7A 1AA7A 2KOUA 5LEKA 3O6BB 3CCUI 2CFXA 1FBUA 4G6TB 2WCC3 3SZGA 5ILUA 3OOUA 2LVHA 3MAJA 4H4KC 2KDOA 4E7HA 3I58A 1IRGA 4A3GJ 1WWXA 4BJTA 1F4KA 1VQ8I 4NUBA 3M1EA 5ERIA 2M8EA 3CZ6A 3SXYA 5AE1A 4XBFA 1EV7A 5LL6R 1MBHA 3OSFA 2LTPA 4XL9A 2XF7A 3F72A 4D7MA 2XF6A 4CGZA 4JX5A 4A6DA 1YTYA 5JVTA 1WVRA 3L9FA 4D5CA 4R03A 4U0VA 3VODA 1PYVA 2WB1A 4GYGA 2HKOA 4I98B 2DLLA 4OOIA 1X4OA 2GWRA 4AIHA 1F36A 4D0PA 3WU0A 4S05A 3ECHA 3K69A 3Q0UA 2AQEA 3HTXA 1N36E 1YITI 1GTKA 5GTHC 3DV8A 3DBHB 1KYQA 2EOOA 2XGEA 3CCQI 1T2KA 1X4PA 2JA6J 2X4HA 2LNBA 1XGOA 2RAEA 3REOA 3S32A 3CQZJ 3H9JA 4BQOA 4D7NA 4BKXA 4Z6YA 3OSGA 1U2WA 1Z3YA 4XORA 2F5EA 3H1CA 2YX4A 2MYSA 4M3BA 3S8PA 3D5LA 3FWEA 4DR4E 2WAEA 2EPMX 1MH4A 1YUIA 1W1WE 2YTFA 5IP9J 2KT0A 1T4NA 2NUEA 2I13A 2L54A 2EZKA 1IAWA 1O7LA 2Y0SA 3VWBA 4MLOA 2YX7A 2WA0A 2YR2A 3L7WA 2CQNA 5E20A 1Y1WJ 1Z7UA 3DPLC 3H5AA 4MTEA 2WBTA 4Y17A 4DR6E 1X58A 1YFHA 3C4TA 2EE8A 5B5EC 2LTRA 2K9MA 2ETHA 3ADLA 5B66C 1JK2A 3J81Z 2LREA 2XB0X 4I7HA 1TTYA 5C44J 5EJCA 4M30A 1LE8B 4KNYA 3BJAA 4UNOA 4KUMA 5ILVA 4IKFA 3HEFA 2Y9YA 5A6AA 1PDAA 2QKMB 1B1BA 2XROA 1X6FA 2F5VA 4LMYA 4GCVA 4ZYAA 5AE2A 2CSHA 3DXJF 1BA5A 4IOAF 1DPRA 3GWZA 3HDDA 4BQQA 1FKAE 2XPWA 2XPUA 1XB4A 1Q1VA 2LKPA 5DEQA 3SEZA 3PNYA 5IOYA 1LE8A 2VL8A 5D4SA 1PJSA 4AIJA 3HB9A 3CDIA 3ZMZA 4A12A 1MZBA 3WTWC 4F2JC 3B02A 1A1JA 2RKHA 2R92J 3I53A 1IRXA 4D5FA 3OMYA 3CF5F 4S04A 1A6IA 4IVNA 2B0LA 2VJJA 3VSKA 3JRCA 2V89A 2DMUA 5CQEA 1XSXA 3HOYJ 3BQZA 2IA2A 3BCAA 2P5LC 1OQYA 4LB6B 5F0HA 3BROA 2AXTC 3RQIA 2DJNA 2YZTA 1TW3A 1WJPA 5EZGA 5BPIA 5DUIA 1ZU1A 4C3IJ 5K5QA 3BJOA 1WZ2A 3COAC 4KT5C 1QNTA 3OYIA 4IHYA 2A07F 2W85A 1A1GA 4JV5E 3ZQFA 1G59A 3ZXSA 2EN2A 3GLLA 1ZYRF 2L3JA 4EM0B 5D4RA 1HW2A 1LEAA 4A0ZA 3THOB 2JVHA 4FHTA 3K4LA 3MCZA 5CKTA 3PL8A 3GTMJ 1UHWA 2E1OA 2XSJC 1TF3A 1YJNI 3Q9VA 3K9TA 2LO3A 1SD7A 1Z67A 1I3QJ 3JAMZ 1MBGA 2E34A 4A3BJ 1R5ID 2FTXB 1GLNA 4YELA 4Q35B 5A6BA 2HYJA 2BVLA 2DA6A 4NBQA 4ZH4F 2HDDA 2VUMJ 3HPSA 1SVMA 2XKPA 4X1EA 4RAGA 2PJPA 2X51A 4O5VA 1MDMA 2PMZA 3LSRA 2Z33A 