4WX9A

Crystal structure of mycobacterium tuberculosis ogt in complex with dna
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
164
structure length
161
Chain Sequence
b'VHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTSRTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALLELEKSRAPADLTLFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*CP*CP*AP*TP*GP*(E1X)P*CP*TP*AP*GP*TP*A)-3')
publication title Crystal structure of Mycobacterium tuberculosis O6-methylguanine-DNA methyltransferase protein clusters assembled on to damaged DNA.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 42
structure length 161
sequence length 164
chains with identical sequence B, C
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2014-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4wx9A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4wx9A01
2FSWA 3GFIA 3WTZA 3D0SA 2P5VA 4L9VA 1TLHB 2FXAA 2BV6A 2F5FA 2F5EA 4U88A 1O57A 1OKRA 2LDUA 2W84A 5E18F 1G3YA 4UNOA 1REPC 4RB1A 5F6FA 4HZFA 4HAMA 4ESFA 4U0VA 2Z3YA 3VODA 1TQPA 3K0LA 3FHZA 5TRDA 3L00A 5FD5A 4PDKA 1RIOH 2YR2A 5KVRA 3W6JB 3BJ6A 4M74A 2DQRA 5ERIA 2ETHA 3T8TA 3D5LA 3ERED 4WXDA 1I1SA 1KU3A 1W5TA 2DW4A 1GXQA 3F6VA 1DPRA 4UVBA 1XGMA 3GVAA 1YTYA 4A0ZA 2YU3A 2L54A 3DPTA 1XSDA 1FBSA 3JW4A 1KU7A 5LHHA 5LEJA 1AWCA 5L3CA 2ZKZA 3FMRA 5BOXA 1U5TA 3BDDA 3RPQA 4ETSA 1B9MA 2HDCA 1XSXA 2NRAC 3P9KA 4I98B 3DFGA 4HX8A 1EH8A 4G9YA 1IUYA 2J5OA 2K27A 1Z05A 3NEUA 4JQFA 2EJRA 3WTWC 5TJJA 3L7WA 2M87A 5ILVA 3TOAA 3E5QA 3GO5A 1IN5A 1IN6A 1K7AA 3H92A 2HFHA 1D5VA 1YIOA 3TO9A 2ZO4A 1XD7A 4EM1A 1ZG3A 3GFLA 1T38A 1ZAOA 2PLYA 2VN2A 5D6EA 4A12A 4Q48A 4FX0A 1J9IA 4P5OA 2BBYA 1IXCA 3ZPLA 4N9HA 4KN4X 3HSRA 3DEUA 5KK1A 3SQNA 4XBFA 2F5CA 4P9UA 5CLSA 3I4PA 4HDVA 2BGCA 2ZNYA 4HA8A 3K2ZA 1FX7A 3QAHA 4AIKA 5HDNA 4TV7A 1PDNC 4OMYA 3M9AA 2PMHA 4A0YA 2JPBA 3CUQA 1FLIA 1WKMA 3HSFA 4O5VA 1YO5C 3HYIA 4B09A 5K1YA 5LHGA 1X3UA 2PFBA 1UCRA 4HF1A 5HOOA 2MH9A 2VT3A 3BP8A 1RZ4A 2Z9OA 2YX7A 3HOTA 2EA2A 2RQPA 4CDGA 1QBJA 4O6JA 5L3BA 1Z1DA 1USSA 2ESNA 4JBAA 2CYYA 2H09A 3TDZC 4KDPA 4BH9A 2F5DA 3F22A 3GFJA 1U5TB 4MHGA 4LK1F 1HKSA 1YW7A 2FNAA 1O3SA 3I71A 3F8MA 4F7ZA 1K78A 2L01A 3ECHA 4MGRA 4OU0A 3QU3A 3CTAA 3N97A 1SD7A 3LA2A 2DI3A 3F8CA 5K5QA 1IF1A 1JGSA 3HSEA 5HDKA 5FO5A 4A6EA 2JRTA 1FY7A 2FMLA 3L2CA 4A5MA 4G8XA 3DXJF 3WGHA 2XKOA 1ODDA 4G94A 2HKXA 1YG2A 1R22A 1LEAA 3BOQA 2KKOA 5LHIA 1TNTA 2H6BA 1IRGA 2PN6A 2CO5A 4NHJA 4NB5A 4IF4A 1WQ2A 1E17A 3MAJA 4XSXF 3ISPA 1Z7UA 3JAMK 1PP8F 3FX3A 1T0FA 2H94A 3HUGA 4DQ2A 4EJVA 4M6XA 2ZBKA 3ZN0A 2DBBA 1MJBA 2OA4A 2YPRA 3KP2A 4RGUA 5H20A 5D5WB 3RYPA 1DP7P 2YX4A 4DNCA 2FE3A 1MD0A 4CXFA 3K9TA 3EDPA 1LNWA 4Q5SF 4LJZF 1KGSA 2DU9A 1R1VA 3K1NA 1TQMA 3BPXA 3V8JA 5DUIA 2OQGA 1U8RA 3V8LA 4ZZDA 2Z33A 4G7OF 5J6XA 2PBIA 2KIUA 3BROA 3WTXC 4RS8A 1IZ1A 1MGTA 2PG4A 3O6BB 2LSOA 2KIMA 1ZG1A 3KZYA 4U7BA 4Q4ZF 2A69F 3FXRA 5D4SA 3IC7A 1TBXA 4ZYDA 4RGSA 3LSTA 3F8BA 4CZZA 2QQAA 4UHTA 2UWMA 3E5UA 4G7ZF 4A2UA 2P6SA 2DPDA 1XCVA 4BXUA 4G6QA 5JFRA 5E1ZB 4N9IA 3BWGA 4UVAA 3LFKA 1Z6TA 3F23A 1O3TA 3R60A 5H6RA 1FT9A 4LLNA 1F4KA 4JK1X 1HKQA 2MH2A 4U7DA 3DP7A 4AWXB 3PQJA 3VOEA 5K5OA 1KU9A 1R5GA 2G7UA 1QGPA 1ZLKA 2EK5A 1FOKA 2A6EF 4UXNA 4EJUA 2CWEA 2R7FA 2X4HA 3E5XA 3WGIA 1SMTA 5DYMA 2LNBA 2MBFA 4S04A 3WTYC 1SFUA 2A68F 5E20A 4A5NA 5ILSA 4U0WA 4XRFA 5ICCA 4EQQA 4CGZA 1T39A 4BHPA 5FLXK 2P7CB 2BYVE 4HDUA 1B9NA 3FF5A 4HYEA 1OR7A 1OPCA 1R1TA 2QQ9A 1O7LA 3LAJA 1HW2A 4LD5A 2XKPA 1XB4A 1XN7A 1NHAA 1J2XA 2G9WA 4L9TA 3IRQA 2XUBA 4LMYA 2IJLA 3KP7A 4R1HA 3WE3A 1FZPB 2A5YB 4IPAA 4A6DA 4XLPF 2K4BA 3R6SA 2IA1A 2RGVA 4WCGA 5E1XA 2CQKA 1D8JA 2M30A 1IAWA 3KLNA 3GLXA 1V4RA 3KEQA 4YFKF 1QZZA 2Y75A 1LQ1A 2V79A 1A04A 3J7AO 2O3FA 3GZ6A 1KU2A 1D8KA 4EM0B 1BI1A 3BPVA 4MTDA 5J8FA 1SAXA 4EM2A 3DKWA 4KMUX 2EV6A 4CICA 4ZZLA 5FB2A 2VC1A 2QBYA 1FSHA 5JI6A 3V7SA 4S05A 2HS5A 3F8FA 3TKYA 1BM9A 3KEOA 2QVOA 3KZZA 5E8IA 2GZWA 4UVCA 4GO1A 4L5JA 4I01A 2P6TA 1R1UA 2XAGA 3QOPA 1J75A 3LQRA 1ON2A 3T0YA 4RGRA 4WF2A 2ZCWA 2FBKA 4BQAA 4HBLA 2XAHA 2P7VB 4I7HA 1QQIA 2M45A 4M9SA 1G4DA 1HKTA 4EVIA 5DUKA 3WTSC 2GAUA 3SXYA 2IP2A 2UXNA 1CF7B 1J0RA 4UV9A 3K1MA 4LFUA 4HQEA 2EFNA 3CDHA 2OAZA 1ZGJA 6PAXA 1KQ0A 3MEXA 3S2WA 2QZ8A 1CGPA 4LG0B 1LDDA 1KYZA 2HYFA 3F72A 2V1UA 2VT2A 2DFIA 4EMSA 1LB2A 2WV0A 4KIFA 2PI0A 1I27A 3WG9A 2VBYA 3E6DA 5JVTA 3JTHA 2M5WA 1IXSB 1YS6A 2P5KA 1OYYA 1KQ9A 1F9NA 4LK0F 1I6XA 3FXQA 3HHHA 4MEXF 3TOBA 5LBQA 2VBWA 1Z91A 1ZH5A 1BBYA 4YFXF 2P8TA 3Q9VA 2ISYA 1F1ZA 5D5UB 4IRIA 4M9ZA 2QBYB 1S8NA 1WI9A 1FBUA 3O2PE 4I09A 5HS7A 5HS9A 5DDGA 2MA3A 3T1BA 4EGYA 3H3UA 5F64A 5JHUA 2FF4A 1PUEE 4OIQF 1ZRFA 3KP5A 1L0OC 1W5SA 1XMAA 4L5IA 3BJAA 4BAYA 1K79A 3QU6A 4RAYA 1G3SA 5HLIA 3K1PA 3KLOA 4LB6B 3T5XA 4OIPF 1SD6A 4HLXA 1BC7C 4Y15A 4Q47A 1FYKA 4E70A 4M72A 1V3FA 4LLGF 4CYDA 2L02A 5FD6A 1KA8A 4M9XA 1FSEA 3KE2A 3FZVA 2TDXA 1Z6RA 2XAFA 2D2WA 5LRSA 1XDSA 1USTA 1BI3A 2OU2A 1ZREA 2STWA 3I64A 2K02A 3I54A 1STZA 3C18A 1MJ9A 1EH6A 4MTEA 4BNCA 2CSOA 2EFOA 1P4WA 5BS6A 3MZHA 4L9JA 5LGUA 4XSZF 2RKHA 4HQMA 2NAZA 5BPDA 3GF2A 2VE9A 1XDUA 5D5XB 