4WX9A

Crystal structure of mycobacterium tuberculosis ogt in complex with dna
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
164
structure length
161
Chain Sequence
VHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTSRTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALLELEKSRAPADLTLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Mycobacterium tuberculosis O6-methylguanine-DNA methyltransferase protein clusters assembled on to damaged DNA.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords DNA (5'-D(*GP*CP*CP*AP*TP*GP*(E1X)P*CP*TP*AP*GP*TP*A)-3')
total genus 42
structure length 161
sequence length 164
chains with identical sequence B, C
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2014-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4wx9A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4wx9A01
2MBFA 5IT3A 2UXNA 1ULYA 1FC3A 4ENJA 1O7FA 1YIOA 4KN7X 4IRHA 3O3KA 2ESHA 3ZPLA 2QQ9A 1UB9A 2R7DA 2XROA 3KZYA 1YO5C 2V6CA 1O7LA 4PGGA 1E2XA 3IRRA 2YU3A 1SD4A 4BH9A 3H3UA 1R00A 3VODA 4HYEA 3TO6A 4ENMA 1Z91A 4I0BA 1HW1A 5A2QK 5LHIA 5F6FA 3LFKA 2GQQA 4LMYA 4R79A 4M6XA 1KU9A 1G3TA 3SFZA 4P55A 5D6EA 3BWGA 4RGRA 4M9XA 1FOKA 2FE3A 4AWXB 4S05A 4YFKF 4MNUA 4L9VA 4OIRF 1K6OA 4N9IA 3BJ6A 4UUVA 1ZG3A 1GXPA 3GX4X 2OQGA 5FLXZ 2QLZA 1U5TC 3ECOA 4Y17A 4R1HA 3V7CA 1FLIA 4BHPA 2A5YB 5LEKA 1MZBA 2Z3YA 3FM3A 1SFEA 2DO7A 5FD5A 5FLXK 3K1NA 3K2ZA 3KLOA 2F2EA 5HLGA 1J75A 4UVBA 1TW3A 2HKXA 4U0YA 1Q1HA 1O3RA 1Y0UA 4KT5C 4I7HA 2QQAA 1B4AA 2A69F 2KJCA 5JVTA 4LB5A 5FGMA 1XSVA 5AIQA 1IF1A 2XIGA 3TO9A 1YS7A 3I64A 1U5TB 4Q5SF 2JT1A 3RKYA 2MH9A 1J59A 3C7JA 4KUMA 2FQ3A 2FA5A 3MEXA 1WRJA 1F5TA 2HWVA 3E5XA 4LFUA 3DXJF 4Q48A 1WSUA 3QPTA 1XCVA 4YFNF 4IVNA 1T6SA 5D5WB 3PQKA 4AVPA 1QBJA 3KP4A 4CHUA 4L18B 3T8TA 2MA3A 3IWFA 3GFMA 4UV8A 3CUQC 1NHAA 3TOAA 2XAJA 4G7HF 3WE3A 3DP7A 1BIBA 1ZYRF 2ESNA 2O0YA 2ZNYA 1OKRA 3Q5FA 3I54A 3P7NA 2XV4S 2HTJA 2DU9A 3KP6A 1ZRFA 3WU1B 2DQLA 3KEQA 5HDGA 1XSXA 2H6BA 2CO5A 5AONA 1STZA 1JE8A 4CDGA 1YYVA 2JRTA 2CW0F 1TQIA 5JHUA 1F1ZA 3E3VA 5IT9K 3MQ0A 4I09A 2D2WA 5J8CA 2V1DA 1OPCA 4HF0A 3HTSB 3GO5A 1H9TA 3CJNA 5E1WA 2F5EA 4FX0A 3WTWC 2RQPA 4XSZF 1V4RA 5AIPA 2QM3A 1MJAA 1MKMA 4K2EA 2LF8A 2FNPA 5ICGA 2CGPA 1IW7F 3DPTA 4XRFA 5ICEA 1Z6TA 2Y0MA 3C18A 1UHWA 3HRMA 1FBUA 3T8RA 1JXSA 2AXLA 2HZTA 3CUOA 1ZARA 2FMLA 2L02A 5ILVA 2ZJ2A 2UZKA 1G3YA 3H3ZA 3TDUC 1S29A 2BYVE 2RV8A 1T39A 1TNSA 3IC7A 3E6CC 2LDUA 2PBIA 3WTZA 4LK0F 4PDKA 3TOBA 3HHGA 2FF4A 4U7BA 2X0LA 2VN2A 1ON1A 2IP2A 1S7AA 3J80Z 2VONA 1X3UA 5A2QZ 4NQWA 4EVIA 4ZYHA 4B09A 1FPQA 1YTYA 1MGTA 2V79A 1EH7A 3T0YA 1QGPA 3DV8A 2CG4A 1KQ0A 2YPRA 2O03A 3M7GA 3KFWX 1IZ1A 3J7AO 4A6DA 2PMUA 4EJUA 2P8TA 2Q0OA 4L5IA 2QENA 3JW4A 1WQ2A 1MDMB 3ML6A 1SAXA 3V7SA 2JPBA 3TO7A 4U7DA 5ICFA 5K5RA 3F21A 3N4MA 2Y75A 4I0AA 1G3SA 3QPHA 1PUEE 1CF7A 4OU0A 2RGVA 4A0ZA 2ZFWA 1K79A 1XGSA 1J7KA 4JBAA 4RAYA 4EM2A 2GIVA 1G6NA 2VODA 3WTVC 4U88A 2IJLA 1FY7A 3GXOA 6PAXA 3FXRA 2RC4A 3LQQA 3EYYA 3E6MA 5DV5A 3H92A 1Z7UA 4EM1A 5HOOA 3VFZA 2HQNA 1FT9A 4M73A 1Z6RA 2J5OA 1R5GA 5BPIA 1SD5A 2QZ8A 3KP3A 1R1VA 4HX8A 4HDUA 1R1UA 3OV8A 1K78B 5BPDA 1GXQA 4GGGA 4LB6B 1LB2A 5E8GA 1LDJA 1R23A 3R0JA 2EFQA 2FU4A 3JAMZ 2J5PA 3E5UA 3ZMSA 3HOTA 3FWEA 1B59A 4WCGA 3F8MA 3B02A 2ZO4A 1TQMA 2ZBKA 2CYYA 3ZN1A 4XLNF 1DDNA 5E8IA 2NAZA 2GA1A 4HQEA 4I2OA 3MCZA 5DCFA 4HX4A 1XD7A 1D8KA 1F4KA 1BIAA 2DLLA 4A2UA 5E17F 3RYPA 4WWCA 2EFNA 4MEYF 2HYFA 4HLXA 2YX4A 4KN4X 1LEBA 1EV7A 5BOXA 5EEGA 5L3FA 4L5JA 2L3DA 1FNNA 1I1GA 3K9TA 2VOOA 1TNTA 2XRNA 2DI3A 2WWYA 1J2XA 1T98A 3R6SA 1F9NA 2HTSA 1D3YA 5HS8A 3GEZA 5H6RA 4MQVA 4R8HA 2R7FA 1REPC 4XBFA 2Q8KA 1FYLA 1IAWA 4UVCA 5HVQC 1HSTA 3WGHA 3HRSA 3I4PA 2E1NA 2WV0A 3KEOA 2NNYA 3LWFA 5DUKA 1R7JA 4EJWA 4WXCA 4AD9A 1G4DA 3I59B 1XMKA 3D0SA 1HW5A 4ZYDA 4OINF 2HEOA 5E1XA 4RGUA 1ZG1A 3LQRA 4O6JA 3R4KA 4NB5A 1RNLA 3REOA 2GXBA 4IJAA 3IWZA 4PGHA 2Z99A 1BJAA 2K02A 4M72A 2QYOA 5HDKA 5LGUA 3F72A 1R1TA 4G6DA 1SMTA 2B0LA 1EH6A 3HSRA 1SD6A 4RGSA 2DTRA 1Z9CA 3F8FA 3GVAA 2EK5A 1FX7A 2P7CB 1U8RA 1KA8A 5FO5A 4Y13A 5DUIA 1WI9A 4KNYA 5JFRA 1HBXG 5LRRA 4IHTA 4D0PA 2PFBA 2PQ8A 3KCCA 2MLGA 4IRIA 4L9NA 4BNCA 3SXYA 4G6QA 1PP8F 4E70A 1YFHA 5LLQA 3KE2A 4HA8A 1FYKA 3F6OA 3GLXA 4U0WA 1FP2A 2M87A 4AIKA 4IPAA 4HW0A 2OU2A 4F7ZA 2EV5A 3FMQA 3HSEA 4CO8A 4BHCA 3BPXA 4LK1F 2XVCA 1W4MA 2VC0A 4M6YA 1JHHA 3SZPA 3FZVA 3Q9SA 3U2RA 2VXZA 3WG9A 4EM0B 2HOEA 3NQOA 1L0OC 5BS6A 2K4BA 2CQKA 4CZZA 3K0LA 3RPQA 5LGTA 3K1PA 1KU2A 3L7WA 5D6FA 2JSCA 3WTUC 4HBLA 1XMAA 4GYGA 2IA0A 4I98B 4M74A 1IN8A 3KP2A 2BE5F 2EJRA 5E18F 4OMYA 3F8CA 2PMHA 1XGOA 3D5LA 3WGGA 2DQRA 3ECHA 2D1HA 3ZMDA 4LGWA 3ZMUA 2RKHA 3F6VA 4GXOA 1O3QA 5HDNA 3RKWA 4CICA 3WTSC 1ZREA 5L3EA 4N9HA 2DPDA 2LF7A 5D5UB 5D8KB 5FFZA 3LSTA 3NRVA 1LVAA 2XKPA 2Z9OA 5DEQA 2VOPA 3KZZA 1BI0A 3C3WA 1BI2A 1TTYA 5FFXA 1FYMA 3EDPA 4RS8A 3SQNA 3WE2A 2BBYA 2QBYB 5ICCA 2HYGD 4WXHA 2KJBA 1SFUA 3GUDA 3SZTA 2LKPA 5CVRA 3O6BB 2IA2A 3RJPA 2M30A 2H6CA 3ZQ7A 3ERED 4ESFA 2VE8A 2D45A 1KYWA 3NEUA 1KYZA 4JQFA 3I59A 2GAUA 2W57A 4KICA 2AS5F 1DPRA 1FZPB 1AOYA 4LG0A 4EQQA 3N97A 