2WZOA

The structure of the fyr domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
146
structure length
146
Chain Sequence
b'GRPVFPIGLGGLTVYSLGEIITDRPGFHDESAIYPVGYCSTRIYASMKCPDQKCLYTCQIKDGGVQPQFEIVPEDDPQNAIVSSSADACHAELLRTISTTMGKLMPNLLPAGADFFGFSHPAIHNLIQSCPGARKCINYQWVKFDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSFORMING GROWTH FACTOR BETA REGULATOR 1
publication title The Structure of the Fyr Domain of Transforming Growth Factor Beta Regulator 1 (Tbrg1)(Pna)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 35
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2009-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05964 FYRN F/Y-rich N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.360 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2wzoA01
2WZOA
chains in the Genus database with same CATH superfamily
3JU0A 4O4KA 4F9CB 1IBLE 3LLHA 4BHCA 4DR7E 1YUIA 2ODRC 4Q28A 4WYQB 5LLQA 5KL7A 3K6QA 5A6BA 3BBGA 2LO3A 3BGHA 2EMXA 1KYQA 2LT7A 2EN7A 1N3GA 2EMLA 3IWDA 2EM2A 1IQSA 2N3HA 1J26A 1L4SA 2RPCA 2WBSA 2JYAA 2M4IA 3OMLA 1N34E 2EOYA 2LV2A 1WHQA 3P1XA 1PJSA 1RC7A 2K7IA 4X64E 2JR1A 2LMZA 1HNZE 2FV4B 1FKAE 4HTGA 2F8BA 1ZBTA 1RQ0A 3MHHC 1X48A 1A1KA 2UU9E 3EQ1A 1UBDC 2ADRA 3L00A 4ZYDA 4LFAE 2KONA 1KJKA 2KOUA 2WZOA 1TF6A 1WXRA 2JPAA 2I9IA 4O24A 4IS1C 1T4LB 2JWOA 4R03A 2GLIA 2YTNA 4ZYEA 3AUZA 2NUGA 2VE7C 2EPKX 1YFHA 3C6KA 1MGTA 4JI4E 2VF1A 1YPNA 4JI3E 3F6HA 4KHPE 1UN6B 5ADZA 2GPIA 2HC5A 3EPLA 2MKNA 1YSAC 4WXDA 2EMKA 1DI2A 2EMFA 2YTIA 3ADJA 4LU9A 1T39A 4FK5C 4BHBA 1IBME 2ENCA 1XNRE 4JYAE 1ZU1A 3H09A 5LL6R 4LFBE 3TQMA 1TN9A 2DRPA 4KWYA 1X47A 1G2DC 1FJGE 2MC6A 4R2CA 2EPZA 2L2NA 5KL5A 1BBOA 2LTSA 2V88A 2YZTA 2R1FA 2MDRA 2EOSA 4DV4E 2V87A 2YTOA 2EMWA 2RS7A 4F9BB 3MSWA 2VQFE 2RQLA 4R2SA 3M99B 3J7Yp 3ADIA 5CFFE 2PRTA 4BC7A 2H36X 3HPZA 5A6AA 1IMUA 2V83A 4WSPA 2ENHA 3QG5C 4DV0E 4JV5E 1N36E 2I13A 1T4NA 4R2EA 2NA2A 2YSOA 4KZSA 2YTQA 2YPNA 5KL6A 4WX9A 2ELYA 2EN1A 2D9HA 2EM0A 2YTFA 1EH8A 2FGGA 2NUFA 1N33E 2EZ6A 2RTXA 4DR5E 4ZYHA 2EOQA 2EM9A 4LF7E 1WJPA 4DR3E 2EL6A 2M7QA 1JK2A 2LRSA 3J7AG 