1IN7A 2EFPA 2K7LA 3ZN1A 2XIGA 1YW9A 5HLHA 3U2RA 2HTSA 4PGGA 2V9VA 5CVRA 1XGSA 4G7HF 2A3SA 4WX9A 3FM3A 3I0TA 2HQNA 4U0YA 2OZUA 1FNNA 4CHUA 1P4XA 3WU1B 2RDPA 2OD5A 2JZYA 1B4AA 2HTJA 3MWMA 4A0XA 1FYLA 1IN4A 2WC2A 3DV8A 2VBXA 5DCFA 3AAFA 1Y0UA 5A2QZ 3GFMA 3KFWX 3C1DA 4P9FA 3KETA 3SHFA 2VXZA 2BE5F 3V8KA 2EV5A 4P55A 1RUOA 3OV8A 4OIOF 2FOKA 2HWVA 5LGTA 1Q1HA 2ELHA 4ESJA 1QO0D 1JHHA 1HSTA 5DEQA 4M6YA 3FM5A 4IHSA 1LVAA 1FP1D 1W7PA 1FP2A 1S29A 5CVJA 1C0WA 2IVMA 4ZYEA 2NNYA 1QPMA 3JTGA 3HRUA 2W24A 3HRSA 4GYGA 3LA3A 4IHTA 2K4JA 1T2KA 4FT8A 4HV5A 5CVVA 3E6CC 2A61A 2VC0A 4KN7X 1LEBA 3U9GA 1BJAA 4KYWA 2D45A 4L0YB 2HKOA 1UHMA 3J81Z 3RJPA 1TW3A 1G3TA 5L3GA 4KNYA 1UB9A 5CVIA 2MLGA 2W85A 2L3DA 4YIFA 5ICGA 1FPQA 2P4WA 4ENJA 3C3WA 2EA4A 3ABTA 3JSOA 3PQKA 1B1BA 3J80K 1E2XA 4ESBA 1AOYA 2FU4A 1U6GA 3I53A 1YFHA 5F1RA 5IT9Z 3WTUC 1O7FA 4MQ9F 1H9GA 3FXUA 1YS7A 2LKPA 4KMFA 3GXOA 2XHKA 3ZMDA 4MEYF 4WK8F 2LF8A 1LDKB 2PJPA 1GHCA 4RB0A 3COAC 2HEOA 3B73A 5LEKA 1P4AA 4N0BA 5HS8A 5DCMB 3IKTA 1HSJA 2XGXA 5BMZA 2QWWA 2EFQA 1CF7A 2XRNA 2XV4S 3P9IA 2Q8KA 3M8FA 1IN8A 1R5HA 3QPTA 1XGNA 2C6YA 3K69A 3BJOA 2LF7A 4LG0A 1OMIA 2VE8A 5DV5A 4ENNA 3GW2A 1T6SA 3GEZA 2VOOA 4G6DA 3EQLF 1DPUA 1MDMB 3RKYA 5LGNA 2KRFA 1R7JA 2ISZA 2EV0A 2H6CA 3KP4A 1W7PB 1BN5A 3KCCA 2ZXJA 4RB2C 2Q2EA 1HW1A 2K86A 5D8KB 5D4RA 1FBQA 3SZPA 2IT0A 1ZHFA 5CJ9A 1U78A 3ZP5A 5ICEA 1P6RA 2JSCA 4PCQA 4LLLA 3G73A 4M73A 2E7WA 5CYVA 1RUNA 2XVCA 3IKVA 2FQ3A 2ACJA 1L3LA 1S6LA 1WWXA 2Y0MA 3V7CA 2M1BA 2GA2A 2G7HA 3ZMSA 3Q9SA 2XROA 1S7OA 3F3XA 1RNLA 3OOPA 3LA7A 2WWYA 2VBZA 5EEHA 4ENKA 2NS0A 2PMUA 1T98A 1XCBA 1PP7U 3V4GA 2FRHA 3E6BA 2HOEA 1R00A 4HW0A 2O6GE 4EJOA 2M8EA 2NNNA 2GXBA 3MCZA 2A6HF 3HIFA 1VTNC 4UUVA 5JR3A 3LQQA 4IVNA 1FWZA 4Z2YA 3WU0A 5L3EA 2GWRA 2FNPA 1ZN2A 1YYVA 5D6FA 3KP6A 2GA1A 1J59A 3QP6A 3TQNA 3P7NA 1P2FA 4FX4A 1B59A 1B6AA 4L9NA 2X0LA 2DK5A 4PZJA 2D1VA 2QUFA 3U1DA 2CGPA 1ON1A 1ZARA 3IWFA 4I02A 5FFZA 3MFKA 2FBIA 2E1CA 3DF8A 2EWNA 2KJCA 2BEOA 2HGCA 1BC8C 1KQ8A 1IRFA 5BQTA 1SFXA 2QQBA 5AONA 4IXAA 4I0AA 2IA0A 1GVJA 3B02A 1JHFA 2ZMEA 2L4MA 1ZRCA 1R23A 1K6OA 4PGHA 3EYIA 1KYWA 3FWEA 4WXHA 1TNSA 5E17F 2HZTA 2IA2A 1SFEA 1MKMA 2Z99A 1BI0A 3WE2A 2MLKA 2DPUA 3IWZA 3GUDA 3CUOA 4Y13A 2O8XA 2PEXA 1FC3A 4HX4A 5E8GA 4EGZA 2GIVA 2DT5A 4KFCA 2Z5UA 2Y48A 3F21A 4IJAA 1LJ9A 4CO8A 1ULYA 3F6OA 1MJAA 4OIRF 3BY6A 4QWQA 3FMQA 3CJNA 2CW0F 4KIGA 2R3SA 2OQRA 3HOSA 1P92A 1GXPA 1WSUA 4L18B 1U2WA 5AIPA 1QNTA 2HYGD 3IL2A 4BHBA 4HF2A 4EJTA 3LAPA 2IW5A 4IRHA 4OINF 4AD9A 1ZGAA 2J5PA 4D0PA 1TQIA 3RPUA 4I2OA 2YSRA 1H0MA 3TO6A 3TO7A 4MNUA 3HTUA 3I58A 4FHTA 2VONA 1W7PD 4P96A 1ZYRF 1EH7A 2DLLA 3NQOA 3QRFF 1DDNA 4XLNF 1HW5A 4R79A 3HHGA 1UHWA 2ADUA 2FA5A 3BZ6A 5IT3A 3T8RA 4GCVA 3KP3A 4R8HA 4H0EA 3VFZA 3PFIA 3JAMZ 2XAQA 1ZG5A 3DQVC 3ULQB 2HR3A 1H9TA 1S3JA 3SFZA 2A07F 4GXOA 3RYRA 3F8NA 3V7RA 1ONVA 2RC4A 2RV8A 3P9CA 5J8CA 4EJWA 3GYHX 2COMA 3M7GA 2EB7A 3HRMA 4WWCA 2R7DA 1TTYA 5ED4A 1JXSA 4M71A 4AIJA 3Q5FA 5HLGA 2W57A 2ZMEB 4ENMA 4BYYA 1TW2A 2PQ8A 1J5YA 3EUHA 5HVQC 1U3EM 3HTSB 4MQVA 3E3VA 4RAZA 1UFMA 5L3DA 2F2EA 2JTVA 4ZH4F 1BIAA 2FEZA 3E97A 2XAJA 5FGMA 1QZYA 3ROUA 2JPCA 4GYIA 2RNJA 4K2EA 1ZLJA 2STTA 1S7AA 3GX4X 2DK8A 1YLFA 3I5UA 3ZMVA 3VEPA 2V1XA 3O3KA 4ASNA 1O3RA 4QLCU 2GXGA 2D1HA 2JT1A 4HF0A 3W6KB 4RB3C 2CFXA 4KIBA 5D8LB 3WODF 3SZTA 3WTVC 3M8EA 5DCMA 2DTRA 2O0YA 3L09A 3RDIA 5DD8A 2EFWA 2MC3A 4L0ZB 3WGGA 3QPHA 4LB5A 2V1DA 4ON0A 5ICFA 3R0JA 5H6QA 3EYYA 1O3QA 2OZ6A 1HQCA 3J80Z 2O61A 1D3YA 3RIRA 5ILUA 3RTRA 1I5ZA 5L3FA 2E7XA 3ABUA 3CUQB 3QP5A 1MDMA 2XASA 3I59A 2QYOA 5DD4A 3CO7C 1XSVA 3G3ZA 3NRVA 3ZMUA 1W4MA 3CLOA 2V6CA 5FLXZ 1R58A 3E6MA 3IRRA 2B0LA 5D5VB 2ZFWA 2O03A 2KJBA 4BHCA 4Y17A 4HLYA 3R4KA 1IW7F 2ZJ2A 3H3ZA 2P5LC 1BIBA 4LGWA 4EV0A 2GQQA 4KUMA 4KT5C 1EV7A 4O3MA 3DPLC 2KIFA 2ZNZA 5K5RA 1J7KA 4GGGA 4NQWA 1K78B 2QLZA 5LLQA 4YG2F 1MZBA 3C7JA 5FFXA 1SD4A 2DO7A 4WXCA 2ESHA 5LRRA 3RKXA 5A2QK 3TDUC 4HX7A 2CG4A 1G3WA 5BPIA 3R0AA 1YQAA 3EETA 5E1WA 2W25A 4B8XA 4ZYGA 1BOAA 1DUXC 2DQLA 1U5TC 2DAOA 3REOA 3R61A 4ZYHA 4KA4A 3RKWA 1JE8A 3ML6A 4HOBA 5AIQA 2OBPA 2H27A 1G6NA 1YW8A 2AS5F 1F5TA 4IRGA 3L9FA 3MQ0A 2MD5A 3JSPA 5HDGA 4OMZA 4OOIA 3TGNA 2FBHA 1I1GA 4RGXA 1WRJA 3FMSA 1RI7A 3ELKA 2RVCA 2HQRA 2IPQX 3ZMZA 4UV8A 4YIIA 1OYWA 1FYMA 3ECOA 2IRFG 1SMYF 2RN7A 3I59B 3LWFA 4HV6A 3VB2A 4YFNF 4KICA 2L4AA 3J81K 3M1EA 4AIHA 2NYXA 1HBXG 2WTEA 3GWZA 3IHUA 1XMKA 1OYIA 2FMYA 1R36A 5CVUA 1XGOA 1ZRDA 3MZYA 2VODA 3ZMTA 3N4MA 2Q0OA 3GZ5A 2UZKA 2VOPA 3HRTA 2QM3A 3ZQ7A 1Z9CA 3CO6C 1HXDA 3WTTC 3CUQC 1IXRC 1LDJA 3RI4A 4AVPA 4I0BA 2QENA 2UXXA 5IT9K 1BI2A 2E1NA 2AXLA 5EEGA 1SD5A
chains in the Genus database with same CATH superfamily