5TJJA 3ZMTA 1KQ8A 3I5UA 1USTA 2VBWA 4EMSA 1HKSA 3QU3A 1ZGJA 1YQAA 2VBZA 3ZN0A 1LJ9A 3C1DA 3G73A 4HF2A 3BOQA 2VE9A 2IPQX 3ROUA 2L4AA 4CXFA 3GZ5A 2HKOA 3I0TA 1USSA 1I6XA 1KQ9A 3MAJA 3M8EA 1RUOA 4A6EA 3IKVA 2XAFA 2A68F 1T2KA 3V8JA 4CYDA 4ASNA 1BC8C 1TBXA 2FOKA 3J80K 2ACJA 3HYIA 3TDZC 5HLHA 2ADUA 1MDMA 3TGNA 1HW2A 2NNNA 2XUBA 3JTGA 2EFPA 4FX4A 4M71A 1R5HA 1TQPA 2FBKA 2L4MA 2JZYA 3I53A 1CGPA 3P9IA 3B73A 4EJVA 2O61A 4A5NA 3V7RA 2MC3A 1QZYA 2COMA 5E20A 4ZZDA 2W24A 2CSOA 2NRAC 1W7PD 2KIUA 4G94A 2PLYA 3HUGA 2Z33A 5D4SA 3FMRA 3FMSA 4KDPA 4G7ZF 2TDXA 4LLGF 3ULQB 5L3DA 1B9MA 5HS9A 1E17A 3EUHA 3W6JB 2HGCA 4Y15A 1OYYA 2RDPA 2K27A 2KIMA 3S2WA 1O3SA 1U2WA 1YG2A 3L09A 1ZRDA 2UWMA 3QP6A 2QWWA 3CTAA 3HSFA 3U9GA 1U3EM 5D5VB 5J6XA 5K5OA 2P5LC 3Q9VA 4L0ZB 1QNTA 4ON0A 5KK1A 4ENKA 5H20A 4BXUA 4LLNA 3BDDA 1B1BA 2OA4A 2EFWA 1D5VA 5EEHA 5LHHA 3GFIA 2OZUA 4LLLA 3U1DA 1A04A 3M9AA 4OIPF 2FXAA 2ZMEB 3LAPA 4HF1A 4XSXF 2PEXA 1SFXA 1BM9A 1WWXA 2RVCA 3DF8A 3ABTA 2H09A 5JR3A 3GFLA 2WTEA 3HTUA 2V1UA 1LEAA 4KIBA 4BHBA 3RI4A 1V3FA 3L00A 4HZFA 3FF5A 2K4JA 1OMIA 4EGZA 5D5XB 3K69A 2CWEA 4HQMA 3SHFA 1YLFA 2DFIA 4A0XA 2G9WA 1IXSB 4IHSA 2ISZA 2VC1A 4UV9A 4JK1X 2KKOA 2W84A 2ZMEA 3COAC 4UHTA 1C0WA 4AIJA 5L3GA 4CGZA 3ABUA 4P5OA 5HS7A 2ELHA 4I01A 5DD4A 3O2PE 2XGXA 1MD0A 3AAFA 3WGIA 2Z5UA 5DD8A 3T5XA 3WU0A 4KMFA 2O6GE 3E97A 1HKTA 2PI0A 3F22A 1HXDA 2STWA 5E1ZB 2FRHA 2Y48A 1VTNC 2Q2EA 4A12A 2FNAA 2ZNZA 2STTA 3I58A 2YSRA 2FBIA 2M45A 3FXQA 4GO1A 2GA2A 4H0EA 3IKTA 4U0VA 1XDSA 1U5TA 5CVVA 1UFMA 4MGRA 2FMYA 1ZAOA 3IRQA 4XLPF 2E1CA 2EWNA 4NHJA 3BROA 1P6RA 1QPMA 1ZHFA 1L3LA 1XDUA 4RB1A 5FD6A 2XAQA 2L01A 4MHGA 1O3TA 2QUFA 4ZYEA 1T0FA 5CVUA 1SMYF 2IW5A 5TRDA 4HAMA 2HQRA 2HR3A 1XGMA 1OYIA 2EV0A 4GCVA 1YS6A 2MH2A 2P5KA 3CO6C 1BI3A 1ONVA 2YR2A 1J9IA 3FM5A 4G9YA 1I1SA 1ODDA 3BJAA 3DEUA 2IT0A 4A5MA 4TV7A 4I02A 1YW8A 2A6HF 2DAOA 4AIHA 3HOSA 5CYVA 4RGXA 3L2CA 1SD7A 4GYIA 1DP7P 2GWRA 4KFCA 3FX3A 1GHCA 4ESBA 3FXUA 1LNWA 3DQVC 4YIFA 3JTHA 4OIOF 5L3BA 3F8NA 5ILSA 3ISPA 3VB2A 2JPCA 3TKYA 3ZMVA 4LD5A 5LHGA 2ZKZA 5H6QA 1RUNA 2DBBA 4RB2C 1W7PA 3MWMA 5JI6A 2P6SA 4G8XA 1S7OA 1ZGAA 2DW4A 3R61A 2XKOA 3QP5A 2IVMA 5ERIA 2KIFA 2LNBA 4N0BA 5HLIA 5DDGA 2RNJA 2R3SA 2M8EA 2HFHA 4MTDA 1UHMA 1T38A 4ESJA 5CLSA 3J81Z 3BP8A 1XGNA 2DT5A 1FBQA 1BN5A 3GW2A 2ZCWA 3HIFA 4YFXF 3LA7A 2VT3A 1XB4A 1OR7A 2P7VB 4IXAA 3WTXC 1J5YA 2RN7A 5D4RA 5DCMB 2QVOA 4L0YB 4WF2A 5LEJA 1PP7U 2K86A 3GZ6A 1S3JA 2D1VA 1KU7A 4WK8F 1B6AA 4L9JA 4LJZF 2A6EF 2ZXJA 3RYRA 3HRTA 1IN5A 1AWCA 4HV6A 1MJBA 2IA1A 5F1RA 5KVRA 3L9FA 4UNOA 3MFKA 2L54A 2O3FA 2V9VA 2QBYA 1GVJA 3K1MA 2C6YA 1FSHA 5BMZA 1MJ9A 2BV6A 3KETA 2XAGA 2OD5A 3BY6A 5K1YA 1U78A 2BEOA 2DK5A 1P2FA 4KYWA 2ETHA 2OBPA 4OOIA 2M1BA 4L9TA 4EGYA 1W7PB 3EETA 5DCMA 2EV6A 2FBHA 2G7UA 4BYYA 3T1BA 1S6LA 1YW7A 4S04A 3LAJA 4Q47A 2QQBA 1HKQA 2VBXA 4MTEA 4HDVA 1IN6A 3GWZA 3EQLF 1DPUA 4ZH4F 4ENNA 3P9KA 2H94A 4LG0B 2EA4A 2CFXA 3HRUA 3PQJA 4PCQA 1P4XA 2VT2A 5ED4A 1XCBA 1JGSA 4MEXF 4KIGA 4KIFA 2DK8A 1G3WA 1R22A 4DQ2A 2FEZA 3MZYA 2XAHA 2E7XA 3BZ6A 1FP1D 3CO7C 4YG2F 1BOAA 3WODF 3QU6A 1RI7A 3F3XA 2YX7A 1K7AA 4HV5A 1TW2A 1R58A 1FWZA 1YW9A 3KP5A 1D8JA 4B8XA 3DFGA 3E6DA 5DYMA 1BI1A 1LDDA 2W85A 2HS5A 2E7WA 2KRFA 4EV0A 2H27A 4A0YA 1IN4A 4PZJA 2VBYA 4HOBA 1K78A 4IRGA 1ON2A 4P9UA 1KGSA 3TQNA 4HLYA 1Z1DA 2V1XA 3R60A 3G3ZA 1ZLJA 5LRSA 3DPLC 2MD5A 1TLHB 3ELKA 3V4GA 4O3MA 2ISYA 1XSDA 4G7OF 4OMZA 1IRFA 1P4AA 1RZ4A 2NYXA 3IL2A 3GF2A 4QLCU 1RIOH 1ZG5A 1BC7C 3R0AA 1S8NA 3QOPA 2OZ6A 1OYWA 3E6BA 1I27A 1P4WA 4FHTA 5LGNA 3WTYC 2LSOA 3CUQB 1BBYA 1IUYA 4QWQA 4MQ9F 3LA3A 4BAYA 3WTTC 4ZYGA 3E5QA 5L3CA 1H9GA 4RB0A 1Z05A 3GFJA 4Z2YA 2X4HA 1O57A 1R36A 4BQAA 3P9CA 2F5CA 1ZH5A 5CVIA 2EFOA 3MZHA 1WKMA 1U6GA 3W6KB 3KP7A 5FB2A 1I5ZA 3LA2A 3F8BA 1IRGA 1ZRCA 3M1EA 1ZN2A 3IHUA 2UXXA 3RKXA 3FHZA 2GZWA 5CVJA 4UVAA 3CUQA 2K7LA 3M8FA 4WXDA 1FBSA 3V8LA 4UXNA 1LDKB 3ZMZA 2OAZA 4ETSA 1FSEA 3CDHA 3RIRA 2IRFG 5BQTA 4WX9A 3J81K 4P9FA 5CJ9A 2PG4A 1KU3A 4KA4A 1XN7A 2WC2A 3EYIA 1HQCA 4KMUX 2M5WA 3VOEA 1UCRA 1ZLKA 2MLKA 3QAHA 2HDCA 4RB3C 1P92A 2G7HA 4HX7A 2GXGA 4IF4A 1DUXC 4FT8A 1HSJA 1JHFA 5LBQA 3RTRA 3RPUA 1PDNC 2A61A 3QRFF 4P96A 3RDIA 1EH8A 3F23A 2PJPA 1LQ1A 2O8XA 3ZP5A 1J0RA 3JAMK 2OQRA 4O5VA 1W5SA 4EJTA 2JTVA 3KLNA 3BJOA 4ZZLA 2A07F 5D8LB 2EA2A 2NS0A 3HHHA 4YIIA 3BPVA 3JSOA 3VEPA 1IXRC 2XHKA 1W5TA 3I71A 3CLOA 3V8KA 2EB7A 2BGCA 1IXCA 5IT9Z 4Q4ZF 2F5DA 2P4WA 1QZZA 1IN7A 2PN6A 4DNCA 5K5QA 4RAZA 2DPUA 4M9SA 2P6TA 5J8FA 3GYHX 4OIQF 2W25A 2FSWA 3OOPA 2P5VA 1H0MA 1QO0D 1B9NA 2XASA 3JSPA 5F64A 1QQIA 2A3SA 2F5FA 3DKWA 5ILUA 3PFIA 1CF7B 4EJOA 4M9ZA
chains in the Genus database with same CATH superfamily