2CO5A 2ZNYA 3M1CA 2BW3A 1ZQ3P 2EPRA 1FSHA 3ZMSA 5HDKA 4G6DA 1P4WA 4HZFA 4C2MJ 4F92B 1HNZE 3H35A 3SZPA 2EPNA 5D6FA 2YT4A 2OC6A 2Z9OA 1YZ9A 1T38A 2ZXIA 4R8OA 3SEQA 2IPQX 4L5JA 1V3FA 4BCAA 4DYCA 4F55A 3L2QA 1UN6B 4QWQA 5LHGA 3AL0C 4XKBA 3OL3A 4XQFA 1VQLI 1DGRM 2VBYA 2V8QB 3U21A 2FGGA 3R6SA 2YTPA 2M2EA 4N4NB 1R5GA 2VXDA 1HC8A 1POGA 2H27A 5FFZA 4HNVA 1WJDA 5B1BH 3A1YA 3KEYA 1SD4A 2GZWA 4RB0A 5DUKA 4QIWN 3SHFA 1SEUA 1UHSA 4E7ZA 4C9YA 2HZTA 2OPTA 3N05A 4P9FA 2K4BA 1YX5A 3TDUC 2M1SA 1TN9A 2XGCA 3F6GA 1B8IB 4Q5SF 1FOYA 4I0AA 2ZJPF 4B4CA 4ABZA 5JHUA 4FX4A 1WJAA 3VFZA 1YS7A 1WJBA 2MA3A 2EMFA 1MJBA 3RQ4A 3KP2A 3FM5A 4HA8A 1I1SA 2V9PA 1IUYA 1VI0A 5L3FA 4B3ME 3IWFA 3SYTA 1HSTA 3CC4I 3CCVI 4CUGA 1FLIA 1P7IA 2M45A 4LFAE 3CF2A 4I09A 4DW6A 1BN5A 3BPVA 5F08A 3ZPLA 3OYCA 3BIDA 4CZCA 3GBGA 3D1NI 3ZQLA 2EN1A 3F3XA 2LY2A 4HLYA 3I0TA 1N34E 5BNGA 4QPOA 4RLFA 1YYKA 4BUPA 1RUNA 4BMJA 4ITVA 2BGCA 1JT6A 1S5LC 4Y15A 3RMPA 1OJLA 2X6OA 3J80Z 1H89C 4OMYA 1VNDA 2P8TA 3G6EI 3RIRA 3FK6A 2EQ3A 2V4JC 1I1GA 3KZIC 1AHDP 4N4RB 3EQ1A 2RPCA 2GA1A 2ZMEA 5L3GA 4RGUA 3KZZA 2HHHE 4F9AB 1XGNA 1CGPA 1A1LA 4RDUA 1TWHJ 3GXOA 1OR7C 5K5RA 1MBKA 4KDPA 2LCEA 2IGNA 1R00A 3MWMA 3V7CA 5F0FA 3QG5C 3LWFA 2OUMA 2WV0A 2L9RA 4R8HA 3K4NA 1B72B 5A2QZ 1LPQA 1JUSA 2DN0A 2XHKA 1Y6IA 3HTUA 3GFJA 2XGXA 2P6TA 1AKHB 1USSA 2RV8A 1F9NA 1XCBA 2YPRA 2MG4A 2CQKA 3ASOH 4B43A 2P7CB 1YYWA 1K7AA 2G0EA 4NC8A 2TCTA 1X19A 2FEZA 1U5TA 2EMGA 1QRYA 2NS7A 3CJRB 3OTOE 3FXQA 5KL3A 3Q5FA 2CV1A 3OYBA 3A2KA 5DV5A 5A69A 1IF1A 2ELZA 3B6AA 1X49A 5IT9C 1BM9A 1RUOA 2EV0A 3OR2C 2EOIA 1PUFB 3UNGC 3W2VA 1OISA 2X1CA 4CHUA 2BE5F 2EBIA 5M5XJ 1R36A 3ZMTA 1QBJA 1G2FC 4MQ9F 4M74A 5BOXA 4EEFG 3QRFF 2R7TA 5JHFA 2HKXA 3GTKJ 4HRIA 3J81K 2KKOA 4GYIA 4TUGA 3CDLA 1B6AA 3K4MA 5DM6F 4WXDA 4Y7NJ 2MH9A 2A25A 1W5CC 4O4KA 2DPUA 2E7WA 2JVGA 4L0ZB 3KE2A 1BBOA 4X65E 4W97A 1X2MA 1AH5A 1U3EM 4O43A 3K1NA 1V5EA 2BHYA 4JI1E 2CH0A 2ICWG 2HPIA 2HDCA 2QUFA 1KJKA 1FMVA 2JK3A 1QQIA 1TBXA 2R7WA 2E1MC 3DBLB 4YIIA 1R71A 2QA4I 2VQEE 3MKLA 4MO7A 