4WX9A

Crystal structure of mycobacterium tuberculosis ogt in complex with dna
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
164
structure length
161
Chain Sequence
VHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTSRTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALLELEKSRAPADLTLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Mycobacterium tuberculosis O6-methylguanine-DNA methyltransferase protein clusters assembled on to damaged DNA.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords DNA (5'-D(*GP*CP*CP*AP*TP*GP*(E1X)P*CP*TP*AP*GP*TP*A)-3')
total genus 42
structure length 161
sequence length 164
chains with identical sequence B, C
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2014-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4wx9A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4wx9A01
3JSPA 2XKOA 2M30A 1U5TA 3SZPA 4F7ZA 4LB6B 1SMTA 1YS6A 1U2WA 3F8BA 4KA4A 1SFEA 4BAYA 4ENMA 1EH7A 5JFRA 3K9TA 2CG4A 1K6OA 2V1XA 5LHHA 3T1BA 2ZJ2A 1XGOA 1XDUA 4MNUA 1XCVA 5L3EA 2WC2A 3DPTA 2A3SA 3F6OA 5CVJA 1IN7A 3DEUA 2V6CA 1MDMB 2KJBA 1XGSA 2Z33A 3K1MA 4XSZF 1B6AA 1OYYA 5ICFA 4LLLA 1P4AA 3DFGA 2ZO4A 1KYWA 5L3GA 1BBYA 4MEYF 1R1TA 4KN7X 4G94A 5DEQA 4KUMA 3VB2A 2QQBA 4GYIA 3SXYA 5FFXA 1F5TA 1XSVA 2GZWA 3WGHA 3HHGA 5HS8A 2FEZA 3GFIA 5FLXK 3Q9SA 4Q48A 4G7HF 1P2FA 3LA3A 2KJCA 3MWMA 1F1ZA 3I59B 2F5CA 3WTZA 2ELHA 1ON1A 4HLYA 5TRDA 4FX4A 2JZYA 1U5TB 1A04A 2K02A 2M45A 4LK1F 1QNTA 2EB7A 2STWA 3WTWC 2Z3YA 4G6QA 1TQIA 2H6CA 5K5QA 2VOOA 3E5UA 3I58A 1RI7A 3GFMA 3HRMA 3G73A 3H3ZA 3FMSA 4IHSA 4IF4A 4GGGA 3FF5A 2PJPA 3LFKA 1KGSA 5LBQA 3GW2A 1ZN2A 4HDUA 3GZ6A 1Y0UA 4Y13A 2IRFG 2YR2A 2KRFA 2FMYA 1USTA 2BYVE 5JR3A 2VONA 1P92A 3KETA 3J81Z 4A5NA 5K1YA 3GZ5A 2QYOA 3I5UA 2DPUA 2IA1A 3F21A 3FMQA 1OYIA 2UWMA 1I1GA 2Y0MA 4MQVA 4IXAA 3N97A 1W4MA 2MH9A 5LGNA 1TW2A 2WTEA 1G6NA 1YG2A 2ZNZA 3FM5A 1YTYA 1CF7A 1BIBA 1ZLKA 2XAJA 1LJ9A 1TW3A 3KP7A 1FSHA 5DCFA 3EQLF 2E1CA 3K69A 4JBAA 1T38A 2XAQA 3CUOA 2HYFA 3F6VA 4KN4X 4WX9A 2BE5F 2HOEA 3ROUA 1WKMA 2PQ8A 2K7LA 3SQNA 1ZAOA 1YS7A 2YSRA 3BJ6A 3TDZC 4YFKF 2A6EF 1DP7P 3FXRA 3DPLC 4CZZA 3ERED 1ZHFA 2ESHA 4FX0A 3U9GA 1Z91A 1LB2A 5BMZA 5KVRA 4ZYEA 5J8CA 2EK5A 1UHMA 1UCRA 1P4XA 1ZARA 3CTAA 3RJPA 2DQRA 4HQEA 2RVCA 1B1BA 3E5XA 4EQQA 1TNSA 2VBXA 1JHHA 3FM3A 1XMKA 3R0JA 1ZREA 3C18A 1QGPA 3HSEA 2F5DA 1XGNA 3BOQA 4I01A 5BPIA 1BM9A 3TOBA 3BZ6A 4DQ2A 3VFZA 1O3TA 3NEUA 5DD8A 3EYYA 3HRUA 5EEGA 3TO6A 5L3DA 4Z2YA 2ETHA 1BC7C 5CYVA 4WWCA 3CUQA 2COMA 1S7OA 5ED4A 4L18B 1QPMA 3WTUC 1RUOA 4ASNA 4O6JA 1D8JA 1TQMA 4U88A 2TDXA 4LJZF 2DI3A 2FXAA 4ZYGA 1IRGA 1HW1A 2VT3A 2FA5A 1IW7F 1S8NA 1UB9A 2QLZA 1ZRFA 1BC8C 2K27A 2VC1A 1F9NA 4ZYDA 4LGWA 1I6XA 2EFPA 4YG2F 3OV8A 4M6YA 2H94A 2HFHA 3TKYA 2Z99A 4XSXF 4PGGA 5J8FA 5D6FA 3AAFA 3LA2A 1R00A 2ISYA 1QQIA 4L9NA 2XRNA 2OQRA 1FY7A 2DBBA 3V8LA 3R4KA 5K5RA 4ENJA 1YLFA 2YX4A 2XAHA 3N4MA 1JGSA 3PQJA 3M1EA 3QOPA 4HBLA 5FD5A 2PMUA 5F64A 2QQAA 1OYWA 1XD7A 2LDUA 1I27A 2IJLA 1O3QA 5DCMB 1R1VA 3ML6A 2W57A 4CICA 4G7ZF 2JRTA 5E8GA 1YIOA 5BOXA 2G9WA 3RPQA 3V7CA 4P9FA 2GQQA 1K78B 1H9GA 2VC0A 2OBPA 3F8FA 2VXZA 5CVVA 3ZMTA 1OPCA 4A6EA 3FXQA 2W24A 4M73A 5D8KB 3E6DA 1J59A 3PQKA 3R0AA 3L7WA 4BYYA 2ESNA 3I4PA 4HZFA 4HW0A 2ISZA 4L9VA 5HS9A 2XAFA 5HOOA 2CW0F 2DW4A 3I59A 3C3WA 5LLQA 2PFBA 3FHZA 2GAUA 3QPHA 2XIGA 3SFZA 4KNYA 4I0AA 2P5VA 2NNYA 4YFXF 2NAZA 4KIGA 2M1BA 3MAJA 2O6GE 4L0YB 3FMRA 5JI6A 2QVOA 2H09A 4IRGA 4KYWA 1OKRA 3WU0A 2Q2EA 4XLPF 3P9KA 2D1HA 5H20A 1FBQA 4HLXA 4RGRA 2BGCA 2MLGA 4EGYA 1Z6TA 3PFIA 3I54A 3J7AO 2A61A 3EUHA 2MLKA 4RB3C 1T98A 2P5LC 3E6MA 4IPAA 4KMUX 3CO7C 3K1PA 2BEOA 2H27A 5DD4A 1YW9A 3D0SA 3GO5A 1TQPA 5HDKA 4OMZA 4M9ZA 1XGMA 2K86A 1RNLA 2L01A 2CSOA 4CHUA 2RQPA 3KP6A 1E17A 2ZBKA 4RAYA 1R23A 4ON0A 2Z9OA 4OIOF 1XSXA 2A69F 3CUQB 3QAHA 4M6XA 2XGXA 4RS8A 5F6FA 4LG0A 4WXCA 2CYYA 5D5XB 1SMYF 3GFJA 2J5OA 1BOAA 2UZKA 2HTSA 5LRSA 3ZMUA 3I71A 1T2KA 3IWZA 4HF0A 3U1DA 4YFNF 5HS7A 1BI0A 2LF7A 5D8LB 4HAMA 2HEOA 1V3FA 1RUNA 2IA0A 3E97A 1YFHA 1FSEA 2L54A 4G9YA 2FQ3A 3KFWX 2HTJA 4M71A 3EETA 2VBZA 2HKOA 2WWYA 1IXCA 1FPQA 4CO8A 1FBUA 3HRTA 1JE8A 4L9JA 1WWXA 2A07F 2JSCA 4ZZDA 1Z6RA 5LHIA 2HWVA 4KFCA 2H6BA 3T8TA 1O7FA 4OOIA 2PMHA 4M9SA 5DYMA 5ILVA 2A68F 2XASA 3DQVC 1AOYA 2FE3A 1BJAA 3ZN0A 1J2XA 2CQKA 4AIJA 1ZH5A 2A5YB 2KIFA 5F1RA 2O0YA 1G3TA 2PEXA 1FP1D 2DLLA 3O6BB 1ZG1A 1J5YA 1SD7A 5H6QA 2Q8KA 4I2OA 1U78A 3IKTA 2FSWA 4KICA 1BI3A 4UVBA 1R58A 4I09A 3KZYA 5D4RA 3KEQA 1G3SA 5D5VB 3ZMVA 1S7AA 3TO9A 2HKXA 4NB5A 1WRJA 1B9MA 3K0LA 4CDGA 1FZPB 1SFUA 2L02A 4QWQA 4O5VA 2W84A 1MZBA 1MDMA 2D2WA 3L2CA 2P6SA 3CJNA 2NNNA 2DK8A 1HSJA 3L09A 2BV6A 3F23A 4JQFA 4Y17A 4A2UA 1HXDA 4K2EA 2O61A 3GEZA 2LF8A 2STTA 2FBHA 1B59A 1K79A 3V4GA 4WF2A 3TQNA 1V4RA 1OMIA 4U0YA 3CDHA 4UHTA 2QM3A 1T39A 4KMFA 1ZG5A 2IW5A 1KU7A 2FNPA 2VN2A 3VODA 1J7KA 2MD5A 2YU3A 5D4SA 3K1NA 2UXNA 2XHKA 1JXSA 2X0LA 2RN7A 3L9FA 3H92A 1R7JA 3F3XA 5FLXZ 3BY6A 3BJAA 4AIHA 3BPXA 3E3VA 4A0YA 3JW4A 1RIOH 2L4MA 4QLCU 3KP2A 4UUVA 4LMYA 3TGNA 3JTGA 1FT9A 1ODDA 3M8EA 2EV6A 3I0TA 1HQCA 2CGPA 3K2ZA 1KU9A 