3OS0A 2DDAA 2MBFA 2MC6A 5IT3A 3BF2A 2UXNA 1ULYA 2CU7A 1FC3A 4ENJA 2QCOA 3ZR8X 1O7FA 5C3EJ 2Y0SA 1YIOA 4KN7X 4IRHA 3O3KA 1ACIA 2BB8A 2ESHA 1O4XA 4RAGA 3ZPLA 2NABA 4F2JC 1YUIA 3QQAA 2IGKA 1GV5A 2QQ9A 3JRBA 2ZJQF 1YX3A 1UB9A 2R7DA 1GQEA 2MKDA 2XROA 3VSLA 1V5EA 3KZYA 4JYKA 1YO5C 4GKKE 1KZHA 2CUEA 3V42A 2V6CA 1O7LA 1T56A 2HQ5A 4PGGA 3MHSC 4LU9A 1E2XA 4HEIA 3ZCOA 4JI8E 3FIWA 5TSEA 2EMFA 3IWCA 3IRRA 2YU3A 1SD4A 4BH9A 3H3UA 2Y0SN 1FJGE 3G1OA 1R00A 2WY8Q 3VODA 4Q35B 4HYEA 3HPSA 3TO6A 1ETKA 4IQJA 4W1UA 4QTRA 4X64E 1N32E 5J47A 4ENMA 1Z91A 3AUZA 2DB2A 3ZOQB 4I0BA 1HW1A 2CV2A 2IS1A 3GTMJ 4BXXJ 2EE8A 5A2QK 3CCUI 1LLMC 1KONA 4DYCA 1T8IA 5LHIA 2EMAA 5F6FA 3RPUD 3SEQA 3LFKA 2GQQA 4LMYA 4R79A 4M6XA 1KU9A 1G3TA 3PNVA 5BR8E 4IL6C 4JI3E 3CJTB 2V89A 4BY7J 2WADA 2LYCA 3K10A 3SFZA 5GAGJ 4P55A 5D6EA 4B3XA 4XN0A 1X1CA 3BWGA 1NK3P 1ETQA 2L0KA 4RGRA 1VI0A 4M9XA 4BC9A 2X85A 3CCRI 1FOKA 4B43A 2FE3A 1NK2P 3JRDA 4AWXB 2R7SA 5AC4A 4S05A 4YFKF 2E2HJ 4MNUA 2V83A 4L9VA 4OIRF 1K6OA 3D5RC 1X49A 1D1CA 4N9IA 4NHRA 2R1FA 3BJ6A 4UUVA 1ZG3A 3K7AJ 1MNMC 2DA4A 1GXPA 1YJNI 4C2MJ 3GZNB 4XMYA 3GX4X 1X6FA 2KISA 3P1XA 2OQGA 3OYKA 5FLXZ 1TWGJ 2QLZA 4A93J 2CPNA 1U5TC 3ECOA 5E3LA 1A31A 4Y17A 2R4GA 4R1HA 3V7CA 4RHBB 3S15J 2ECBA 1FLIA 4RLQA 1JJ8C 2MKNA 3MHHC 1Z7LA 4BHPA 2A5YB 5LEKA 1MZBA 2EMGA 2Z3YA 4B47A 2MC5A 3FM3A 4HG2A 1SFEA 3L2UA 2DO7A 4DR6E 5FD5A 2EPMX 5FLXK 2E60A 3K1NA 3D5SC 3K2ZA 3KLOA 3CJQB 2R7XA 3HOXJ 2F2EA 3BR2A 4ZC3A 5HLGA 1J75A 4E7KA 4UVBA 1TW3A 2EOIA 3HL2A 1XNRE 3UNGC 2HKXA 2RS7A 4U0YA 2VB6A 1HC8A 1Q1HA 4NUBA 1MSEC 1O3RA 3JREA 1X4PA 2W7NA 1Y0UA 4KT5C 2NVQJ 2N3HA 2EOXA 4BQNA 2R93J 4I7HA 5FLXC 2QQAA 3AG4H 1B4AA 1OCZH 2A69F 3DPUA 4CCLA 1SAUA 3CF2A 2KJCA 5JVTA 4A3BJ 2BY0A 4LB5A 5FGMA 1WXRA 3OL3A 3ESWB 1XSVA 5A6BD 4OX9E 3RMPA 3F6GA 3OYHA 3KYDB 4XLHA 3SJMA 5AIQA 2QA4I 1IF1A 4GFBA 3HZJA 2XIGA 3TO9A 1YS7A 3I64A 1FKAE 2KRHA 2LO3A 1BBOA 2K9QA 1U5TB 4LF7E 4Q5SF 2EPFA 2EORA 2JT1A 3RKYA 2MH9A 4TUIA 4BDZA 3H35A 1J59A 3C7JA 4KUMA 1A1KA 4U87A 5B5EC 2FQ3A 2BY3A 1T33A 2FA5A 3MEXA 1WRJA 1F5TA 2HWVA 5FKLA 3E5XA 4LFUA 1N33E 3DBLB 4AM3A 3DXJF 3KPHA 3BTIA 4Q48A 3WHCA 1WSUA 2EN7A 3MKWB 1IBLE 3QPTA 1XCVA 2O5RA 3OL4A 4YFNF 4XONA 2PJRB 1EKZA 1XMQE 4B44A 4IVNA 2XB5A 1T6SA 5D5WB 3U1KA 3PQKA 2R7WA 2Y69H 3CQZJ 4AVPA 3L2RA 1QBJA 3KP4A 4CHUA 4L18B 3K4NA 3T8TA 1RKTA 2EPKX 2DYSH 4C3IJ 4RBOA 5GTIC 2MA3A 1B8IA 3IWFA 3GFMA 3ONQA 2NVXJ 4J01A 4UV8A 3CUQC 1NHAA 3TOAA 2XAJA 2IS6A 3BZKA 4I6ZA 4PFOA 4G7HF 1MBJA 2ELKA 3ZOBA 3LSIA 3WE3A 3DP7A 1BIBA 1ZYRF 2BW3B 3PIPF 1ITYA 4IKFA 2RREA 3A01B 2ESNA 1JKOC 2O0YA 4BKXA 4BJ6C 2Y9ZA 2ZNYA 3O8HA 1OKRA 3Q5FA 4QPOA 3I54A 1FMVA 3P7NA 2XV4S 4FQGA 2HTJA 4AIDA 2DU9A 5FLMJ 1MMDA 3KP6A 1FJLA 1TWFJ 4CYCA 1ZRFA 3PL8A 3WU1B 2JVAA 3AL0C 4F9AB 2DQLA 4Z6YA 4YELA 3JRFA 3G71I 3KEQA 1ETOA 5KL6A 5HDGA 2EMCA 1XSXA 4CZCA 2H6BA 2L7KA 2Q2EB 4I76A 2YZTA 3PUBA 5CFFE 1FTTA 2CO5A 5AONA 1STZA 2H8RA 4BMJA 4DUYE 1TF6A 1JE8A 4CDGA 1A1JA 1XMOE 1YYVA 2F48A 3BTLA 2Z2SB 1H89C 2JRTA 3GTJJ 3EUKL 4WPYA 2CW0F 1TQIA 5JHUA 2EZLA 4C9YA 1OCCH 3S3MA 3J81C 1WI3A 2BVLA 3AFHA 1F1ZA 3E3VA 2EZIA 2EOZA 5IT9K 3MQ0A 3F0CA 3OYNA 5LMNE 2V88A 2DA1A 4PSWA 4I09A 4ZJZA 2EPUA 2D2WA 3JAMC 5J8CA 3E0JB 2V1DA 1OPCA 3K2AA 3MKYB 4L5EA 4YIRX 2EOJA 2NVUB 1JI8A 4HF0A 3F9KA 3HTSB 3GO5A 1VQOI 3TEDA 2VKDA 1H9TA 2KHXA 1LVKA 2DA3A 1HNXE 1PDAA 1WJAA 3DLLF 3CJNA 5E1WA 1IQSA 1MH4A 3MSWA 2ZM6E 2V87A 2F5EA 2D9HA 3HPHA 3JRHA 4FX0A 1I3QJ 4BS9A 2YRHA 4DV2E 3G1LA 3WTWC 2RQPA 4XSZF 5IP9J 2F4OB 3DEWA 3S2HJ 1V4RA 4A3FJ 3W2WA 5AIPA 2QM3A 1X1BA 5IV8B 4IHVA 2MGQA 3OS1A 2EL4A 1A1IA 1MJAA 1MKMA 2HDWA 2KDZA 1N77A 4K2EA 2GLOA 2LF8A 2FNPA 5ICGA 2CGPA 5M5XJ 2XRLA 1IW7F 1GV2A 2GOXB 2VASA 3DPTA 4XRFA 5ICEA 1Z6TA 4ZDPA 2FQ4A 5A6BA 2Y0MA 3C18A 1UHWA 2DXIA 3HRMA 1FBUA 1AAYA 2QGUA 4AVZA 3T8RA 4BC7A 1JXSA 2VQFE 1LFBA 2AXLA 2HZTA 2RQLA 4ZTJA 1Z1BA 3CUOA 1QRYA 4R2RA 1ZARA 2FMLA 2L02A 5ILVA 1DGWY 5IWAE 2ZJ2A 2UZKA 3EPKA 4BCAA 1B8IB 1G3YA 2R7VA 1WJ5A 1UELB 3H3ZA 4MO7A 3TDUC 1G8XA 1S29A 4E4HA 1X2NA 2BYVE 2HDDA 4BE0A 1QU3A 2QEXI 3J7YJ 2RV8A 3CP2A 1T39A 4DYRA 2VPRA 3CCVI 1TNSA 1XS9A 3IC7A 3E6CC 2JA7J 2VJIA 2VQEE 1K6YA 2LDUA 2MABA 2PBIA 3WTZA 3EQ1A 4LK0F 4FCYA 1JGGA 4PDKA 3SEZA 2E1OA 2P0WA 3TOBA 2DFFA 1E3OC 3LMLA 1MMAA 2E34A 2I9IA 4GKJE 3HHGA 3J7Yp 4DR2E 2FF4A 4U7BA 2NUFA 2X0LA 2VN2A 1ON1A 2HXIA 1S7AA 2IP2A 1BR1A 3J80Z 1DU6A 2VONA 3DBRB 1X3UA 1TP4A 5A69A 1SFKA 3BG5A 2KLOA 5A2QZ 1WHNA 4NQWA 1APLC 4EVIA 4ZYHA 1TC3C 2DYRH 3BR1A 3GTGJ 2RAEA 4ANJA 1UMQA 4B09A 1QA6A 1YUJA 1FPQA 1W36D 1R4NB 1MGTA 2V79A 1YTYA 1EH7A 3T0YA 4ITVA 1X1DA 4DR7E 1OLTA 2HVQA 1GDTA 1QGPA 4JOMA 2VJJA 3DV8A 5FKNA 2CG4A 2V4JC 1KQ0A 2YPRA 1DGCA 1VQ7I 2O03A 3M7GA 3OSGA 1T4LB 1SC7A 2Y2ZA 2ICWG 3KFWX 1IZ1A 1X3WB 2TRTA 2EIKH 4A6DA 3J7AO 2M4KA 3K70C 2GIZA 2PMUA 1A6QA 3OYAA 2ME6A 4EJUA 2P8TA 2Q0OA 3HUGB 4L5IA 2QENA 4D9JA 4M9VC 3Q0WA 3EUHC 3JW4A 2MYSA 1WQ2A 1PKPA 1JJ6C 2KL4A 1MDMB 3CCYA 3IWDA 5KL5A 3ML6A 1SAXA 3HOVJ 3V7SA 4BQOA 2JPBA 3TO7A 4U7DA 2B3TB 5ICFA 3H36A 5K5RA 3VDXA 1X1PA 4LF4E 3F21A 3N4MA 2M9AA 1I39A 2Y75A 3BC8A 4I0AA 2X6OA 1PJQA 2KOUA 1G3SA 3QPHA 2CMPA 1PUEE 1CF7A 2BBGA 2M0MA 4OU0A 2RGVA 4A0ZA 1N34E 4HPQA 2EMWA 4DBRA 2ZFWA 1K79A 1XGSA 1Y1WJ 1J7KA 1V55H 1OFCX 4JBAA 4RAYA 1UG0A 2X6WA 4MFDA 4EM2A 2L2NA 1TT5B 4R2DA 2K9SA 1BR4A 2GIVA 3M1CA 5DTDA 1LKXA 1G6NA 2VODA 4DR4E 4CCMA 3BG7A 4L8NA 4JI7E 1MMGA 3TBIA 2GLIA 3WTVC 4U88A 2DRPA 2IJLA 1FY7A 2E1MA 3GXOA 6PAXA 3FXRA 2RC4A 2JWOA 3LQQA 4E7IA 3EYYA 2EN3A 4YHHE 2A6TA 3E6MA 2ID6A 1YJWI 1FIPA 1MSFC 2LUQA 5DV5A 4CA0A 