1TQPA 3LL7A 2JUGA 4LK1F 1R58A 2JJ7A 2C6YA 3BTCA 2FOKA 4BY1J 4DGWB 4R2SA 3OIPA 1YYVA 5TISC 1ZR2A 1LUJB 2Y0SN 4E7IA 2DLKA 2OBPA 1O57A 2QM3A 1MMSA 4UUVA 3GTQJ 1IV8A 2PX9A 2VRDA 2DOAA 2RNGA 5D5XB 2L01A 2EOEA 2XV4S 1HLVA 3IUOA 3D0SA 3MHSC 4H0EA 2ELHA 4O6JA 4A6EA 2XAQA 3L2CA 4PJLA 3F21A 2RSMA 4YFXF 1BW6A 1QVUA 4WSGA 1WHUA 2DYSH 4DBRA 4DV2E 4M9ZA 2P81A 2R7SA 1TP4A 4FTHA 3CJTB 3GZ5A 1ZRCA 2VF1A 4E7SA 2CGPA 3E6DA 4Q47A 5KL5A 3IKTA 4HEIA 2DYRH 3B6CA 4L9NA 1LDDA 3ADJA 4BU2A 1D3YA 2YRHA 2LE2A 1RETA 5EEHA 4GO1A 3DPTA 3OR1C 4CA0A 2R7XA 3CP2A 3S1QJ 2EMLA 2EZ6A 3PO2J 1FPQA 2RTXA 2DMTA 1S8NA 4CCOA 3CMYA 3H09A 4DYQA 1A04A 1TNSA 2GOMA 1IRZA 1LJ9A 4PZJA 2IS4A 2EQRA 2UV1A 2DAOA 2JA5J 4CCKA 1TF6A 3DKXA 3BZCA 3A4CA 4E70A 3J7Yp 2PG4A 1LDKB 1DI2A 3RTRA 4LFBE 2EM7A 3CC7I 3DKWA 3RYRA 2F4VE 2Z3YA 4MFEA 1JK1A 3JSOA 3LA2A 1K79A 1O4XA 4KISA 2VPRA 3GCMA 2J5PA 2BBGA 1X1BA 2NAZA 1W36C 3C1DA 3RKQA 3KLOA 2VKEA 1RMDA 5FLXC 2WAFA 1RESA 1MJ9A 3OS1A 4ENNA 1N75A 2KIFA 2EFNA 1IMUA 3HGGA 2EPUA 2ADRA 2O9LA 5GADJ 3LSPA 2M4IA 1FC3A 2NVQJ 2OF7A 2KRHA 3S1RJ 3TW6A 2M87A 2DA4A 2EMCA 3H36A 2O5RA 3VYSB 1ZHFA 1ZG3A 1JKRC 1HNWE 3V8KA 4KFCA 1ZR9A 1YW9A 5AE3A 4YRVA 4A5MA 4WXHA 2XAJA 3AFHA 2LVSA 2KL4A 2F2EA 2HZDA 5EGOB 5F1RA 4XRSG 2A05A 2B9DA 2L92A 2MW8A 1QU6A 3JSPA 5M3FJ 2HXIA 1ITYA 2HQRA 4YEJA 3W6JB 5HDGA 2VC1A 4MLVA 1LLMC 3VB2A 5HS9A 3RI4A 2YTOA 2E5ZA 4HV6A 2KIMA 5LLQA 2PN6A 1EH7A 1IG7A 2DFFA 4DOZA 5JFRA 4IHVA 1G6NA 1BR2A 5GAGJ 2EH3A 1JHFA 5FKOA 5J6XA 3HPHA 2COBA 4XN3A 3ZR8X 5L3CA 2DW4A 4DV5E 4LFCE 2HGCA 3KWRA 2JQ7A 2ELYA 3FXUA 4R2AA 1WI3A 3FX3A 4IHSA 3HSEA 2STTA 4HDUA 4ENJA 2PBIA 4WFTA 4XM3A 3D5RC 2OZ6A 2LSOA 3HOUJ 2JZYA 1JT0A 3DTEA 3F22A 3IWZA 1NG7A 3KCCA 1J9IA 1YJ9I 5DCMB 2EMWA 3JU0A 4IS1C 1W7PB 3A03A 3RKXA 5BR8E 2LYCA 1YG2A 1K61A 1H88C 2LF8A 5DM7F 2K9NA 3E3VA 2ELKA 4KN7X 4JOMA 1YJWI 1Z05A 1RR8C 2ODRC 2ZNZA 3GFLA 4NC6A 3IL2A 1FTZA 1RQ0A 2EA4A 1R9TJ 5AIPA 2VT3A 1JKQC 4KJZA 4QSHA 3QU6A 1LB2A 2DDBA 3VYTB 4XRSA 2JTVA 2EL5A 2M30A 3DJWA 1BL0A 4NQWA 1ETXA 5K1YA 5DCMA 