2WZOA

The structure of the fyr domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
146
structure length
146
Chain Sequence
GRPVFPIGLGGLTVYSLGEIITDRPGFHDESAIYPVGYCSTRIYASMKCPDQKCLYTCQIKDGGVQPQFEIVPEDDPQNAIVSSSADACHAELLRTISTTMGKLMPNLLPAGADFFGFSHPAIHNLIQSCPGARKCINYQWVKFDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords TRANSFORMING GROWTH FACTOR BETA REGULATOR 1
publication title The Structure of the Fyr Domain of Transforming Growth Factor Beta Regulator 1 (Tbrg1)(Pna)
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2009-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05964 FYRN F/Y-rich N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.360 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2wzoA01
2WZOA
chains in the Genus database with same CATH superfamily
1DGCA 4X66E 2EM7A 2YTGA 2EN3A 1N33E 4KWYA 1ZR9A 2DIXA 2EN2A 2UXBE 4M2ZA 1YPNA 2EPRA 2EN6A 2LVHA 3MHHC 2R76A 2Q8UA 1NEIA 5LL6R 1YFHA 5A69A 4JI5E 2YSPA 2EWLA 3P1XA 4BHBA 2V83A 1HNWE 1A1FA 2G7HA 2L3CA 4BS9A 4X8WA 4F9BB 3RMPA 4DV0E 3MHSC 5DNYA 4LF7E 1WJPA 2V88A 4DV6E 2YU8A 4MLQA 4X65E 1SFEA 4DR4E 2KHXA 4X62E 4WYQB 2EPAA 3MSWA 3EQ1A 2EL5A 1IQSA 2EOIA 1T39A 2M7QA 4IJDA 2EZ6A 2L2NA 2WBUA 1JK1A 2MDRA 3IWDA 2EPNA 4WXDA 4YY3E 2L3JA 2J7JA 5A2QC 2YU5A 3IWCA 4HEIA 2ODRC 2RSIA 2EN7A 4F6MA 2LV2A 1YSAC 4DR7E 1BBGA 1T38A 5IWAE 4LTYA 2EOHA 3HXLA 3JTZA 1A1LA 1UBDC 2MC6A 2EOEA 3TQMA 3EPLA 1TF6A 3EPHA 2EOXA 5LLQA 2DLKA 2KONA 2WBTA 2EPOA 4DUYE 1SR9A 2UUBE 1XMQE 4JI3E 2N3GA 1N3GA 2BBGA 2JOBA 2MC5A 1YYWA 4WSPA 2VRDA 1HNXE 4F54A 4NXNE 2EOQA 4OX9E 2JXPA 3BGHA 1RQ0A 3LMLA 3KZYA 2UU9E 2EPUA 2EOFA 5F3WA 2L8TA 5KL3A 2EOJA 5A6BA 2LUPB 4KHPE 1WHNA 1FKAE 2EMXA 5CFFE 5A6AA 2UUAE 4L5NC 2I13A 2MDGA 4N4RB 1QNTA 2YTDA 4M30A 2LMZA 2PRTA 2HGHA 4GKJE 5AE1A 4R8OA 2JP9A 2DRPA 3J7Yp 1T4OA 3C4BA 2YTIA 2EQ0A 1GQEA 2DMIA 1X47A 2EOMA 4LF4E 1F2IG 2EM2A 