2EOJA 4NXME 4ZYGA 2ZM6E 4DR6E 2DGCA 5IXMB 2YTJA 4NHRA 3EPHA 1X6FA 4NZVA 2UXBE 4X9JA 1ZBQA 2EOXA 4MLVA 1UHZA 2EOHA 1UILA 2B7VA 2EMAA 2EP3A 4WPYA 3ECRA 4F6MA 2E72A 4WFTA 4JI0E 2CTDA 2DB2A 4DUZE 1EH6A 4F6NA 4YHHE 2LTRA 4Q35B 4O5GA 3IWCA 3HQ1A 2EM8A 1T38A 1O0WA 3KZZA 1MEYC 3THNA 2L6MA 1A1GA 5IT9C 4DR2E 2EPMX 2F4VE 2JVAA 3BF2A 4F54A 2ENAA 5DNYA 4JI6E 1NCSA 5LMNE 3VYXA 2KHXA 2YTEA 4K0KE 1EKZA 1HNWE 2L33A 4LFCE 4DV7E 4JI1E 2LJHA 2YU5A 2EPRA 2K4VA 2LUQA 1GTKA 1TF3A 4M30A 5F3WA 3T1HE 5A6KA 3HTXA 1PKPA 1N32E 2EMYA 5A2QC 4DV1E 2JXPA 2EPNA 2V86A 2L3JA 3C4TA 3BIDA 2EWLA 3VK6A 4DV6E 3HXLA 3DF6A 2VRDA 2VQEE 4GKKE 3IWBA 3C6MA 2UXDE 2EPCA 4P78A 2EN2A 4LF6E 2LCEA 2J7JA 2BB8A 4GKJE 2HJJA 3VHTB 1YYWA 1HNXE 1WRJA 4GZNC 4GEQB 1SFEA 2EOMA 4WSGA 1HR0E 2LUPB 2MDGA 3J80C 1PJQA 2EM4A 1AAYA 1LLMC 4DV5E 2L92A 4I8OA 1G2FC 2MC5A 4TUIA 2L8TA 4X8WA 4F9AB 4X65E 2EOEA 1A1LA 1X6EA 2UUAE 2FTXB 2L2MA 1NEIA 2DLQA 1YZ9A 4B3RE 5AE1A 4BS9A 2V8QB 1SR9A 5LMUE 2YWQA 4TUGA 2WBTA 3EPJA 4J8ZA 2EPUA 2EOFA 4M2ZA 4AQYE 2HHHE 2E5LE 2GHFA 4LF4E 3KWRA 4BCAA 4BMJA 3JTZA 3AV0A 3C4BA 2EMBA 5AC4A 2RS6A 1F2IG 2M1SA 1A1JA 1DQ3A 5KL2A 4MLQA 4JI8E 5IWAE 2YTDA 5TSEA 2WCC3 1BBGA 5A69A 4R2PA 4NXNE 2YTGA 2EMCA 1ZAAC 4L5NC 2Q8UA 5KL3A 4R2AA 4R8OA 5AE3A 1T4OA 1A1FA 4OOGC 4BBYA 4LF5E 2EN6A 4OX9E 1IBKE 2UXCE 3RMPA 1DGCA 2R76A 4N4RB 1PDAA 1X5WA 5A6BD 1YUJA 2DMIA 2EMHA 2LJUA 4RH8A 2B9DA 2M9AA 2L2KB 3JAMC 2EMGA 2EQ0A 2EOIA 4LF9E 4DV3E 2A25A 5BR8E 1YYOA 2N3GA 1PJTA 2YSPA 2YRMA 2ODRD 3T1YE 2JOBA 1XMOE 2DLKA 1BB8A 2YTPA 4R2RA 2E1MA 3HPSA 2EJ4A 4LF8E 5FLXC 4DUYE 4L8NA 2JY9A 1JK1A 2HGHA 4M9VC 2EPOA 4M0VA 4DV2E 2UUBE 4LTYA 1EH7A 4R2QA 4DR1E 3F6GA 4B3TE 2LE2A 2CT1A 2B3TB 4B3SE 4O43A 4DR4E 1RMDA 2JOXA 4YY3E 2EM6A 2RSMA 2EE8A 2EN4A 2RSIA 4IJDA 1Z1BA 4RHBB 4X66E 1XNQE 1X3CA 3ADLA 2EORA 4JI5E 2EPXA 2BBGA 2V89A 4HEIA 2MKDA 1WHNA 2EOZA 2WBUA 2NUEA 5KL4A 3OTOE 2DIXA 2NABA 1B69A 1GZ6A 2CSHA 2EN8A 1X49A 1IQOA 5A6JA 2DSYA 2V85A 3THOB 2EL5A 1AH5A 2B7TA 2IHR1 2LVHA 2EMIA 3ZOQB 1A1IA 3J81C 2LBSB 3UK3C 2DMYA 1GQEA 5IV8B 2EM7A 2YU8A 2EPAA 2EPPA 1QNTA 2UUCE 2N8XA 1I94E 2EPLX 1J5EE 2EN3A 2EQ1A 4BC9A 4DKKA 3ADGA 2EOOA 2EM5A 1X6HA 4DMIA 4X62E 5T6JA 2G7HA 5AASA 1P47A 4JI2E 4P7DA 1A1HA 3FIGA 4WXCA 2YRKA 4R2DA 2YT4A 3LMLA 1QU6A 1XMQE 2JP9A 1ZR9A 3KZYA 2YRHA 2EQ3A 3VYYA 4JI7E 1YYKA 2CPNA 1STUA 5AE2A 2L3CA 2EL4A 3MHSC 4F2JC 3EPKA 3DJWA 5AC5A 2ELZA 2EMZA 4B3ME 2EM3A