4JI3E 5LGTA 4XIDA 3EPHA 2ZFWA 4NXNE 3FIWA 3OY9A 1O3TA 4LLNA 2HS5A 5J1YA 3J7AO 2ZJQF 3CLQA 4CCLA 2V1UA 1CF7B 4RB2C 1DU6A 2GAUA 1FP1D 2ESHA 2L9VA 3HXLA 5FLVA 5IWAE 3ZCOA 3CUQA 3VYRB 1K78B 4TUIA 3BR1A 2VKHA 1LFPA 2JWOA 3J7AG 4CCMA 4G7ZF 5BQTA 2ESNA 4BXFA 2QEXI 4L5IA 2VJ5A 3V42A 5LHIA 1LEBA 3HOVJ 2W24A 1HA8A 1W5SA 2HQNA 4BHBA 2DA7A 1P4AA 4L8NA 2JA7J 2K27A 1YX3A 2HR3A 1SFOJ 2QSFX 3GW2A 3HHGA 3J7ZI 1CF7A 3GTLJ 2P7VB 2EOFA 3M8EA 3RYPA 4RLQA 2DQLA 2BYVE 2KISA 1XCVA 3LSJA 1A35A 1ETQA 2XKOA 3DFGA 1CQTA 2EPFA 2DMQA 4L5EA 4P96A 5FRMA 1S7OA 2BOLA 2EB7A 4WSPA 2E35A 4LF7E 2JR1A 1QVTA 3JRBA 1XS9A 2HQ5A 4XNFA 3MD2A 4AVPA 5CVVA 2VOOA 4D1QA 3HYIA 1UB9A 1EH6A 3A0HC 4GFBA 4L9JA 3ISPA 1WJEA 3G4SI 3VSLA 4XLHA 4N0BA 2HQAA 4OIRF 3E0JB 4G8XA 2GA2A 5LFAA 1JGGA 2JXPA 1I5ZA 3MVPA 1L3LA 2LY9A 2OD5A 3C2GA 3S93A 2NVYJ 1SAUA 3VDXA 5ADZA 2A5YB 3BDDA 2LUPB 3F6OA 1A6QA 4C3HJ 2R7QA 1D1CA 4A3JJ 2NVXJ 3IH3A 2M34A 1ODDA 4V19K 4ZTJA 2VQHA 4JI6E 2VONA 4M2ZA 1BW5A 2YSPA 3VPRA 2BXYA 2ZXWH 4A3CJ 2CYYA 1LDJA 4BBSJ 1IDYA 2K3PA 2HYGD 1WGXA 1PKPA 2EN3A 3WGHA 1ACIA 4EV0A 3MEXA 1X47A 4HDVA 1DUXC 5CYVA 5HNFA 4F6MA 3JRGA 3HOXJ 4CCJA 3TMOA 2FBIA 4BXUA 4E4HA 3AKZA 3F9KA 3PIOF 2LC2A 2HVQA 5E1ZB 1ULYA 2OA4A 1V54H 3L2VA 2MKNA 4BJ5C 3LMLA 4IJDA 2DI3A 1FIAA 2DT5A 3RKYA 1R1VA 2LD5A 1REPC 3L09A 2YRMA 2AXLA 3O3KA 1KYZA 4BACA 1NK3P 2KQRA 4O5GA 3TOAA 1GXQA 1X3UA 4LK0F 3SZTA 1U0JA 4AUXA 3IWDA 2PEXA 4FE4A 4ZDLA 3H3VK 4R2EA 4XOPA 3M99B 4ETSA 4BNCA 2Y31A 2EM0A 3WTVC 1FOWA 3F0CA 4F91B 4DYRA 3IWBA 3K1MA 4JI4E 2EFOA 5KL4A 5F27A 3N97A 5KCMA 1ON1A 3RPUD 2D45A 2K9QA 1YE9A 3BTIA 2V83A 3DWLE 4NNJA
chains in the Genus database with same CATH topology
2Z99A 4IRGA 1BBYA 3PQJA 2PQ8A 2DFIA 1W5TA 1AWCA 1QZZA 3E6MA 3I4PA 5LRRA 4ZZDA 2DU9A 3HOTA 4Q4ZF 4LB5A 2Q0OA 2QQBA 2D2WA 2VODA 3H3ZA 3RJPA 2EJRA 3WE2A 3ROUA 2FA5A 2RGVA 2V6CA 3R60A 2QZ8A 4F7ZA 4UHTA 2J5OA 4MEYF 2OQGA 4HX8A 2EK5A 2A68F 3R61A 3FHZA 2NNYA 2FNAA 3P7NA 1B9NA 1ZRDA 3T8RA 3FMQA 3RPQA 3CO7C 2F5DA 3V7SA 3L00A 5H20A 1IN7A 1U8RA 1KQ8A 