3H92A 5A6KA 2UUZA 2UXBE 2VKVA 3LMMA 3HKZA 4M3BA 1Z7UA 2PMZA 2DTZA 4EM1A 5HOOA 3VFZA 3CCLI 4B1RA 2HQNA 3LSPA 2KDOA 4BBRJ 2LP0A 1AKHA 1FT9A 1UAAA 2EMYA 2ZB9A 3AG2H 4E6KG 3L2WA 4M73A 1Z6RA 2J5OA 1R5GA 1IRXA 5BPIA 1SD5A 1FEXA 2QZ8A 1A35A 4C2UA 2EQ3A 1A36A 4MLVA 2DT6A 3KP3A 2JXPA 1R1VA 4HX8A 4HDUA 1R1UA 2YTEA 1R9TJ 3OV8A 3CMMA 4XNFA 1K78B 1A6IA 5BPDA 3PO2J 5F0FA 1GXQA 4GGGA 1VQ5I 4LB6B 1LB2A 5E8GA 4F54A 3C6KA 3BR6A 4V19K 1ETVA 1MBFA 2PMZN 1A1GA 1LDJA 3IAM2 3AKZA 1R23A 1S7EA 5GP9A 3R0JA 2DFEA 2EFQA 2X6XA 4KITB 1YRNA 3OYBA 3CP8A 2FU4A 3JAMZ 5A6AA 1P9QC 2K3PA 2J5PA 3EPZA 3E5UA 3S8PA 2LREA 2BY2A 3ZMSA 3HOTA 2N8GA 1B59A 3FWEA 4WCGA 1A1FA 4LFBE 3F8MA 5EDNA 3FXLA 3BCAA 3B02A 3J7AG 4O43A 2ZO4A 3K6GA 3GTKJ 1TQMA 2M0CA 3FHNA 2ZBKA 1HNWE 2F4VE 2CYYA 1HOMA 3ZN1A 1W0UA 4XLNF 2FOWA 1DDNA 5E8IA 2F4MB 2NAZA 2GA1A 2F5VA 1G2FC 2Z16A 4HQEA 4KZSA 4LF9E 5C4JJ 3MCZA 4I2OA 5DCFA 4HX4A 1XD7A 1D8KA 2LK2A 2JY9A 1F4KA 1BIAA 2DLLA 3HGYA 4JI5E 2EM2A 4NC7A 4F52A 3OTOE 4J8ZA 2O8KA 5AE2A 1WVRA 4A2UA 3H1CA 3I4NJ 1JT6A 3ZQLA 2ELZA 3OWTA 3CCSI 4HNTA 5E17F 4BUPA 2HOTA 1F36A 1GLNA 2YTQA 2K9LA 2VE7C 3RYPA 2LG4A 2V6EA 4WWCA 3OYFA 2EFNA 2EQ0A 2JUCA 4MEYF 2HYFA 3DTIA 4HLXA 2YX4A 4LITA 3OYGA 4KN4X 5CQEA 1LEBA 1EV7A 2JN6A 1M1EB 2QF7A 5EEGA 5BOXA 3BIDA 5L3FA 2DA5A 4L5JA 1VQLI 2L3DA 1FNNA 3K4MA 1I1GA 1PJSA 3K9TA 2VOOA 1TNTA 3S1MJ 2R7TA 2E1MB 4GDFA 3JRIA 1Z0XA 2XRNA 2DI3A 4BJTA 5HLTA 2WWYA 1IMUA 4TUGA 3DF6A 4WSGA 4M3FA 1J2XA 1T98A 3CC7I 3R6SA 4H4KC 1F9NA 2HTSA 1AA7A 2FTXB 4ZYAA 1BW5A 1D3YA 5HS8A 2EPRA 3GEZA 1G2HA 2V1NA 3OYCA 5H6RA 2UXCE 4MQVA 3VYRB 1T4OA 1R5ID 4R8HA 3LLHA 2IGMA 2R7FA 4FISA 1REPC 4OWRB 1V5FA 4XBFA 2Q8KA 1FYLA 4XKWA 4HSRA 1IAWA 4UVCA 2ODRC 1U8BA 1QZEA 5JLWA 1I50J 2KONA 5HVQC 4IHWA 4UB8C 1HSTA 3WGHA 5JHFA 2EINH 2LLKA 3HRSA 3I4PA 2E1NA 4RH8A 2WV0A 1B69A 3KEOA 2NNYA 3K4BA 3LWFA 2MW8A 3I56I 5DUKA 5LMUE 3HGGA 4P1WA 1R7JA 1T95A 4EJWA 1IBME 4M3EA 5F04A 4WXCA 4AD9A 1X58A 1OR7C 1G4DA 2EM6A 1D1AA 3I59B 1T0FC 1XMKA 3D0SA 2LBFA 3QYEA 2LV2A 2JSPA 5FLVA 2L33A 1HW5A 4ZYDA 1S9HA 2VLAA 4A3IJ 4AUXA 1K4TA 2B9SA 4DBQA 4OINF 2HEOA 1VFCA 3WG7H 5E1XA 3G4SI 3OYIA 4RGUA 2XDVA 1ZG1A 2I5UA 3HKZN 3LQRA 2E5ZA 4O6JA 3R4KA 4XK4A 1VQKI 4RDUA 4NB5A 1RNLA 3REOA 2GXBA 1B72A 4IJAA 1D5YA 3HM5A 4M30A 4LG3A 4DV0E 5FROA 4AC0A 3RQ4A 3RZDJ 4BBSJ 2M1SA 3QOEA 2W48A 3KZIC 3IWZA 4PGHA 2Z99A 3HJEA 1MBHA 1BJAA 5GAEJ 1O0WA 2HJJA 2K02A 5DS9A 4X65E 2ODRD 2E5LE 4PJJA 2YTNA 4M72A 2I10A 2NOJB 2QYOA 1Z3XA 5M5YJ 5HDKA 5LGUA 3F72A 1R49A 1R1TA 4G6DA 3OYLA 1SMTA 2M8GX 2B0LA 4MLOA 2MG4A 1QVUA 1VNDA 1EH6A 3PNTA 1UHSA 2WA0A 1DQUA 1MMSA 1BL0A 3HSRA 1SD6A 4RGSA 2V8QB 2DTRA 3U21A 3F8FA 4Y33A 1Z9CA 3GVAA 2EN6A 3SZGA 3HOUJ 4Y3OA 3H0DA 2J7JA 2EK5A 4II2A 1FX7A 1SFOJ 2P7CB 1U8RA 3RZOJ 1KA8A 5FO5A 4Y13A 3S1RJ 5DUIA 1WGXA 1WI9A 3KEYA 3N05A 4KNYA 5EEAA 4M0VA 5JFRA 3BGHA 4P7DA 1HBXG 2H8WA 5LRRA 3DKXA 4JX6A 2GXAA 2EOFA 1RMDA 5B1AH 1H8AC 2WBUA 2CW8A 4IHTA 2AQEA 2CUZA 2IS4A 4D0PA 2V9KA 5HNFA 2VPLA 2EQ1A 2PFBA 2PQ8A 3KCCA 3PM1A 2MLGA 4RMNA 2KMUA 4IRIA 4DV3E 2LMDA 3CCQI 4CCOA 5T6JA 4L9NA 4BNCA 4JI4E 2JMWA 3RCOA 3SXYA 1VQ6I 4G6QA 1PP8F 5F3WA 3SFIA 4E70A 3GTQJ 1A1HA 4QIWN 1YFHA 2KFDA 3MN2A 5LLQA 1B72B 2VJ4A 3KE2A 4HA8A 2KT0A 1FYKA 3F6OA 3GLXA 2JPAA 4U0WA 2JVGA 1FP2A 2M87A 2KP6A 3LSJA 4M3DA 2BZTA 4JX4A 4PJMA 1Y8RB 4IPAA 4AIKA 2EM0A 3SDBA 4HW0A 2EP3A 5B3SH 2OU2A 3K4KA 4XLFA 4KHPE 4F7ZA 5J3LA 3JRGA 2YRMA 1UZCA 2EV5A 2A05A 1BOBA 3X2QH 3K4CA 5K7HA 1D0YA 1L4SA 5K7FA 1HLVA 3C2BA 3FMQA 3HSEA 4CO8A 3VYYA 3GCMA 4BHCA 3I3LA 2HGHA 3BPXA 4LK1F 2AO9A 4UB6C 2XVCA 1W4MA 4CCNA 2VC0A 1MIJA 4M6YA 5EGOB 1JHHA 3SZPA 3FZVA 4BE2A 2EPCA 3Q9SA 1RESA 4FE4A 3U2RA 2VXZA 3WG9A 1ZGWA 1K83J 4EM0B 2HOEA 3NQOA 3IH3A 5AE1A 1L0OC 4XRMA 1BW6A 5BS6A 2K4BA 3MZ8A 2OV7A 1VZ0A 2CQKA 1MMNA 4CZZA 2XB0X 5CPRB 3K0LA 5DM6F 3RPQA 2KHMA 3K1PA 4ABZA 5LGTA 4HRIA 2YPNA 5A6JA 1KU2A 3W6VA 1ERDA 3FISA 3L7WA 3VYTB 4FASD 5D6FA 2F8BA 3FXMA 4NC8A 1ZR2A 4OAZA 2GHFA 2JSCA 5J40A 3WTUC 4HBLA 1WJPA 2ZXHA 1IV6A 1XMAA 2AQFA 2YTFA 2EZKA 2HOAA 4GYGA 2IA0A 1P7IA 4AYBN 4BGDA 3HBLA 3EPHA 4I98B 2JOXA 4BDYA 2YTOA 3BLYA 4M74A 1IV8A 1IN8A 2EM9A 2QKLB 3KP2A 2R7RA 3B6AA 2BE5F 3VHTB 2EJRA 3DBHB 5E18F 4OMYA 1X3CA 1JTYA 3F8CA 5EYRA 2PMHA 3C2HA 1VF9A 4DR1E 2B7TA 1XGOA 2LOOA 3D5LA 3WGGA 2IGNA 5E3OA 2B9DA 2DQRA 3ECHA 1UG2A 5B1BH 1OCOH 2D1HA 4E7LA 2M7AA 3ZMDA 4LGWA 3ZMUA 5F1JA 2ADRA 1F2IG 2XC7A 3VSKA 2CUFA 2RKHA 5KHDA 4BEHB 3PIOF 2UV1A 3F6VA 4GXOA 1UN6B 5HDNA 1O3QA 1JKRC 3RKWA 3BT9A 3E1SA 4CICA 3WTSC 4JI0E 1DU0A 1ZREA 5L3EA 3FDYA 4DKKA 4N9HA 2DPDA 2OTJI 4IHYA 4IS1C 1YI2I 2LF7A 4LF6E 3UR3C 5D5UB 2JR1A 5D8KB 2OPTA 5FFZA 3LSTA 1TWHJ 3NRVA 2VF1A 1LVAA 2XKPA 2JQ7A 3OIPA 2Z9OA 3J80C 4ZTFA 2EQRA 4O4KA 1J09A 5KNLA 3BZCA 3JCUC 2A5WA 5DEQA 1YHQI 2VOPA 1POGA 3KZZA 2L7ZA 4ZDOA 4BQQA 2YTIA 5IYCJ 1LE8B 3C3WA 1BI0A 4Q28A 1BI2A 4XN3A 1TTYA 5FFXA 4A3CJ 4FETA 1Y1VJ 4F93B 1FYMA 3DCFA 1QHHD 1BB8A 5FRMA 2FV4B 3CESA 3EDPA 4RS8A 1PYVA 3SQNA 3WE2A 2BBYA 2QBYB 2KRCA 5ICCA 2LY1A 2M3AA 1ZKGA 2DA6A 2HYGD 2AXTC 3OYEA 2EOEA 3A0BC 3C4BA 4WXHA 3FKJA 2E36A 4F6MA 5IP6A 2KJBA 2ZJRF 4IX7A 4XOTA 