2ODRD 2LRSA 4M0VA 2EOOA 2YRKA 4RHBB 2LBSB 1A1GA 1X49A 2F8BA 2ENCA 5IXMB 1N32E 4F6NA 2BB8A 5BR8E 4LF5E 1BBOA 2DLQA 1XMOE 2R1FA 4B3RE 5FLXC 2EN4A 3J7AG 4DUZE 3KZZA 3VYYA 4P7DA 2CPNA 2FTXB 4JI6E 5LMUE 1RMDA 1MEYC 1X6EA 4TUIA 2VE7C 2CT1A 2EMWA 1DI2A 3THNA 2EORA 1IMUA 2YRHA 2L2KB 2YTPA 2NUGA 2NUEA 2M9AA 1X3CA 3HQ1A 1XNRE 4BBYA 2EL6A 4LFBE 1IBLE 2M4IA 3C6KA 4ZYEA 4BC9A 1JK2A 2V85A 4Q28A 5IT9C 2ADRA 2FGGA 2JOXA 4ZYGA 1GZ6A 2LO3A 4F2JC 2NABA 4WXCA 2E5LE 4JI4E 2N8XA 2EMYA 2K4VA 2M1SA 4DV5E 3BBGA 4DV4E 2V86A 2DGCA 1I94E 5T6JA 4K0KE 1HNZE 5AC5A 2EMAA 1TN9A 4BHCA 3KWRA 2YT4A 2V87A 1WHQA 5KL2A 1IQOA 2EQ1A 4TUGA 2LTRA 5KL6A 4MLVA 4WX9A 4I8OA 1J5EE 4O4KA 4NXME 1UHZA 4R2AA 1TF3A 2RTXA 4WPYA 2RS7A 2V8QB 2UXCE 1EH6A 1N36E 2EMLA 1AH5A 2YTFA 1J26A 4B3ME 2GHFA 2JY9A 1L4SA 5AC4A 4LFAE 2JYAA 1A1HA 1X6HA 2L33A 3C4TA 5A6KA 4L8NA 2LCEA 4R2SA 2EE8A 4DR6E 4WFTA 2WZOA 1YUJA 1MGTA 2EPZA 1A1KA 4LF8E 1YZ9A 4DR2E 1NCSA 3F6HA 2EJ4A 5TSEA 2K7IA 3ECRA 3DJWA 5A6BD 2EMGA 1KYQA 3ADJA 3BIDA 1T4LB 2GLIA 2EMCA 1YUIA 4GEQB 3EPJA 2RQLA 4DV1E 2EM8A 2JVAA 2KOUA 1G2FC 4BMJA 3AUZA 1WRJA 1ZBTA 1PKPA 2ELYA 2EL4A 2L2MA 1LLMC 1WXRA 2EOZA 4DMIA 3J81C 4JI0E 4O5GA 2NUFA 2EN1A 3FIGA 2ENAA 5AE2A 4R2DA 3BF2A 4NHRA 5KL4A 4R2RA 3JU0A 4BC7A 4JI2E 3OTOE 4DR1E 4LF6E 2VQFE 4LF9E 2ENHA 2E1MA 1DQ3A 2EP3A 2HC5A 2EPCA 4R03A 1YYKA 4WSGA 2VF1A 1A1IA 2YPNA 1BB8A 2B7TA 5A6JA 1UN6B 2EPPA 3F6GA 2RSMA 2YTEA 2EM3A 3ADIA 2H36X 1QU6A 5KL7A 2JWOA 2EMBA 3ZOQB 2EPKX 1X5WA 4YHHE 2YWQA 4O24A 4IS1C 3QG5C 2YTOA 1PJTA 1KJKA 4R2PA 3VYXA 4P78A 4B3TE 4JI7E 2LT7A 2EM9A 4M9VC 1X6FA 2LJHA 2EMHA 3C6MA 1FJGE 3ADLA 4JV5E 2LE2A 3UK3C 2EM5A 4DV2E 1PDAA 2UXDE 4GKKE 4ZYDA 2EMIA 1EKZA 4LFCE 2RS6A 1Z1BA 4LU9A 2EOSA 2F4VE 1T4NA 3T1HE 1GTKA 2HJJA 2EOYA 2V89A 3IWBA 4X64E 2ZM6E 4R2QA 2EMFA 3ADGA 2DSYA 2I9IA 1XNQE 2DB2A 1ZAAC 4B3SE 3AV0A 2WBSA 2B9DA 3T1YE 1N34E 4F9CB 2DMYA 2YZTA 2A25A 