2FQ4A 2FSWA 3GFIA 2HDWA 3D0SA 2P5VA 4L9VA 3WTZA 4M3FA 1TT0A 4IHVA 1TLHB 2FXAA 4A3KJ 2BV6A 3S2DJ 2F5FA 1MW7A 2F5EA 4U88A 5FRMA 3MHHC 1O57A 1OKRA 2UUBE 2LDUA 2W84A 5E18F 2DSYA 4QPQA 1G3YA 2IAIA 5LL6R 2DGCA 3ABLH 4UNOA 1REPC 4RB1A 2VUMJ 3CJQB 2EBIA 5A2QC 5F6FA 4HZFA 1ETVA 4HAMA 4ESFA 1WFXA 4U0VA 2Z3YA 3VODA 2Y9YA 2CSHA 1TQPA 3K0LA 2KT0A 5GTHC 3FHZA 5TRDA 3L00A 3LSMA 5FD5A 4PDKA 1RIOH 2EORA 2YR2A 5IP9J 3W2VA 5IP6A 3CJRB 2K4VA 2L2OA 5LMUE 4PFOA 4B3XA 2BZTA 5KVRA 2IGMA 3W6JB 3BJ6A 1A6QA 2Y30A 4M74A 1IJWC 4F52A 4A93J 1RKTA 1TWAJ 2DQRA 4RLFA 2X6YA 5ERIA 5EGOA 2KQRA 2ETHA 2EN2A 3DF6A 3BTJA 1ACIA 3EPJA 5LD2C 3T8TA 3D5LA 4R2QA 2WBSA 3ERED 4WXDA 1VQ5I 1I1SA 1H89C 1KU3A 1W5TA 2DW4A 4Y52J 1GXQA 3F6VA 1DPRA 2XF5A 4UVBA 1XGMA 2EQRA 3GVAA 1D0YA 1YTYA 4A0ZA 2YU3A 3IWCA 2L54A 1BL0A 1MEYC 3DPTA 3SZGA 4DR7E 1XSDA 1FBSA 3JW4A 5J1RA 1KU7A 2YZTA 5LHHA 5LEJA 1AWCA 5L3CA 2ZKZA 2EZ6A 1Z3XA 3PSIA 2HVSA 2VLAA 2DODA 3FMRA 5BOXA 1U5TA 1B72A 2WY8Q 3BDDA 2X9DA 3RPQA 3ZQLA 5B1BH 4ETSA 3P5JA 3ZQGA 3CLQA 3BG9A 1QU6A 2EPPA 4DR1E 3ZQFA 1P7IA 4BL0B 2CPNA 5AASA 3LSHA 2EL4A 4QTRA 1DQ3A 1QZEA 3FIWA 1B9MA 2HDCA 1XSXA 2HXOA 5FLVA 2NRAC 3K4MA 3OS2A 3P9KA 2VB6A 3J81C 2CUZA 2EZLA 1OCRH 5CPRB 4I98B 3DFGA 1T0FC 3NWSA 3T1HE 4OWRB 4HX8A 1ORKA 1F36A 2HJJA 4QIWN 4HPQA 4XIDA 1EH8A 4G9YA 4DMIA 1IUYA 2YTIA 2EN1A 4DR2E 2J5OA 4CCJA 4BY1J 2K27A 2Y9ZA 5B5EC 3ECRA 2NOGA 2H8RA 1Z05A 2K9QA 3NEUA 2EJRA 4JQFA 3WTWC 1YJ9I 5TJJA 4LFCE 2X1DA 3L7WA 2M87A 2EIKH 3QYFA 4BBSJ 1NK3P 5ILVA 3TOAA 3E5QA 3OR1C 4B3TE 3GO5A 5IPAA 4A3BJ 2DLQA 2PJRB 1IN5A 2IEKA 2EL6A 1HR0E 1IN6A 3JCUC 1K7AA 3H92A 2HI3A 3OSGA 2CQ7A 2HFHA 1D5VA 4AIDA 1YIOA 3TO9A 3HG9A 2EMGA 2ZO4A 1XD7A 3IAM2 4EM1A 3VYRB 1ZG3A 2H36X 1WXRA 3GFLA 1T38A 3W2AA 1LFPA 1ZAOA 2WV1A 2PLYA 4DOZA 4UY8I 2VN2A 1IDZA 4LOCA 4RLQA 1NCSA 2M1SA 4IOCF 1BW5A 2ODRC 5D6EA 4A12A 1MNMC 2ENAA 4Q48A 4FX0A 1J9IA 3CZ6A 4P5OA 3RCOA 4A69C 2M7QA 2BBYA 1IXCA 3ZPLA 4N9HA 4KN4X 3HSRA 3K4KA 1S9HA 3DEUA 3E7LA 5KK1A 3SQNA 1QA6A 1X1CA 1TF3A 4XBFA 2F5CA 3CESA 2MKNA 3SFIA 4P9UA 5CLSA 4JI7E 3I4PA 5IYCJ 2WAQA 4HDVA 5EG0B 4RH8A 2BGCA 2ZNYA 4HA8A 3K2ZA 3OIOA 2KDZA 1FX7A 2EMXA 3QAHA 4AIKA 3CCRI 5HDNA 4TV7A 1PDNC 4OMYA 3M9AA 3GTMJ 2PMHA 5C3EJ 4A0YA 2MC6A 1WJAA 2CT1A 1XNQE 1X58A 2JPBA 3BQYA 3CUQA 1FLIA 4TUGA 1JKRC 1WKMA 3HSFA 4O5VA 1YO5C 1R71A 3HYIA 4BE2A 1SANA 1A35A 4EATA 2ELJA 4X1EA 3ERMA 4B09A 5K1YA 5LHGA 3LLHA 5GPAA 3MHSC 1X3UA 2IXSA 2PFBA 1UCRA 4XLFA 4BXFA 4HF1A 1XNRE 2DN0A 5HOOA 4A3JJ 5J1YA 2MH9A 3QOEA 3MD2A 2GHFA 4Q28A 5IV8B 5KL4A 2VT3A 3BP8A 1RZ4A 1IV6A 3RQ4A 2Z9OA 4PUSA 2L3JA 1EF4A 2YX7A 2K9LA 3HOTA 2EA2A 2QSFX 2RQPA 4CDGA 1QBJA 4LF8E 4O6JA 5FROA 4XLCA 5L3BA 4KHPE 1P9QC 1GV2A 1Z1DA 4LFAE 1USSA 1EA3A 2ESNA 2CYYA 4JBAA 2X1CA 4DW6A 2WADA 2H09A 2Y0SN 4JOMA 3TDZC 4KDPA 1B8IA 4CCMA 4BH9A 2F5DA 3F22A 3GFJA 2HNHA 1B72B 1U5TB 4MHGA 2R7RA 2VPRA 4LK1F 3W2WA 4D1QA 1I3AA 1HKSA 1YW7A 4BKXA 2FNAA 2LR8A 1T4LB 1U8BA 4XOPA 1O3SA 3I71A 4D5FA 2MABA 2LJHA 2MC5A 4D7MA 3HKZN 2BW3A 2VRDA 1R9TJ 2E35A 3DBRB 2JMWA 3F8MA 2EZHA 4F7ZA 1K78A 2L01A 3BCBA 3ECHA 3H36A 3S3MA 2EMLA 4MGRA 4BE1A 4OU0A 3QU3A 3CTAA 1OFCX 3CCVI 1SD7A 2JJ7A 3N97A 1D1BA 4DUZE 3LA2A 3H09A 2DI3A 3F8CA 3S16J 5K5QA 1IF1A 1JGSA 2E72A 3HSEA 1JKQC 5HDKA 2GLOA 3DLAA 5FO5A 4A6EA 2XAUA 2JRTA 1FY7A 2FMLA 3IH3A 3L2CA 4OAYA 4A5MA 4GKKE 4G8XA 3DXJF 1IMUA 4XKWA 3WGHA 2XKOA 1OR7C 3VWBA 1ODDA 2JK3A 2Y69H 4G94A 4DYCA 4BE0A 1WJ5A 1PJQA 2HKXA 3TBIA 1YG2A 1R22A 3RKQA 4E6KG 5C4XJ 1ITYA 1OCPA 2FV4B 1LEAA 3BOQA 2EPNA 3JTZA 2KKOA 4M2ZA 5LHIA 1TNTA 1S72I 1Q1VA 1N77A 1IRZA 2H6BA 2IS4A 1IRGA 2PN6A 3A0BC 1JUSA 2AXTC 1P47A 2CO5A 1LKXA 3AG1H 3C6MA 1MNDA 3A03A 3EQ1A 2W4SA 2XB0X 4NHJA 3VSKA 4NZVA 1A1FA 1KONA 2NVYJ 4NB5A 4IF4A 1WQ2A 3FIGA 1E17A 3MAJA 4XSXF 2YTGA 2X6WA 5BR8E 3I55I 3ISPA 4X8WA 2H8WA 1Z7UA 3JAMK 1PP8F 2EM4A 2JWOA 2PX9A 2VQGA 1N78A 2W7NA 1TWGJ 3FX3A 1T0FA 1X3WB 4KITB 3EPLA 2M4KA 2LC2A 3I4NJ 2F48A 2L2KB 2H94A 3OYGA 1GDTA 2KHMA 4UB8C 1SVLA 3HUGA 4DQ2A 1BR4A 3UNGC 4EJVA 5GAGJ 4E7HA 4DV1E 4M6XA 3K6QA 2ZBKA 3ZN0A 3O8HA 1H88C 2YRHA 3Q0WA 2L2MA 2DBBA 1MJBA 2OA4A 2YPRA 3KP2A 4RGUA 5H20A 1BA5A 2F8BA 2EMCA 2VQEE 2CUEA 5D5WB 5KCMA 4F6NA 1BBOA 3RYPA 2RS6A 1DP7P 4CZCA 4WSPA 4R2SA 4GFBA 2YX4A 1YYOA 3VK6A 3K70C 4DNCA 4GRIA 1IDYA 2LBFA 5A6AA 4YHHE 3A01A 4UUSA 3I9V2 4MFDA 3VYUB 2FE3A 1MD0A 4CXFA 3K9TA 1H8AC 4XMYA 1D0ZA 3SJMA 3AG4H 3EDPA 1LNWA 1BB8A 4Q5SF 4LJZF 1KGSA 2DU9A 1R1VA 2GOMA 1DU6A 4FTHA 3K1NA 1TQMA 4A3LJ 5M3FJ 2EPUA 3HPZA 2R5ZA 3A1YA 2J7JA 4F9AB 3BPXA 3V8JA 3JRBA 5ADZA 4R03A 1OCTC 5DUIA 2OQGA 1U8RA 2HGHA 3V8LA 4ZZDA 4PJNA 2Z33A 2XRLA 5J6XA 4G7OF 2PBIA 2YU8A 2KIUA 2H1LA 2ZXWH 3BROA 2DMPA 3WTXC 1LPQA 4RS8A 3BBGA 1YUIA 2EMHA 3VDXA 1HC8A 1IZ1A 3H35A 3OYBA 1E3OC 2PMZN 4BUPA 4LF6E 1MGTA 4F93B 5DNYA 2PG4A 4LTYA 3O6BB 2LSOA 2KIMA 1ZTRA 5IYDJ 1ZG1A 1GQEA 3FHNA 2CJJA 3KZYA 4U7BA 3IWDA 1VI0A 4Q4ZF 2A69F 3FXRA 2KZGA 5D4SA 3IC7A 1Y39A 4JI5E 2EPXA 1TBXA 3OOUA 2EM5A 4ZYDA 4RGSA 3CCYA 3OL4A 1ZGWA 1HA8A 3LSTA 3F8BA 2KRHA 4CZZA 2BW3B 3GTGJ 2QQAA 2X1EA 2XSJC 2Z1DA 4UHTA 1MBKA 2UWMA 4WFTA 3E5UA 4G7ZF 2DA3A 5B66C 4A2UA 2P6SA 2DPDA 4DBQA 1XCVA 2M3AA 4BXUA 4JI2E 4PK4A 4G6QA 5JFRA 2DA5A 5E1ZB 2A25A 4N9IA 1A1JA 3BWGA 4UVAA 2YTDA 3LFKA 5B3SH 1Z6TA 5DM6F 3F23A 4JYKA 1O3TA 3R60A 5H6RA 4AM3A 3NARA 3DKXA 3UKGA 2EE8A 1FMWA 4R2DA 1E3PA 3J7ZI 1FT9A 1FJGE 1B69A 5HNHA 4LLNA 3KWRA 1BOBA 1F4KA 2K7IA 1DQUA 4JK1X 2B3TB 5GP9A 1HKQA 2QSHX 3Q0UA 2YTQA 2M0CA 2MH2A 2YU5A 4U7DA 3DP7A 4AWXB 3KYLA 3HXLA 3JRDA 1L4SA 3PQJA 3VOEA 4BQOA 4V19K 4J00A 