1SFUA 3GUDA 2BHYA 2COBA 1Y0NA 3SZTA 2LKPA 5CVRA 2QSHX 3CDLA 2LVHA 3O6BB 1LUJB 2IA2A 3RJPA 2M30A 2H6CA 3P5JA 3QYFA 3KWRA 2E35A 3ZQ7A 2VJ5A 3ERED 4ESFA 4LFCE 2VE8A 2D45A 1KYWA 3NEUA 1KYZA 4JQFA 2JOBA 3I59A 2GAUA 3JTZA 2W57A 1G2DC 1OISA 4KICA 2AS5F 1DPRA 1FZPB 3UK3C 1AOYA 4LG0A 4EQQA 1ZBTA 2NUEA 3N97A 5TJJA 3ZMTA 1SEUA 1YYKA 1KQ8A 3BQYA 3TP0A 3I5UA 1I94E 3IP4B 3TMOA 1IDZA 1E0EA 1USTA 2VBWA 4EMSA 1HKSA 4DMIA 1UHZA 3QU3A 1ZGJA 3CJRB 1YIJI 3TP3A 2DMIA 3GBGA 1YQAA 1OCTC 1SVOA 3LFUA 1BBGA 2VBZA 3ZN0A 1LJ9A 1WZ2A 5E3NA 3C1DA 4AQYE 3A1YA 5B66C 3G73A 1PUFB 4HTGA 4HF2A 2EL6A 3BOQA 2X1CA 2VE9A 2IPQX 2JP9A 3ROUA 3IWBA 2L4AA 4CXFA 4B3ME 3GZ5A 2HKOA 3JU0A 2UU9E 3I0TA 2YU5A 1USSA 1I6XA 2K40A 1SR9A 3ADGA 1KQ9A 4DUZE 1JK1A 2M34A 3MAJA 2H36X 3M8EA 1R6RA 4M3GA 3TW6A 1RUOA 2EIMH 2EM4A 2MC4A 2L2OA 4A6EA 3FBIB 3IKVA 2XAFA 4G12A 2I13A 2A68F 3CCMI 4C30A 1T2KA 3VPRA 2XF5A 3V8JA 4CYDA 2HNHA 4ASNA 1TZLA 4PSXA 2CQXA 1BC8C 4R2PA 3CLQA 1TBXA 2BVMA 2FOKA 2E71A 2LBFB 3HB9A 3J80K 2ACJA 1J5EE 3HYIA 1HF0A 1FOXA 3TDZC 2DOFA 5HLHA 3OSFA 2ADUA 1PUFA 5IPAA 3TGNA 1MDMA 2OTLI 1UILA 2LJHA 4LF8E 4JI6E 1HW2A 1A1LA 3ZGKA 1VQ8I 2RQQA 3SDGA 3WU2C 2KZVA 2OJED 4E7JA 2O9LA 1DP3A 2NNNA 1X3ZB 2LBSB 2ELYA 5IT9C 2XUBA 2LY2A 4R2SA 4Y7NJ 3JTGA 2EFPA 4FX4A 4M71A 3H9QA 1R71A 2KZGA 4BY1J 1R5HA 1TQPA 2XPWA 4HNVA 5KL7A 2FBKA 4DV1E 2L4MA 5IY5H 4E7ZA 1IUFA 2JZYA 3I53A 3KYLA 3P9IA 1CGPA 3B73A 4EJVA 2O61A 4A5NA 3V7RA 1J26A 2ZC2A 2MC3A 1ETYA 4D7NA 4DIQA 1QZYA 2COMA 5E20A 3WHBA 3ECRA 2L8TA 2CH0A 4ZZDA 1S5LC 5KL2A 2W24A 3NWTA 1VQNI 4C3HJ 2CSOA 1HDDC 2NRAC 5AASA 3PSIA 4BEHA 4D1QA 1W7PD 3H3VK 2WCC3 4F91B 2KIUA 2EPZA 4F9BB 2KQRA 3FXJA 3ZQHA 4G94A 5EGOA 2PLYA 3W2VA 3HUGA 2Z33A 5D4SA 3FMRA 3PNYA 2CV1A 3FMSA 1Y39A 4KDPA 3THNA 2L7FP 4G7ZF 2TDXA 4LLGF 3ULQB 5L3DA 2RSIA 3BG3A 2YWQA 1B9MA 2YU9J 1IDYA 1PVEA 5HS9A 3M99B 5LD2C 2E19A 4DZPA 1E17A 3EUHA 3W6JB 3RQIA 2HGCA 4Y15A 1OYYA 4QPQA 2HVSA 2RDPA 2EN8A 2EWLA 2WY7Q 3H5NA 3LSGA 4F9CB 4IOAF 2K27A 3OS2A 2EMBA 2KIMA 1XPXA 4N4NB 5IOZA 1YITI 3S2WA 1O3SA 1U2WA 1YG2A 3G2BA 3L09A 2ZFUA 1ZRDA 2WAQA 2UWMA 5IP7J 3ABLH 1WJBA 2ID3A 3K70D 3QP6A 2QWWA 1IGNA 3CTAA 2QKMB 5EF6A 3HSFA 3U9GA 3NWSA 1U3EM 2R7ZJ 5D5VB 5JVGF 4N4RB 5J6XA 2JA2A 2LRDA 2ZMEC 4CCKA 5K5OA 1N3GA 4WFTA 3HTXA 1OCRH 2M4IA 2HOSA 2LCEA 2P5LC 3Q9VA 2LR8A 4L0ZB 3ADJA 2PJRA 2WZOA 4GZNC 4AYBA 3VWBA 1IO2A 2XF6A 1QNTA 4DYQA 3HPZA 4ON0A 5KK1A 4CUGA 3BCBA 3CF5F 4ENKA 1QPIA 4MLQA 5H20A 4BXUA 2RNGA 4LLNA 3BDDA 1B1BA 2OA4A 1LFPA 2EFWA 2LUPB 1D5VA 2EN2A 2X51A 5EEHA 2LKXA 4F55A 5LHHA 3GFIA 4X8WA 4B3AA 2OZUA 3HPGA 4LLLA 3U1DA 2IXSA 1LE8A 3LSKA 1A04A 3M9AA 2ENHA 3T1HE 4OIPF 2FXAA 2ZMEB 3LAPA 2X1DA 3OYMA 4PFPA 4XSXF 4HF1A 2PEXA 4R03A 3ADIA 5F08A 4R8OA 1SFXA 1BM9A 1WWXA 1IC8A 2RVCA 1N25A 3DF8A 3ABTA 2H09A 5JR3A 4KISA 3GFLA 2WTEA 3OMYA 3FXKA 3GMEA 3HTUA 2V1UA 1LEAA 4KIBA 4JP0A 4FE7A 4MIMA 4BHBA 5J4VA 3HEFA 3RI4A 1V3FA 2ELJA 3L00A 2LY9A 4HZFA 1ZR4A 3CC4I 1U9NA 1NG6A 2K4JA 3FF5A 3BTJA 3OR2C 1ZELA 2VQGA 1P47A 1OMIA 2NVYJ 4EGZA 1SANA 2FX0A 5D5XB 1V54H 3LOCA 3GTOJ 3K69A 3KIOA 2CWEA 4HQMA 3IAS2 3ASOH 1N36E 3SHFA 2V9PA 1FTZA 2YTGA 1YLFA 2EMIA 2DFIA 4J19A 4A0XA 1TL8A 2NVTJ 2G9WA 1IXSB 2DOEA 4IHSA 3HC7A 4A3KJ 2EN1A 2ISZA 2XAUA 4BXFA 1RRJA 2VC1A 4JK1X 4UV9A 1AH5A 2EILH 3VK6A 2EPXA 2KKOA 2W84A 2Z1DA 3ZQQA 2BHZA 2ZMEA 3COAC 4UHTA 1C0WA 3CD6I 4AIJA 4B3TE 1JUMA 3Q0UA 5L3GA 1BJZA 4CGZA 3A2KA 4O5GA 3ABUA 2K9NA 4P5OA 2LJUA 2HXOA 3AV0A 5HS7A 2VKEA 2ELHA 1N78A 2NUGA 4I01A 5DD4A 3O2PE 2WBMA 1MD0A 2XGXA 3AAFA 3WGIA 2Z5UA 2F6CA 5DD8A 1K61A 3CMYA 2JWTA 3HQ1A 3IH2A 3T5XA 3WU0A 3HDDA 4II3A 4KMFA 2VKHA 5DM7F 2O6GE 3H5RA 4KWYA 1XX5A 3IV5A 2EOMA 3E97A 1LPQA 2LTPA 5BNGA 1ETXA 5J1YA 2PI0A 2LVSA 1HKTA 3F22A 1Z77A 1DI2A 1HXDA 2STWA 5E1ZB 2FRHA 2WV1A 2Y48A 3F6HA 2WAFA 1VTNC 2MSYA 2Q2EA 4OAYA 4JI2E 4A12A 4G6TB 2FNAA 2ZNZA 3IH4A 4PK4A 3VYUB 3D1NI 5M5WJ 2STTA 2EMHA 2ZSIB 2EMXA 1OQYA 4V2FA 3I58A 2YSRA 2FBIA 2M45A 3FXQA 4GO1A 2RSMA 2GA2A 4H0EA 4RAFA 3IKTA 4U0VA 2IHR1 1NG7A 4I8OA 2R5YB 3BBGA 1CQTA 1XDSA 1U5TA 2L2MA 4R2QA 5CVVA 1UFMA 2DA7A 3QPSA 4MGRA 3QWLA 1Y6IA 2FMYA 3DU6A 1ZAOA 3IRQA 4GRIA 2WB1N 4XLPF 1WHQA 3H9GA 2E1CA 1XNQE 2EWNA 3PO3J 4NHJA 3BROA 1NCSA 3HG9A 1P6RA 1MNEA 1QPMA 1ZHFA 1XMXA 2NS7A 3M07A 1L3LA 1JUPA 1XDUA 2CFOA 3G6EI 3AL0B 2CSHA 4JV5E 4RB1A 1RC9A 5FD6A 3OYDA 5HNHA 2YSPA 2XAQA 3S1QJ 3ZQGA 2L5QA 2WBSA 1BR2A 5GADJ 4C2TA 2HPMA 3ADLA 2L01A 4MHGA 2EH3A 5H2FC 1O3TA 2QUFA 1GT0C 3HOZJ 1D1BA 4WYQB 1ZQ3P 4ZYEA 1T0FA 5CVUA 1SMYF 2IW5A 4XICA 5TRDA 5KAIC 2K3FA 4RM3A 4D7MA 4B3RE 4HAMA 1HA8A 4J00A 2EM7A 1I6HJ 4XRSG 2HQRA 2HR3A 3BTCA 1XGMA 2R7UA 5EZHA 1JK2A 2FJ1A 3PJRA 1OYIA 3BG9A 2R5YA 2EV0A 4GCVA 1HDPA 1YS6A 2MH2A 2HU9A 2P5KA 4XKCA 2XSDC 3GLLA 4XIDA 3CO6C 1GZ6A 2CTDA 1ZAAC 2EOYA 1BI3A 1ONVA 2BW3A 2HZDA 2YR2A 3A0HC 1J9IA 3W3CA 2R0QC 3FM5A 2MD0A 2X1EA 2BOLA 3L2QA 3GTLJ 1PJTA 3J7ZI 4G9YA 1KYQA 1I1SA 1ODDA 1YOVB 3BJAA 3DEUA 2CRGA 2IT0A 4A5MA 4TV7A 1WH5A 4I02A 4B48A 1W0TA 1VQMI 1YW8A 4NZVA 4A3GJ 2A6HF 5KCMA 2DAOA 2EL5A 2XF7A 2G0EA 4AIHA 4EEFG 1EKEA 2CJJA 2BY1A 5CYVA 4E7SA 3HOSA 1A5JA 1Y8QB 2DMUA 2ECCA 3L2VA 