4PCQA 2O03A 2QENA 3V7SA 2LKPA 4UVCA 4ENKA 1W5SA 1W7PA 3LQRA 4RB2C 4ZH4F 4CYDA 5E1ZB 3G3ZA 1J75A 1P4WA 2G7UA 1P6RA 2VE8A 4CXFA 3ZN1A 3GFLA 4BH9A 3T8RA 2ZXJA 3RIRA 5L3CA 3J80K 4AVPA 1VTNC 4PDKA 4HV6A 4IRIA 5D6EA 1SAXA 1LEAA 1E2XA 2V1DA 4I02A 4H0EA 4R79A 3MFKA 3ZP5A 2BBYA 2EV5A 1IF1A 4HV5A 2KIUA 3F72A 1MD0A 1IAWA 2GXGA 4M74A 1ZYRF 2OD5A 5CVRA 4MEXF 1W5TA 1XSDA 2DAOA 2CFXA 3LWFA 1G3YA 3V7RA 3HSRA 2R7FA 4OMYA 2ADUA 1NHAA 2DT5A 2P7CB 1MJBA 1S3JA 4HF1A 5ICCA 5CVIA 2MC3A 4ESJA 2OAZA 1Q1HA 2VBYA 3H3UA 4EGZA 1FWZA 3M9AA 1PP8F 2NYXA 3LA7A 2DTRA 1ZRDA 3TOAA 4O3MA 4R8HA 4L0ZB 2RKHA 1FNNA 1FP2A 1EH8A 3E6BA 5E1XA 4EVIA 4GXOA 2ZFWA 2YPRA 3NRVA 2ACJA 2M5WA 3W6JB 1U3EM 5A2QK 3SZTA 5CJ9A 5E18F 3LQQA 5ICEA 4IJAA 1ON2A 2GXBA 5HLGA 1SFXA 3RKYA 2X4HA 3RTRA 1HKTA 2HZTA 1FYLA 3GYHX 1U8RA 2E7XA 1IN6A 1CF7B 1XN7A 3KE2A 3C1DA 2R7DA 2XROA 3CUQC 4MHGA 4B09A 3P7NA 3CLOA 2Z5UA 3U2RA 1RZ4A 1LDKB 1Z9CA 1G4DA 2PI0A 3MEXA 4Y15A 4LK0F 4A0ZA 4A5MA 1J9IA 2K4BA 2EFNA 3ZQ7A 2JPCA 5BPDA 3WGGA 1BN5A 1R5GA 4ESFA 2F5FA 1D8KA 2XKPA 2EJRA 2MA3A 3M8FA 5ILSA 3QPTA 3EYIA 2P6TA 3KP3A 1KQ8A 2ZMEB 4LB5A 2VBWA 3WGIA 3WE2A 3RKXA 3HTSB 2LNBA 3BDDA 2E1NA 4P5OA 1ZGJA 4LFUA 1PDNC 4B8XA 4TV7A 4UXNA 4HOBA 3KCCA 2DK5A 1T0FA 1QZYA 2UXXA 2VT2A 2QBYB 3CO6C 4AIKA 1ZGAA 2FRHA 1B4AA 1LNWA 2Y75A 5D5UB 2XAGA 3HIFA 4WK8F 4UV9A 2L3DA 4AD9A 3WTVC 3IKVA 4M9XA 2HDCA 1XMAA 1GXQA 1WI9A 3MQ0A 5DCMA 4ZZLA 4MGRA 3J80Z 1S29A 1IXRC 1SD6A 1GVJA 2E7WA 1MJAA 4YIFA 4BQAA 4BXUA 1IN5A 3RYPA 1X3UA 5L3FA 1G3WA 1LQ1A 2RC4A 3DF8A 3HRSA 2JT1A 3FWEA 1T6SA 3D5LA 2FF4A 3SHFA 5LGTA 1R5HA 5FGMA 3KP5A 2MBFA 2RGVA 1ZLJA 1Z1DA 1H0MA 1IZ1A 4HX4A 5KK1A 1GXPA 4S05A 1KYZA 5TJJA 4Q4ZF 4HDVA 1SD5A 2PG4A 2CO5A 4N9IA 4WXHA 2MH2A 2XUBA 4OINF 3ZMDA 3R6SA 5LHGA 3IRQA 5LGUA 2ZKZA 5JVTA 1DUXC 2OZUA 3TDUC 3ZPLA 5EEHA 4N0BA 2O8XA 3WTTC 1TNTA 4XRFA 3GF2A 1SD4A 4UNOA 3WTYC 4G6DA 1R36A 4ESBA 3DV8A 1MKMA 3F8CA 2ZNYA 1H9TA 5DDGA 3M7GA 2V1UA 4NHJA 2JPBA 2QZ8A 3VEPA 1XDSA 2W25A 4AWXB 1PUEE 5IT3A 2FMLA 4GO1A 4R1HA 4HX8A 4EV0A 5HLHA 4IVNA 4E70A 3O2PE 2QQ9A 3COAC 3W6KB 2HQNA 2PBIA 3KP4A 5LEJA 2HGCA 5FB2A 4Q47A 1IUYA 2P5KA 3REOA 1ZG3A 1XCBA 3ELKA 2O3FA 3B73A 5LRRA 1TTYA 3BROA 4IRHA 3HTUA 1GHCA 4I7HA 2VODA 5H6RA 4N9HA 5IT9Z 5E8IA 2GWRA 4GYGA 3MCZA 4BHCA 1YW8A 4GCVA 4BHPA 4U7DA 1K7AA 1HKQA 3BPVA 4EM0B 3KZZA 3T5XA 3HUGA 3WG9A 4RB0A 1OR7A 2K4JA 5K5OA 4I0BA 5LEKA 2V79A 3GWZA 6PAXA 3O3KA 1FC3A 2FOKA 4RAZA 4A6DA 2GA1A 3Q9VA 4L9TA 1L0OC 1FX7A 4KT5C 4G7OF 2OQGA 2LSOA 3OOPA 2V9VA 3GUDA 3WE3A 3GVAA 3NQOA 1J0RA 1IN4A 2QBYA 1K78A 2HR3A 2R3SA 2YX7A 3QP5A 4EMSA 1ZRCA 3FXUA 1UHWA 1YYVA 3S2WA 2IVMA 1BI1A 2DQLA 1YW7A 4NQWA 4BNCA 4M72A 2L4AA 4OIQF 4RGUA 2A6HF 2FNAA 3BJOA 3QU3A 4EJOA 2D1VA 1D3YA 3I53A 5E17F 3FX3A 3LAJA 1FBSA 4XBFA 4RB1A 3I64A 1EH6A 4P9UA 1S6LA 4JK1X 2CWEA 1IXSB 4HA8A 2DO7A 4OIPF 5AONA 1YO5C 3T0YA 3IL2A 5J6XA 5DUIA 2EA4A 1UFMA 3C7JA 1HSTA 4FT8A 3KEOA 3QRFF 1LDJA 2ZMEA 3ULQB 1KQ0A 3HYIA 3VOEA 1CGPA 3L00A 3QP6A 1O3RA 1LEBA 2GIVA 2F2EA 4L5JA 2XVCA 5CVUA 5JHUA 3IRRA 2HYGD 3JAMK 3R60A 3QU6A 1WQ2A 1C0WA 2J5PA 3F8NA 4LG0B 2AXLA 1O3SA 1PP7U 2DPDA 1ULYA 5HLIA 3ZMZA 1HKSA 3BP8A 3FZVA 1JHFA 5D5WB 3ECHA 4LLNA 5DV5A 3TO7A 4EJTA 2B0LA 3RYRA 4DNCA 4HF2A 5CLSA 2G7HA 5HDNA 2M8EA 1D5VA 4L5IA 2QUFA 1BI2A 1LVAA 3ABUA 1TBXA 2HS5A 1FOKA 4KDPA 3MZYA 3B02A 2IA2A 1R22A 4U7BA 2QWWA 1KU3A 1IRFA 4U0VA 1KA8A 2DFIA 3ABTA 5L3BA 2Q0OA 1ONVA 1LDDA 3JAMZ 3E6CC 4UVAA 1U5TC 1I1SA 4EM1A 1QZZA 3HOSA 4G8XA 1B9NA 1STZA 3V8JA 4BHBA 3V8KA 3HSFA 1O7LA 4RGSA 4MQ9F 3RDIA 4PZJA 3BWGA 2FU4A 3HHHA 4HQMA 3DXJF 3RPUA 3ECOA 5AIQA 5E20A 2AS5F 2PLYA 2EV0A 4XLNF 4EJUA 4A0XA 1HW2A 1MGTA 4OU0A 4S04A 1QO0D 3R61A 1FYKA 2KIMA 4LD5A 4LLGF 2NRAC 5FO5A 3EDPA 3IHUA 4P55A 4ENNA 2P8TA 1KQ9A 2JTVA 3P9IA 4IHTA 3F8MA 4D0PA 2EFWA 1YQAA 4P96A 2IT0A 3GX4X 1Z7UA 3HOTA 2DU9A 5ICGA 2GA2A 1I5ZA 4U0WA 1DDNA 4I98B 4Q5SF 4UV8A 3LSTA 3JTHA 4RGXA 4YIIA 3ZMSA 4CGZA 1HBXG 1FLIA 3MZHA 2P7VB 1O57A 1HW5A 2OZ6A 1BIAA 1MJ9A 2VOPA 2HQRA 3IWFA 5HDGA 3RI4A 3DKWA 2F5EA 4ETSA 1AWCA 3LAPA 3F22A 4WCGA 1WSUA 4FHTA 1R1UA 5ILUA 1FYMA 1EV7A 5IT9K 4KIFA 2NS0A 2RV8A 4WXDA 3KLNA 3WTXC 2RNJA 3J81K 2EWNA 2P4WA 2OA4A 2EA2A 4PGHA 4EJVA 3ISPA 1F4KA 1L3LA 4ZYHA 3IC7A 2WV0A 2C6YA 5E1WA 4EJWA 1IN8A 2KKOA 4A12A 1W7PD 3GLXA 2FBIA 2VE9A 5ERIA 3GXOA 1KU2A 4HX7A 5BS6A 5HVQC 3KLOA 4EM2A 4OIRF 5BQTA 5FD6A 1USSA 2FBKA 1TLHB 4MTDA 3RKWA 3Q5FA 5AIPA 1DPUA 5FFZA 1U6GA 1REPC 2OU2A 1Z05A 3E5QA 3WTSC 3WODF 2EFQA 1QBJA 2PN6A 3DP7A 2EFOA 2M87A 4KIBA 2W85A 2RDPA 2XV4S 3P9CA 2Y48A 1DPRA 5DUKA 3WU1B 1W7PB 4MTEA 3JSOA 2D45A 2IP2A 1XB4A 2IPQX 5A2QZ 4HYEA 2ZCWA
chains in the Genus database with same CATH superfamily