4BACA 1FIPA 3QPLA 2ZM6E 3LSKA 5K5OA 2XPWA 3S2HJ 1IRXA 1D0XA 1KU9A 1R5GA 2G7UA 2CRGA 1QGPA 2FJ1A 1VQMI 1J09A 1D1CA 1ZLKA 2EK5A 5J4YA 1FOKA 3J7AG 2A6EF 3VPRA 4UXNA 2NS7A 4EJUA 1X49A 2CWEA 2R7FA 2X4HA 3E5XA 4YEJA 1SMTA 1TWHJ 5DYMA 2LNBA 2MBFA 3DWLE 3WGIA 5J1UA 2LKXA 1UILA 3F6HA 2R92J 4S04A 4IQ4A 3CF2A 2R7WA 2GXAA 3HJEA 4OAZA 2LT7A 2HPMA 3WTYC 1OCZH 3RSNA 1SFUA 2A68F 5E20A 4A5NA 1DGCA 2KISA 5ILSA 4U0WA 4XRFA 3BTIA 5ICCA 3HTXA 4EQQA 4CGZA 4NDLA 1T39A 4BHPA 2ZJQF 5FLXK 1RR7A 2P7CB 2N8XA 1WJCA 3JAMC 2BYVE 1X2NA 4XM3A 3VYTB 4HDUA 1B9NA 1BR1A 1YI2I 2VE7C 3I3LA 3FF5A 4HYEA 1OR7A 3TMOA 1OPCA 2MW8A 4XKCA 1R1TA 4AQYE 4N4OB 2UU9E 2QQ9A 3BCAA 2ENHA 2YRMA 3A0HC 2Y2ZA 2YT4A 1O7LA 2LTPA 3CCLI 2WAEA 3LAJA 1BW6A 1HW2A 2ZJRF 1NG7A 2R4GA 3FK7A 2WBMA 2DYSH 2LBFB 1APLC 1SVOA 2GIZA 1IBLE 4LD5A 1ETKA 1XB4A 2XKPA 1XN7A 1NHAA 1J2XA 2JA8J 3CDLA 1R4NB 2G9WA 4L9TA 2R5YA 2ME0A 2BVMA 3IRQA 1DU0A 2RQLA 2VKHA 1UN6B 2XUBA 2OCCH 4LMYA 2IJLA 1WCMJ 3KP7A 4R1HA 2X6OA 2YWQA 3C4TA 1WH7A 2K9MA 3WE3A 1FZPB 1N36E 4B44A 1DP3A 1MIJA 2A5YB 3HPHA 4IPAA 2VQHA 2ZXHA 4A6DA 4XLPF 2KFDA 2K4BA 1K61A 3VYYA 3R6SA 5GAHJ 2XGEA 3OYMA 2IA1A 9ANTA 2VF1A 2A5WA 4MO7A 2MFZA 2RGVA 4WCGA 5E1XA 2CQKA 4R2AA 3F6GA 1D8JA 2Q8UA 2EMYA 2M30A 3U21A 1MBGA 1IAWA 3KLNA 1N25A 3RQIA 3L2WA 4XK4A 3GLXA 1V4RA 2DLKA 2PJRA 2LRSA 1ETQA 3KEQA 4YFKF 2A6TA 3AUZA 1QZZA 2Y75A 3G4SI 2RREA 1LQ1A 2V79A 3PO3J 2ZXIA 4M30A 1A04A 2LK2A 3J7AO 2O3FA 4WPYA 2TRTA 4BQNA 3JU0A 5GPCA 1IBME 5EF6A 3GZ6A 1KU2A 5DS9A 2MD0A 5AC5A 2RQQA 1D8KA 4EM0B 1PKPA 2BOLA 1BI1A 3BPVA 4MTDA 4DV7E 3FKJA 5J8FA 1SAXA 4EM2A 1WVRA 5CQEA 1PVEA 3DKWA 1JKPC 3MKLA 4KMUX 1ZR2A 3DEEA 2EV6A 4CICA 4ZZLA 5FB2A 3S32A 4LG3A 2VC1A 2QBYA 2OPTA 2VQFE 2ELZA 1FSHA 1UZCA 2DA1A 5JI6A 1ZBTA 2EPMX 3IP4B 1X1BA 2L7ZA 5EYRA 5EG0A 1IGNA 1N33E 3V7SA 3FXLA 1TF6A 2VQCA 3PL8A 1SFOJ 4S05A 5AE2A 2HS5A 2QQ8A 4BDYA 1UG0A 3F8FA 4KWYA 2UXCE 3TL4X 4BU2A 5AE3A 3BIDA 2BHZA 3TKYA 4CA0A 1A6IA 2L3CA 1BM9A 3KEOA 5F0FA 4OOGC 1A1IA 3PJRA 1YSAC 2QVOA 5FKNA 2M4GA 3KZZA 2EIJH 2CQNA 3TW6A 3JRFA 2CH0A 4FCYA 1YIJI 2EOFA 5E8IA 1POGA 2GZWA 4UVCA 4ZJZA 2HOAA 5KL5A 4GO1A 4DBRA 4L5JA 4I01A 2P6TA 1R1UA 2E36A 4AVZA 2XAGA 3L2VA 3H0DA 1DI2A 3QOPA 1J75A 2L92A 1X6EA 3LQRA 1ON2A 4RMNA 3T0YA 3S3NA 4RGRA 4DYRA 2ME6A 2CW8A 2ZCWA 2FBKA 4WF2A 3ZGKA 4BQAA 4HBLA 2XAHA 2P7VB 2EOEA 4N4RB 1V5GA 3QODA 4I7HA 3GBGA 4HEIA 2UXBE 4HSRA 5H2FC 5A6JA 2EN7A 2L7KA 3GLLA 1QQIA 2LTSA 4PSWA 3EPZA 3GTJJ 3EPHA 1G59A 2M45A 3KZIC 1VQ8I 4M9SA 2LFBA 1RKWA 1G4DA 2JOBA 3HOWJ 1HKTA 2YTOA 2HZDA 4EVIA 3BQZA 2YUSA 2YTEA 5DUKA 3BF2A 3WTSC 5FLXC 2GAUA 2EJ4A 3SXYA 2IP2A 2EOZA 2UXNA 1R49A 1CF7B 5J3LA 1J0RA 4UV9A 3O8GA 3K1MA 4LFUA 2NVQJ 4HQEA 2EFNA 3CDHA 4MLOA 4IHWA 2OAZA 2MG4A 1ZGJA 4BJ5C 6PAXA 1KQ0A 3EUKL 2BXZA 4UB6C 1A5JA 3MEXA 3ZRGA 2I5UA 4NUBA 1VQ6I 2NXNB 3S2WA 3AL0C 2QZ8A 4N4NB 2MYSA 1CGPA 4RAFA 3RZOJ 1TZLA 3BG7A 4LG0B 3FDYA 1YYKA 2UUZA 1LDDA 2COBA 2R5YB 1KYZA 2DMUA 2HYFA 3G6EI 3F72A 3EPKA 2V1UA 2VT2A 2DFIA 2M2EA 4ZDPA 4DZJA 4C2TA 4EMSA 3K6GA 2K85A 4DV0E 2EL5A 1LB2A 1FKAE 2WV0A 4KIFA 1I3QJ 2CV1A 2PI0A 2V6EA 1I27A 2DOEA 4DUYE 4LIUA 4XL9A 4F2JC 1MSEC 3LMMA 4CSWA 3DJWA 4AU7A 3WG9A 1TWFJ 3ZQQA 1UAAA 2VBYA 4X64E 3E6DA 5JVTA 3JTHA 3H9QA 3JRAA 2M5WA 3KPHA 1IXSB 2K5CA 1AU7A 1Z1BA 4F9BB 2R7VA 1YS6A 2P5KA 1OYYA 2WCC3 1KQ9A 1F9NA 1HNWE 2EOOA 4KISA 4DZPA 1ZR4A 4LK0F 4KT6A 2M0MA 1I6XA 3FXQA 3HHHA 4MEXF 3TOBA 5LBQA 1FJLA 4DR6E 2VBWA 2M4IA 2YTJA 1VQNI 1Z91A 1ZH5A 1BBYA 1HNZE 4YFXF 4KZSA 2P8TA 2AQFA 3Q9VA 4ANJA 5IT9C 2ISYA 1F1ZA 2VI6A 3KIOA 2E2HJ 5D5UB 5A6BA 1J5EE 1FMVA 4IRIA 4A3CJ 4M9ZA 4DR4E 2QBYB 1S8NA 1WI9A 1FBUA 3O2PE 4I09A 5HS7A 5HS9A 2EQ0A 1YYWA 3T1YE 5DDGA 1JTXA 2MA3A 1O4XA 2R7XA 1GVDA 4CCLA 2O8KA 1NH3A 2EPRA 3T1BA 1U0JA 3CC2I 4EGYA 2I8DA 2I10A 3H3UA 1N75A 5F64A 2EMZA 5JHUA 3KX2A 2BY2A 2HYJA 2FF4A 1PUEE 4HSTA 5B1AH 4OIQF 1ZRFA 2VL8A 3KP5A 1BBGA 2ODRD 1L0OC 2L9SA 1W5SA 2QA4I 1XMAA 2L9VA 4L5IA 3BJAA 3TP0A 4BAYA 1QHGA 1K79A 5F0CA 3QU6A 2QKLB 4RAYA 1G3SA 4O4KA 5HLIA 1X6HA 1UJ8A 3K1PA 1JI8A 3OIPA 3KLOA 4LB6B 2NS8A 3T5XA 3DKYA 4OIPF 2XGCA 1BJZA 1SD6A 2GOXB 2E19A 4HLXA 1KJKA 4MIMA 4PJ0C 3CP8A 1BC7C 1IV8A 4Y15A 1PUFA 4Q47A 4HNUA 3DTIA 4JI1E 3H0GJ 1FYKA 4E70A 4M72A 1V3FA 2WY7Q 2GPIA 4LLGF 4MLVA 4CYDA 2L02A 2R1FA 5FD6A 1JUMA 4A3DJ 1KA8A 4M9XA 1EKZA 4DYQA 1FSEA 1X1DA 3F9KA 1QHHD 3FZVA 3KE2A 4JP0A 2TDXA 1WH5A 2R0QC 3ONQA 4BJTA 3ADGA 1Z6RA 5KL2A 4CCNA 3HL2A 3K4CA 3DTEA 2B7VA 2XAFA 5F27A 2JXPA 4RAGA 2YPNA 2D2WA 4DV5E 2KDOA 5LRSA 1XDSA 2NUEA 1TWCJ 3A02A 3SDBA 4M0VA 1USTA 1BI3A 2OU2A 1ZREA 1XX5A 1RR8C 2STWA 3AV0A 3I64A 2K02A 3I54A 2DJIA 1STZA 2E1MC 3HPGA 2NOJB 1QRYA 2DTZA 1MNEA 2VKEA 3C18A 3CDIA 2GM4A 3A2KA 5KL3A 2WB1A 4B3ME 1MJ9A 2OUMA 3BT9A 1EH6A 4MTEA 4BNCA 1Y0NA 2CSOA 2EFOA 4O5GA 2L9RA 4ZDOA 2BY1A 3GTPJ 1X3ZB 1P4WA 2IS1A 5BS6A 2GLIA 3MZHA 4WSGA 4L9JA 4IQJA 2ENCA 5LGUA 3M1CA 2DFFA 4XSZF 2RKHA 1W1WE 4BGDA 2QCOA 4HRIA 1UHZA 4HQMA 3OWTA 3CMEI 2NAZA 1WGXA 2EM3A 2NUFA 5BPDA 2LJUA 3GF2A 2VE9A 2B63J 1XS9A 2B9SA 3S1QJ 3PFYA 1GLNA 4A3EJ 1G8XA 2I9IA 1XDUA 1Z77A 5D5XB 4M3BA 1IN7A 2M9AA 4LF4E 4J01A 2EFPA 2CW7A 2K7LA 