2VXDA 4NDLA 4X62E 4RGXA 3L2CA 1SD7A 4GYIA 1DP7P 1V5GA 2GWRA 3HOWJ 4KFCA 2DCEA 3TW7A 9ANTA 3FX3A 1GHCA 4ESBA 1ZR9A 5CKTA 5J1RA 3FXUA 1LNWA 3DQVC 1KJKA 2NS8A 1YJ9I 2M2EA 2W4SA 5F27A 2D5VA 4YIFA 3JTHA 2CQQA 2YS9A 3ZQCA 1JT0A 4OOGC 1TWAJ 5M3MJ 2EOOA 4OIOF 5L3BA 5TISC 2FGGA 2DLKA 5FKOA 2YTJA 3F8NA 3LNQA 5ILSA 3ISPA 2YUSA 1TN9A 3VB2A 3OOUA 3ZRGA 2OCEA 1MBGA 2JPCA 1MEYC 3TKYA 3ZMVA 5ADZA 1DQ3A 1UBDC 1TWCJ 4LD5A 3ZXSA 5LHGA 2ENAA 2ZKZA 5H6QA 3S3OA 1IG7A 3QG5C 4NXNE 1RUNA 1ZBQA 4KJZA 5E79C 5GTHC 1X5WA 2DBBA 4RB2C 4KT6A 1W7PA 2DMNA 4XQFA 1WCMJ 3MWMA 5JI6A 2P6SA 4G8XA 1OJLA 1S7OA 1ZGAA 2DW4A 3R61A 2XKOA 2YTPA 3ASNH 2QQ8A 3QP5A 4IJDA 2IVMA 5ERIA 2KIFA 2LNBA 4N0BA 5HLIA 5DDGA 2RNJA 2R3SA 2M8EA 2CV0A 2HFHA 3OMLA 4M2ZA 2VIXA 5KL4A 3BR0A 4A3LJ 4UY8I 1X6HA 1ZU1A 4N4OB 4MTDA 1SVLA 2CUJA 1UHMA 1T38A 4ESJA 5CLSA 3I55I 2O7OA 3J81Z 2JVHA 3BP8A 4FK5C 2B63J 3PUFA 1STUA 1XGNA 2DT5A 1FBQA 1BN5A 2CT1A 3GW2A 2ZCWA 2JRMA 2W82A 2WAQN 3KX2A 3HIFA 4E7HA 2K5CA 3DTKA 1WHUA 4YFXF 4F92B 3A01A 4R2AA 3MVPA 2EM5A 3LA7A 4ZDLA 2DLQA 2CQ7A 3C4TA 2VT3A 1XB4A 1GVDA 2CQNA 2DGCA 1OR7A 2P7VB 2ENCA 3EUAA 2IBDA 4PJ0C 1NH3A 3DEEA 4IXAA 3WTXC 1J5YA 2RN7A 2WAEA 4DZJA 5D4RA 5DCMB 2QVOA 2XGEA 1XTAA 3FK6A 4L0YB 3S93A 4WF2A 2V7FA 4D5FA 5LEJA 1PP7U 2K86A 3GZ6A 1S3JA 2R7QA 3CDIA 2D1VA 5IXMB 1WJDA 4LIVA 1KU7A 4L5NC 5HODA 1Q1VA 1IJWC 4WK8F 2VQLA 2E2JJ 3THOB 5GAHJ 4GEQB 1B6AA 1GUUA 4HNUA 2R76A 4RA2A 1Y56A 4L9JA 1RPWA 4LJZF 1HR0E 4R2CA 2A6EF 5A2QC 2ZXJA 1HNZE 3RYRA 2JA8J 3E7LA 2OUMA 3HRTA 1IN5A 4XL9A 4QSHA 2E1MC 1AWCA 4EATA 3CC2I 4HV6A 1T4NA 2KIQA 2EPLX 4JYAE 1MJBA 2IA1A 5FKMA 5F1RA 2GM4A 2UUAE 2AHQA 3L9FA 5KVRA 2DMQA 4UNOA 3CZ6A 3MFKA 2L54A 2EBIA 2K4VA 2HHHE 4B3SE 2L6MA 1XC5A 2O3FA 2V9VA 4HSTA 4F3QA 2QBYA 1GVJA 3K1MA 2C6YA 3AG3H 1FSHA 4DOZA 1MJ9A 5BMZA 2BV6A 2EPAA 3KETA 1X2MA 2BXYA 2XAGA 5E3MA 2LT7A 4JI1E 2OD5A 3BY6A 2LE2A 5K1YA 2UUBE 2GOMA 1EA3A 1U78A 2BEOA 1WH7A 2DK5A 3K4LA 2ZJPF 1P2FA 3AG1H 2EM8A 2EOQA 4XORA 1RR7A 3JRCA 3DLAA 4BACA 4KYWA 2ETHA 1E3HA 3A02A 2OBPA 2GBYA 3OIOA 4OOIA 2M1BA 2M4GA 4L9TA 4M6VA 2DJNA 4EGYA 1W7PB 3EETA 5KL3A 1DGRM 3FK7A 2E72A 5DCMA 2EV6A 2FBHA 2DMYA 2G7UA 3CCEI 3CCJI 2PX9A 1GTKA 1X4OA 3G1MA 3T1BA 1S6LA 4BYYA 1ZTRA 4X9JA 2MDGA 4XLEA 1YPNA 4BU2A 1YW7A 1HCRA 2DMTA 4S04A 3K6QA 3LAJA 4DW6A 3Q3SA 1MBKA 4Q47A 2HYJA 2QQBA 3LSRA 1HKQA 1RQ0A 3CMEI 2ZSHB 1AU7A 3ABMH 3LL7A 1QU6A 2VBXA 4MTEA 4HDVA 1IN6A 2E5NA 1BA5A 4PJNA 3MKZA 2UXDE 1YX5A 3DKYA 3EQLF 3GWZA 5IYDJ 1DPUA 4ZH4F 2GPIA 3J7AY 4ENNA 3P9KA 3H09A 2H94A 4LG0B 2EA4A 2CFXA 3HRUA 2IEKA 3S17J 4WSPA 3Q0VA 3PQJA 5IYBJ 2DDBA 4NXME 1FMWA 5J1UA 1JKPC 4PCQA 1P4XA 2VT2A 5FJ8J 1YZ9A 1E3PA 2XGCA 4LTYA 1Z3YA 3RSNA 5ED4A 1XCBA 1MBEA 2M7QA 1JGSA 1H88C 2M7BA 5LFAA 2L9SA 3BR3A 2DMPA 3C2GA 4KIGA 4MEXF 1IQOA 4KIFA 1JTXA 1N75A 2DK8A 2XGDA 1G3WA 1R22A 4DQ2A 2FEZA 3MZYA 2XAHA 2E7XA 2V26A 3BZ6A 2L3JA 1FP1D 3T1YE 3CO7C 2DFHA 4YG2F 1BOAA 2ME0A 1IBKE 3WODF 2LTRA 3QU6A 3NARA 4W97A 1RI7A 3F3XA 2YX7A 1K7AA 4HV5A 2EZ6A 1TW2A 1MNDA 1R58A 2QSGX 4F6NA 4R2EA 1R4MB 1FWZA 5JLXA 1YW9A 3KP5A 1YYWA 3O8GA 3W2AA 1D8JA 4A3EJ 4Y4RA 2F4IA 4B8XA 3S1NJ 3DFGA 4Y52J 4CH7A 3E6DA 5DYMA 1X1AA 2N8XA 2X48A 1BI1A 1LDDA 2W85A 1YRNB 2YTDA 3PFYA 5GPCA 3M4OJ 5GPAA 4P78A 2LH9A 2HS5A 2N3GA 2HI3A 4LIUA 2ZXWH 5C4XJ 2L3CA 3EPJA 5F0CA 2E7WA 2KRFA 4EV0A 1U9OA 3QYBA 2H27A 2EPOA 2VL8A 4A0YA 1IN4A 4PZJA 2LFBA 2H1KA 2VBYA 2JA6J 4HOBA 4CYCB 2TCTA 1K78A 4IRGA 1LFUP 1ON2A 4P9UA 1KGSA 5KAFC 3TQNA 3UKGA 1W5CC 3JRAA 1Z1DA 4HLYA 3DTEA 2V1XA 3QODA 3R60A 3G3ZA 2NA2A 1ZLJA 1YYOA 4UUTA 1MH3A 5LRSA 3HXLA 3DPLC 2A25A 3S32A 1X48A 2UUCE 2W00A 2OF7A 4XM3A 2MD5A 2P81A 2JA5J 2DN0A 1TLHB 3ELKA 2VQCA 3V4GA 4O3MA 4BE1A 3TL4X 2ISYA 5K7ZA 1XG1A 1XSDA 4G7OF 4YY3E 4OMZA 3OYJA 5EG0A 1IRFA 1P4AA 1RZ4A 2XPUA 1P7JA 2Y31A 2VI6A 2NYXA 3IL2A 2IS2A 3GF2A 4AU7A 4QLCU 1RIOH 1U0JA 1ZG5A 4NBQA 4IOCF 1IRZA 3H5AA 2R5ZB 3KYCB 4S0HB 1NTCA 3FXOA 3R0AA 1S8NA 3QOPA 1RKWA 4RM2A 2OCCH 1BC7C 3BR5A 3OY9A 5M3FJ 2OZ6A 2Q1ZB 2V86A 1OYWA 3ABKH 4BL0B 4A3DJ 2RS6A 2ZXIA 5J4YA 3E6BA 1FIAA 2R92J 1I27A 1P4WA 4FHTA 4X66E 5LGNA 2FUG2 1WJEA 3WTYC 2E2IJ 2W1OA 2LSOA 3CUQB 2EOSA 1D0XA 2IAIA 2L92A 3OIQA 1BBYA 1ORKA 2DA2A 4QWQA 1IUYA 4MQ9F 3LA3A 4BAYA 3WTTC 3SYTA 2XPVA 2V85A 2H1LA 5AE3A 2X9DA 1G59A 2YU8A 4ZYGA 3E5QA 1YSAC 3ZQIA 5L3CA 4LFAE 1H9GA 4RB0A 1Z05A 3GFJA 3DU5A 5C44J 2LKSA 1I3AA 4Z2YA 2X4HA 1O57A 1WJFA 1R36A 2XSJC 4BQAA 3MMYB 2CS3A 1VQ4I 3P9CA 1ZK8A 2F5CA 2RTXA 2Q8UA 3EPLA 2EOHA 4DV7E 3DWLE 4IO9F 4YRVA 1ZH5A 5CVIA 2EFOA 3LSHA 3MZHA 2DSYA 4FTHA 1WKMA 4CCJA 4BJ5C 3JR9A 1U6GA 2EZHA 3W6KB 3KP7A 5FB2A 1I5ZA 1X47A 1T08B 3BQZA 3LA2A 5IOYA 3F8BA 1AHDP 4A3JJ 1IRGA 1ZRCA 3M1EA 4LOCA 3M8JA 2JUGA 4LF5E 1ZN2A 1QHGA 1ENHA 2HPIA 2CW7A 3IHUA 2UXXA 1FOYA 3RKXA 3FIGA 5EG0B 3FHZA 4BBYA 2GZWA 5CVJA 1Z21A 4UVAA 2EMKA 3S3NA 3CUQA 2K7LA 2EJ4A 3M8FA 4WXDA 1FBSA 4XLAA 1VQ9I 4C3JJ 4UXNA 3V8LA 4YEJA 1LDKB 4A69C 3ZMZA 2NXNB 2OAZA 5F0HA 2R5ZA 2YT4A 2EIJH 4ETSA 4RLFA 1JUSA 1OCPA 1FSEA 3CDHA 3RIRA 3FBNB 3VYSB 1F43A 2DT7B 2IRFG 5BQTA 4UUSB 4IEJA 2DIXA 4WX9A 2BXZA 4P9FA 5FKKA 3J81K 5CJ9A 2PG4A 2L9VA 1RETA 1KU3A 