chains in the Genus database with same CATH topology
2V87A 3JU0A 4DV1E 4LF9E 2RS7A 4F9BB 4F9CB 4DV3E 2V86A 1IBLE 3LLHA 3MSWA 2VQFE 2L3JA 4DR7E 2ODRC 3C4TA 4Q28A 4WYQB 5BR8E 2EWLA 3VK6A 2N3GA 3T1YE 1YYOA 3J7Yp 2ODRD 3ADIA 2JOBA 3HXLA 5CFFE 4DV6E 3DF6A 4BC7A 2H36X 2VQEE 3K6QA 1XMOE 3HPZA 4GKKE 3IWBA 2E1MA 3HPSA 4LF8E 2UXDE 2V83A 4WSPA 5FLXC 4DV0E 4DUYE 4P78A 4L8NA 2JY9A 4JV5E 1N36E 3IWDA 4LF6E 1T4NA 4M0VA 2N3HA 4DV2E 2NA2A 2UUBE 4GKJE 4LTYA 1J26A 4DV4E 4DR1E 4KZSA 3F6GA 4B3TE 2M4IA 1HNXE 1YYWA 2LE2A 3OMLA 2B3TB 1N34E 4B3SE 4GEQB 4DR4E 1WHQA 1HR0E 3P1XA 2FGGA 2LUPB 2NUFA 3J80C 1N33E 2JOXA 2RTXA 4YY3E 4DV5E 2L92A 4I8OA 4DR5E 1RC7A 2EZ6A 2RSMA 2MC5A 4TUIA 2L8TA 4X8WA 4X64E 2JR1A 4F9AB 4X65E 4LF7E 2LMZA 1HNZE 2FV4B 4DR3E 2UUAE 2FTXB 1FKAE 2L2MA 2F8BA 2M7QA 4X66E 1XNQE 1ZBTA 2LRSA 1RQ0A 3ADLA 3J7AG 1YZ9A 4JI5E 1X48A 4NXME 4B3RE 5AE1A 2UU9E 2ZM6E 2V89A 4DR6E 4BS9A 2V8QB 1SR9A 1WHNA 2UXBE 5LMUE 2NUEA 4TUGA 1ZBQA 4LFAE 3OTOE 1UHZA 2DIXA 1UILA 2KONA 4J8ZA 2KOUA 1GZ6A 2B7VA 4WPYA 2WZOA 4M2ZA 1WXRA 1X49A 4AQYE 1T4LB 2E5LE 4WFTA 2JWOA 2HHHE 4LF4E 4JI0E 4R03A 2DB2A 4DUZE 2DSYA 2V85A 3AUZA 3KWRA 4BCAA 2VE7C 4BMJA 2NUGA 3JTZA 3AV0A 2IHR1 2B7TA 3ZOQB 2LTRA 3C4BA 4YHHE 2RS6A 3J81C 3IWCA 2M1SA 3HQ1A 1O0WA 1DQ3A 4JI4E 4JI8E 5IWAE 2DMYA 1GQEA 2LBSB 2L6MA 2VF1A 5IT9C 4DR2E 4JI3E 2F4VE 2UUCE 2JVAA 1I94E 4F54A 5DNYA 4JI6E 4NXNE 3F6HA 5LMNE 3VYXA 2KHXA 4KHPE 1J5EE 4L5NC 5ADZA 4K0KE 4BC9A 4R8OA 5AE3A 4DKKA 1EKZA 1T4OA 3ADGA 1HNWE 2L33A 4X62E 4LFCE 4DMIA 4OOGC 4DV7E 5T6JA 4BBYA 1DI2A 4JI1E 2G7HA 2LJHA 3ADJA 4LU9A 4P7DA 5AASA 4JI2E 3FIGA 4LF5E 1IBKE 4OX9E 1IBME 3RMPA 2K4VA 1XNRE 2UXCE 2YT4A 4JYAE 2LUQA 3LMLA 3H09A 1QU6A 5LL6R 1XMQE 4LFBE 4M30A 5F3WA 3T1HE 3VYYA 1X47A 4JI7E 2MC6A 1FJGE 3HTXA 1YYKA 2CPNA 1STUA 5AE2A 2L3CA 2L2NA 2B9DA 2L2KB 1PKPA 2LTSA 2V88A 2YZTA 3DJWA 2MDRA 3JAMC 1N32E 4B3ME 5A2QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WZO A; 