1WRJA 1T0FA 5DDGA 1Y0UA 1T98A 1DPUA 2FXAA 3P9CA 3TKYA 3ABTA 3IKVA 1PUEE 3QU3A 1D5VA 1H9TA 4NHJA 4ASNA 4MNUA 2QWWA 2M1BA 4RGRA 1XMKA 1LQ1A 2PLYA 4UXNA 1I6XA 4EGZA 2ADUA 3EETA 5DD8A 1VTNC 4QLCU 1OMIA 5D5VB 3WE3A 3HUGA 2R7FA 1P6RA 2OU2A 4KICA 4BAYA 1MDMB 3CO6C 4PDKA 3M7GA 1SAXA 1RZ4A 2STWA 1ZRFA 3PFIA 3JW4A 4CYDA 2AS5F 1ON2A 1AOYA 2CWEA 2Y75A 4EMSA 2IA1A 2H6CA 2DK8A 2VBWA 4HBLA 1FX7A 2FMLA 2EWNA 1W7PD 3HRUA 1KA8A 5IT9Z 1BI0A 2XUBA 1BI1A 3T1BA 3DQVC 4CO8A 3KFWX 4OMZA 4Y13A 3ELKA 4N9IA 3JTGA 1TQIA 4ZYEA 1Z1DA 3ZP5A 2MBFA 5D8LB 1HXDA 4RS8A 4IJAA 2JRTA 2YSRA 4WXCA 1QO0D 2XAHA 4B8XA 1XGSA 4WWCA 1FYMA 2FMYA 4M71A 2BV6A 1OR7A 1WSUA 2HOEA 4XSXF 2HWVA 2UZKA 4FX0A 5ICGA 4ON0A 4JQFA 2ZMEB 3GFMA 4EM2A 4XLPF 2D1HA 2JPBA 1Q1HA 3GF2A 3I5UA 3V8JA 4UVBA 4RAYA 1U5TB 3LAPA 4A5NA 1JE8A 5D5UB 1JHHA 2FBKA 3KP4A 1B9MA 1BI2A 2EA2A 1YIOA 3I54A 1ZARA 1SD5A 1QZYA 3EQLF 2KJCA 3CUOA 3QPTA 2Z5UA 3I59A 4ZYHA 2JSCA 4U0YA 1KU9A 1DP7P 5FFXA 3GO5A 5ED4A 3GUDA 5FLXZ 3KZYA 2L4AA 5L3DA 1R5HA 1QGPA 2CSOA 2X0LA 2P6SA 5J8FA 3KP3A 5HLGA 3MZHA 3K2ZA 2QYOA 3IRRA 2A6HF 2VOPA 1J7KA 1SFUA 1UCRA 1TQMA 2R3SA 2RVCA 1PP8F 1Z9CA 1G3YA 1L0OC 2L3DA 2HYFA 4WX9A 5LEJA 5E8GA 3CJNA 4OIPF 1U5TC 4KYWA 5FB2A 1FT9A 2O0YA 4AD9A 4BH9A 3S2WA 3RPUA 2UWMA 2XRNA 4KMUX 3M9AA 5FD6A 2O6GE 1R7JA 2E1NA 2G9WA 1XSDA 2L4MA 1OYYA 2DQRA 5EEGA 4M6XA 3E6CC 1USTA 3JAMK 2EFPA 1K6OA 1B59A 4I2OA 4CICA 3DEUA 3BWGA 4JBAA 3VEPA 3KETA 2F5CA 2IRFG 4YG2F 1HW1A 1J59A 1ZREA 2A69F 1OPCA 2H09A 4M72A 1OYIA 2ZBKA 4TV7A 2HFHA 2QQ9A 2FE3A 5FGMA 4LGWA 1FBSA 1IRFA 2DO7A 3HRTA 3MZYA 3EYIA 2QBYB 3HTSB 2RNJA 3EUHA 1NHAA 4M9SA 3WTTC 1ONVA 1KGSA 2EV5A 2QBYA 4IPAA 3FMRA 3IC7A 5DCFA 4BYYA 2HEOA 4HF0A 1BI3A 3F8FA 3F8CA 1FZPB 3GVAA 4K2EA 3LSTA 4WK8F 1YQAA 2V1XA 1UFMA 2ZCWA 3KP5A 1T6SA 3QPHA 3ERED 4HLXA 5E17F 5ICCA 4HX4A 4U88A 3J80K 2GXGA 3TO7A 4PGGA 2MH2A 3EYYA 4M9XA 3CUQB 5L3BA 3F23A 3K1PA 1GXPA 3LFKA 5LRSA 3F6VA 2CG4A 3IRQA 4U0WA 5A2QK 1G4DA 4EVIA 1P2FA 4HX7A 4XSZF 2O8XA 3WTUC 2KRFA 1MJAA 1FY7A 2XVCA 2A6EF 4LLGF 