3ZN1A 3ZCOA 1O0WA 2XIGA 3LOCA 5JVGF 3K10A 1YW9A 5HLHA 3U2RA 2HTSA 1X4PA 4S0HB 4PGGA 2FX0A 2CUJA 2V9VA 3ZQCA 2MC4A 5E3LA 5CVRA 3BG5A 1XGSA 4G7HF 2NABA 4R2CA 3FK6A 5K7FA 2A3SA 4WX9A 3FM3A 1MBEA 2P81A 2HQNA 1V55H 2A05A 2OZUA 3I0TA 1RC9A 3HB9A 4U0YA 3CMYA 2LVHA 3ZOBA 1ZR9A 1FNNA 4CHUA 1F43A 2LCEA 5AC4A 3PIPF 2EPKX 1T95A 1VNDA 1P4XA 2UUAE 1MMNA 3E0JB 1JKOC 3WU1B 2X6XA 2RDPA 1OJLA 1X1PA 2OD5A 4NXME 2JZYA 2EMBA 1B4AA 2HTJA 1VQ4I 3MWMA 1YHQI 2FD5A 3J7Yp 3E1SA 1QVTA 4G6TB 3ABKH 2HQ5A 5IXMB 4A0XA 4AC0A 1FYLA 2XF7A 1IN4A 3HGYA 2WC2A 3CQZJ 2R7TA 2O7OA 2AQEA 3DV8A 1CQTA 2VBXA 5DCFA 2ID3A 1MH4A 1I50J 5KNLA 1Y0UA 3IUOA 4DIQA 3AAFA 5FKMA 5A2QZ 5LMNE 4Q35B 4YY3E 1U9OA 1IO2A 2KRCA 3I56I 3GFMA 5EZHA 3W6VA 3KFWX 2KLOA 2EIMH 2ECCA 3FISA 3C1DA 2QKMB 4P9FA 2E5ZA 3KETA 1Y1WJ 4F3QA 4A3FJ 5K7ZA 3SHFA 2VXZA 2BE5F 1XG1A 1Z7LA 2DA6A 2XF6A 3HZJA 1Y56A 3V8KA 2EV5A 3OYHA 2JSPA 4IO9F 4P55A 4F92B 1V5FA 2F4VE 1RUOA 1YUJA 3OV8A 3MSWA 4OIOF 1IQSA 2FOKA 3P1XA 5EJCA 2EZKA 2M7AA 1D1AA 1W36C 2HWVA 3TW7A 1PUFB 1A1GA 5LGTA 2EM8A 1LE8B 1LUJB 3U1KA 1Q1HA 2ELHA 3Q3SA 4ESJA 1QO0D 1UBDC 3WHBA 1JHHA 4Y4RA 3K4BA 2DYRH 1HSTA 1ZBQA 5DEQA 4M6YA 3FM5A 5J4VA 4IHSA 1LVAA 1FP1D 4C30A 2R7QA 3K70D 4L5NC 2LY9A 1I94E 3BR2A 2EMKA 1W7PA 3TEDA 3HOXJ 4P7DA 1FP2A 1S29A 5CVJA 1Y6IA 5IP7J 3ABMH 1C0WA 2IVMA 2E71A 2L9NA 2R7ZJ 2N3HA 1K4TA 4ZYEA 3OYFA 3L2UA 4LFBE 2NNYA 4XOTA 1QPMA 3JTGA 3K4NA 3J7AY 3CCJI 5GAEJ 5AE1A 2L5QA 3HRUA 2W24A 3HRSA 4GYGA 5F04A 3QWLA 3DEWA 3GMEA 3LA3A 4IHTA 2K4JA 1YX5A 1T2KA 5FLMJ 5E79C 2DXIA 2QF7A 4FT8A 3C2GA 1RPWA 3PUFA 4HV5A 5CVVA 5J40A 4I6ZA 3E6CC 3OY9A 2HPIA 5JHFA 1YOVB 2A61A 2VC0A 4KN7X 1TN9A 2EINH 3U9GA 4RBOA 1LEBA 1BJAA 1Y8RB 4KYWA 2D45A 4L0YB 2HKOA 1UHMA 1MMSA 3BZKA 4A3GJ 3J81Z 3M4OJ 3RJPA 1TW3A 2DT7B 1G3TA 2W48A 4HNTA 2XC7A 2YSOA 5L3GA 4KNYA 1UB9A 3WHCA 3DPUA 1P7JA 4Y3OA 2CV0A 3S3OA 2VJIA 3BR5A 4G12A 3G71I 1X3CA 4JX4A 3BR3A 4LF5E 3H5NA 5EEAA 3FXJA 2BVLA 5CVIA 4PSXA 3H5RA 3D5SC 1QU3A 2MLGA 2W85A 5M3MJ 2L3DA 3THNA 4I99C 3FKIJ 2FOWA 3JRGA 4YIFA 4DV6E 5C4JJ 5ICGA 4JI3E 4JX6A 2DA4A 1A1HA 1FPQA 4B4CA 4M3DA 3SYTA 5E3NA 5TGTA 1WJPA 2P4WA 4ENJA 3C3WA 4E7SA 3KYCB 2EA4A 2LD5A 1AKHB 2CFOA 4JI8E 1YJWI 3ABTA 1TT5B 3JSOA 2M7BA 3PQKA 2LP0A 1B1BA 3J80K 4BQQA 1E2XA 4ESBA 3HOZJ 1AOYA 2EOMA 2FU4A 3ZQHA 2Y31A 1U6GA 2E1MA 3B6CA 3BTCA 2V85A 4P78A 4YRVA 3I53A 1YFHA 4C3IJ 5F1RA 4J8ZA 3CCMI 3WTUC 1O7FA 4MQ9F 1H9GA 5IOZA 5IT9Z 3FXUA 1YS7A 1PJRA 2LKPA 2ZMEC 2WAQN 4KMFA 3GXOA 4HNVA 1XC5A 2XHKA 3ZMDA 2WA0A 4MEYF 4WK8F 2K3FA 2LKSA 1STUA 2LF8A 1LDKB 2OJED 4LITA 5F0HA 1EJ9A 2YSPA 3DBLB 3AG3H 5E3MA 2PJPA 1GHCA 5F3WA 4RB0A 2JRMA 4LF7E 3COAC 2HEOA 2JVHA 5KAIC 3S17J 1RRJA 3B73A 5LEKA 1P4AA 3FXKA 3FBIB 4N0BA 5HS8A 4F54A 1Z0XA 5DCMB 2OTJI 3IKTA 1N34E 4WYQB 1HSJA 2EPAA 1AH5A 5GADJ 4XLAA 2XGXA 3OR2C 4D7NA 2KOUA 1D5YA 5BMZA 2QWWA 1R4MB 2EFQA 1CF7A 2EWLA 3CJTB 2V89A 2WBUA 3JR9A 2XRNA 2XV4S 3P9IA 5BNGA 3HGGA 2Q8KA 3M8FA 1JGGA 5GTIC 3BG3A 4GKJE 1G2FC 1IN8A 1R5HA 3QPTA 1MH3A 3NWTA 1NTCA 2E1OA 4NHRA 4RHBB 1XGNA 1YZ9A 2C6YA 3K69A 3BG6A 2YU9J 4QSHA 2VKDA 2LF7A 3BJOA 3DCFA 4LG0A 2EOJA 1OMIA 2LVSA 2VE8A 5DV5A 4ENNA 1Y8QB 3GW2A 1X5WA 3S14J 1T6SA 4E7ZA 1AA7A 3GEZA 2VOOA 4H4KC 2R76A 4LIVA 4G6DA 3CCSI 3CCUI 2XGDA 1FEXA 2L7MP 3EQLF 2MKDA 4R8OA 1DPUA 2YTPA 1MDMB 3RKYA 3LMLA 4K0KE 5LGNA 4RA2A 2KRFA 1R7JA 1NEIA 4IZZA 4X62E 2ISZA 2EV0A 2H6CA 2Y0SA 3KP4A 5A69A 1W7PB 1BN5A 3JRHA 1FOXA 3CF5F 3KCCA 4U87A 2ZXJA 4RB2C 3CMMA 2F6CA 1ZKGA 5A6BD 4CH7A 2Q2EA 1HW1A 3KYDB 3OYNA 2HOSA 2O5RA 1X19A 1HDDC 2K86A 5D8KB 2V7FA 4F55A 1FBQA 1W5CC 2VJ5A 4M3EA 5D4RA 3SZPA 3JRIA 1WHNA 2IT0A 1RESA 1ZHFA 3C2BA 2LY1A 5CJ9A 1X1AA 4C3JJ 1U78A 3ZP5A 1HF0A 2IGKA 1WJBA 5ICEA 4NC6A 1P6RA 2EZIA 2JSCA 4PCQA 1FTTA 4LLLA 1VQKI 3G73A 4M73A 2FUG2 2E7WA 1WJEA 5CYVA 4L8NA 1RUNA 2XVCA 4Y7NJ 3IKVA 1V5EA 1WHUA 2FQ3A 3QQAA 2ACJA 1YPNA 1L3LA 1S6LA 2JWTA 2JA6J 4EEFG 3CC4I 1WWXA 1V54H 2JQ7A 3BC8A 2Y0MA 3V7CA 1MMDA 2LREA 2M1BA 2NVXJ 3BR6A 4XR6A 2GA2A 2LLKA 2G7HA 3ZMSA 3Q9SA 2XROA 3HDDA 2DOAA 1S7OA 3HOYJ 3F3XA 1RNLA 4GZNC 4X66E 3K2AA 3OOPA 3LA7A 4XLHA 2VBZA 4JX5A 5EEHA 4DJAA 2WWYA 4ENKA 1RC7A 2NS0A 2KMUA 4XKVA 2PMUA 1T98A 4FISA 3KEYA 5CQGA 4A3IJ 1Z67A 1XCBA 4NQWB 3V4GA 2FRHA 1PP7U 3S1NJ 3E6BA 2EH3A 2HOEA 2JVGA 1R00A 4HW0A 2O6GE 4EJOA 2M8EA 4JV5E 2NNNA 2GXBA 4BDZA 3MCZA 4BC7A 2A6HF 1ENHA 2LRDA 3HIFA 4CYCA 1VTNC 4UUVA 2JP9A 4XRSA 3LQQA 4IVNA 4Z2YA 1FWZA 3WU0A 5JR3A 5L3EA 1T8IA 2GWRA 1X2MA 4FQGA 2DMQA 2FNPA 1ZN2A 1VZ0A 1YYVA 2LMDA 5D6FA 3CC7I 3H3VK 2E1MB 5HODA 3KP6A 4XNFA 4IJDA 5JLWA 2LG4A 4BBRJ 3J80C 4PFPA 5M5XJ 4IOAF 2GA1A 1J59A 3QP6A 3A4CA 3TQNA 3P7NA 1P2FA 1NG6A 1B59A 4FX4A 1MSFC 2M8GX 1B6AA 2W1OA 1MBHA 2EQ3A 4L9NA 5KL7A 2X0LA 2RTXA 2D5VA 3EUHC 2DK5A 2E34A 2VPLA 2EOHA 4A3MJ 4PZJA 3X2QH 1JTYA 3AL0B 2D1VA 2QUFA 3SEZA 3U1DA 2CGPA 1ON1A 1GUUA 5M5WJ 4B43A 2YS9A 5DTDA 1ZARA 3IWFA 4I02A 4CCKA 4XONA 4RDUA 2JA5J 2Q1ZB 5FFZA 3MFKA 1VQ9I 2FBIA 2KP6A 2E1CA 4RM3A 3DF8A 3GTKJ 1IC8A 2EWNA 2I13A 4YIRX 4GEQB 2KJCA 2BEOA 2HGCA 4RM2A 1G2HA 4E7KA 1BC8C 1Z3YA 3K7AJ 1KYQA 1KQ8A 2OF7A 1IG7A 1DGWY 1IRFA 1VF9A 3BR1A 5BQTA 3V42A 4II3A 2KIQA 