4DZJA 3JSPA 3RZDJ 1OFCX 4A69C 2XKOA 3GCMA 4A3EJ 2M30A 1VQ9I 4DR2E 1U5TA 3SZPA 4F7ZA 4LB6B 1SMTA 1YS6A 1U2WA 2KLOA 4E7HA 2DA1A 2XRLA 3F8BA 3H5RA 4KA4A 1K83J 1SFEA 1X3WB 1IBKE 4Y3OA 4HTGA 3RCOA 4OOGC 4BAYA 5F3WA 5M5YJ 4ENMA 1EH7A 5JFRA 2VPLA 4XKVA 1A1IA 2LK2A 1R4MB 3K9TA 5TISC 2CG4A 3SEQA 2YRHA 1K6OA 2CRGA 2V1XA 3T1HE 2LY2A 5LHHA 3T1BA 4A3DJ 2ZJ2A 4A3LJ 1A5JA 1XGOA 3ONQA 5IYBJ 2GLIA 3EPLA 4A3KJ 1XDUA 3DU5A 4MNUA 1OCZH 1XCVA 4BQQA 5L3EA 2WC2A 3JRDA 2CFOA 3DPTA 2VKDA 5FKMA 4AUXA 5M3MJ 2A3SA 3F6OA 2ID3A 1IN7A 2ME0A 1QRYA 2V6CA 3DEUA 2KJBA 5CVJA 1MDMB 1Y1WJ 2RQQA 4I6ZA 1XGSA 3E1SA 3JRHA 3K1MA 2Z33A 4XSZF 1B6AA 4HSRA 1OYYA 3BTIA 5ICFA 4LLLA 1P4AA 3DFGA 5AE2A 2ZO4A 2L33A 3RQIA 1KYWA 5L3GA 4A3MJ 4KT6A 3OYHA 4RMNA 1A6IA 2VXDA 1BBYA 2K9SA 1LLMC 4MEYF 1R1TA 2YZTA 4BE0A 4KN7X 4QPOA 3HGGA 3J81C 4G94A 2YTPA 4XRMA 2MABA 2MGQA 3BG7A 5DEQA 4D1QA 3OIOA 4KUMA 3VB2A 2QQBA 1WZ2A 4GYIA 3AFHA 3SXYA 5FFXA 1F5TA 1XSVA 2GZWA 1I50J 3WGHA 4EEFG 1LFPA 2EMXA 2YU5A 1T8IA 3HHGA 5HS8A 2FEZA 4BE1A 1EKZA 5FRMA 3GFIA 5FLXK 2LO3A 1UMQA 1CQTA 2QGUA 3Q9SA 4Q48A 4G7HF 1P2FA 1W5CC 1AU7A 3LA3A 4IL6C 2KJCA 2EN8A 2EQ1A 3MWMA 1F1ZA 1FJLA 2L2NA 3I59B 1BB8A 2F5CA 3WTZA 2DT6A 2ELHA 1ON1A 2ZXIA 4HLYA 1DGRM 5TRDA 1T95A 1X2NA 4FX4A 2JZYA 1U5TB 2RS7A 2GPIA 1Q1VA 1MSFC 3BQZA 3AG1H 1MMDA 1A04A 2K02A 2M45A 4LK1F 1QNTA 4R8OA 4LF4E 2EB7A 5C44J 1JUPA 2X1EA 2DSYA 2EM0A 2STWA 1VQ6I 3WTWC 2Z3YA 1FMWA 4G6QA 2ZSIB 1TQIA 3SEZA 3OYCA 2BY0A 2H6CA 5K5QA 4M3DA 2VOOA 3E5UA 3PNVA 1V55H 3I58A 3PUFA 2CV2A 1STUA 1RI7A 3GFMA 2Y30A 1ACIA 2CW8A 3HRMA 1RRJA 2L9NA 4HNTA 2EPMX 2L9SA 3G73A 2ZM6E 3H3ZA 1RMDA 4CCKA 1DQUA 4HG2A 4DKKA 1NCSA 2DCEA 3FMSA 4IHSA 4IF4A 1VI0A 4GGGA 3FF5A 2PJPA 3LFKA 1KGSA 5LBQA 3GW2A 2E19A 1WJCA 2HHHE 1ZN2A 4ANJA 3DEEA 4HDUA 3GZ6A 4MLVA 1Y0UA 4Y13A 2IRFG 4E7IA 1X4PA 2YR2A 3S1NJ 2KRFA 2UXBE 2FMYA 1X1DA 1USTA 5AC4A 2BYVE 1D5YA 1U0JA 4UUSA 5JR3A 4XLEA 2VONA 1TWGJ 2HOTA 2YTGA 1L4SA 1S9HA 5E3NA 4BE2A 1P92A 3KETA 1LUJB 1NK3P 3J81Z 2EMWA 4A5NA 5K1YA 3TMOA 3H9JA 4NC8A 3LMLA 1WGXA 3GZ5A 2QYOA 2ECCA 3I5UA 2DPUA 3CCYA 1GTKA 2IA1A 2LBFB 3F21A 5F0FA 1X6HA 2BY1A 3FMQA 1OYIA 2UWMA 3ADLA 3CC2I 4NXNE 4F93B 2I9IA 1A36A 1I1GA 2WCC3 2Y0MA 1MBKA 4MQVA 1F36A 1IG7A 4IXAA 4RAFA 4XM3A 4XKWA 2W7NA 3N97A 5LD2C 1W4MA 3CZ6A 4YELA 2MH9A 5LGNA 1TW2A 2WTEA 2DB2A 1G6NA 1YG2A 2ZNZA 3C2BA 5J40A 1ITYA 3FM5A 3HKZA 5FKNA 1BOBA 1YTYA 1W1WE 2FJ1A 4JI3E 1CF7A 1BIBA 2QQ8A 2E1MC 2XAJA 1ZLKA 1X48A 2ENAA 3RSNA 1TW3A 1LJ9A 3KP7A 4M3BA 3ZR8X 1FSHA 1ETOA 5DCFA 3EQLF 2HU9A 2CV1A 1UG2A 1FEXA 1POGA 2VQGA 2E1CA 3K69A 3WG7H 4JBAA 2EMFA 1YRNA 1MBHA 2V9PA 3ASNH 3QQAA 4D9JA 2XSJC 1T38A 4CCJA 3CCRI 1YSAC 2XAQA 5GPCA 3CUOA 2CQ7A 1X1CA 2PMZA 2K3PA 2DA5A 2F4OB 2LG4A 2HYFA 3MKYB 3CCLI 3F6VA 4KN4X 4WX9A 2BE5F 4BBRJ 2HOEA 3ROUA 3IUOA 3HZJA 1WKMA 2PQ8A 4XKCA 3S14J 3G1OA 2NXNB 2K7LA 3ZQQA 3SQNA 4DZPA 1ZAOA 3QODA 2LUPB 1D0XA 1YS7A 1W36C 2EPAA 2YSRA 3I9V2 3BJ6A 2EH3A 4OAYA 5GADJ 2R5YA 3J7YJ 1JKOC 1IUFA 3TW7A 2CT1A 3TDZC 4YFKF 3DF6A 4O5GA 2A6EF 4WYQB 1DP7P 3FXRA 3CJRB 4K0KE 1JUMA 2G0EA 3H1CA 3DPLC 1TP4A 3CDIA 4CZZA 5KL6A 3MVPA 3ERED 4XNFA 2EM7A 1ZHFA 2ESHA 4FX0A 3U9GA 2EPUA 1Z91A 1LB2A 5BMZA 1ZQ3P 5KVRA 4ZYEA 5FKKA 3IP4B 5J8CA 1VQNI 3THOB 2EK5A 3VDXA 4DW6A 3HB9A 1UHMA 1UCRA 1P4XA 1ZARA 3K4CA 3CCJI 2JOBA 4LIUA 4IOCF 3CTAA 3AUZA 5KAFC 2FUG2 3RJPA 2DQRA 1TWCJ 3CP2A 4HQEA 2RVCA 3GMEA 2I8DA 2R7QA 1B1BA 3FDYA 3E5XA 4EQQA 2JVAA 4RHBB 4MFDA 1MNEA 1TNSA 2VBXA 2QA4I 1JHHA 3IAS2 3PNTA 3FM3A 5EDNA 1WJPA 3A01A 3TBIA 1XMKA 3S93A 3R0JA 1ZREA 2M7BA 4DOZA 1VQLI 4M0VA 1BR4A 3C18A 4DV5E 1X1PA 1ZELA 2Y0SN 3K70C 4JV5E 4JX4A 1QGPA 2CMPA 4IHXA 2HNHA 4ZC3A 3HSEA 1ZBQA 2F5DA 1XGNA 3BOQA 4I01A 1APLC 2EOQA 2NOJB 5IYCJ 1MMSA 4JX6A 5BPIA 2QF7A 1G2DC 4FE4A 2N3GA 4X0GA 2HVRA 1RR7A 1AAYA 1BM9A 1ERDA 3VYXA 3TOBA 4PFOA 2LD5A 3BZ6A 4DQ2A 5GTHC 3VFZA 3IV5A 5HNHA 4W1UA 4DUYE 3FK7A 1JUSA 2R4GA 1O3TA 3NEUA 1OCPA 3A03A 2BY3A 2F6CA 5DD8A 3I3LA 5EZHA 3EYYA 4DYRA 2NA2A 1T33A 3HRUA 2WA0A 2XC7A 2V88A 5EEGA 2W1OA 4NHRA 1YI2I 3TO6A 5L3DA 2OTLI 2EQ3A 4Z2YA 2NS8A 4R03A 5FROA 2EMZA 2ETHA 4E7SA 1WJBA 5F27A 3L2UA 4BY1J 1OISA 2HVSA 1BC7C 2LMDA 4HEA2 4GEQB 1XX5A 2WB1N 1MNMC 5CYVA 1ETXA 4WWCA 3CUQA 2UV1A 2COMA 2UXDE 1S7OA 1E3PA 5ED4A 4L18B 3G71I 2LE2A 1QPMA 3WTUC 3OIPA 1RUOA 4ASNA 4O6JA 1D8JA 4CSWA 2NVQJ 2EZIA 3T1YE 1TQMA 4U88A 2D5VA 1JJ6C 2R7VA 2M0MA 4BC9A 2TDXA 1VQ7I 1I39A 2MG4A 3OYBA 2L8TA 4LJZF 3W6VA 2ENHA 2NABA 2DI3A 2FXAA 4X9JA 4ZYGA 4C2TA 1IRGA 2DMIA 2YPNA 1P7IA 4AIDA 1HW1A 2VT3A 2FA5A 1PDAA 5B5EC 1IW7F 1S8NA 2EOEA 1YJWI 2EP3A 2Y2ZA 1UB9A 2QLZA 1ZRFA 1HC8A 2E35A 2EOMA 3A4CA 1BC8C 4BEHB 2K27A 3LLHA 4F3QA 2IBDA 2VC1A 1F9NA 2H8RA 1ZK8A 4ZYDA 4LGWA 4IX7A 1I6XA 2EFPA 4YG2F 3OV8A 1GV2A 2L7ZA 4M6YA 3DBLB 2AQFA 2H94A 2YTDA 1MEYC 2HFHA 3TKYA 1VQOI 2EPFA 2CV0A 2Z99A 4XSXF 4N4NB 4PGGA 1S72I 5J8FA 3LSKA 5D6FA 3CDLA 3AAFA 1WJEA 3LA2A 4J19A 2MC5A 3JRBA 1R00A 5CQGA 1QVUA 2CU7A 3SDGA 3GTGJ 2ISYA 1QQIA 4L9NA 2XRNA 2DA7A 2OQRA 1FTZA 4C30A 1FY7A 2DBBA 2EZLA 4V2FA 3V8LA 4DV6E 3BCBA 5KL3A 3R4KA 2PJRA 2EE8A 1OCRH 4JI8E 4II2A 5K5RA 1YLFA 4ENJA 2YX4A 2V87A 2UUAE 2IXSA 4FE7A 2XAHA 3N4MA 4XL9A 4QIWN 1JGSA 3PQJA 5LMNE 2GHFA 4E7KA 1T4OA 4F52A 3IAM2 3M1EA 3QOPA 4HBLA 4BKXA 1OCTC 1DU6A 3AV0A 2DRPA 5FD5A 2PMUA 5F64A 2KIQA 3OR2C 1EF4A 5A69A 4IQ4A 2ZXWH 4DBQA 2QQAA 2EOSA 1OYWA 5C4JJ 3OR1C 3KYCB 4XICA 3M4OJ 1XD7A 2A25A 3ADGA 2LDUA 1I27A 2IJLA 4JI7E 5J1RA 3LL7A 2EPNA 3VYYA 1O3QA 1S7EA 1R1VA 3M1CA 3ML6A 5DCMB 2W57A 1KZHA 3OSFA 4CICA 4QTRA 4G7ZF 2JRTA 5E8GA 2LT7A 2Q8UA 1YIOA 