4KA4A 2VUMJ 1XN7A 2WC2A 2I8DA 2K9MA 3EYIA 4O24A 3IUOA 3LSMA 1HQCA 4IQ4A 4JX5A 1FOWA 4KMUX 2M5WA 2HC5A 2M9HA 4XKBA 3H9JA 3VOEA 5CQGA 3ERMA 1UCRA 3C6MA 2R7OA 1QVTA 1ZLKA 3A4CA 2MLKA 1Z67A 4A3MJ 3K4JA 3QAHA 2HDCA 3MD2A 4RB3C 2L9NA 2JJ7A 1UJ8A 3A03A 5TGTA 1P92A 5LL6R 2G7HA 4HX7A 2GXGA 2YRKA 2L7MP 4IF4A 4DR3E 5DNYA 4XLCA 1DUXC 1YE9A 4FT8A 4NNJA 1HSJA 4X6AJ 1VQPI 2JYAA 1JHFA 4PJLA 4B4CA 2K7IA 5LBQA 1ETWA 3RTRA 3RPUA 1X19A 1PDNC 2A61A 3QRFF 2L2KB 4DV4E 2YSOA 1EJ9A 5EJCA 2PRTA 5AC5A 4P96A 1WPKA 3RDIA 1EH8A 4HEA2 3F23A 2LD5A 3HOYJ 2PJPA 1WFXA 1LQ1A 2O8XA 4V2GA 3ZQFA 3ZP5A 1J0RA 3JAMK 2OQRA 4O5VA 1W5SA 5EZGA 2EMZA 4EJTA 2KPMA 4XOPA 2EPPA 2JTVA 3KLNA 2EN4A 2JK3A 3NAUA 3QPLA 3BJOA 1AKHB 3S16J 4UUSA 3CMAI 4ZZLA 2A07F 5D8LB 1W1WE 2EA2A 2NS0A 1JKQC 2EPNA 3HHHA 4YIIA 3BPVA 3JSOA 1MW7A 2DODA 3VEPA 5FRNA 1IXRC 2XHKA 3DJWA 1W5TA 2DJIA 1RR8C 1S72I 3B6CA 3I71A 3GTPJ 3CLOA 2LTSA 4I99C 4XKVA 3TQMA 3MKLA 2K85A 1WJCA 3H0GJ 2MFZA 3V8KA 2EB7A 1SVMA 2BGCA 1IXCA 2NOGA 5IT9Z 4Q4ZF 2LC2A 2F5DA 2L9RA 4PUSA 4D5CA 2EMLA 1D0ZA 1QZZA 2OC6A 2P4WA 1IN7A 2B7VA 4XR6A 1PJRA 2PN6A 4DNCA 4DGWB 3BG6A 3S2DJ 4DJAA 3L1PA 2WBTA 5K5QA 4RAZA 2DPUA 4M9SA 2VRDA 1TF3A 3M3YJ 3VYXA 2P6TA 5J8FA 3GYHX 4OIQF 4IHXA 2W25A 3I4MJ 2LMZA 4DR5E 2HQAA 1W36C 2EM3A 2FSWA 3OOPA 3PSFA 2B7EA 4IZZA 4K0KE 2P5VA 3I9V2 4CSWA 2DOAA 1H0MA 3S14J 4DV5E 2QSFX 1QO0D 2VQHA 3OR1C 1K4SA 1B9NA 2XASA 4X1EA 3JSPA 1TT0A 5F64A 2LRSA 4DV6E 1QQIA 2FD5A 3FKIJ 2MDRA 2A3SA 1X6EA 4X0GA 3RKQA 2RPCA 2F5FA 4MFEA 1EF4A 2Y9YA 3DKWA 4NQWB 4NC6A 5ILUA 1NEIA 2WB1A 2IGOA 1RC7A 2Y30A 3PFIA 2HVRA 4XRSA 4EJOA 2X6YA 4M9ZA 1CF7B
chains in the Genus database with same CATH topology
2MBFA 5IT3A 2UXNA 1ULYA 1FC3A 4ENJA 1O7FA 1YIOA 4KN7X 4IRHA 3O3KA 2ESHA 3ZPLA 2QQ9A 1UB9A 2R7DA 2XROA 3KZYA 1YO5C 2V6CA 1O7LA 4PGGA 1E2XA 3IRRA 2YU3A 1SD4A 4BH9A 3H3UA 1R00A 3VODA 4HYEA 3TO6A 4ENMA 1Z91A 4I0BA 1HW1A 5A2QK 5LHIA 5F6FA 3LFKA 2GQQA 4LMYA 4R79A 4M6XA 1KU9A 1G3TA 3SFZA 4P55A 5D6EA 3BWGA 4RGRA 4M9XA 1FOKA 2FE3A 4AWXB 4S05A 4YFKF 4MNUA 4L9VA 4OIRF 1K6OA 4N9IA 3BJ6A 4UUVA 1ZG3A 1GXPA 3GX4X 2OQGA 5FLXZ 2QLZA 1U5TC 3ECOA 4Y17A 4R1HA 3V7CA 1FLIA 4BHPA 2A5YB 5LEKA 1MZBA 2Z3YA 3FM3A 1SFEA 2DO7A 5FD5A 5FLXK 3K1NA 3K2ZA 3KLOA 2F2EA 5HLGA 1J75A 4UVBA 1TW3A 2HKXA 4U0YA 1Q1HA 1O3RA 1Y0UA 4KT5C 4I7HA 2QQAA 1B4AA 2A69F 2KJCA 5JVTA 4LB5A 5FGMA 1XSVA 5AIQA 1IF1A 2XIGA 3TO9A 1YS7A 3I64A 1U5TB 4Q5SF 2JT1A 3RKYA 2MH9A 1J59A 3C7JA 4KUMA 2FQ3A 2FA5A 3MEXA 1WRJA 1F5TA 2HWVA 3E5XA 4LFUA 3DXJF 4Q48A 1WSUA 3QPTA 1XCVA 4YFNF 4IVNA 1T6SA 5D5WB 3PQKA 4AVPA 1QBJA 3KP4A 4CHUA 4L18B 3T8TA 2MA3A 3IWFA 3GFMA 4UV8A 3CUQC 1NHAA 3TOAA 2XAJA 4G7HF 3WE3A 3DP7A 1BIBA 1ZYRF 2ESNA 2O0YA 2ZNYA 1OKRA 3Q5FA 3I54A 3P7NA 2XV4S 2HTJA 2DU9A 3KP6A 1ZRFA 3WU1B 2DQLA 3KEQA 5HDGA 1XSXA 2H6BA 2CO5A 5AONA 1STZA 1JE8A 4CDGA 1YYVA 2JRTA 2CW0F 1TQIA 5JHUA 1F1ZA 3E3VA 5IT9K 3MQ0A 4I09A 2D2WA 5J8CA 2V1DA 1OPCA 4HF0A 3HTSB 3GO5A 1H9TA 3CJNA 5E1WA 2F5EA 4FX0A 3WTWC 2RQPA 4XSZF 1V4RA 5AIPA 2QM3A 1MJAA 1MKMA 4K2EA 2LF8A 2FNPA 5ICGA 2CGPA 1IW7F 3DPTA 4XRFA 5ICEA 1Z6TA 2Y0MA 3C18A 1UHWA 3HRMA 1FBUA 3T8RA 1JXSA 2AXLA 2HZTA 3CUOA 1ZARA 2FMLA 2L02A 5ILVA 2ZJ2A 2UZKA 1G3YA 3H3ZA 3TDUC 1S29A 2BYVE 2RV8A 1T39A 1TNSA 3IC7A 3E6CC 2LDUA 2PBIA 3WTZA 4LK0F 4PDKA 3TOBA 3HHGA 2FF4A 4U7BA 2X0LA 2VN2A 1ON1A 2IP2A 1S7AA 3J80Z 2VONA 1X3UA 5A2QZ 4NQWA 4EVIA 4ZYHA 4B09A 1FPQA 1YTYA 1MGTA 2V79A 1EH7A 3T0YA 1QGPA 3DV8A 2CG4A 1KQ0A 2YPRA 2O03A 3M7GA 3KFWX 1IZ1A 3J7AO 4A6DA 2PMUA 4EJUA 2P8TA 2Q0OA 4L5IA 2QENA 3JW4A 1WQ2A 1MDMB 3ML6A 1SAXA 3V7SA 2JPBA 3TO7A 4U7DA 5ICFA 5K5RA 3F21A 3N4MA 2Y75A 4I0AA 1G3SA 3QPHA 1PUEE 1CF7A 4OU0A 2RGVA 4A0ZA 2ZFWA 1K79A 1XGSA 1J7KA 4JBAA 4RAYA 4EM2A 2GIVA 1G6NA 2VODA 3WTVC 4U88A 2IJLA 1FY7A 3GXOA 6PAXA 3FXRA 2RC4A 3LQQA 3EYYA 3E6MA 5DV5A 3H92A 1Z7UA 4EM1A 5HOOA 3VFZA 2HQNA 1FT9A 4M73A 1Z6RA 2J5OA 1R5GA 5BPIA 1SD5A 2QZ8A 3KP3A 1R1VA 4HX8A 4HDUA 1R1UA 3OV8A 1K78B 5BPDA 1GXQA 4GGGA 4LB6B 1LB2A 5E8GA 1LDJA 1R23A 3R0JA 2EFQA 2FU4A 3JAMZ 2J5PA 3E5UA 3ZMSA 3HOTA 3FWEA 1B59A 4WCGA 3F8MA 3B02A 2ZO4A 1TQMA 2ZBKA 2CYYA 3ZN1A 4XLNF 1DDNA 5E8IA 2NAZA 2GA1A 4HQEA 4I2OA 3MCZA 5DCFA 4HX4A 1XD7A 1D8KA 1F4KA 1BIAA 2DLLA 4A2UA 5E17F 3RYPA 4WWCA 2EFNA 4MEYF 2HYFA 4HLXA 2YX4A 4KN4X 1LEBA 1EV7A 5BOXA 5EEGA 5L3FA 4L5JA 2L3DA 1FNNA 1I1GA 3K9TA 2VOOA 1TNTA 2XRNA 2DI3A 2WWYA 1J2XA 1T98A 3R6SA 1F9NA 2HTSA 1D3YA 5HS8A 3GEZA 5H6RA 4MQVA 4R8HA 2R7FA 1REPC 4XBFA 2Q8KA 1FYLA 1IAWA 4UVCA 5HVQC 1HSTA 3WGHA 3HRSA 3I4PA 2E1NA 2WV0A 3KEOA 2NNYA 3LWFA 5DUKA 1R7JA 4EJWA 4WXCA 4AD9A 1G4DA 3I59B 1XMKA 3D0SA 1HW5A 4ZYDA 4OINF 2HEOA 5E1XA 4RGUA 1ZG1A 3LQRA 4O6JA 3R4KA 4NB5A 1RNLA 3REOA 2GXBA 4IJAA 3IWZA 4PGHA 2Z99A 1BJAA 2K02A 4M72A 2QYOA 5HDKA 5LGUA 3F72A 1R1TA 4G6DA 1SMTA 2B0LA 1EH6A 3HSRA 1SD6A 4RGSA 2DTRA 1Z9CA 3F8FA 3GVAA 2EK5A 1FX7A 2P7CB 1U8RA 1KA8A 5FO5A 4Y13A 5DUIA 1WI9A 4KNYA 5JFRA 1HBXG 5LRRA 4IHTA 4D0PA 2PFBA 2PQ8A 3KCCA 2MLGA 4IRIA 4L9NA 4BNCA 3SXYA 4G6QA 1PP8F 4E70A 1YFHA 5LLQA 3KE2A 4HA8A 1FYKA 3F6OA 3GLXA 4U0WA 1FP2A 2M87A 4AIKA 4IPAA 4HW0A 2OU2A 4F7ZA 2EV5A 3FMQA 3HSEA 