1SFXA 2QQBA 4B1RA 1WJDA 5AONA 2LUQA 4IXAA 4I0AA 3VHTB 3ASOH 3I4MJ 2IA0A 1GVJA 2CQQA 2F5VA 3B02A 4E4HA 1JHFA 3IH2A 2ZMEA 1UHSA 2L4MA 1ZRCA 1R23A 1K6OA 4PGHA 4AYBA 1KYWA 3FWEA 3EYIA 4WXHA 1TNSA 3PIOF 4UUTA 4PJLA 4BEHB 3PNYA 2HZTA 5E17F 3GZNB 2IA2A 1SFEA 3GTQJ 1MKMA 2Z99A 1BI0A 4C3HJ 2JA7J 3HBLA 3WE2A 2ZB9A 2DT6A 2EM2A 2MLKA 4ZYAA 2DPUA 3IWZA 3GUDA 3CUOA 2PMZA 4Y13A 3ADIA 2O8XA 2PEXA 2XDVA 1FC3A 4HX4A 5E8GA 4ZTJA 1XTAA 3MVPA 2IHR1 2LUPB 4M6VA 2FTXB 3QPSA 2NA2A 2M9HA 2Q2EB 2XPUA 2GIVA 4EGZA 1QPIA 3ZOQB 2DT5A 4KFCA 2LTRA 3ZQIA 4AUXA 1UMQA 2Z5UA 2Y48A 3F21A 3OYLA 2X48A 4IJAA 1LJ9A 5A6KA 3HC7A 3PUBA 4CO8A 1ULYA 5CKTA 1A36A 3F6OA 5IYBJ 2H1KA 1MJAA 5HNFA 1T56A 3LSJA 2CV2A 1GTKA 4TUIA 4OIRF 3BY6A 4QWQA 3FMQA 2EPOA 1S7EA 2NVTJ 2MDRA 4BCAA 1XMQE 3CJNA 1WPKA 2CW0F 4IEJA 1A31A 4KIGA 2R3SA 2OQRA 3HOSA 4XICA 2BHYA 5F1JA 3DLLF 1P92A 2LE2A 4GDFA 2RSIA 2HVQA 2KL4A 1KZHA 3DBHB 1WSUA 1GXPA 4L18B 2K40A 1U2WA 4X65E 5AIPA 1QNTA 4IS1C 1UG2A 4NC8A 2F4OB 1HDPA 2HYGD 3IL2A 4BHBA 2QEXI 2EOQA 5KAFC 4HF2A 2EM9A 1LVKA 5EDNA 2DCEA 2E5LE 5JLXA 4EJTA 4IX7A 3LAPA 2IW5A 1RETA 3MZ8A 4IRHA 4OINF 4AD9A 2WBTA 3D1NI 4NXNE 1ZGAA 2O9LA 2J5PA 3C2HA 4D0PA 4CYCB 2EMFA 1TQIA 3RPUA 3WG7H 4I2OA 4P1WA 1SVMA 4DR5E 2YSRA 4J19A 1H0MA 2ICWG 3DU5A 2BXYA 3TO6A 3TO7A 4MNUA 3HTUA 3I58A 3IAS2 5FKOA 1I6HJ 5KHDA 4FHTA 2VONA 4LF9E 2Z2SB 1W7PD 3S93A 4P96A 2QGUA 2EN6A 1ZYRF 1EH7A 4C2UA 2WAFA 4XN3A 3OYJA 4HG2A 2DLLA 3NQOA 3QRFF 1DDNA 2V88A 4XLNF 1HW5A 4R79A 1LE8A 4R2PA 1MMGA 3HHGA 1UHWA 2HQAA 3H5AA 1E0EA 3FXMA 2R7OA 3ZXSA 4C2MJ 1F2IG 2UUCE 2ADUA 2YTFA 2FA5A 3BZ6A 5IT3A 3T8RA 2XPVA 4GCVA 2L6MA 4DKKA 1ZAAC 1OLTA 3B6AA 3KP3A 4R8HA 3AKZA 4H0EA 1X6FA 1WJFA 2DDAA 3VFZA 3PFIA 1QVUA 3JAMZ 2DOFA 4DV3E 2PRTA 3OYIA 2UV1A 5DM7F 2XAQA 1ZG5A 2V26A 3EUAA 3DQVC 3ULQB 1ETOA 2HR3A 1H9TA 2L7FP 5EGOB 1S3JA 3HPSA 3LL7A 3SFZA 2A07F 3ADLA 3OIQA 4GXOA 3RYRA 3F8NA 5IOYA 1MMAA 3V7RA 1JK2A 2JUCA 1ONVA 2RC4A 2RV8A 3P9CA 4NC7A 2KHXA 2B9DA 2DMNA 2IGOA 4DV2E 5J8CA 4EJWA 3GYHX 2EOSA 3H9GA 3OSFA 1SAUA 2COMA 5KL6A 1N3GA 3M7GA 2EQ1A 2EB7A 2NUGA 2VJ4A 3HRMA 1YE9A 4ABZA 4F6MA 4WWCA 2KONA 2R7DA 1TTYA 5ED4A 3OYCA 1JXSA 3BGHA 4M71A 4AIJA 2EPFA 4I76A 1W0UA 4XN0A 2RPCA 3Q5FA 4B3SE 5HLGA 1N32E 4BMJA 2E2JJ 2K9SA 2W57A 4XRSG 2ZMEB 4ENMA 4JYAE 2OV7A 1XMOE 4JI6E 2X51A 1TW2A 4BYYA 5M5YJ 2PQ8A 1YJNI 3C4BA 2DRPA 2LOOA 3W3CA 3OYAA 4KJZA 1G2DC 4W97A 1J5YA 3EUHA 5HVQC 2JA2A 1U3EM 1ZU1A 3H9JA 3HTSB 3MKYB 2RAEA 4MQVA 2JPAA 3E3VA 5C44J 4RAZA 2K3PA 4ZTFA 3QYEA 2L0KA 2EM0A 1UFMA 2EPLX 4XQFA 5L3DA 3LSRA 5IY5H 1NK2P 2F2EA 1VQLI 2JTVA 2OTLI 4ZH4F 1JJ8C 1BIAA 2FEZA 1AKHA 3E97A 2XAJA 2JR1A 5FGMA 4IL6C 3CD6I 5IWAE 1QZYA 4V2FA 3ROUA 1K4SA 3LFUA 2JPCA 1TC3C 3HQ1A 2DDBA 4GYIA 2RNJA 2P0WA 4ZC3A 2RS7A 4PJMA 4DV4E 3OYDA 1FIAA 2CMPA 4K2EA 4BJ6C 4BS9A 1ZLJA 2STTA 1S7AA 3GX4X 1XMXA 1YLFA 2DK8A 3I5UA 4BBYA 3G2BA 3VEPA 3ZMVA 2ECBA 4JI4E 1IQOA 2V1XA 2ZFUA 3O3KA 4ASNA 3UK3C 1O3RA 4CCOA 2F4MB 2R7UA 4QLCU 1JT0A 2GXGA 1W0TA 2D1HA 2CS3A 2JT1A 2EMWA 4HF0A 3SDGA 3W6KB 2N3GA 4RB3C 4D5CA 2CFXA 4DR3E 4KIBA 5D8LB 3HOVJ 1ZQ3P 3WODF 2ELYA 3PNTA 4V2GA 2DJNA 3SZTA 2DMIA 3MN2A 2AHQA 3WTVC 3GTLJ 1SR9A 2LH9A 2LYCA 3D5RC 2EMIA 4B3RE 3OMYA 3G1LA 3K4JA 2EOIA 4M3GA 3M8EA 4X0GA 5DCMA 4F9CB 2DTRA 3DU6A 1YX3A 3F0CA 5TSEA 4Y33A 2O0YA 1WHQA 3L09A 2EPZA 3RDIA 5DD8A 2WZOA 2EN8A 2EFWA 2MC3A 3NAUA 2IS2A 1I39A 4L0ZB 3S1RJ 2HVRA 3WGGA 3QPHA 2LMZA 3AFHA 4DGWB 1ETYA 1HOMA 2EN4A 4LB5A 2V4JC 2V1DA 4ON0A 1UELB 5ICFA 3ADJA 1WZ2A 3R0JA 5H6QA 1IBKE 3DTKA 3EYYA 1O3QA 1ETWA 3VSLA 3OMLA 2OZ6A 2V9PA 3M07A 1HQCA 2GBYA 3J80Z 3THOB 2O61A 3ASNH 1M1EB 3CCQI 1D3YA 3RIRA 5ILUA 3RTRA 3C6KA 4BY7J 1RQ0A 2R7SA 1ETXA 1I5ZA 2BB8A 5L3FA 2E7XA 3AG2H 3ABUA 2B7TA 1OISA 1AHDP 1WI3A 3RMPA 3CUQB 3QP5A 1MDMA 5LFAA 5FKLA 1TL8A 1R5ID 1U9NA 5E3OA 2XASA 3LNQA 3I59A 2LO3A 4YELA 2E2IJ 2EPCA 2QYOA 3M99B 3BLYA 5DD4A 1A1LA 2TCTA 3CO7C 1XSVA 4M9VC 1X47A 3G3ZA 2L2NA 3PM1A 1R6RA 2CTDA 3NRVA 1OCOH 1GZ6A 3ZMUA 1W4MA 3VYSB 3CLOA 2V6CA 5FLXZ 1R58A 3E6MA 4W1UA 3IRRA 2JUGA 2X85A 1X4OA 3N05A 1W36D 3PSFA 2B0LA 1YRNA 2L33A 2M34A 5D5VB 3M3YJ 2L8TA 4JI0E 2ZFWA 2Z16A 2O03A 4IHYA 2KJBA 4BHCA 3G1OA 3IH4A 3JRCA 2LY2A 2QSGX 4Y17A 4E7JA 4II2A 3OTOE 4XORA 4AYBN 4HLYA 1FOWA 2IGNA 2ZC2A 3BTLA 4MLQA 2BY3A 4HEA2 4X6AJ 3R4KA 3M8JA 1IW7F 2K9NA 2ZJ2A 4XKBA 1PJSA 3H3ZA 2P5LC 3CMAI 4R2EA 1BIBA 2EOYA 4LGWA 1K6YA 3ESWB 2OCEA 4EV0A 2GQQA 4NNJA 4R2RA 2CU7A 4KUMA 1B8IB 2EMAA 2ZSIB 3OYEA 1HNXE 4KT5C 1GT0C 1J26A 1BR2A 1EV7A 4O3MA 3DPLC 2ADRA 1MBFA 2KIFA 4F91B 4OX9E 2VIXA 2VASA 4BXXJ 2ZNZA 5K5RA 3LSPA 1FOYA 1RMDA 1J7KA 4GGGA 2DMYA 3QG5C 4NQWA 4MFEA 1K78B 1S5LC 1JJ6C 2QLZA 2JYAA 3HEFA 3BR0A 5LLQA 2HOTA 2B7EA 2VXDA 5EZGA 4YG2F 2DB2A 3Q0VA 3CCEI 1MZBA 3C7JA 5FFXA 2ID6A 1SD4A 1DGRM 2DO7A 4WXCA 2ESHA 1VFCA 5LRRA 3RKXA 5A2QK 3TDUC 1YITI 4HX7A 2CG4A 1G3WA 3G1MA 4B47A 4FASD 1ZELA 3S1MJ 5BPIA 1HCRA 3R0AA 1YQAA 5FJ8J 1XPXA 3J7YJ 3EETA 2G0EA 1SEUA 3PO2J 2DA7A 5E1WA 5K7HA 2VJJA 4XLEA 2W25A 4B8XA 4ZYGA 3GTOJ 1BOAA 1DUXC 2DQLA 1U5TC 2DAOA 3GCMA 3REOA 2EP3A 2CUFA 2V1NA 3R61A 4ZYHA 4KA4A 3RKWA 4Z6YA 4O24A 4NBQA 2JOXA 4CUGA 1JE8A 