5BOXA 2G9WA 3LSPA 2OV7A 3RPQA 3KIOA 3VYSB 3V7CA 1HR0E 4P9FA 2DLQA 3SZGA 2GQQA 3OL3A 4F9AB 1K78B 1H9GA 1JKRC 2VC0A 3DPUA 2OBPA 3F8FA 2B3TB 4M6VA 2GBYA 2VXZA 2XPWA 5CVVA 3ZMTA 1OPCA 2K5CA 2KONA 2Y69H 4A6EA 3FXQA 2W24A 1IQOA 4M73A 4LFCE 4UB6C 5D8KB 3E6DA 3HOVJ 2R5ZB 2XF7A 4R2PA 4GRIA 1XG1A 1WJ5A 3FBNB 4Y33A 1J59A 3PQKA 3R0AA 4PJJA 3L7WA 4BYYA 3E7LA 2ESNA 3I4PA 2EM9A 1ZTRA 4HZFA 4MO7A 2LRDA 1HNWE 1WPKA 4HW0A 1G2HA 3DKYA 3H36A 4L9VA 2QKLB 2M0CA 2ISZA 5HS9A 4FK5C 3LSJA 2EIJH 4JI2E 1J09A 2XAFA 5HOOA 1RC7A 2BZTA 1QHGA 2CW0F 2DW4A 2E2JJ 4ZYAA 3I59A 3C3WA 4AVZA 5LLQA 2NVXJ 2PFBA 5HODA 3FHZA 1ZR9A 2GAUA 3QPHA 2F4IA 5GP9A 2XIGA 4RH8A 3SFZA 1H88C 3S32A 2YU9J 3LOCA 4PSWA 4KNYA 2ID6A 2KRCA 1MMGA 4I0AA 5IOYA 2P5VA 1R4NB 2NNYA 4BY7J 1NK2P 1ZBTA 3BTLA 2LREA 4YFXF 2NAZA 4KIGA 5BR8E 3BZCA 2M1BA 2IS4A 3JR9A 3MAJA 2DTZA 3NWTA 4BACA 2EPZA 2O6GE 2O9LA 4L0YB 4PSXA 3GTPJ 3FMRA 5JI6A 2DJNA 2QVOA 1VQPI 2H09A 1JI8A 4IHYA 1GLNA 4IRGA 4KYWA 3K4JA 4XORA 1OKRA 2X6XA 3WU0A 2I5UA 1WI3A 2HXIA 3FXMA 5AE1A 2Q2EA 2VI6A 4XLPF 1TZLA 3P9KA 2EPLX 1N25A 2D1HA 2H1LA 5H20A 1FBQA 2DMNA 1QZEA 3QYEA 4HLXA 3RPUD 4CH7A 2LR8A 4RGRA 2BGCA 2MLGA 2BXZA 2MKNA 4EGYA 3ZCOA 1Z6TA 3PFIA 5AE3A 4B3RE 2HI3A 1JK2A 4BC7A 3I54A 1T56A 3MKWB 4L8NA 3BC8A 4BJ5C 3PSIA 3J7AO 4RM2A 3M07A 1U9NA 3ASOH 3L2RA 1N3GA 2A61A 3EUHA 2MLKA 4RB3C 3AKZA 2ELZA 2NVYJ 2LTRA 3E0JB 1T98A 4WSGA 4A3GJ 1JT0A 2EM6A 2YSOA 3KWRA 2P5LC 3E6MA 2XPVA 1AKHA 4IPAA 2DMYA 1U9OA 4B4CA 2EMIA 3OYAA 4BCAA 4KMUX 2K9QA 3CO7C 3K1PA 2BEOA 4DGWB 2H27A 3ZQFA 1XNQE 5DD4A 1YW9A 1TWFJ 2EBIA 4ZJZA 4XLHA 1GQEA 1IC8A 2V89A 3D0SA 3GO5A 3ZRGA 1TQPA 4AM3A 1B8IA 1YX5A 4M3FA 5HDKA 2LY9A 4OMZA 4M9ZA 2LJUA 2E71A 1E3OC 1X19A 1XGMA 1Z67A 3RQ4A 2K86A 1RNLA 2L01A 2VQLA 3D5RC 2UUBE 2CSOA 3CMYA 4CHUA 3H35A 4B3SE 2RQPA 4R2AA 3KP6A 1E17A 5A6KA 1X1AA 2ZBKA 3FIWA 4BMJA 4RAYA 1B72B 4BQNA 2B63J 1R23A 4ON0A 2Z9OA 4OIOF 1QVTA 4PFPA 3FK6A 1XSXA 3CJTB 4Z6YA 1V54H 2A69F 3CUQB 3QAHA 4M6XA 2XGXA 1JKQC 4RS8A 5F6FA 4Q35B 1XNRE 4DR6E 4LG0A 4LF5E 3QPLA 2J7JA 4GKKE 4BXXJ 2LJHA 2NOGA 3K4NA 4WXCA 4R2QA 2CYYA 3C2HA 1SANA 4M3EA 5D5XB 2VQCA 1SMYF 3GFJA 3MN2A 2L7FP 1G8XA 2TCTA 2J5OA 4RA2A 4JI0E 2VB6A 4I76A 4WSPA 2CW7A 1BOAA 2UZKA 2EMAA 2HTSA 5LRSA 4BXFA 3ZMUA 3HUGB 4CYCB 3I71A 1T2KA 2WBTA 3IWZA 4HF0A 2E1MB 4B3TE 1Z21A 1A1KA 3U1DA 2A5WA 4YFNF 5TGTA 5HS7A 1D1CA 1BI0A 2B7EA 4DR4E 2FX0A 1EJ9A 1RESA 2ZJPF 4WFTA 4ZDPA 4DIQA 2V7FA 4JOMA 2LF7A 5D8LB 1LPQA 4HAMA 5DM6F 2HEOA 4V2GA 4O24A 2OCEA 4RM3A 3S8PA 1V3FA 1SVOA 1RUNA 2IA0A 3E97A 2WBSA 1YFHA 4M9VC 2EIKH 1FSEA 2L54A 1LKXA 1Z77A 2YTEA 4G9YA 2EMCA 4JI4E 2FQ3A 3KFWX 2HTJA 2Z16A 4M71A 1YPNA 3EETA 2VBZA 3CMMA 3OYDA 2HKOA 3SFIA 2WWYA 2E2HJ 1IXCA 1FPQA 1YE9A 3DLAA 2EN7A 4CO8A 1UZCA 3OMYA 1JGGA 4JI6E 1FBUA 3HRTA 3ZQGA 2V86A 5JLXA 2WAFA 1JE8A 4L9JA 3CD6I 1WWXA 2EL5A 4B3AA 2A07F 2B9DA 1X1BA 1UJ8A 1ZR4A 5IP6A 5KAIC 1WFXA 2KOUA 4FASD 4EATA 3S17J 3OS1A 2O5RA 2GOMA 2JSCA 1Z3XA 4ZZDA 1Z6RA 5LHIA 4A3JJ 2HWVA 4KFCA 4KISA 2H6BA 3T8TA 2FV4B 1O7FA 4OOIA 3W3CA 2PMHA 2XB0X 4M9SA 1DU0A 3J7Yp 2X48A 1Y1VJ 5DYMA 5ILVA 2A68F 2XASA 1X49A 3DQVC 1YYOA 3C2GA 1AOYA 2FE3A 5GAGJ 2ELKA 1BJAA 4XRSG 3ZN0A 4D5CA 3QOEA 4B48A 2LV2A 1J2XA 1P47A 1JK1A 2HVQA 2CQKA 3G4SI 5A2QC 5GTIC 4AIJA 1IJWC 4KJZA 1ZH5A 2A5YB 5CPRB 3ECRA 2EM2A 1E0EA 2CUEA 5HNFA 1LFUP 2DYSH 1Y56A 4F9BB 2KIFA 3S1QJ 1Z1BA 5F1RA 2O0YA 1G3TA 4FQGA 3N05A 4R2RA 3S3MA 1X6FA 2PEXA 1T4LB 2LYCA 2JVGA 1YIJI 3C4BA 2EL6A 1FP1D 2ELJA 2DLLA 3O6BB 3VYRB 3PO2J 1ZG1A 4TUIA 2R7UA 1YUJA 1J5YA 1SD7A 5H6QA 4DV4E 1BL0A 2Q8KA 5J1YA 4DV7E 4I2OA 1U8BA 1U78A 1V5FA 3SYTA 3IKTA 2FSWA 2WBMA 4KICA 2CS3A 1IRZA 1B72A 1BI3A 4UVBA 1R58A 4I09A 3CF2A 3DTIA 3KZYA 5D4RA 2L6MA 1OLTA 3KEQA 2LTPA 1G3SA 4V19K 5D5VB 2R92J 1HA8A 3ZMVA 1GV5A 1ORKA 2A05A 2DN0A 5EF6A 3BCAA 2HQ5A 2QEXI 3CCMI 3MHSC 1S7AA 2GIZA 2UUCE 1IRXA 3OYMA 2XDVA 2K40A 1PKPA 3TO9A 2NUGA 3KEYA 2WBUA 2PJRB 1FIAA 2HKXA 4NB5A 4CCNA 1WRJA 1B9MA 3K0LA 3LSGA 2EPKX 4CDGA 1FZPB 1SFUA 2L02A 4QWQA 4O5VA 2JRMA 2LKSA 2W84A 2ME6A 1MZBA 2M34A 5A6BA 3ABMH 1MDMA 2D2WA 3L2CA 1IQSA 3VSKA 2P6SA 3CJNA 3I55I 4DR3E 4CA0A 1A1FA 3TQMA 2NNNA 2DK8A 1HSJA 3L09A 3J80C 3WHBA 3CCVI 2BV6A 2DOEA 3F23A 2VRDA 4X64E 4JQFA 3VYUB 1LE8A 3W2AA 2K9LA 4H4KC 2A6TA 1N36E 3CESA 3EUHC 2X1DA 4P7DA 5F1JA 4Y17A 3IH3A 4A2UA 2YUSA 3F9KA 2LH9A 1HXDA 4K2EA 2LBSB 3OYGA 4B43A 4Y4RA 2O61A 3LFUA 1BW5A 3GEZA 2LF8A 2BY2A 3JRGA 2LCEA 5C3EJ 1IMUA 2FBHA 1B59A 1K79A 2STTA 3V4GA 4G12A 4WF2A 3TQNA 4XKBA 1V4RA 2VJ4A 1SFOJ 1OMIA 3GLLA 4U0YA 2WAQA 1X3ZB 3CDHA 4E7LA 4UHTA 2Y31A 1A6QA 2QM3A 2EMKA 2XAUA 1T39A 4KMFA 2AXTC 4BU2A 1ZG5A 2IW5A 3DJWA 1KU7A 2AQEA 5J1UA 1JKPC 3BR1A 2FNPA 2VN2A 2L9VA 3VODA 2YU3A 1IO2A 1J7KA 2MD5A 2X6WA 5D4SA 1VQMI 3K1NA 3IWCA 2E60A 2UXNA 2XHKA 1JXSA 2BXYA 4YEJA 3S2HJ 2X0LA 2RN7A 1G2FC 3L9FA 2L0KA 1K4TA 2M7QA 1MBJA 1ENHA 3H92A 1R7JA 3F3XA 5FLXZ 1ZAAC 2HXOA 3BY6A 3O8HA 4PJ0C 3BJAA 3CCEI 3ABLH 3A0HC 1O4XA 4AIHA 3HDDA 2EPRA 3BPXA 4G6TB 3E3VA 4A0YA 5EGOA 4AC0A 4FTHA 1SAUA 3S15J 2VKEA 1AH5A 3JW4A 1PJQA 1RIOH 2L4MA 5E3LA 4QLCU 3KP2A 2N3HA 4JI1E 4UUVA 4LMYA 3DTEA 5FKLA 3TGNA 3MKZA 