4CO8A 4BHCA 3BPXA 4LK1F 2XVCA 1W4MA 2VC0A 4M6YA 1JHHA 3SZPA 3FZVA 3Q9SA 3U2RA 2VXZA 3WG9A 4EM0B 2HOEA 3NQOA 1L0OC 5BS6A 2K4BA 2CQKA 4CZZA 3K0LA 3RPQA 5LGTA 3K1PA 1KU2A 3L7WA 5D6FA 2JSCA 3WTUC 4HBLA 1XMAA 4GYGA 2IA0A 4I98B 4M74A 1IN8A 3KP2A 2BE5F 2EJRA 5E18F 4OMYA 3F8CA 2PMHA 1XGOA 3D5LA 3WGGA 2DQRA 3ECHA 2D1HA 3ZMDA 4LGWA 3ZMUA 2RKHA 3F6VA 4GXOA 1O3QA 5HDNA 3RKWA 4CICA 3WTSC 1ZREA 5L3EA 4N9HA 2DPDA 2LF7A 5D5UB 5D8KB 5FFZA 3LSTA 3NRVA 1LVAA 2XKPA 2Z9OA 5DEQA 2VOPA 3KZZA 1BI0A 3C3WA 1BI2A 1TTYA 5FFXA 1FYMA 3EDPA 4RS8A 3SQNA 3WE2A 2BBYA 2QBYB 5ICCA 2HYGD 4WXHA 2KJBA 1SFUA 3GUDA 3SZTA 2LKPA 5CVRA 3O6BB 2IA2A 3RJPA 2M30A 2H6CA 3ZQ7A 3ERED 4ESFA 2VE8A 2D45A 1KYWA 3NEUA 1KYZA 4JQFA 3I59A 2GAUA 2W57A 4KICA 2AS5F 1DPRA 1FZPB 1AOYA 4LG0A 4EQQA 3N97A 5TJJA 3ZMTA 1KQ8A 3I5UA 1USTA 2VBWA 4EMSA 1HKSA 3QU3A 1ZGJA 1YQAA 2VBZA 3ZN0A 1LJ9A 3C1DA 3G73A 4HF2A 3BOQA 2VE9A 2IPQX 3ROUA 2L4AA 4CXFA 3GZ5A 2HKOA 3I0TA 1USSA 1I6XA 1KQ9A 3MAJA 3M8EA 1RUOA 4A6EA 3IKVA 2XAFA 2A68F 1T2KA 3V8JA 4CYDA 4ASNA 1BC8C 1TBXA 2FOKA 3J80K 2ACJA 3HYIA 3TDZC 5HLHA 2ADUA 1MDMA 3TGNA 1HW2A 2NNNA 2XUBA 3JTGA 2EFPA 4FX4A 4M71A 1R5HA 1TQPA 2FBKA 2L4MA 2JZYA 3I53A 1CGPA 3P9IA 3B73A 4EJVA 2O61A 4A5NA 3V7RA 2MC3A 1QZYA 2COMA 5E20A 4ZZDA 2W24A 2CSOA 2NRAC 1W7PD 2KIUA 4G94A 2PLYA 3HUGA 2Z33A 5D4SA 3FMRA 3FMSA 4KDPA 4G7ZF 2TDXA 4LLGF 3ULQB 5L3DA 1B9MA 5HS9A 1E17A 3EUHA 3W6JB 2HGCA 4Y15A 1OYYA 2RDPA 2K27A 2KIMA 3S2WA 1O3SA 1U2WA 1YG2A 3L09A 1ZRDA 2UWMA 3QP6A 2QWWA 3CTAA 3HSFA 3U9GA 1U3EM 5D5VB 5J6XA 5K5OA 2P5LC 3Q9VA 4L0ZB 1QNTA 4ON0A 5KK1A 4ENKA 5H20A 4BXUA 4LLNA 3BDDA 1B1BA 2OA4A 2EFWA 1D5VA 5EEHA 5LHHA 3GFIA 2OZUA 4LLLA 3U1DA 1A04A 3M9AA 4OIPF 2FXAA 2ZMEB 3LAPA 4HF1A 4XSXF 2PEXA 1SFXA 1BM9A 1WWXA 2RVCA 3DF8A 3ABTA 2H09A 5JR3A 3GFLA 2WTEA 3HTUA 2V1UA 1LEAA 4KIBA 4BHBA 3RI4A 1V3FA 3L00A 4HZFA 3FF5A 2K4JA 1OMIA 4EGZA 5D5XB 3K69A 2CWEA 4HQMA 3SHFA 1YLFA 2DFIA 4A0XA 2G9WA 1IXSB 4IHSA 2ISZA 2VC1A 4UV9A 4JK1X 2KKOA 2W84A 2ZMEA 3COAC 4UHTA 1C0WA 4AIJA 5L3GA 4CGZA 3ABUA 4P5OA 5HS7A 2ELHA 4I01A 5DD4A 3O2PE 2XGXA 1MD0A 3AAFA 3WGIA 2Z5UA 5DD8A 3T5XA 3WU0A 4KMFA 2O6GE 3E97A 1HKTA 2PI0A 3F22A 1HXDA 2STWA 5E1ZB 2FRHA 2Y48A 1VTNC 2Q2EA 4A12A 2FNAA 2ZNZA 2STTA 3I58A 2YSRA 2FBIA 2M45A 3FXQA 4GO1A 2GA2A 4H0EA 3IKTA 4U0VA 1XDSA 1U5TA 5CVVA 1UFMA 4MGRA 2FMYA 1ZAOA 3IRQA 4XLPF 2E1CA 2EWNA 4NHJA 3BROA 1P6RA 1QPMA 1ZHFA 1L3LA 1XDUA 4RB1A 5FD6A 2XAQA 2L01A 4MHGA 1O3TA 2QUFA 4ZYEA 1T0FA 5CVUA 1SMYF 2IW5A 5TRDA 4HAMA 2HQRA 2HR3A 1XGMA 1OYIA 2EV0A 4GCVA 1YS6A 2MH2A 2P5KA 3CO6C 1BI3A 1ONVA 2YR2A 1J9IA 3FM5A 4G9YA 1I1SA 1ODDA 3BJAA 3DEUA 2IT0A 4A5MA 4TV7A 4I02A 1YW8A 2A6HF 2DAOA 4AIHA 3HOSA 5CYVA 4RGXA 3L2CA 1SD7A 4GYIA 1DP7P 2GWRA 4KFCA 3FX3A 1GHCA 4ESBA 3FXUA 1LNWA 3DQVC 4YIFA 3JTHA 4OIOF 5L3BA 3F8NA 5ILSA 3ISPA 3VB2A 2JPCA 3TKYA 3ZMVA 4LD5A 5LHGA 2ZKZA 5H6QA 1RUNA 2DBBA 4RB2C 1W7PA 3MWMA 5JI6A 2P6SA 4G8XA 1S7OA 1ZGAA 2DW4A 3R61A 2XKOA 3QP5A 2IVMA 5ERIA 2KIFA 2LNBA 4N0BA 5HLIA 5DDGA 2RNJA 2R3SA 2M8EA 2HFHA 4MTDA 1UHMA 1T38A 4ESJA 5CLSA 3J81Z 3BP8A 1XGNA 2DT5A 1FBQA 1BN5A 3GW2A 2ZCWA 3HIFA 4YFXF 3LA7A 2VT3A 1XB4A 1OR7A 2P7VB 4IXAA 3WTXC 1J5YA 2RN7A 5D4RA 5DCMB 2QVOA 4L0YB 4WF2A 5LEJA 1PP7U 2K86A 3GZ6A 1S3JA 2D1VA 1KU7A 4WK8F 1B6AA 4L9JA 4LJZF 2A6EF 2ZXJA 3RYRA 3HRTA 1IN5A 1AWCA 4HV6A 1MJBA 2IA1A 5F1RA 5KVRA 3L9FA 4UNOA 3MFKA 2L54A 2O3FA 2V9VA 2QBYA 1GVJA 3K1MA 2C6YA 1FSHA 5BMZA 1MJ9A 2BV6A 3KETA 2XAGA 2OD5A 3BY6A 5K1YA 1U78A 2BEOA 2DK5A 1P2FA 4KYWA 2ETHA 2OBPA 4OOIA 2M1BA 4L9TA 4EGYA 1W7PB 3EETA 5DCMA 2EV6A 2FBHA 2G7UA 4BYYA 3T1BA 1S6LA 1YW7A 4S04A 3LAJA 4Q47A 2QQBA 1HKQA 2VBXA 4MTEA 4HDVA 1IN6A 3GWZA 3EQLF 1DPUA 4ZH4F 4ENNA 3P9KA 2H94A 4LG0B 2EA4A 2CFXA 3HRUA 3PQJA 4PCQA 1P4XA 2VT2A 5ED4A 1XCBA 1JGSA 4MEXF 4KIGA 4KIFA 2DK8A 1G3WA 1R22A 4DQ2A 2FEZA 3MZYA 2XAHA 2E7XA 3BZ6A 1FP1D 3CO7C 4YG2F 1BOAA 3WODF 3QU6A 1RI7A 3F3XA 2YX7A 1K7AA 4HV5A 1TW2A 1R58A 1FWZA 1YW9A 3KP5A 1D8JA 4B8XA 3DFGA 3E6DA 5DYMA 1BI1A 1LDDA 2W85A 2HS5A 2E7WA 2KRFA 4EV0A 2H27A 4A0YA 1IN4A 4PZJA 2VBYA 4HOBA 1K78A 4IRGA 1ON2A 4P9UA 1KGSA 3TQNA 4HLYA 1Z1DA 2V1XA 3R60A 3G3ZA 1ZLJA 5LRSA 3DPLC 2MD5A 1TLHB 3ELKA 3V4GA 4O3MA 2ISYA 1XSDA 4G7OF 4OMZA 1IRFA 1P4AA 1RZ4A 2NYXA 3IL2A 3GF2A 4QLCU 1RIOH 1ZG5A 1BC7C 3R0AA 1S8NA 3QOPA 2OZ6A 1OYWA 3E6BA 1I27A 1P4WA 4FHTA 5LGNA 3WTYC 2LSOA 3CUQB 1BBYA 1IUYA 4QWQA 4MQ9F 3LA3A 4BAYA 3WTTC 4ZYGA 3E5QA 5L3CA 1H9GA 4RB0A 1Z05A 3GFJA 4Z2YA 2X4HA 1O57A 1R36A 4BQAA 3P9CA 2F5CA 1ZH5A 5CVIA 2EFOA 3MZHA 1WKMA 1U6GA 3W6KB 3KP7A 5FB2A 1I5ZA 3LA2A 3F8BA 1IRGA 1ZRCA 3M1EA 1ZN2A 3IHUA 2UXXA 3RKXA 3FHZA 2GZWA 5CVJA 4UVAA 3CUQA 2K7LA 3M8FA 4WXDA 1FBSA 3V8LA 4UXNA 1LDKB 3ZMZA 2OAZA 4ETSA 1FSEA 3CDHA 3RIRA 2IRFG 5BQTA 4WX9A 3J81K 4P9FA 5CJ9A 2PG4A 1KU3A 4KA4A 1XN7A 2WC2A 3EYIA 1HQCA 4KMUX 2M5WA 3VOEA 1UCRA 1ZLKA 2MLKA 3QAHA 2HDCA 4RB3C 1P92A 2G7HA 4HX7A 2GXGA 4IF4A 1DUXC 4FT8A 1HSJA 1JHFA 5LBQA 3RTRA 3RPUA 1PDNC 2A61A 3QRFF 4P96A 3RDIA 1EH8A 3F23A 2PJPA 1LQ1A 2O8XA 3ZP5A 1J0RA 3JAMK 2OQRA 4O5VA 1W5SA 4EJTA 2JTVA 3KLNA 3BJOA 4ZZLA 2A07F 5D8LB 2EA2A 2NS0A 3HHHA 4YIIA