3RZDJ 3ML6A 1AAYA 4HOBA 5AIQA 3CP2A 2W00A 4XRMA 2OBPA 2F4IA 2V87A 2R93J 2H27A 2MSYA 2E60A 1G6NA 2BY0A 2KPMA 5F08A 2DIXA 2DFEA 1YW8A 2ZJPF 1T4NA 2AS5F 2EILH 1F5TA 1T08B 4IRGA 3L9FA 3OL3A 1VQPI 3MQ0A 2MD5A 2HU9A 4FE4A 3JSPA 4FK5C 1LFUP 2UXDE 2N8GA 3S15J 1VQ7I 1SFKA 5HDGA 2RSMA 4OMZA 3BZCA 4OOIA 1HLVA 1T33A 2LV2A 3MKWB 2DA2A 3TGNA 3QYBA 5FRNA 2FBHA 2JN6A 3HUGB 1Y1VJ 1I1GA 5HLTA 3OS1A 5J47A 4RGXA 4E7LA 1WRJA 3FMSA 3L2RA 2VKVA 1RI7A 3ELKA 3JREA 4X9JA 2EM7A 2MDGA 2BBGA 2RVCA 1T4OA 2HQRA 2ELKA 2W82A 3SEQA 2IPQX 2MGQA 3ZMZA 3L1PA 1K83J 2ZSHB 2EM6A 1ERDA 2DFHA 4UV8A 1OYWA 4YIIA 1FYMA 4BEHA 3ECOA 2IRFG 3TQMA 4BC9A 4FE7A 2V86A 1SMYF 2RN7A 3I59B 3WU2C 3A01B 4O43A 1X48A 4UUSB 1VQOI 3LWFA 4HV6A 5TISC 3VB2A 4YFNF 1SC7A 1PDAA 4KICA 2L4AA 3MMYB 5FKKA 3MKZA 3J81K 4IKFA 3M1EA 1OCCH 2FGGA 2AO9A 4AIHA 2V9KA 2NYXA 4E7IA 4L5EA 1HBXG 1JT6A 2EOXA 2WB1N 2WTEA 2HHHE 4HTGA 3FBNB 3GWZA 3IHUA 1XMKA 4I8OA 3FXOA 1YRNB 3UR3C 3TP3A 3L2QA 1ZK8A 1OYIA 2FMYA 3IWBA 4B48A 1R36A 2R5ZB 4ITVA 4PJJA 5CVUA 3HKZA 2V8QB 1XGOA 3H1CA 1ZRDA 3PNVA 2KZVA 1IUFA 3MZYA 2RNGA 2VODA 4ZDLA 2DMTA 2JVAA 3ZMTA 3OYKA 1FTZA 2HC5A 1MBJA 3N4MA 2YTNA 1JK1A 4QPOA 1PJTA 3HM5A 2Q0OA 2XB5A 3S8PA 1GV5A 4IHXA 2IS6A 3GZ5A 2UZKA 2VOPA 3HRTA 3OS0A 2QM3A 1TP4A 3ZQ7A 4LU9A 2IBDA 1OQYA 2HXIA 3CO6C 1Z9CA 1HXDA 2CQXA 3CUQC 3LSIA 3WTTC 1IXRC 1LDJA 2EN3A 3RI4A 2JY9A 1LLMC 4AVPA 4I0BA 5T6JA 2E5NA 2QENA 2XSDC 2UXXA 1PYVA 3RPUD 3IV5A 2D9HA 2LBSB 3ZR8X 1Z21A 2VQLA 3K4LA 2NVUB 5IT9K 1BI2A 4B3AA 4C9YA 2OC6A 4D9JA 3HOUJ 2YRKA 1E3HA 5CFFE 2E1NA 1EKEA 2HDDA 3VYXA 1A1KA 2AXLA 5EEGA 2V83A 1LFBA 1JUPA 3LSGA 1SD5A 4FETA
chains in the Genus database with same CATH topology
2FSWA 3GFIA 3WTZA 3D0SA 2P5VA 4L9VA 1TLHB 2FXAA 2BV6A 2F5FA 2F5EA 4U88A 1O57A 1OKRA 2LDUA 2W84A 5E18F 1G3YA 4UNOA 1REPC 4RB1A 5F6FA 4HZFA 4HAMA 4ESFA 4U0VA 2Z3YA 3VODA 1TQPA 3K0LA 3FHZA 5TRDA 3L00A 5FD5A 4PDKA 1RIOH 2YR2A 5KVRA 3W6JB 3BJ6A 4M74A 2DQRA 5ERIA 2ETHA 3T8TA 3D5LA 3ERED 4WXDA 1I1SA 1KU3A 1W5TA 2DW4A 1GXQA 3F6VA 1DPRA 4UVBA 1XGMA 3GVAA 1YTYA 4A0ZA 2YU3A 2L54A 3DPTA 1XSDA 1FBSA 3JW4A 1KU7A 5LHHA 5LEJA 1AWCA 5L3CA 2ZKZA 3FMRA 5BOXA 1U5TA 3BDDA 3RPQA 4ETSA 1B9MA 2HDCA 1XSXA 2NRAC 3P9KA 4I98B 3DFGA 4HX8A 1EH8A 4G9YA 1IUYA 2J5OA 2K27A 1Z05A 3NEUA 4JQFA 2EJRA 3WTWC 5TJJA 3L7WA 2M87A 5ILVA 3TOAA 3E5QA 3GO5A 1IN5A 1IN6A 1K7AA 3H92A 2HFHA 1D5VA 1YIOA 3TO9A 2ZO4A 1XD7A 4EM1A 1ZG3A 3GFLA 1T38A 1ZAOA 2PLYA 2VN2A 5D6EA 4A12A 4Q48A 4FX0A 1J9IA 4P5OA 2BBYA 1IXCA 3ZPLA 4N9HA 4KN4X 3HSRA 3DEUA 5KK1A 3SQNA 4XBFA 2F5CA 4P9UA 5CLSA 3I4PA 4HDVA 2BGCA 2ZNYA 4HA8A 3K2ZA 1FX7A 3QAHA 4AIKA 5HDNA 4TV7A 1PDNC 4OMYA 3M9AA 2PMHA 4A0YA 2JPBA 3CUQA 1FLIA 1WKMA 3HSFA 4O5VA 1YO5C 3HYIA 4B09A 5K1YA 5LHGA 1X3UA 2PFBA 1UCRA 4HF1A 5HOOA 2MH9A 2VT3A 3BP8A 1RZ4A 2Z9OA 2YX7A 3HOTA 2EA2A 2RQPA 4CDGA 1QBJA 4O6JA 5L3BA 1Z1DA 1USSA 2ESNA 4JBAA 2CYYA 2H09A 3TDZC 4KDPA 4BH9A 2F5DA 3F22A 3GFJA 1U5TB 4MHGA 4LK1F 1HKSA 1YW7A 2FNAA 1O3SA 3I71A 3F8MA 4F7ZA 1K78A 2L01A 3ECHA 4MGRA 4OU0A 3QU3A 3CTAA 3N97A 1SD7A 3LA2A 2DI3A 3F8CA 5K5QA 1IF1A 1JGSA 3HSEA 5HDKA 5FO5A 4A6EA 2JRTA 1FY7A 2FMLA 3L2CA 4A5MA 4G8XA 3DXJF 3WGHA 2XKOA 1ODDA 4G94A 2HKXA 1YG2A 1R22A 1LEAA 3BOQA 2KKOA 5LHIA 1TNTA 2H6BA 1IRGA 2PN6A 2CO5A 4NHJA 4NB5A 4IF4A 1WQ2A 1E17A 3MAJA 4XSXF 3ISPA 1Z7UA 3JAMK 1PP8F 3FX3A 1T0FA 2H94A 3HUGA 4DQ2A 4EJVA 4M6XA 2ZBKA 3ZN0A 2DBBA 1MJBA 2OA4A 2YPRA 3KP2A 4RGUA 5H20A 5D5WB 3RYPA 1DP7P 2YX4A 4DNCA 2FE3A 1MD0A 4CXFA 3K9TA 3EDPA 1LNWA 4Q5SF 4LJZF 1KGSA 2DU9A 1R1VA 3K1NA 1TQMA 3BPXA 3V8JA 5DUIA 2OQGA 1U8RA 3V8LA 4ZZDA 2Z33A 4G7OF 5J6XA 2PBIA 2KIUA 3BROA 3WTXC 4RS8A 1IZ1A 1MGTA 2PG4A 3O6BB 2LSOA 2KIMA 1ZG1A 3KZYA 4U7BA 4Q4ZF 2A69F 3FXRA 5D4SA 3IC7A 1TBXA 4ZYDA 4RGSA 3LSTA 3F8BA 4CZZA 2QQAA 4UHTA 2UWMA 3E5UA 4G7ZF 4A2UA 2P6SA 2DPDA 1XCVA 4BXUA 4G6QA 5JFRA 5E1ZB 4N9IA 3BWGA 4UVAA 3LFKA 1Z6TA 3F23A 1O3TA 3R60A 5H6RA 1FT9A 4LLNA 1F4KA 4JK1X 1HKQA 2MH2A 4U7DA 3DP7A 4AWXB 3PQJA 3VOEA 5K5OA 1KU9A 1R5GA 2G7UA 1QGPA 1ZLKA 2EK5A 1FOKA 2A6EF 4UXNA 4EJUA 2CWEA 2R7FA 2X4HA 3E5XA 3WGIA 1SMTA 5DYMA 2LNBA 2MBFA 4S04A 3WTYC 1SFUA 2A68F 5E20A 4A5NA 5ILSA 4U0WA 4XRFA 5ICCA 4EQQA 4CGZA 1T39A 4BHPA 5FLXK 2P7CB 2BYVE 4HDUA 1B9NA 3FF5A 4HYEA 1OR7A 1OPCA 1R1TA 2QQ9A 1O7LA 3LAJA 1HW2A 4LD5A 2XKPA 1XB4A 1XN7A 1NHAA 1J2XA 2G9WA 4L9TA 3IRQA 2XUBA 4LMYA 2IJLA 3KP7A 4R1HA 3WE3A 1FZPB 2A5YB 4IPAA 4A6DA 4XLPF 2K4BA 3R6SA 2IA1A 2RGVA 4WCGA 5E1XA 2CQKA 1D8JA 2M30A 1IAWA 3KLNA 3GLXA 1V4RA 3KEQA 4YFKF 1QZZA 2Y75A 1LQ1A 2V79A 1A04A 3J7AO 2O3FA 3GZ6A 1KU2A 1D8KA 4EM0B 1BI1A 3BPVA 4MTDA 5J8FA 1SAXA 4EM2A 3DKWA 4KMUX 2EV6A 4CICA 4ZZLA 5FB2A 2VC1A 2QBYA 1FSHA 5JI6A 3V7SA 4S05A 2HS5A 3F8FA 3TKYA 1BM9A 3KEOA 2QVOA 3KZZA 5E8IA 2GZWA 4UVCA 4GO1A 4L5JA 4I01A 2P6TA 1R1UA 2XAGA 3QOPA 1J75A 3LQRA 1ON2A 3T0YA 4RGRA 4WF2A 2ZCWA 2FBKA 4BQAA 4HBLA 2XAHA 2P7VB 4I7HA 1QQIA 2M45A 4M9SA 1G4DA 1HKTA 4EVIA 5DUKA 3WTSC 2GAUA 3SXYA 2IP2A 2UXNA 1CF7B 1J0RA 4UV9A 3K1MA 4LFUA 4HQEA 2EFNA 3CDHA 2OAZA 1ZGJA 6PAXA 1KQ0A 3MEXA 3S2WA 2QZ8A 1CGPA 4LG0B 1LDDA 1KYZA 2HYFA 3F72A 2V1UA 2VT2A 2DFIA 4EMSA 1LB2A 