2XAGA 1O3QA 1P4XA 1YW8A 5BMZA 2PI0A 1LNWA 2FRHA 5JI6A 2EV6A 2OQRA 1IN4A 1FSEA 1U6GA 3LQQA 3R0JA 2PMHA 2H6BA 1F5TA 1QPMA 1FBQA 3JTHA 1BC7C 4NB5A 4G7OF 4G94A 5TJJA 4EQQA 2K86A 5LHHA 3C18A 3GLXA 1S29A 4ZYGA 1IXRC 1T39A 1MGTA 2MLKA 3CUQC 2FBHA 1HSJA 1OYWA 1MD0A 3SQNA 3P9IA 1WQ2A 3BY6A 1KU3A 2HTSA 4IF4A 1FNNA 3T8TA 3MFKA 3FXRA 3LA3A 4IRIA 3WTXC 1BJAA 4DNCA 3WTSC 5CLSA 1J2XA 1D8JA 1IZ1A 4BHPA 5JR3A 5FO5A 2ZXJA 5HS7A 2IW5A 1J0RA 4RAZA 3HRMA 1SD6A 1HW5A 2ISYA 2ZKZA 5HDNA 4XRFA 3U1DA 1HBXG 4KIBA 4G9YA 5J8CA 3E6BA 2COMA 4RGXA 1KQ9A 1IN5A 1WI9A 3OV8A 2WTEA 4WF2A 3WG9A 1HKTA 1BC8C 3AAFA 1XDSA 1SFXA 1ZLJA 1LVAA 4P5OA 4KA4A 3FF5A 2Q8KA 4RGSA 3RKWA 3PQKA 2W84A 1PP7U 2BBYA 1J5YA 4R1HA 1XDUA 2UXNA 4AWXB 1IXCA 3DF8A 2KIUA 3IHUA 1IXSB 5ILSA 3ECOA 3E5QA 4IHTA 4UVAA 3GX4X 1ZG5A 2IVMA 4GXOA 1R23A 1O7FA 2NNNA 3TGNA 1GHCA 5AIQA 4B09A 2O3FA 4OU0A 5TRDA 3QP6A 2FSWA 3GEZA 3KLNA 1IN6A 3KEQA 4YIFA 4Q48A 2JT1A 4U7DA 1UHMA 4I02A 3MQ0A 3NRVA 1H9GA 1PDNC 2A3SA 3H3UA 1KQ0A 1ZLKA 1XN7A 4XLNF 2QENA 2FNPA 5HLIA 1G3SA 1RI7A 3K0LA 2ISZA 3WTZA 3F8NA 3C3WA 4P55A 4LG0B 1SFEA 3QOPA 2GXBA 2E1CA 4BHCA 3V7RA 4UV9A 5CVRA 2VE9A 2MC3A 2D1VA 1HQCA 3T5XA 1FP2A 3LAJA 4GGGA 1SMYF 1ZAOA 1XSVA 4LG0A 5KVRA 4MQVA 3WGGA 2EFWA 1ZH5A 5BPDA 3R0AA 2RQPA 2XIGA 2K02A 1S6LA 3E97A 2P4WA 2CW0F 1E17A 3FM3A 4A0XA 5AONA 2ZJ2A 1BOAA 4U7BA 2H94A 1ZN2A 1Z6TA 5E8IA 2G7UA 4HW0A 1GVJA 2NRAC 4L9TA 2VT2A 2Y0MA 4ZYDA 3F8BA 1ZG1A 3CLOA 3Q9SA 4ZZLA 4PGHA 2Q2EA 2QQAA 3M8FA 4MGRA 2RDPA 3OOPA 3P9KA 5LGUA 4M6YA 1YO5C 2V9VA 3VOEA 3E5UA 4ESBA 2LF7A 5CVIA 1R1TA 4G6QA 1Z6RA 5HS8A 2VXZA 1BIBA 1S3JA 1D8KA 4KMFA 1DDNA 4WCGA 4FT8A 4EJVA 2KJBA 2QVOA 5F64A 2EFQA 1KU2A 1FWZA 4HQMA 3I59B 3HIFA 1OKRA 1MKMA 4Z2YA 1IN8A 1YLFA 2FF4A 3U2RA 2WWYA 2OZUA 1Z91A 2MLGA 2IT0A 4ESJA 4L9VA 5D8KB 2IP2A 4LLLA 5IT3A 4IXAA 2OAZA 2IA0A 1W4MA 4EJWA 4HF2A 3B73A 2LDUA 5HVQC 4R79A 1F1ZA 2P5VA 1YW7A 3BPXA 4EJUA 3KP6A 1KYWA 4UV8A 4UVCA 4OIOF 3BP8A 2E7XA 3TQNA 2O03A 4IRHA 4CDGA 3ML6A 5CJ9A 4A2UA 3CDHA 2RC4A 2K7LA 1ZGAA 1U78A 3KP7A 