4ZYHA 4JI1E 1IBME 1G2DC 2NA2A 4Q35B 4DV3E 2EPXA 5KL5A 2EMKA 4F9AB 5ADZA 4BCAA 3JAMC 3LLHA 2CSHA 2RPCA 2ELZA 4GZNC 2E72A 5AASA 2HHHE 1IBKE 4DV7E 2YTNA 2YTJA 5IV8B 2UUCE 2EMZA 2WCC3 2FV4B 2B3TB 1RC7A 1PJSA 2LUQA 1A1JA 2LTSA 3EPKA 3OMLA 4J8ZA 2VQEE 3L00A 1ZU1A 2GPIA 4JI8E 3HTXA 4X9JA 2EQ3A 2L6MA 2L92A 2MKNA 1EH8A 4FK5C 1ZBQA 2D9HA 2LJUA 2IHR1 1PJQA 2EM4A 1YYOA 1X48A 1HR0E 3VK6A 2EN8A 2JR1A 3J80C 4R2CA 1AAYA 5AE3A 4O43A 2B7VA 2YRMA 3K6QA 4NZVA 4DR5E 4AQYE 1B69A 2EPLX 3HPZA 5LMNE 2CTDA 4JYAE 4DKKA 2EM0A 2N3HA 2MKDA 2YSOA 2YTQA 3THOB 1STUA 3H09A 2EM6A 2EPMX 4R2EA 3M99B 3HPSA 1P47A 3DF6A 4HTGA 1O0WA 1EH7A 4KZSA 4RH8A 3VHTB 4DR3E 4OOGC 1UILA 2JPAA
chains in the Genus database with same CATH topology
5AE1A 4X66E 4R8OA 1J26A 3J7Yp 1RC7A 4B3ME 4GKKE 1T4OA 2JY9A 3C4BA 1N33E 1GQEA 2DIXA 1X47A 1EKZA 4LF4E 4LFAE 4LFCE 2RS6A 2UXBE 2ODRD 2L33A 2LRSA 3C4TA 4LU9A 4L8NA 4M0VA 4M2ZA 2F4VE 1T4NA 3T1HE 1IBLE 2LBSB 4DR6E 5LL6R 2V89A 4WFTA 4JI5E 3IWBA 4X64E 2EWLA 3P1XA 2ZM6E 2V83A 2WZOA 4JI2E 1HNWE 2G7HA 4LF8E 1X49A 4DR2E 1YZ9A 2F8BA 2L3CA 3F6HA 4BS9A 1N32E 4X8WA 4F9BB 3RMPA 3ADGA 2DSYA 4DV0E 1XNQE 2DB2A 3DJWA 5DNYA 5BR8E 4LF7E 2V88A 4B3SE 3AV0A 4DV6E 4LF5E 2B9DA 4X65E 1XMOE 3ADJA 3T1YE 1N34E 2KHXA 1T4LB 4DR4E 4F9CB 2DMYA 4X62E 2YZTA 4WYQB 3MSWA 5FLXC 4B3RE 3J7AG 4DUZE 3VYYA 4GEQB 4JI1E 1IBME 2M7QA 2EZ6A 4DV1E 2L2NA 4P7DA 2NA2A 2CPNA 2FTXB 2JVAA 2KOUA 2MDRA 3IWDA 5LMUE 4JI6E 4BMJA 3AUZA 4TUIA 2VE7C 4YY3E 1ZBTA 1PKPA 2L2MA 2L3JA 1DI2A 5A2QC 3IWCA 1WXRA 4DV3E 4DMIA 3J81C 4F9AB 5ADZA 4JI0E 2ODRC 4BCAA 3JAMC 3LLHA 2NUFA 3FIGA 2L2KB 5AE2A 5AASA 2HHHE 2NUEA 2NUGA 1IBKE 4DR7E 4DV7E 3HQ1A 2UUCE 1XNRE 5IWAE 2FV4B 4LTYA 4BBYA 2B3TB 4LFBE 3HXLA 3JU0A 2LUQA 3JTZA 4BC7A 2M4IA 2LTSA 3OTOE 2MC6A 4BC9A 4DR1E 3OMLA 4J8ZA 4LF6E 2VQEE 2VQFE 2V85A 4LF9E 4Q28A 5IT9C 2KONA 2FGGA 2JOXA 2E1MA 4JI8E 1DQ3A 3HTXA 1GZ6A 4DUYE 1SR9A 4R03A 