#chains in the Genus database with same CATH topology
 3JU0 A;  4O4K A;  4F9C B;  1IBL E;  3LLH A;  4BHC A;  4DR7 E;  1YUI A;  2ODR C;  4Q28 A;  4WYQ B;  5LLQ A;  5KL7 A;  3K6Q A;  5A6B A;  3BBG A;  2LO3 A;  3BGH A;  2EMX A;  1KYQ A;  2LT7 A;  2EN7 A;  1N3G A;  2EML A;  3IWD A;  2EM2 A;  1IQS A;  2N3H A;  1J26 A;  1L4S A;  2RPC A;  2WBS A;  2JYA A;  2M4I A;  3OML A;  1N34 E;  2EOY A;  2LV2 A;  1WHQ A;  3P1X A;  1PJS A;  1RC7 A;  2K7I A;  4X64 E;  2JR1 A;  2LMZ A;  1HNZ E;  2FV4 B;  1FKA E;  4HTG A;  2F8B A;  1ZBT A;  1RQ0 A;  3MHH C;  1X48 A;  1A1K A;  2UU9 E;  3EQ1 A;  1UBD C;  2ADR A;  3L00 A;  4ZYD A;  4LFA E;  2KON A;  1KJK A;  2KOU A;  2WZO A;  1TF6 A;  1WXR A;  2JPA A;  2I9I A;  4O24 A;  4IS1 C;  1T4L B;  2JWO A;  4R03 A;  2GLI A;  2YTN A;  4ZYE A;  3AUZ A;  2NUG A;  2VE7 C;  2EPK X;  1YFH A;  3C6K A;  1MGT A;  4JI4 E;  2VF1 A;  1YPN A;  4JI3 E;  3F6H A;  4KHP E;  1UN6 B;  5ADZ A;  2GPI A;  2HC5 A;  3EPL A;  2MKN A;  1YSA C;  4WXD A;  2EMK A;  1DI2 A;  2EMF A;  2YTI A;  3ADJ A;  4LU9 A;  1T39 A;  4FK5 C;  4BHB A;  1IBM E;  2ENC A;  1XNR E;  4JYA E;  1ZU1 A;  3H09 A;  5LL6 R;  4LFB E;  3TQM A;  1TN9 A;  2DRP A;  4KWY A;  1X47 A;  1G2D C;  1FJG E;  2MC6 A;  4R2C A;  2EPZ A;  2L2N A;  5KL5 A;  1BBO A;  2LTS A;  2V88 A;  2YZT A;  2R1F A;  2MDR A;  2EOS A;  4DV4 E;  2V87 A;  2YTO A;  2EMW A;  2RS7 A;  4F9B B;  3MSW A;  2VQF E;  2RQL A;  4R2S A;  3M99 B;  3J7Y p;  3ADI A;  5CFF E;  2PRT A;  4BC7 A;  2H36 X;  3HPZ A;  5A6A A;  1IMU A;  2V83 A;  4WSP A;  2ENH A;  3QG5 C;  4DV0 E;  4JV5 E;  1N36 E;  2I13 A;  1T4N A;  4R2E A;  2NA2 A;  2YSO A;  4KZS A;  2YTQ A;  2YPN A;  5KL6 A;  4WX9 A;  2ELY A;  2EN1 A;  2D9H A;  2EM0 A;  2YTF A;  1EH8 A;  2FGG A;  2NUF A;  1N33 E;  2EZ6 A;  2RTX A;  4DR5 E;  4ZYH A;  2EOQ A;  2EM9 A;  4LF7 E;  1WJP A;  4DR3 E;  2EL6 A;  2M7Q A;  1JK2 A;  2LRS A;  3J7A G;  2EOJ A;  4NXM E;  4ZYG A;  2ZM6 E;  4DR6 E;  2DGC A;  5IXM B;  2YTJ A;  4NHR A;  3EPH A;  1X6F A;  