1WKMA 2VE8A 4HV5A 5K5OA 2QLZA 3GZ6A 1STZA 4KN4X 3DP7A 2ACJA 1I27A 1J75A 1V4RA 1TLHB 3E5XA 1RNLA 4HOBA 4CXFA 4HYEA 2L02A 3FMSA 6PAXA 3WODF 3W6KB 5LBQA 3HSFA 4LFUA 1JXSA 1R22A 3SFZA 2M5WA 2YU3A 1P92A 5E18F 2DPDA 1XGMA 3R4KA 3LA7A 2Y48A 1G3TA 4KIGA 4LJZF 1EH8A 4KIFA 5LGNA 5IT9K 3V8LA 3C7JA 1HKSA 2HTJA 3TOBA 5HLHA 1RIOH 3ZMDA 2PMUA 2O61A 1C0WA 2P5KA 3ZQ7A 5E1WA 2VN2A 3WGIA 1O3SA 3ABUA 5L3EA 2NS0A 2A61A 4L0YB 3U9GA 3GYHX 1YS6A 4BQAA 5CVUA 3BJ6A 3O2PE 3QAHA 1IW7F 2VBZA 1FYLA 2RN7A 4MHGA 2JPCA 4JK1X 4EM1A 5DD4A 1XMAA 2R7DA 5KK1A 4ENMA 3EDPA 4YFNF 5ICFA 2GIVA 3GFIA 2DBBA 3ZN1A 3ULQB 3T0YA 2VBXA 2VC0A 2W25A 4HF1A 2W57A 5H6QA 4G7HF 5ICEA 3QP5A 4EJOA 4RB1A 2XASA 3G73A 3H92A 4L18B 2XAFA 2TDXA 2GQQA 3V4GA 2DK5A 3HHHA 4I0BA 2IJLA 3BZ6A 5D6EA 1W7PA 4HAMA 4P9UA 5BS6A 5D5WB 3TDZC 4PCQA 4LD5A 3ZN0A 1G3WA 3ZMUA 1S7AA 2V79A 5H6RA 1FOKA 4HQEA 4EJTA 5FLXK 5DYMA 2MD5A 3TO9A 1JGSA 3WU1B 1ZGJA 3HOSA 1E2XA 5FD5A 1R1UA 2F5FA 3FZVA 1K78A 1BIAA 3CTAA 5HOOA 4OINF 4O3MA 2NYXA 2ZO4A 5E1XA 2BEOA 4EGYA 2FQ3A 3ZMVA 2PFBA 3I64A 1FYKA 3N4MA 3G3ZA 4DQ2A 3RDIA 1SMTA 1KU7A 3KEOA 1B4AA 3NQOA 4MTDA 3HRSA 5F6FA 3NEUA 1HKQA 2G7HA 1H0MA 1O3RA 1TNTA 3F8MA 4RB3C 4MEXF 3WTYC 2WC2A 4M73A 4OIQF 2FU4A 4N9HA 3I71A 2K4JA 3TO6A 4ENKA 2UXXA 4I01A 3BOQA 1TW2A 4ESFA 4YFKF 3HSRA 2V1DA 4CZZA 5CVJA 2DTRA 4A0YA 4AIKA 3LQRA 1XD7A 5LEKA 3O6BB 2CFXA 1FBUA 5ILUA 3MAJA 1IRGA 3I58A 1WWXA 1F4KA 3M1EA 5ERIA 2M8EA 3SXYA 4XBFA 1EV7A 3F72A 4CGZA 4A6DA 1YTYA 5JVTA 3L9FA 4U0VA 3VODA 4GYGA 2HKOA 4I98B 2DLLA 4OOIA 2GWRA 4AIHA 4D0PA 3WU0A 4S05A 3ECHA 3K69A 3DV8A 1T2KA 2X4HA 2LNBA 1XGOA 3REOA 1U2WA 2F5EA 2YX4A 3D5LA 3FWEA 2L54A 1IAWA 1O7LA 2YX7A 2YR2A 3L7WA 5E20A 1Z7UA 3DPLC 4MTEA 4Y17A 1YFHA 2ETHA 3J81Z 4I7HA 1TTYA 4KNYA 3BJAA 4UNOA 4KUMA 5ILVA 1B1BA 2XROA 4LMYA 4GCVA 3DXJF 1DPRA 3GWZA 1XB4A 5DEQA 2LKPA 5D4SA 4AIJA 3ZMZA 4A12A 1MZBA 3WTWC 3B02A 2RKHA 3I53A 4S04A 4IVNA 2B0LA 1XSXA 2IA2A 2P5LC 4LB6B 3BROA 1TW3A 5BPIA 5DUIA 5K5QA 3BJOA 3COAC 4KT5C 1QNTA 2A07F 2W85A 1ZYRF 4EM0B 5D4RA 1HW2A 