2EN6A 3HGYA 2R7XA 1A1JA 3JTGA 5E3MA 2RSIA 2M3AA 2JJ7A 1SEUA 2ZSHB 1FT9A 3BF2A 2OJED 1ODDA 3M8EA 1IBME 2EV6A 3I0TA 1HQCA 2CGPA 4D7MA 2M9HA 3PUBA 2JA2A 4AYBN 3H9GA 4CCOA 2YRMA 2EOXA 2KFDA 4NXME 3PSFA 1W0UA 1WJDA 1FTTA 2E72A 3K2ZA 4CCLA 1GT0C 1XC5A 5JVGF 1KU9A 4A3IJ 2E34A 2EN1A 4PCQA 1WXRA 2LMZA 2O03A 2QENA 1W36D 3V7SA 2LKPA 1G59A 4UVCA 4LTYA 1A1GA 4ENKA 1X47A 1W5SA 1ZU1A 1W7PA 3LQRA 4RB2C 4ZH4F 4CYDA 2P81A 4HNUA 4BL0B 1RC9A 5E1ZB 2AO9A 3G3ZA 1J75A 1P4WA 2G7UA 1P6RA 2X6OA 2VE8A 4CXFA 3PIOF 3ZN1A 3GFLA 2ZFUA 2LKXA 4BH9A 3T8RA 4DYCA 3F6HA 3QWLA 4OAZA 2ZXJA 3OSGA 3RIRA 5L3CA 3J80K 2WB1A 3FXJA 1YHQI 3HPHA 4AVPA 1VTNC 1ZGWA 3LSIA 4PDKA 2M4GA 2K7IA 2EZHA 4HV6A 2LBFA 2DOFA 2DJIA 2V6EA 4IRIA 5D6EA 4C3JJ 5J4VA 1LEAA 1SAXA 1N34E 3LSHA 1E2XA 2V1DA 5A6AA 4I02A 4A3FJ 4H0EA 1NH3A 4R79A 3KZIC 3MFKA 3ZP5A 4YRVA 3HPGA 2BBYA 2EV5A 2N8XA 1IF1A 2Z2SB 1PJRA 1Z3YA 3A1YA 1N33E 4HV5A 2KIUA 1PJTA 3NARA 3F72A 3HM5A 1MD0A 3IH2A 2GXGA 1IAWA 2K85A 3QG5C 4M74A 2F8BA 1DQ3A 1UG0A 2DA3A 3A2KA 1ZYRF 3AL0B 2BVLA 2OD5A 1WJFA 2TRTA 5CVRA 2L2KB 4BJ6C 4MEXF 1W5TA 1XSDA 2ELYA 1N77A 1WH5A 2DAOA 2IS2A 2L7MP 4PJLA 4DUZE 2CFXA 5H2FC 3JAMC 3JTZA 3LWFA 2VASA 4L5EA 1G3YA 1XMQE 3V7RA 3OYJA 3HSRA 4J8ZA 3V42A 4GDFA 2R7FA 4OMYA 2ADUA 1NHAA 2DT5A 2P7CB 2EN2A 3LSMA 1MJBA 2YTJA 2E36A 1S3JA 4HF1A 1RR8C 5ICCA 1BA5A 3K6QA 5CVIA 4LIVA 2XGEA 2IGKA 3Q0UA 5K7HA 2IS1A 5ADZA 2MC3A 3B6AA 4ZTJA 2E2IJ 4LF6E 1JTYA 4GZNC 4ESJA 1KJKA 2COBA 2OAZA 4NQWB 4F2JC 4LFBE 1Q1HA 2VBYA 3H3UA 1R49A 2DA6A 5C4XJ 4JI5E 4EGZA 3P1XA 1FWZA 2YTIA 5F08A 1WHQA 3M9AA 1PP8F 2M8GX 2NYXA 3PO3J 2EMLA 1F2IG 4F9CB 3HKZN 1IDYA 3PL8A 1MBGA 5DM7F 3BZKA 1IBLE 3LA7A 2DTRA 1GDTA 4GFBA 1V5GA 1ZRDA 2EM8A 1ZKGA 4NC7A 3TOAA 2R7RA 2R5YB 4O3MA 2R7SA 2JY9A 4R8HA 4L0ZB 2W4SA 1PYVA 2DDBA 1Y8RB 2RKHA 1UILA 3OS2A 1FNNA 3BTJA 3HOZJ 1FP2A 1EH8A 1YOVB 3E6BA 5E1XA 5JLWA 1K4SA 4EVIA 3KYDB 3HPZA 4GXOA 1X58A 2ZFWA 3H5AA 2YPRA 4PUSA 2EM3A 3NRVA 2ACJA 2M5WA 2VE7C 5FLXC 5J4YA 3W6JB 2OUMA 2QKMB 1U3EM 1VZ0A 5A2QK 3SZTA 1GUUA 2GOXB 5CJ9A 3K2AA 5E18F 5KL5A 5M5XJ 1JTXA 2EOIA 3LQQA 4I8OA 5ICEA 3HTXA 1XPXA 4MLOA 4IJAA 1ON2A 2V9KA 3G6EI 4OX9E 2QSGX 4XOPA 2MC4A 2GXBA 2WV1A 5KL7A 3PFYA 5F0CA 2V1NA 5HLGA 1SFXA 3RKYA 2X4HA 3RTRA 1Y0NA 2V83A 1PUFB 2LOOA 2MDRA 5IV8B 2DFHA 1SFKA 5DS9A 5B1AH 1HKTA 2HZTA 1FYLA 2FOWA 4C3HJ 3GYHX 1U8RA 4F92B 2E7XA 1IN6A 5F0HA 1CF7B 1XN7A 3KE2A 3C1DA 3MMYB 1TT5B 2R7DA 2XROA 2YU8A 2YTOA 4A3CJ 3CUQC 4MHGA 4B09A 2JA5J 3P7NA 3CLOA 2Z5UA 3U2RA 1RZ4A 1LDKB 1Z9CA 1G4DA 3OYFA 2JP9A 1I94E 3KYLA 2PI0A 1RPWA 2KDZA 3HBLA 3PM1A 3MEXA 4XRSA 5FLMJ 4B47A 3D5SC 4RLQA 1WCMJ 2E5NA 4Y15A 1VQ8I 4B3ME 4LK0F 5EG0A 2NS7A 4RBOA 3VSLA 3VWBA 2EPPA 4A0ZA 3JREA 3NWSA 4A5MA 4DMIA 2F5VA 1J9IA 2EJ4A 4TUGA 2K4BA 2DA4A 2EFNA 3ZQ7A 4U87A 9ANTA 2JPCA 2HPMA 5IOZA 5BPDA 3WGGA 1O0WA 4XONA 1BN5A 1TWHJ 2VQEE 1R5GA 4ESFA 2F5FA 2ZMEC 1D8KA 4IQJA 2WZOA 2XKPA 2JA6J 2OPTA 2EJRA 2EOYA 3AG3H 2E1MA 2MA3A 3ZOBA 3M8FA 5ILSA 1X5WA 1OJLA 3QPTA 3EYIA 2P6TA 3Q3SA 3KP3A 4M3GA 1KQ8A 2ZMEB 5M5WJ 3C4TA 1V5EA 4LB5A 2VBWA 3WGIA 1VQ4I 2E1OA 3WE2A 1WHNA 2KRHA 5IYDJ 3RKXA 1YJNI 3HTSB 4Q28A 1MIJA 2LNBA 3BDDA 2B7VA 4X8WA 2JA8J 1HF0A 3FKJA 2E1NA 1Y8QB 3Q0WA 4P5OA 4PK4A 1ZGJA 5IPAA 4IZZA 1DI2A 4S0HB 4MFEA 4LFUA 1PDNC 4B8XA 1I3AA 5AASA 5EYRA 1HNZE 5B3SH 2RNGA 4TV7A 4UXNA 4HOBA 3KCCA 2DK5A 1T0FA 2DMTA 2XSDC 3K70D 1RQ0A 2CPNA 1N32E 1QZYA 2UXXA 2VT2A 1BJZA 2HYJA 2MD0A 3ZGKA 3CO6C 2QBYB 3HOXJ 4AIKA 1ZGAA 2FRHA 1B4AA 3A01B 3H9QA 4O43A 1LNWA 3FXKA 3C6MA 2Y75A 2IHR1 5D5UB 3CJQB 3TEDA 2ZB9A 2HDWA 4N4OB 3PNYA 1A35A 4WPYA 2XAGA 3THNA 3ADJA 1YZ9A 5J3LA 3HIFA 5E3OA 5K7ZA 1LVKA 4WK8F 1QA6A 4UV9A 2K4VA 4GKJE 2EOOA 2L3DA 4AD9A 3WTVC 1FIPA 3IKVA 3QYFA 4M9XA 4LF7E 2HDCA 4CZCA 2GLOA 1XMAA 2YTQA 2DMQA 5KNLA 5AC5A 4IO9F 1GXQA 2WADA 3LNQA 2HC5A 1WI9A 3MQ0A 4ABZA 5DCMA 4ZZLA 2WY7Q 4MGRA 3EPKA 3J80Z 1S29A 1IXRC 4HEIA 1SD6A 1GVJA 2JVHA 4C9YA 2EMGA 1ETWA 3DU6A 1R6RA 2E7WA 1MJAA 1WHUA 2DA2A 4YIFA 4BQAA 1HOMA 2JN6A 4R2CA 2CQNA 4BXUA 1IN5A 3CMEI 3NAUA 1AA7A 1UELB 4HRIA 2EQ0A 1YX3A 3RYPA 3EPJA 1UBDC 1X3UA 5L3FA 1DGWY 1G3WA 2DODA 1LQ1A 2R7TA 3BR6A 2RC4A 3K4LA 1YUIA 3DF8A 3HRSA 4UY8I 1MNDA 1RKTA 2JT1A 3EUKL 4M30A 1DGCA 3FWEA 1T6SA 3D5LA 3HPSA 3ABKH 4DBRA 2FF4A 3LSRA 4O4KA 1A1HA 2DXIA 2M7AA 2KISA 3SHFA 5LGTA 1R5HA 5FGMA 3BG6A 2KP6A 2W00A 2MBFA 3KP5A 2RGVA 1ZLJA 1Z1DA 3OYIA 4XLCA 3A02A 2EZ6A 1NTCA 1WVRA 2IGMA 1H0MA 1IZ1A 1HNXE 4HX4A 2N8GA 5KK1A 1GXPA 3KPHA 4S05A 2IAIA 2H36X 2RS6A 4NZVA 1TF6A 1KYZA 5TJJA 1MH4A 1PVEA 4IS1C 4Q4ZF 4XIDA 4HDVA 2R7ZJ 1SD5A 4E7JA 4BBSJ 2UXCE 2L9RA 2PG4A 2HOSA 3GBGA 2CO5A 2MYSA 4N9IA 3GTJJ 1BBOA 4WXHA 2NVTJ 2MH2A 2XUBA 1SC7A 3O8GA 4DR7E 3K7AJ 3MSWA 4OINF 3ZMDA 3F6GA 2L3CA 2JOXA 2ZJQF 3R6SA 4C2UA 5LHGA 3IRQA 5LGUA 2X1CA 2EMYA 2ZKZA 3M3YJ 4X1EA 1NG6A 2X85A 5JVTA 1DUXC 2OZUA 1LE8B 3TDUC 2F4MB 1VQKI 4JYAE 4L5NC 3L2QA 4R2SA 3ZPLA 5EEHA 3CCSI 4N0BA 2LC2A 2O8XA 3ZQHA 1TNTA 4BGDA 2DT7B 3WTTC 3JRAA 3HL2A 2VLAA 2YT4A 2CUJA 5LMUE 4DV2E 2LY1A 4XRFA 2VJIA 4IKFA 2EILH 3GF2A 5IP7J 1SD4A 4UNOA 2QSHX 2LVSA 5IP9J 4J00A 5M3FJ 3WTYC 4G6DA 1R36A 1I3QJ 4ESBA 3L1PA 3DV8A 