4NZV A;  2UXB E;  4X9J A;  1ZBQ A;  2EOX A;  4MLV A;  1UHZ A;  2EOH A;  1UIL A;  2B7V A;  2EMA A;  2EP3 A;  4WPY A;  3ECR A;  4F6M A;  2E72 A;  4WFT A;  4JI0 E;  2CTD A;  2DB2 A;  4DUZ E;  1EH6 A;  4F6N A;  4YHH E;  2LTR A;  4Q35 B;  4O5G A;  3IWC A;  3HQ1 A;  2EM8 A;  1T38 A;  1O0W A;  3KZZ A;  1MEY C;  3THN A;  2L6M A;  1A1G A;  5IT9 C;  4DR2 E;  2EPM X;  2F4V E;  2JVA A;  3BF2 A;  4F54 A;  2ENA A;  5DNY A;  4JI6 E;  1NCS A;  5LMN E;  3VYX A;  2KHX A;  2YTE A;  4K0K E;  1EKZ A;  1HNW E;  2L33 A;  4LFC E;  4DV7 E;  4JI1 E;  2LJH A;  2YU5 A;  2EPR A;  2K4V A;  2LUQ A;  1GTK A;  1TF3 A;  4M30 A;  5F3W A;  3T1H E;  5A6K A;  3HTX A;  1PKP A;  1N32 E;  2EMY A;  5A2Q C;  4DV1 E;  2JXP A;  2EPN A;  2V86 A;  2L3J A;  3C4T A;  3BID A;  2EWL A;  3VK6 A;  4DV6 E;  3HXL A;  3DF6 A;  2VRD A;  2VQE E;  4GKK E;  3IWB A;  3C6M A;  2UXD E;  2EPC A;  4P78 A;  2EN2 A;  4LF6 E;  2LCE A;  2J7J A;  2BB8 A;  4GKJ E;  2HJJ A;  3VHT B;  1YYW A;  1HNX E;  1WRJ A;  4GZN C;  4GEQ B;  1SFE A;  2EOM A;  4WSG A;  1HR0 E;  2LUP B;  2MDG A;  3J80 C;  1PJQ A;  2EM4 A;  1AAY A;  1LLM C;  4DV5 E;  2L92 A;  4I8O A;  1G2F C;  2MC5 A;  4TUI A;  2L8T A;  4X8W A;  4F9A B;  4X65 E;  2EOE A;  1A1L A;  1X6E A;  2UUA E;  2FTX B;  2L2M A;  1NEI A;  2DLQ A;  1YZ9 A;  4B3R E;  5AE1 A;  4BS9 A;  2V8Q B;  1SR9 A;  5LMU E;  2YWQ A;  4TUG A;  2WBT A;  3EPJ A;  4J8Z A;  2EPU A;  2EOF A;  4M2Z A;  4AQY E;  2HHH E;  2E5L E;  2GHF A;  4LF4 E;  3KWR A;  4BCA A;  4BMJ A;  3JTZ A;  3AV0 A;  3C4B A;  2EMB A;  5AC4 A;  2RS6 A;  1F2I G;  2M1S A;  1A1J A;  1DQ3 A;  5KL2 A;  4MLQ A;  4JI8 E;  5IWA E;  2YTD A;  5TSE A;  2WCC 3;  1BBG A;  5A69 A;  4R2P A;  4NXN E;  2YTG A;  2EMC A;  1ZAA C;  4L5N C;  2Q8U A;  5KL3 A;  4R2A A;  4R8O A;  5AE3 A;  1T4O A;  1A1F A;  4OOG C;  4BBY A;  4LF5 E;  2EN6 A;  4OX9 E;  1IBK E;  2UXC E;  3RMP A;  1DGC A;  2R76 A;  4N4R B;  1PDA A;  1X5W A;  5A6B D;  1YUJ A;  2DMI A;  2EMH A;  2LJU A;  4RH8 A;  2B9D A;  2M9A A;  2L2K B;  3JAM C;  2EMG A;  2EQ0 A;  2EOI A;  4LF9 E;  4DV3 E;  2A25 A;  5BR8 E;  1YYO A;  2N3G A;  1PJT A;  2YSP