2WV0A 4KIFA 2PI0A 1I27A 3WG9A 2VBYA 3E6DA 5JVTA 3JTHA 2M5WA 1IXSB 1YS6A 2P5KA 1OYYA 1KQ9A 1F9NA 4LK0F 1I6XA 3FXQA 3HHHA 4MEXF 3TOBA 5LBQA 2VBWA 1Z91A 1ZH5A 1BBYA 4YFXF 2P8TA 3Q9VA 2ISYA 1F1ZA 5D5UB 4IRIA 4M9ZA 2QBYB 1S8NA 1WI9A 1FBUA 3O2PE 4I09A 5HS7A 5HS9A 5DDGA 2MA3A 3T1BA 4EGYA 3H3UA 5F64A 5JHUA 2FF4A 1PUEE 4OIQF 1ZRFA 3KP5A 1L0OC 1W5SA 1XMAA 4L5IA 3BJAA 4BAYA 1K79A 3QU6A 4RAYA 1G3SA 5HLIA 3K1PA 3KLOA 4LB6B 3T5XA 4OIPF 1SD6A 4HLXA 1BC7C 4Y15A 4Q47A 1FYKA 4E70A 4M72A 1V3FA 4LLGF 4CYDA 2L02A 5FD6A 1KA8A 4M9XA 1FSEA 3KE2A 3FZVA 2TDXA 1Z6RA 2XAFA 2D2WA 5LRSA 1XDSA 1USTA 1BI3A 2OU2A 1ZREA 2STWA 3I64A 2K02A 3I54A 1STZA 3C18A 1MJ9A 1EH6A 4MTEA 4BNCA 2CSOA 2EFOA 1P4WA 5BS6A 3MZHA 4L9JA 5LGUA 4XSZF 2RKHA 4HQMA 2NAZA 5BPDA 3GF2A 2VE9A 1XDUA 5D5XB 1IN7A 2EFPA 2K7LA 3ZN1A 2XIGA 1YW9A 5HLHA 3U2RA 2HTSA 4PGGA 2V9VA 5CVRA 1XGSA 4G7HF 2A3SA 4WX9A 3FM3A 3I0TA 2HQNA 4U0YA 2OZUA 1FNNA 4CHUA 1P4XA 3WU1B 2RDPA 2OD5A 2JZYA 1B4AA 2HTJA 3MWMA 4A0XA 1FYLA 1IN4A 2WC2A 3DV8A 2VBXA 5DCFA 3AAFA 1Y0UA 5A2QZ 3GFMA 3KFWX 3C1DA 4P9FA 3KETA 3SHFA 2VXZA 2BE5F 3V8KA 2EV5A 4P55A 1RUOA 3OV8A 4OIOF 2FOKA 2HWVA 5LGTA 1Q1HA 2ELHA 4ESJA 1QO0D 1JHHA 1HSTA 5DEQA 4M6YA 3FM5A 4IHSA 1LVAA 1FP1D 1W7PA 1FP2A 1S29A 5CVJA 1C0WA 2IVMA 4ZYEA 2NNYA 1QPMA 3JTGA 3HRUA 2W24A 3HRSA 4GYGA 3LA3A 4IHTA 2K4JA 1T2KA 4FT8A 4HV5A 5CVVA 3E6CC 2A61A 2VC0A 4KN7X 1LEBA 3U9GA 1BJAA 4KYWA 2D45A 4L0YB 2HKOA 1UHMA 3J81Z 3RJPA 1TW3A 1G3TA 5L3GA 4KNYA 1UB9A 5CVIA 2MLGA 2W85A 2L3DA 4YIFA 5ICGA 1FPQA 2P4WA 4ENJA 3C3WA 2EA4A 3ABTA 3JSOA 3PQKA 1B1BA 3J80K 1E2XA 4ESBA 1AOYA 2FU4A 1U6GA 3I53A 1YFHA 5F1RA 5IT9Z 3WTUC 1O7FA 4MQ9F 1H9GA 3FXUA 1YS7A 2LKPA 4KMFA 3GXOA 2XHKA 3ZMDA 4MEYF 4WK8F 2LF8A 1LDKB 2PJPA 1GHCA 4RB0A 3COAC 2HEOA 3B73A 5LEKA 1P4AA 4N0BA 5HS8A 5DCMB 3IKTA 1HSJA 2XGXA 5BMZA 2QWWA 2EFQA 1CF7A 2XRNA 2XV4S 3P9IA 2Q8KA 3M8FA 1IN8A 1R5HA 3QPTA 1XGNA 2C6YA 3K69A 3BJOA 2LF7A 4LG0A 1OMIA 2VE8A 5DV5A 4ENNA 3GW2A 1T6SA 3GEZA 2VOOA 4G6DA 3EQLF 1DPUA 1MDMB 3RKYA 5LGNA 2KRFA 1R7JA 2ISZA 2EV0A 2H6CA 3KP4A 1W7PB 1BN5A 3KCCA 2ZXJA 4RB2C 2Q2EA 1HW1A 2K86A 5D8KB 5D4RA 1FBQA 3SZPA 2IT0A 1ZHFA 5CJ9A 1U78A 3ZP5A 5ICEA 1P6RA 2JSCA 4PCQA 4LLLA 3G73A 4M73A 2E7WA 5CYVA 1RUNA 2XVCA 3IKVA 2FQ3A 2ACJA 1L3LA 1S6LA 1WWXA 2Y0MA 3V7CA 2M1BA 2GA2A 2G7HA 3ZMSA 3Q9SA 2XROA 1S7OA 3F3XA 1RNLA 3OOPA 3LA7A 2WWYA 2VBZA 5EEHA 4ENKA 2NS0A 2PMUA 1T98A 1XCBA 1PP7U 3V4GA 2FRHA 3E6BA 2HOEA 1R00A 4HW0A 2O6GE 4EJOA 2M8EA 2NNNA 2GXBA 3MCZA 2A6HF 3HIFA 1VTNC 4UUVA 5JR3A 3LQQA 4IVNA 1FWZA 4Z2YA 3WU0A 5L3EA 2GWRA 2FNPA 1ZN2A 1YYVA 5D6FA 3KP6A 2GA1A 1J59A 3QP6A 3TQNA 3P7NA 1P2FA 4FX4A 1B59A 1B6AA 4L9NA 2X0LA 2DK5A 4PZJA 2D1VA 2QUFA 3U1DA 2CGPA 1ON1A 1ZARA 3IWFA 4I02A 5FFZA 3MFKA 2FBIA 2E1CA 3DF8A 2EWNA 2KJCA 2BEOA 2HGCA 1BC8C 1KQ8A 1IRFA 5BQTA 1SFXA 2QQBA 5AONA 4IXAA 4I0AA 2IA0A 1GVJA 3B02A 1JHFA 2ZMEA 2L4MA 1ZRCA 1R23A 1K6OA 4PGHA 3EYIA 1KYWA 3FWEA 4WXHA 1TNSA 5E17F 2HZTA 2IA2A 1SFEA 1MKMA 2Z99A 1BI0A 3WE2A 2MLKA 2DPUA 3IWZA 3GUDA 3CUOA 4Y13A 2O8XA 2PEXA 1FC3A 4HX4A 5E8GA 4EGZA 2GIVA 2DT5A 4KFCA 2Z5UA 2Y48A 3F21A 4IJAA 1LJ9A 4CO8A 1ULYA 3F6OA 1MJAA 4OIRF 3BY6A 4QWQA 3FMQA 3CJNA 2CW0F 4KIGA 2R3SA 2OQRA 3HOSA 1P92A 1GXPA 1WSUA 4L18B 1U2WA 5AIPA 1QNTA 2HYGD 3IL2A 4BHBA 4HF2A 4EJTA 3LAPA 2IW5A 4IRHA 4OINF 4AD9A 1ZGAA 2J5PA 4D0PA 1TQIA 3RPUA 4I2OA 2YSRA 1H0MA 3TO6A 3TO7A 4MNUA 3HTUA 3I58A 4FHTA 2VONA 1W7PD 4P96A 1ZYRF 1EH7A 2DLLA 3NQOA 3QRFF 1DDNA 4XLNF 1HW5A 4R79A 3HHGA 1UHWA 2ADUA 2FA5A 3BZ6A 5IT3A 3T8RA 4GCVA 3KP3A 4R8HA 4H0EA 3VFZA 3PFIA 3JAMZ 2XAQA 1ZG5A 3DQVC 3ULQB 2HR3A 1H9TA 1S3JA 3SFZA 2A07F 4GXOA 3RYRA 3F8NA 3V7RA 1ONVA 2RC4A 2RV8A 3P9CA 5J8CA 4EJWA 3GYHX 2COMA 3M7GA 2EB7A 3HRMA 4WWCA 2R7DA 1TTYA 5ED4A 1JXSA 4M71A 4AIJA 3Q5FA 5HLGA 2W57A 2ZMEB 4ENMA 4BYYA 1TW2A 2PQ8A 1J5YA 3EUHA 5HVQC 1U3EM 3HTSB 4MQVA 3E3VA 4RAZA 1UFMA 5L3DA 2F2EA 2JTVA 4ZH4F 1BIAA 2FEZA 3E97A 2XAJA 5FGMA 1QZYA 3ROUA 2JPCA 4GYIA 2RNJA 4K2EA 1ZLJA 2STTA 1S7AA 3GX4X 2DK8A 1YLFA 3I5UA 3ZMVA 3VEPA 2V1XA 3O3KA 4ASNA 1O3RA 4QLCU 2GXGA 2D1HA 2JT1A 4HF0A 3W6KB 4RB3C 2CFXA 4KIBA 5D8LB 3WODF 3SZTA 3WTVC 3M8EA 5DCMA 2DTRA 2O0YA 3L09A 3RDIA 5DD8A 2EFWA 2MC3A 4L0ZB 3WGGA 3QPHA 4LB5A 2V1DA 4ON0A 5ICFA 3R0JA 5H6QA 3EYYA 1O3QA 2OZ6A 1HQCA 3J80Z 2O61A 1D3YA 3RIRA 5ILUA 3RTRA 1I5ZA 5L3FA 2E7XA 3ABUA 3CUQB 3QP5A 1MDMA 2XASA 3I59A 2QYOA 5DD4A 3CO7C 1XSVA 3G3ZA 3NRVA 3ZMUA 1W4MA 3CLOA 2V6CA 5FLXZ 1R58A 3E6MA 3IRRA 2B0LA 5D5VB 2ZFWA 2O03A 2KJBA 4BHCA 4Y17A 4HLYA 3R4KA 1IW7F 2ZJ2A 3H3ZA 2P5LC 1BIBA 4LGWA 4EV0A 2GQQA 4KUMA 4KT5C 1EV7A 4O3MA 3DPLC 2KIFA 2ZNZA 5K5RA 1J7KA 4GGGA 4NQWA 1K78B 2QLZA 5LLQA 4YG2F 1MZBA 3C7JA 5FFXA 1SD4A 2DO7A 4WXCA 2ESHA 5LRRA 3RKXA 5A2QK 3TDUC 4HX7A 2CG4A 1G3WA 5BPIA 3R0AA 1YQAA 3EETA 5E1WA 2W25A 4B8XA 4ZYGA 1BOAA 1DUXC 2DQLA 1U5TC 2DAOA 3REOA 3R61A 4ZYHA 4KA4A 3RKWA 1JE8A 3ML6A 4HOBA 5AIQA 2OBPA 2H27A 1G6NA 1YW8A 2AS5F 1F5TA 4IRGA 3L9FA 3MQ0A 2MD5A 3JSPA 5HDGA 4OMZA 4OOIA 3TGNA 2FBHA 1I1GA 4RGXA 1WRJA 3FMSA 1RI7A 3ELKA 2RVCA 2HQRA 2IPQX 3ZMZA 4UV8A 4YIIA 1OYWA 1FYMA 3ECOA 2IRFG 1SMYF 2RN7A 3I59B 3LWFA 4HV6A