2JA7J 1MKMA 1B69A 1D1BA 3F8CA 2L5QA 2ZNYA 2EM4A 2CUZA 1H9TA 4LF9E 4F91B 5DDGA 1VFCA 3M7GA 2V1UA 4BBYA 1NG7A 2YRKA 4NHJA 2JPBA 2EOZA 2L92A 2QZ8A 2EOHA 3VEPA 2EMHA 2ADRA 1XDSA 3HJEA 5CFFE 1YRNB 1PJSA 2EIMH 4KITB 2W25A 2VUMJ 2VKVA 4AWXB 1KONA 1PUEE 2XF5A 5IT3A 2W48A 2FMLA 1VQ5I 2WY8Q 3S1MJ 4AU7A 4GO1A 2K9NA 2VQHA 3K10A 4R1HA 4HX8A 3I56I 2M1SA 4EV0A 2MDGA 5HLHA 2OCCH 2BVMA 4R2DA 4IVNA 3RKQA 4E70A 3O2PE 2QQ9A 3COAC 2DLKA 3W6KB 2E5LE 2HQNA 2PBIA 2EINH 4D7NA 3KP4A 2CH0A 5LEJA 2HGCA 3ADIA 5FB2A 4Q47A 4JYKA 1IUYA 3H09A 2R76A 2P5KA 3REOA 1X3CA 4BDYA 2XGCA 1ZG3A 2R7OA 1XCBA 4MLQA 3ELKA 1YJ9I 2ZXHA 4E6KG 2O3FA 4JP0A 3B73A 5GAEJ 1ETQA 2GM4A 2L2MA 4IJDA 2CUFA 5LRRA 1TTYA 4II3A 3BROA 4IRHA 2MFZA 3HTUA 1LFBA 1GHCA 4F6NA 2RSMA 1JJ8C 2EN4A 2FD5A 4I7HA 1BW6A 2VODA 1HLVA 3MD2A 5H6RA 3HOUJ 2PRTA 3OYNA 3TP3A 3BTCA 4N9HA 4LG3A 5IT9Z 1F43A 5E8IA 3ERMA 2GWRA 2W82A 2XB5A 3FKIJ 5IWAE 4X6AJ 2JMWA 2RAEA 4GYGA 3RMPA 4P78A 3MCZA 4B3XA 2BW3A 1OCCH 4DV0E 4XMYA 3WHCA 2B7TA 4BHCA 5EEAA 3DKXA 1YW8A 4ZDOA 1SVLA 1Z7LA 4CUGA 3OYKA 2JWTA 3CC7I 3DWLE 4BHPA 2AHQA 3ZQCA 2D9HA 4X65E 4XQFA 4U7DA 2KHXA 1K7AA 1HKQA 3BPVA 1FOWA 4EM0B 3KZZA 2R5ZA 3BG9A 3T5XA 3HUGA 4UUSB 1P9QC 2VKHA 4LFAE 3WG9A 3S3NA 4RB0A 2JUGA 4IHVA 1OR7A 2VJ5A 5FJ8J 4MIMA 2M2EA 2JXPA 2K4JA 5K5OA 2OTJI 1IV8A 3BR2A 4I0BA 5LEKA 2V79A 3GWZA 3SJMA 1UHSA 3H5NA 3O3KA 6PAXA 2CSHA 1FC3A 4IHWA 3EUAA 2FOKA 4RAZA 4A6DA 3OWTA 4LOCA 3AL0C 4X66E 4AQYE 2GA1A 2ICWG 3Q9VA 1MSEC 3OYEA 4L9TA 1L0OC 2L2OA 4XN0A 5KHDA 4YY3E 1FX7A 4KT5C 1GVDA 2K3FA 2YWQA 4G7OF 2OQGA 2LSOA 4B44A 4CYCA 3OOPA 1T4NA 2V9VA 3C6KA 3GUDA 3WE3A 3GVAA 5B66C 3NQOA 3HXLA 1J0RA 1IN4A 2QBYA 1K78A 4J01A 2HR3A 1S5LC 2R3SA 4A3BJ 4BEHA 2XPUA 2YX7A 3QP5A 4NUBA 3BG3A 5KL2A 4EMSA 1ZRCA 2X9DA 4AYBA 3VK6A 5B1BH 3DTKA 3H0GJ 4DJAA 1MBFA 2VQFE 4X62E 3BR3A 2OF7A 4F55A 3P5JA 3FXUA 2CTDA 2V85A 3TW6A 5FKOA 1UHWA 3DBRB 2YSPA 1YYVA 1MBEA 5IY5H 1AHDP 3S2WA 2IVMA 2X6YA 1BI1A 2DQLA 2XGDA 2Z1DA 2R1FA 2EN3A 2NUEA 3RZOJ 1BR1A 2ZJRF 1MMAA 1YW7A 4NQWA 3S16J 1X6EA 4BNCA 2LVHA 2V4JC 5DTDA 2Q2EB 2F4VE 1QPIA 2CJJA 4M72A 1HCRA 1QU6A 4FETA 2L4AA 3JU0A 2JYAA 4OIQF 4RGUA 3HC7A 2A6HF 2FNAA 3BJOA 3EPZA 3QU3A 5IXMB 1OR7C 2HZDA 2MSYA 5GAHJ 3CMAI 4EJOA 5F04A 2D1VA 1Y39A 1D3YA 3I53A 4PJNA 2VL8A 3J7ZI 5T6JA 2XF6A 3G1LA 5E17F 4BQOA 2NVUB 5J47A 3FX3A 2LFBA 1H89C 3LAJA 1FKAE 1FBSA 4XBFA 2IEKA 1DP3A 4RB1A 3I64A 2LUQA 1EH6A 4P9UA 1S6LA 4JK1X 1AKHB 2DIXA 3SDBA 2WAQN 2K9MA 2CQQA 4FCYA 2CWEA 1IXSB 3DCFA 1W0TA 2UU9E 1UN6B 3K4KA 4HA8A 4ITVA 2DO7A 1TWAJ 4OIPF 4BJTA 3H3VK 5AONA 1SVMA 4UUTA 1YO5C 1BR2A 3T0YA 2JPAA 3IL2A 2KQRA 5J6XA 2JK3A 5DUIA 2EA4A 4DR5E 1ETVA 1UFMA 4KZSA 1B8IB 3C7JA 1OCOH 2O7OA 4ZDLA 3CQZJ 3FXLA 1HSTA 2VPRA 2F48A 4FT8A 3KEOA 3QRFF 1LDJA 4HSTA 2ZMEA 1RETA 3ULQB 3X2QH 1KQ0A 3HYIA 1WJAA 5CKTA 3HEFA 2Q1ZB 3VOEA 4BS9A 1CGPA 1FJGE 1ETKA 4RDUA 3L00A 3QP6A 3LMMA 1O3RA 2LP0A 1LEBA 4KHPE 2GIVA 2F2EA 1H8AC 2FGGA 3J7AY 4L5JA 2XVCA 5CVUA 1FOXA 3BGHA 3AG2H 1BBGA 5JHUA 2CQXA 4E7ZA 2B9SA 3IRRA 1TT0A 2HYGD 5IT9C 3JAMK 3K6GA 3R60A 3QU6A 1WQ2A 1C0WA 5FLVA 2JWOA 2J5PA 1MMNA 2PX9A 2IGNA 5EG0B 3JCUC 3F8NA 2L7KA 4LG0B 2DOAA 2AXLA 3EQ1A 4R2EA 4XN3A 2DYRH 1O3SA 1PP7U 3FBIB 1N75A 3CP8A 2DPDA 1ULYA 2KHMA 5HLIA 3OMLA 3ZMZA 3ZXSA 3VPRA 1HKSA 3BP8A 3FZVA 1JHFA 5D5WB 4M2ZA 1FMVA 3VHTB 5HLTA 2KZVA 3ECHA 1KYQA 3JRCA 2QCOA 3FISA 2M4KA 4LLNA 4ZTFA 5DV5A 3EPHA 3TO7A 4EJTA 2B0LA 3RYRA 1EKEA 2BOLA 2KT0A 3U21A 3GTMJ 4DNCA 3H0DA 4HF2A 1YYKA 5CLSA 2JQ7A 2L3JA 1R9TJ 1FOYA 4PJMA 2G7HA 5HDNA 2M8EA 1D5VA 4L5IA 2OC6A 2QUFA 4Y7NJ 1IDZA 1BI2A 1LVAA 3ABUA 2DFEA 1TBXA 3IWBA 4YIRX 1A1LA 2HS5A 2I10A 1FOKA 2MKDA 4KDPA 2P0WA 3MZYA 1XMXA 3M8JA 4XLFA 3BG5A 2EQRA 3B02A 1J5EE 3ZQIA 2IA2A 2YTFA 1R22A 2MC6A 2V8QB 2HOAA 4NNJA 3D1NI 4U7BA 1ZR2A 2MW8A 2QWWA 1KU3A 1IRFA 4U0VA 2RTXA 4D5FA 3DLLF 1KA8A 2DFIA 3K4MA 3ABTA 2VIXA 5L3BA 2Q0OA 1ONVA 3FIGA 1LDDA 3JAMZ 2BHYA 5JHFA 4UVAA 1U5TC 3UR3C 3E6CC 1I1SA 4N4RB 3HQ1A 4EM1A 3JRIA 3PJRA 4JX5A 3MHHC 4C2MJ 3OL4A 3L2VA 1IV6A 5EGOB 1N78A 1QZZA 4C3IJ 3JRFA 3BBGA 3L2WA 3HOSA 5FRNA 2KDOA 2EL4A 4BDZA 4G8XA 1B9NA 2EMBA 2FTXB 1STZA 1YYWA 3GZNB 4KWYA 3V8JA 4BHBA 3V8KA 2EM5A 2GXAA 1UAAA 3HSFA 2EPOA 1O7LA 3OY9A 4IOAF 4XR6A 1HDDC 5GPAA 4RGSA 3IWDA 1ETYA 4MQ9F 3RDIA 4PZJA 4A93J 3OYLA 2DFFA 3BWGA 2HPIA 4NBQA 2M9AA 2ODRC 2FU4A 3HHHA 4HQMA 3DXJF 2M4IA 4DV1E 2DDAA 3G2BA 2EWLA 1HDPA 2O8KA 1WH7A 3RPUA 3ECOA 1R71A 1XTAA 2IGOA 4DV3E 3BQYA 2RREA 5AIQA 5E20A 5DNYA 3FXOA 4W97A 1Y6IA 1TN9A 2AS5F 2PLYA 2BW3B 2HJJA 3OIQA 2NUFA 5EJCA 2BB8A 2EV0A 3S1RJ 4XLNF 3UKGA 2DGCA 1IGNA 4EJUA 4A0XA 3VYTB 4B1RA 1VF9A 1HW2A 3CC4I 1MGTA 4OU0A 4S04A 2VF1A 1QO0D 4NDLA 3R61A 3OS0A 1FYKA 2KIMA 3OOUA 4LD5A 2KPMA 1D0YA 4LLGF 2EPXA 2NRAC 5FO5A 3K4BA 3EDPA 3IHUA 4P55A 4ENNA 3GTLJ 1QU3A 5TSEA 3M99B 2P8TA 2KMUA 3IH4A 2H8WA 4YHHE 1KQ9A 2JTVA 3P9IA 4XK4A 4IHTA 3F8MA 4D0PA 2Y0SA 2EFWA 1YQAA 4P96A 3GTOJ 2R7WA 4LF8E 2IT0A 1RKWA 3GX4X 1SR9A 2LRSA 3I4NJ 1Z7UA 4QSHA 3MKLA 3S2DJ 3HOTA 2DU9A 2UUZA 5ICGA 2GA2A 1TF3A 1I5ZA 1OQYA 4U0WA 1DDNA 5LL6R 2KL4A 1D1AA 4I98B 3GTQJ 4Q5SF 1X4OA 4UV8A 3KX2A 3LSTA 3JTHA 4RGXA 3A0BC 