A;  2YRM A;  2ODR D;  3T1Y E;  2JOB A;  1XMO E;  2DLK A;  1BB8 A;  2YTP A;  4R2R A;  2E1M A;  3HPS A;  2EJ4 A;  4LF8 E;  5FLX C;  4DUY E;  4L8N A;  2JY9 A;  1JK1 A;  2HGH A;  4M9V C;  2EPO A;  4M0V A;  4DV2 E;  2UUB E;  4LTY A;  1EH7 A;  4R2Q A;  4DR1 E;  3F6G A;  4B3T E;  2LE2 A;  2CT1 A;  2B3T B;  4B3S E;  4O43 A;  4DR4 E;  1RMD A;  2JOX A;  4YY3 E;  2EM6 A;  2RSM A;  2EE8 A;  2EN4 A;  2RSI A;  4IJD A;  1Z1B A;  4RHB B;  4X66 E;  1XNQ E;  1X3C A;  3ADL A;  2EOR A;  4JI5 E;  2EPX A;  2BBG A;  2V89 A;  4HEI A;  2MKD A;  1WHN A;  2EOZ A;  2WBU A;  2NUE A;  5KL4 A;  3OTO E;  2DIX A;  2NAB A;  1B69 A;  1GZ6 A;  2CSH A;  2EN8 A;  1X49 A;  1IQO A;  5A6J A;  2DSY A;  2V85 A;  3THO B;  2EL5 A;  1AH5 A;  2B7T A;  2IHR 1;  2LVH A;  2EMI A;  3ZOQ B;  1A1I A;  3J81 C;  2LBS B;  3UK3 C;  2DMY A;  1GQE A;  5IV8 B;  2EM7 A;  2YU8 A;  2EPA A;  2EPP A;  1QNT A;  2UUC E;  2N8X A;  1I94 E;  2EPL X;  1J5E E;  2EN3 A;  2EQ1 A;  4BC9 A;  4DKK A;  3ADG A;  2EOO A;  2EM5 A;  1X6H A;  4DMI A;  4X62 E;  5T6J A;  2G7H A;  5AAS A;  1P47 A;  4JI2 E;  4P7D A;  1A1H A;  3FIG A;  4WXC A;  2YRK A;  4R2D A;  2YT4 A;  3LML A;  1QU6 A;  1XMQ E;  2JP9 A;  1ZR9 A;  3KZY A;  2YRH A;  2EQ3 A;  3VYY A;  4JI7 E;  1YYK A;  2CPN A;  1STU A;  5AE2 A;  2L3C A;  2EL4 A;  3MHS C;  4F2J C;  3EPK A;  3DJW A;  5AC5 A;  2ELZ A;  2EMZ A;  4B3M E;  2EM3 A; 
#chains in the Genus database with same CATH homology
 2V87 A;  3JU0 A;  4DV1 E;  4LF9 E;  2RS7 A;  4F9B B;  4F9C B;  4DV3 E;  2V86 A;  1IBL E;  3LLH A;  3MSW A;  2VQF E;  2L3J A;  4DR7 E;  2ODR C;  3C4T A;  4Q28 A;  4WYQ B;  5BR8 E;  2EWL A;  3VK6 A;  2N3G A;  3T1Y E;  1YYO A;  3J7Y p;  2ODR D;  3ADI A;  2JOB A;  3HXL A;  5CFF E;  4DV6 E;  3DF6 A;  4BC7 A;  2H36 X;  2VQE E;  3K6Q A;  1XMO E;  3HPZ A;  4GKK E;  3IWB A;  2E1M A;  3HPS A;  4LF8 E;  2UXD E;  2V83 A;  4WSP A;  5FLX C;  4DV0 E;  4DUY E;  4P78 A;  4L8N A;  2JY9 A;  4JV5 E;  1N36 E;  3IWD A;  4LF6 E;  1T4N A;  4M0V A;  2N3H A;  4DV2 E;  2NA2 A;  2UUB E;  4GKJ E;  4LTY A;  1J26 A;  4DV4 E;  4DR1 E;  4KZS A;  3F6G A;  4B3T E;  2M4I