2UUBE 1XMQE 1YYKA 4JI3E 2L6MA 2L92A 2VF1A 2E5LE 4JI4E 2N3GA 2K4VA 2JOBA 1ZBQA 2B7TA 2IHR1 2MC5A 1YYWA 4WSPA 2M1SA 1YYOA 4DV5E 1X48A 3F6GA 2RSMA 1HR0E 4DV4E 1HNXE 2V86A 3VK6A 2JR1A 1I94E 5T6JA 4F54A 3J80C 4NXNE 3ADIA 1HNZE 4K0KE 4OX9E 5AE3A 2H36X 1RQ0A 1QU6A 3LMLA 2B7VA 2UU9E 3K6QA 2JWOA 4DR5E 4AQYE 3ZOQB 3KWRA 2YT4A 2V87A 1WHQA 3HPZA 4YHHE 4TUGA 2LTRA 5LMNE 5F3WA 2L8TA 4JYAE 4I8OA 4DKKA 2N3HA 3VYXA 2LUPB 1J5EE 4KHPE 1WHNA 4NXME 1UHZA 4P78A 1FKAE 1STUA 3H09A 4B3TE 5CFFE 2UUAE 4L5NC 2RTXA 3HPSA 4JI7E 4WPYA 1FJGE 2LJHA 2RS7A 3ADLA 3DF6A 2V8QB 1O0WA 4M30A 2LMZA 2LE2A 4KZSA 4DV2E 1N36E 4JV5E 2UXCE 2UXDE 4DR3E 4GKJE 4OOGC 1UILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WZO A; 
#chains in the Genus database with same CATH topology
 1DGC A;  4X66 E;  2EM7 A;  2YTG A;  2EN3 A;  1N33 E;  4KWY A;  1ZR9 A;  2DIX A;  2EN2 A;  2UXB E;  4M2Z A;  1YPN A;  2EPR A;  2EN6 A;  2LVH A;  3MHH C;  2R76 A;  2Q8U A;  1NEI A;  5LL6 R;  1YFH A;  5A69 A;  4JI5 E;  2YSP A;  2EWL A;  3P1X A;  4BHB A;  2V83 A;  1HNW E;  1A1F A;  2G7H A;  2L3C A;  4BS9 A;  4X8W A;  4F9B B;  3RMP A;  4DV0 E;  3MHS C;  5DNY A;  4LF7 E;  1WJP A;  2V88 A;  4DV6 E;  2YU8 A;  4MLQ A;  4X65 E;  1SFE A;  4DR4 E;  2KHX A;  4X62 E;  4WYQ B;  2EPA A;  3MSW A;  3EQ1 A;  2EL5 A;  1IQS A;  2EOI A;  1T39 A;  2M7Q A;  4IJD A;  2EZ6 A;  2L2N A;  2WBU A;  1JK1 A;  2MDR A;  3IWD A;  2EPN A;  4WXD A;  4YY3 E;  2L3J A;  2J7J A;  5A2Q C;  2YU5 A;  3IWC A;  4HEI A;  2ODR C;  2RSI A;  2EN7 A;  4F6M A;  2LV2 A;  1YSA C;  4DR7 E;  1BBG A;  1T38 A;  5IWA E;  4LTY A;  2EOH A;  3HXL A;  3JTZ A;  1A1L A;  1UBD C;  2MC6 A;  2EOE A;  3TQM A;  3EPL A;  1TF6 A;  3EPH A;  2EOX A;  5LLQ A;  2DLK A;  2KON A;  2WBT A;  2EPO A;  4DUY E;  1SR9 A;  2UUB E;  1XMQ E;  4JI3 E;  2N3G A;  1N3G A;  2BBG A;  2JOB A;  2MC5 A;  1YYW A;  4WSP A;  2VRD A;  1HNX E;  4F54 A;  4NXN