4NC6A 4YIIA 3ZMSA 4CGZA 2Y9YA 4IEJA 1T08B 2R93J 1HBXG 1FLIA 3MZHA 1MH3A 5A6JA 1P7JA 2P7VB 1O57A 3CF5F 3I4MJ 3G1MA 3BIDA 1HW5A 5BNGA 2BBGA 2OZ6A 2YS9A 1BIAA 4CCMA 1MJ9A 4E4HA 2VOPA 3QYBA 2HQRA 1M1EB 3IWFA 4RAGA 2HDDA 4OWRB 1T0FC 1K6YA 1TC3C 1R5ID 2BHZA 5HDGA 3RI4A 3DKWA 2JUCA 2F5EA 3DBHB 2HQAA 5E79C 2HGHA 4DR1E 4ETSA 2KZGA 2H1KA 1I6HJ 1AWCA 3W2WA 3W2VA 3LAPA 3F22A 3J7AG 4RLFA 4WCGA 4LU9A 1D0ZA 5KCMA 3Q0VA 1WSUA 1PUFA 2I13A 2EOFA 4FHTA 1R1UA 2EORA 4F54A 5ILUA 1FYMA 2EOJA 1EV7A 2V26A 1GZ6A 5IT9K 1EA3A 4I99C 4KIFA 2NS0A 1MW7A 2RV8A 2ENCA 4WXDA 5EZGA 3S3OA 1NEIA 1YITI 3KLNA 3WTXC 2Y9ZA 2RNJA 3J81K 2JR1A 2EWNA 2P4WA 2OA4A 2EA2A 2PMZN 5A6BD 3PIPF 4PGHA 4EJVA 3ISPA 3BLYA 3ZQLA 1QHHD 1L3LA 1F4KA 2ODRD 4XLAA 4ZYHA 3IC7A 3AG4H 2WV0A 2C6YA 5E1WA 4BUPA 4EJWA 1IN8A 2KKOA 4A12A 5K7FA 1W7PD 3GLXA 3ZOQB 4F6MA 2EZKA 1K61A 2FBIA 1X2MA 4HYEA 2VE9A 2YTNA 1J26A 3MZ8A 2WAEA 5ERIA 1E3HA 3GXOA 2LLKA 1KU2A 3FHNA 4HPQA 4HX7A 5BS6A 5HVQC 2ECBA 3KLOA 4UB8C 5CQEA 4OIRF 4EM2A 5BQTA 2FQ4A 3BR0A 3F0CA 5FD6A 3OTOE 3B6CA 2DMPA 3WU2C 1USSA 2FBKA 1TLHB 4Y52J 3QPSA 3ESWB 4MTDA 3RKWA 3TP0A 3Q5FA 1VNDA 4QPQA 5AIPA 1DPUA 2ZC2A 1U6GA 2OU2A 5FFZA 3E5QA 1Z05A 1A31A 3BR5A 1REPC 1JT6A 3WODF 3WTSC 1UHZA 2EFQA 2E5ZA 3CCUI 4P1WA 1QBJA 2LTSA 2PN6A 2EPCA 3BT9A 3DP7A 1XS9A 2EFOA 3HOYJ 1XMOE 2R0QC 3TL4X 2M87A 4KIBA 2IS6A 2DMUA 2W85A 2X51A 3UK3C 5KL4A 2RDPA 2XV4S 3HG9A 3P9CA 4FISA 2Y48A 1DPRA 3U1KA 5DUKA 3CCQI 3WU1B 1W7PB 2VJJA 4MTEA 4DYQA 3JSOA 2JSPA 4LITA 3CLQA 2D45A 4XOTA 3GTKJ 2RQLA 1Z0XA 2IP2A 2RPCA 3UNGC 3HOWJ 5LFAA 1XB4A 2QSFX 2IPQX 1TL8A 4HNVA 5A2QZ 3DEWA 4GCVA 2ZCWA
chains in the Genus database with same CATH topology
3JSPA 2XKOA 2M30A 1U5TA 3SZPA 4F7ZA 4LB6B 1SMTA 1YS6A 1U2WA 3F8BA 4KA4A 1SFEA 4BAYA 4ENMA 1EH7A 5JFRA 3K9TA 2CG4A 1K6OA 2V1XA 5LHHA 3T1BA 2ZJ2A 1XGOA 1XDUA 4MNUA 1XCVA 5L3EA 2WC2A 3DPTA 2A3SA 3F6OA 5CVJA 1IN7A 3DEUA 2V6CA 1MDMB 2KJBA 1XGSA 2Z33A 3K1MA 4XSZF 1B6AA 1OYYA 5ICFA 4LLLA 1P4AA 3DFGA 2ZO4A 1KYWA 5L3GA 1BBYA 4MEYF 1R1TA 4KN7X 4G94A 5DEQA 4KUMA 3VB2A 2QQBA 4GYIA 3SXYA 5FFXA 1F5TA 1XSVA 2GZWA 3WGHA 3HHGA 5HS8A 2FEZA 3GFIA 5FLXK 3Q9SA 4Q48A 4G7HF 1P2FA 3LA3A 2KJCA 3MWMA 1F1ZA 3I59B 2F5CA 3WTZA 2ELHA 1ON1A 4HLYA 5TRDA 4FX4A 2JZYA 1U5TB 1A04A 2K02A 2M45A 4LK1F 1QNTA 2EB7A 2STWA 3WTWC 2Z3YA 4G6QA 1TQIA 2H6CA 5K5QA 2VOOA 3E5UA 3I58A 1RI7A 3GFMA 3HRMA 3G73A 3H3ZA 3FMSA 4IHSA 4IF4A 4GGGA 3FF5A 2PJPA 3LFKA 1KGSA 5LBQA 3GW2A 1ZN2A 4HDUA 3GZ6A 1Y0UA 4Y13A 2IRFG 2YR2A 2KRFA 2FMYA 1USTA 2BYVE 5JR3A 2VONA 1P92A 3KETA 3J81Z 4A5NA 5K1YA 3GZ5A 2QYOA 3I5UA 2DPUA 2IA1A 3F21A 3FMQA 1OYIA 2UWMA 1I1GA 2Y0MA 4MQVA 4IXAA 3N97A 1W4MA 2MH9A 5LGNA 1TW2A 2WTEA 1G6NA 1YG2A 2ZNZA 3FM5A 1YTYA 1CF7A 1BIBA 1ZLKA 2XAJA 1LJ9A 1TW3A 3KP7A 1FSHA 5DCFA 3EQLF 2E1CA 3K69A 4JBAA 1T38A 2XAQA 3CUOA 2HYFA 3F6VA 4KN4X 4WX9A 2BE5F 2HOEA 3ROUA 1WKMA 2PQ8A 2K7LA 3SQNA 1ZAOA 1YS7A 2YSRA 3BJ6A 3TDZC 4YFKF 2A6EF 1DP7P 3FXRA 3DPLC 4CZZA 3ERED 1ZHFA 2ESHA 4FX0A 3U9GA 1Z91A 1LB2A 5BMZA 5KVRA 4ZYEA 5J8CA 2EK5A 1UHMA 1UCRA 1P4XA 1ZARA 3CTAA 3RJPA 2DQRA 4HQEA 2RVCA 1B1BA 3E5XA 4EQQA 1TNSA 2VBXA 1JHHA 3FM3A 1XMKA 3R0JA 1ZREA 3C18A 1QGPA 3HSEA 2F5DA 1XGNA 3BOQA 4I01A 5BPIA 1BM9A 3TOBA 3BZ6A 4DQ2A 3VFZA 1O3TA 3NEUA 5DD8A 3EYYA 3HRUA 5EEGA 3TO6A 5L3DA 4Z2YA 2ETHA 1BC7C 5CYVA 4WWCA 3CUQA 2COMA 1S7OA 5ED4A 4L18B 1QPMA 3WTUC 1RUOA 4ASNA 4O6JA 1D8JA 1TQMA 4U88A 2TDXA 4LJZF 2DI3A 2FXAA 4ZYGA 1IRGA 1HW1A 2VT3A 2FA5A 1IW7F 1S8NA 1UB9A 2QLZA 1ZRFA 1BC8C 2K27A 2VC1A 1F9NA 4ZYDA 4LGWA 1I6XA 2EFPA 4YG2F 3OV8A 4M6YA 2H94A 2HFHA 3TKYA 2Z99A 4XSXF 4PGGA 5J8FA 5D6FA 3AAFA 3LA2A 1R00A 2ISYA 1QQIA 4L9NA 2XRNA 2OQRA 1FY7A 2DBBA 3V8LA 3R4KA 5K5RA 4ENJA 1YLFA 2YX4A 2XAHA 3N4MA 1JGSA 3PQJA 3M1EA 3QOPA 4HBLA 5FD5A 2PMUA 5F64A 2QQAA 1OYWA 1XD7A 2LDUA 1I27A 2IJLA 1O3QA 5DCMB 1R1VA 3ML6A 2W57A 4CICA 4G7ZF 2JRTA 5E8GA 1YIOA 5BOXA 2G9WA 3RPQA 3V7CA 4P9FA 2GQQA 1K78B 1H9GA 2VC0A 2OBPA 3F8FA 2VXZA 5CVVA 3ZMTA 1OPCA 4A6EA 3FXQA 2W24A 4M73A 5D8KB 3E6DA 1J59A 3PQKA 3R0AA 3L7WA 4BYYA 2ESNA 3I4PA 4HZFA 4HW0A 2ISZA 4L9VA 5HS9A 2XAFA 5HOOA 2CW0F 2DW4A 3I59A 3C3WA 5LLQA 2PFBA 3FHZA 2GAUA 3QPHA 2XIGA 3SFZA 4KNYA 4I0AA 2P5VA 2NNYA 4YFXF 2NAZA 4KIGA 2M1BA 3MAJA 2O6GE 4L0YB 3FMRA 5JI6A 2QVOA 2H09A 4IRGA 4KYWA 1OKRA 3WU0A 2Q2EA 4XLPF 3P9KA 2D1HA 5H20A 1FBQA 4HLXA 4RGRA 2BGCA 2MLGA 4EGYA 1Z6TA 3PFIA 3I54A 3J7AO 2A61A 3EUHA 2MLKA 4RB3C 1T98A 2P5LC 3E6MA 4IPAA 4KMUX 3CO7C 3K1PA 2BEOA 2H27A 5DD4A 1YW9A 3D0SA 3GO5A 1TQPA 5HDKA 4OMZA 4M9ZA 1XGMA 2K86A 1RNLA 2L01A 2CSOA 4CHUA 2RQPA 3KP6A 1E17A 2ZBKA 4RAYA 1R23A 4ON0A 2Z9OA 4OIOF 1XSXA 2A69F 3CUQB 3QAHA 4M6XA 2XGXA 4RS8A 5F6FA 4LG0A 4WXCA 2CYYA 5D5XB 1SMYF 3GFJA 2J5OA 1BOAA 2UZKA 2HTSA 5LRSA 3ZMUA 3I71A 1T2KA 3IWZA 4HF0A 3U1DA 4YFNF 5HS7A 1BI0A 2LF7A 5D8LB 4HAMA 2HEOA 1V3FA 1RUNA 2IA0A 3E97A 1YFHA 1FSEA 2L54A 4G9YA 2FQ3A 3KFWX 2HTJA 4M71A 3EETA 2VBZA 2HKOA 2WWYA 1IXCA 1FPQA 4CO8A 1FBUA 3HRTA 1JE8A 4L9JA 1WWXA 2A07F 2JSCA 4ZZDA 1Z6RA 5LHIA 2HWVA 4KFCA 2H6BA 3T8TA 1O7FA 4OOIA 2PMHA 4M9SA 5DYMA 5ILVA 2A68F 2XASA 3DQVC 1AOYA 2FE3A 1BJAA 3ZN0A 1J2XA 2CQKA 