1LEAA 4A0ZA 4FHTA 3MCZA 1UHWA 3Q9VA 3K9TA 1SD7A 3JAMZ 4ZH4F 2XKPA 2PJPA 4O5VA 1MDMA 2Z33A 2CO5A 2ZNYA 1FSHA 3ZMSA 5HDKA 4G6DA 1P4WA 4HZFA 3SZPA 5D6FA 2Z9OA 1T38A 2IPQX 4L5JA 1V3FA 4QWQA 5LHGA 2VBYA 3R6SA 1R5GA 2H27A 5FFZA 1SD4A 2GZWA 4RB0A 5DUKA 3SHFA 2HZTA 4P9FA 2K4BA 3TDUC 4Q5SF 4I0AA 5JHUA 4FX4A 3VFZA 1YS7A 2MA3A 1MJBA 3KP2A 3FM5A 4HA8A 1I1SA 1IUYA 5L3FA 3IWFA 1HSTA 1FLIA 2M45A 4I09A 1BN5A 3BPVA 3ZPLA 3F3XA 4HLYA 3I0TA 1RUNA 2BGCA 4Y15A 3J80Z 4OMYA 2P8TA 3RIRA 1I1GA 2GA1A 2ZMEA 5L3GA 4RGUA 3KZZA 1XGNA 1CGPA 3GXOA 5K5RA 4KDPA 1R00A 3MWMA 3V7CA 3LWFA 2WV0A 4R8HA 5A2QZ 2XHKA 3HTUA 3GFJA 2XGXA 2P6TA 1USSA 2RV8A 1XCBA 1F9NA 2YPRA 2CQKA 2P7CB 1K7AA 2FEZA 1U5TA 3FXQA 3Q5FA 5DV5A 1IF1A 1BM9A 1RUOA 2EV0A 4CHUA 2BE5F 1R36A 3ZMTA 1QBJA 4MQ9F 4M74A 5BOXA 3QRFF 2HKXA 3J81K 2KKOA 4GYIA 1B6AA 4WXDA 2MH9A 2DPUA 2E7WA 4L0ZB 3KE2A 1U3EM 3K1NA 2HDCA 2QUFA 1QQIA 1TBXA 4YIIA 1TQPA 4LK1F 1R58A 2C6YA 2FOKA 1YYVA 2OBPA 1O57A 2QM3A 4UUVA 5D5XB 2L01A 2XV4S 3D0SA 4H0EA 2ELHA 4O6JA 4A6EA 2XAQA 3L2CA 3F21A 4YFXF 4M9ZA 3GZ5A 1ZRCA 2CGPA 3E6DA 4Q47A 3IKTA 4L9NA 1LDDA 1D3YA 5EEHA 4GO1A 3DPTA 1FPQA 1S8NA 1A04A 1TNSA 1LJ9A 4PZJA 2DAOA 4E70A 2PG4A 1LDKB 3RTRA 3DKWA 3RYRA 2Z3YA 3JSOA 3LA2A 1K79A 2J5PA 2NAZA 3C1DA 3KLOA 1MJ9A 4ENNA 2KIFA 2EFNA 1FC3A 2M87A 1ZHFA 1ZG3A 3V8KA 4KFCA 1YW9A 4A5MA 4WXHA 2XAJA 2F2EA 5F1RA 3JSPA 2HQRA 3W6JB 5HDGA 2VC1A 3VB2A 5HS9A 3RI4A 4HV6A 2KIMA 5LLQA 2PN6A 1EH7A 5JFRA 1G6NA 1JHFA 5J6XA 5L3CA 2DW4A 2HGCA 3FXUA 3FX3A 4IHSA 3HSEA 2STTA 4HDUA 4ENJA 2PBIA 2OZ6A 2LSOA 2JZYA 3F22A 3IWZA 3KCCA 1J9IA 5DCMB 1W7PB 3RKXA 1YG2A 2LF8A 3E3VA 4KN7X 1Z05A 2ZNZA 3GFLA 3IL2A 2EA4A 5AIPA 2VT3A 3QU6A 1LB2A 2JTVA 2M30A 4NQWA 5K1YA 5DCMA 5LGTA 2ZFWA 1O3TA 4LLNA 2HS5A 3J7AO 2V1UA 1CF7B 4RB2C 2GAUA 1FP1D 2ESHA 3CUQA 1K78B 4G7ZF 5BQTA 2ESNA 4L5IA 5LHIA 1LEBA 2W24A 1W5SA 2HQNA 4BHBA 1P4AA 2K27A 2HR3A 3HHGA 3GW2A 1CF7A 2P7VB 3M8EA 3RYPA 2DQLA 2BYVE 1XCVA 2XKOA 3DFGA 4P96A 1S7OA 2EB7A 4AVPA 5CVVA 2VOOA 3HYIA 1UB9A 1EH6A 4L9JA 3ISPA 4N0BA 4OIR