A;  1HNX E;  1YYW A;  2LE2 A;  3OML A;  2B3T B;  1N34 E;  4B3S E;  4GEQ B;  4DR4 E;  1WHQ A;  1HR0 E;  3P1X A;  2FGG A;  2LUP B;  2NUF A;  3J80 C;  1N33 E;  2JOX A;  2RTX A;  4YY3 E;  4DV5 E;  2L92 A;  4I8O A;  4DR5 E;  1RC7 A;  2EZ6 A;  2RSM A;  2MC5 A;  4TUI A;  2L8T A;  4X8W A;  4X64 E;  2JR1 A;  4F9A B;  4X65 E;  4LF7 E;  2LMZ A;  1HNZ E;  2FV4 B;  4DR3 E;  2UUA E;  2FTX B;  1FKA E;  2L2M A;  2F8B A;  2M7Q A;  4X66 E;  1XNQ E;  1ZBT A;  2LRS A;  1RQ0 A;  3ADL A;  3J7A G;  1YZ9 A;  4JI5 E;  1X48 A;  4NXM E;  4B3R E;  5AE1 A;  2UU9 E;  2ZM6 E;  2V89 A;  4DR6 E;  4BS9 A;  2V8Q B;  1SR9 A;  1WHN A;  2UXB E;  5LMU E;  2NUE A;  4TUG A;  1ZBQ A;  4LFA E;  3OTO E;  1UHZ A;  2DIX A;  1UIL A;  2KON A;  4J8Z A;  2KOU A;  1GZ6 A;  2B7V A;  4WPY A;  2WZO A;  4M2Z A;  1WXR A;  1X49 A;  4AQY E;  1T4L B;  2E5L E;  4WFT A;  2JWO A;  2HHH E;  4LF4 E;  4JI0 E;  4R03 A;  2DB2 A;  4DUZ E;  2DSY A;  2V85 A;  3AUZ A;  3KWR A;  4BCA A;  2VE7 C;  4BMJ A;  2NUG A;  3JTZ A;  3AV0 A;  2IHR 1;  2B7T A;  3ZOQ B;  2LTR A;  3C4B A;  4YHH E;  2RS6 A;  3J81 C;  3IWC A;  2M1S A;  3HQ1 A;  1O0W A;  1DQ3 A;  4JI4 E;  4JI8 E;  5IWA E;  2DMY A;  1GQE A;  2LBS B;  2L6M A;  2VF1 A;  5IT9 C;  4DR2 E;  4JI3 E;  2F4V E;  2UUC E;  2JVA A;  1I94 E;  4F54 A;  5DNY A;  4JI6 E;  4NXN E;  3F6H A;  5LMN E;  3VYX A;  2KHX A;  4KHP E;  1J5E E;  4L5N C;  5ADZ A;  4K0K E;  4BC9 A;  4R8O A;  5AE3 A;  4DKK A;  1EKZ A;  1T4O A;  3ADG A;  1HNW E;  2L33 A;  4X62 E;  4LFC E;  4DMI A;  4OOG C;  4DV7 E;  5T6J A;  4BBY A;  1DI2 A;  4JI1 E;  2G7H A;  2LJH A;  3ADJ A;  4LU9 A;  4P7D A;  5AAS A;  4JI2 E;  3FIG A;  4LF5 E;  1IBK E;  4OX9 E;  1IBM E;  3RMP A;  2K4V A;  1XNR E;  2UXC E;  2YT4 A;  4JYA E;  2LUQ A;  3LML A;  3H09 A;  1QU6 A;  5LL6 R;  1XMQ E;  4LFB E;  4M30 A;  5F3W A;  3T1H E;  3VYY A;  1X47 A;  4JI7 E;  2MC6 A;  1FJG E;  3HTX A;  1YYK A;  2CPN A;  1STU A;  5AE2 A;  2L3C A;  2L2N A;  2B9D A;  2L2K B;  1PKP A;  2LTS A;  2V88 A;  2YZT A;  3DJW A;  2MDR A;  3JAM C;  1N32 E;  4B3M E;  5A2Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...