4AIJA 1ZH5A 2A5YB 2KIFA 5F1RA 2O0YA 1G3TA 2PEXA 1FP1D 2DLLA 3O6BB 1ZG1A 1J5YA 1SD7A 5H6QA 2Q8KA 4I2OA 1U78A 3IKTA 2FSWA 4KICA 1BI3A 4UVBA 1R58A 4I09A 3KZYA 5D4RA 3KEQA 1G3SA 5D5VB 3ZMVA 1S7AA 3TO9A 2HKXA 4NB5A 1WRJA 1B9MA 3K0LA 4CDGA 1FZPB 1SFUA 2L02A 4QWQA 4O5VA 2W84A 1MZBA 1MDMA 2D2WA 3L2CA 2P6SA 3CJNA 2NNNA 2DK8A 1HSJA 3L09A 2BV6A 3F23A 4JQFA 4Y17A 4A2UA 1HXDA 4K2EA 2O61A 3GEZA 2LF8A 2STTA 2FBHA 1B59A 1K79A 3V4GA 4WF2A 3TQNA 1V4RA 1OMIA 4U0YA 3CDHA 4UHTA 2QM3A 1T39A 4KMFA 1ZG5A 2IW5A 1KU7A 2FNPA 2VN2A 3VODA 1J7KA 2MD5A 2YU3A 5D4SA 3K1NA 2UXNA 2XHKA 1JXSA 2X0LA 2RN7A 3L9FA 3H92A 1R7JA 3F3XA 5FLXZ 3BY6A 3BJAA 4AIHA 3BPXA 3E3VA 4A0YA 3JW4A 1RIOH 2L4MA 4QLCU 3KP2A 4UUVA 4LMYA 3TGNA 3JTGA 1FT9A 1ODDA 3M8EA 2EV6A 3I0TA 1HQCA 2CGPA 3K2ZA 1KU9A 4PCQA 2O03A 2QENA 3V7SA 2LKPA 4UVCA 4ENKA 1W5SA 1W7PA 3LQRA 4RB2C 4ZH4F 4CYDA 5E1ZB 3G3ZA 1J75A 1P4WA 2G7UA 1P6RA 2VE8A 4CXFA 3ZN1A 3GFLA 4BH9A 3T8RA 2ZXJA 3RIRA 5L3CA 3J80K 4AVPA 1VTNC 4PDKA 4HV6A 4IRIA 5D6EA 1SAXA 1LEAA 1E2XA 2V1DA 4I02A 4H0EA 4R79A 3MFKA 3ZP5A 2BBYA 2EV5A 1IF1A 4HV5A 2KIUA 3F72A 1MD0A 1IAWA 2GXGA 4M74A 1ZYRF 2OD5A 5CVRA 4MEXF 1W5TA 1XSDA 2DAOA 2CFXA 3LWFA 1G3YA 3V7RA 3HSRA 2R7FA 4OMYA 2ADUA 1NHAA 2DT5A 2P7CB 1MJBA 1S3JA 4HF1A 5ICCA 5CVIA 2MC3A 4ESJA 2OAZA 1Q1HA 2VBYA 3H3UA 4EGZA 1FWZA 3M9AA 1PP8F 2NYXA 3LA7A 2DTRA 1ZRDA 3TOAA 4O3MA 4R8HA 4L0ZB 2RKHA 1FNNA 1FP2A 1EH8A 3E6BA 5E1XA 4EVIA 4GXOA 2ZFWA 2YPRA 3NRVA 2ACJA 2M5WA 3W6JB 1U3EM 5A2QK 3SZTA 5CJ9A 5E18F 3LQQA 5ICEA 4IJAA 1ON2A 2GXBA 5HLGA 1SFXA 3RKYA 2X4HA 3RTRA 1HKTA 2HZTA 1FYLA 3GYHX 1U8RA 2E7XA 1IN6A 1CF7B 1XN7A 3KE2A 3C1DA 2R7DA 2XROA 3CUQC 4MHGA 4B09A 3P7NA 3CLOA 2Z5UA 3U2RA 1RZ4A 1LDKB 1Z9CA 1G4DA 2PI0A 3MEXA 4Y15A 4LK0F 4A0ZA 4A5MA 1J9IA 2K4BA 2EFNA 3ZQ7A 2JPCA 5BPDA 3WGGA 1BN5A 1R5GA 4ESFA 2F5FA 1D8KA 2XKPA 2EJRA 2MA3A 3M8FA 5ILSA 3QPTA 3EYIA 2P6TA 3KP3A 1KQ8A 2ZMEB 4LB5A 2VBWA 3WGIA 3WE2A 3RKXA 3HTSB 2LNBA 3BDDA 2E1NA 4P5OA 1ZGJA 4LFUA 1PDNC 4B8XA 4TV7A 4UXNA 4HOBA 3KCCA 2DK5A 1T0FA 1QZYA 2UXXA 2VT2A 2QBYB 3CO6C 4AIKA 1ZGAA 2FRHA 1B4AA 1LNWA 2Y75A 5D5UB 2XAGA 3HIFA 4WK8F 4UV9A 2L3DA 4AD9A 3WTVC 3IKVA 4M9XA 2HDCA 1XMAA 1GXQA 1WI9A 3MQ0A 5DCMA 4ZZLA 4MGRA 3J80Z 1S29A 1IXRC 1SD6A 1GVJA 2E7WA 1MJAA 4YIFA 4BQAA 4BXUA 1IN5A 3RYPA 1X3UA 5L3FA 1G3WA 1LQ1A 2RC4A 3DF8A 3HRSA 2JT1A 3FWEA 1T6SA 3D5LA 2FF4A 3SHFA 5LGTA 1R5HA 5FGMA 3KP5A 2MBFA 2RGVA 1ZLJA 1Z1DA 1H0MA 1IZ1A 4HX4A 5KK1A 1GXPA 4S05A 1KYZA 5TJJA 4Q4ZF 4HDVA 1SD5A 2PG4A 2CO5A 4N9IA 4WXHA 2MH2A 2XUBA 4OINF 3ZMDA 3R6SA 5LHGA 3IRQA 5LGUA 2ZKZA 5JVTA 1DUXC 2OZUA 3TDUC 3ZPLA 5EEHA 4N0BA 2O8XA 3WTTC 1TNTA 4XRFA 3GF2A 1SD4A 4UNOA 3WTYC 4G6DA 1R36A 4ESBA 3DV8A 1MKMA 3F8CA 2ZNYA 1H9TA 5DDGA 3M7GA 2V1UA 4NHJA 2JPBA 2QZ8A 3VEPA 1XDSA 2W25A 4AWXB 1PUEE 5IT3A 2FMLA 4GO1A 4R1HA 4HX8A 4EV0A 5HLHA 4IVNA 4E70A 3O2PE 2QQ9A 3COAC 3W6KB 2HQNA 2PBIA 3KP4A 5LEJA 2HGCA 5FB2A 4Q47A 1IUYA 2P5KA 3REOA 1ZG3A 1XCBA 3ELKA 2O3FA 3B73A 5LRRA 1TTYA 3BROA 4IRHA 3HTUA 1GHCA 4I7HA 2VODA 5H6RA 4N9HA 5IT9Z 5E8IA 2GWRA 4GYGA 3MCZA 4BHCA 1YW8A 4GCVA 4BHPA 4U7DA 1K7AA 1HKQA 3BPVA 4EM0B 3KZZA 3T5XA 3HUGA 3WG9A 4RB0A 1OR7A 2K4JA 5K5OA 4I0BA 5LEKA 2V79A 3GWZA 6PAXA 3O3KA 1FC3A 2FOKA 4RAZA 4A6DA 2GA1A 3Q9VA 4L9TA 1L0OC 1FX7A 4KT5C 4G7OF 2OQGA 2LSOA 3OOPA 2V9VA 3GUDA 3WE3A 3GVAA 3NQOA 1J0RA 1IN4A 2QBYA 1K78A 2HR3A 2R3SA 2YX7A 3QP5A 4EMSA 1ZRCA 3FXUA 1UHWA 1YYVA 3S2WA 2IVMA 1BI1A 2DQLA 1YW7A 4NQWA 4BNCA 4M72A 2L4AA 4OIQF 4RGUA 2A6HF 2FNAA 3BJOA 3QU3A 4EJOA 2D1VA 1D3YA 3I53A 5E17F 3FX3A 3LAJA 1FBSA 4XBFA 4RB1A 3I64A 1EH6A 4P9UA 1S6LA 4JK1X 2CWEA 1IXSB 4HA8A 2DO7A 4OIPF 5AONA 1YO5C 3T0YA 3IL2A 5J6XA 5DUIA 2EA4A 1UFMA 3C7JA 1HSTA 4FT8A 3KEOA 3QRFF 1LDJA 2ZMEA 3ULQB 1KQ0A 3HYIA 3VOEA 1CGPA 3L00A 3QP6A 1O3RA 1LEBA 2GIVA 2F2EA 4L5JA 2XVCA 5CVUA 5JHUA 3IRRA 2HYGD 3JAMK 3R60A 3QU6A 1WQ2A 1C0WA 2J5PA 3F8NA 4LG0B 2AXLA 1O3SA 1PP7U 2DPDA 1ULYA 5HLIA 3ZMZA 1HKSA 3BP8A 3FZVA 1JHFA 5D5WB 3ECHA 4LLNA 5DV5A 3TO7A 4EJTA 2B0LA 3RYRA 4DNCA 4HF2A 5CLSA 2G7HA 5HDNA 2M8EA 1D5VA 4L5IA 2QUFA 1BI2A 1LVAA 3ABUA 1TBXA 2HS5A 1FOKA 4KDPA 3MZYA 3B02A 2IA2A 1R22A 4U7BA 2QWWA 1KU3A 1IRFA 4U0VA 1KA8A 2DFIA 3ABTA 5L3BA 2Q0OA 1ONVA 1LDDA 3JAMZ 3E6CC 4UVAA 1U5TC 1I1SA 4EM1A 1QZZA 3HOSA 4G8XA 1B9NA 1STZA 3V8JA 4BHBA 3V8KA 3HSFA 1O7LA 4RGSA 4MQ9F 3RDIA 4PZJA 3BWGA 2FU4A 3HHHA 4HQMA 3DXJF 3RPUA 3ECOA 5AIQA 5E20A 2AS5F 2PLYA 2EV0A 4XLNF 4EJUA 4A0XA 1HW2A 1MGTA 4OU0A 4S04A 1QO0D 3R61A 1FYKA 2KIMA 4LD5A 4LLGF 2NRAC 5FO5A 3EDPA 3IHUA 4P55A 4ENNA 2P8TA 1KQ9A 2JTVA 3P9IA 4IHTA 3F8MA 4D0PA 2EFWA 1YQAA 4P96A 2IT0A 3GX4X 1Z7UA 3HOTA 2DU9A 5ICGA 2GA2A 1I5ZA 4U0WA 1DDNA 4I98B 4Q5SF 4UV8A 3LSTA 3JTHA 4RGXA 4YIIA 3ZMSA 4CGZA 1HBXG 1FLIA 3MZHA 2P7VB 1O57A 1HW5A 2OZ6A 1BIAA 1MJ9A 2VOPA 2HQRA 3IWFA 5HDGA 3RI4A 3DKWA 2F5EA 4ETSA 1AWCA 3LAPA 3F22A 4WCGA 1WSUA 4FHTA 1R1UA 5ILUA 1FYMA 1EV7A 5IT9K 4KIFA 2NS0A 2RV8A 4WXDA 3KLNA 3WTXC 2RNJA 3J81K 2EWNA 2P4WA 2OA4A 2EA2A 4PGHA 4EJVA 3ISPA 1F4KA 1L3LA 4ZYHA 3IC7A 2WV0A 2C6YA 5E1WA 4EJWA 1IN8A 2KKOA 4A12A 1W7PD 3GLXA 2FBIA 2VE9A 5ERIA 3GXOA 1KU2A 4HX7A 5BS6A