E;  2EOQ A;  4OX9 E;  2JXP A;  3BGH A;  1RQ0 A;  3LML A;  3KZY A;  2UU9 E;  2EPU A;  2EOF A;  5F3W A;  2L8T A;  5KL3 A;  2EOJ A;  5A6B A;  2LUP B;  4KHP E;  1WHN A;  1FKA E;  2EMX A;  5CFF E;  5A6A A;  2UUA E;  4L5N C;  2I13 A;  2MDG A;  4N4R B;  1QNT A;  2YTD A;  4M30 A;  2LMZ A;  2PRT A;  2HGH A;  4GKJ E;  5AE1 A;  4R8O A;  2JP9 A;  2DRP A;  3J7Y p;  1T4O A;  3C4B A;  2YTI A;  2EQ0 A;  1GQE A;  2DMI A;  1X47 A;  2EOM A;  4LF4 E;  1F2I G;  2EM2 A;  2ODR D;  2LRS A;  4M0V A;  2EOO A;  2YRK A;  4RHB B;  2LBS B;  1A1G A;  1X49 A;  2F8B A;  2ENC A;  5IXM B;  1N32 E;  4F6N A;  2BB8 A;  5BR8 E;  4LF5 E;  1BBO A;  2DLQ A;  1XMO E;  2R1F A;  4B3R E;  5FLX C;  2EN4 A;  3J7A G;  4DUZ E;  3KZZ A;  3VYY A;  4P7D A;  2CPN A;  2FTX B;  4JI6 E;  5LMU E;  1RMD A;  1MEY C;  1X6E A;  4TUI A;  2VE7 C;  2CT1 A;  2EMW A;  1DI2 A;  3THN A;  2EOR A;  1IMU A;  2YRH A;  2L2K B;  2YTP A;  2NUG A;  2NUE A;  2M9A A;  1X3C A;  3HQ1 A;  1XNR E;  4BBY A;  2EL6 A;  4LFB E;  1IBL E;  2M4I A;  3C6K A;  4ZYE A;  4BC9 A;  1JK2 A;  2V85 A;  4Q28 A;  5IT9 C;  2ADR A;  2FGG A;  2JOX A;  4ZYG A;  1GZ6 A;  2LO3 A;  4F2J C;  2NAB A;  4WXC A;  2E5L E;  4JI4 E;  2N8X A;  2EMY A;  2K4V A;  2M1S A;  4DV5 E;  3BBG A;  4DV4 E;  2V86 A;  2DGC A;  1I94 E;  5T6J A;  4K0K E;  1HNZ E;  5AC5 A;  2EMA A;  1TN9 A;  4BHC A;  3KWR A;  2YT4 A;  2V87 A;  1WHQ A;  5KL2 A;  1IQO A;  2EQ1 A;  4TUG A;  2LTR A;  5KL6 A;  4MLV A;  4WX9 A;  4I8O A;  1J5E E;  4O4K A;  4NXM E;  1UHZ A;  4R2A A;  1TF3 A;  2RTX A;  4WPY A;  2RS7 A;  2V8Q B;  2UXC E;  1EH6 A;  1N36 E;  2EML A;  1AH5 A;  2YTF A;  1J26 A;  4B3M E;  2GHF A;  2JY9 A;  1L4S A;  5AC4 A;  4LFA E;  2JYA A;  1A1H A;  1X6H A;  2L33 A;  3C4T A;  5A6K A;  4L8N A;  2LCE A;  4R2S A;  2EE8 A;  4DR6 E;  4WFT A;  2WZO A;  1YUJ A;  1MGT A;  2EPZ A;  1A1K A;  4LF8 E;  1YZ9 A;  4DR2 E;  1NCS A;  3F6H A;  2EJ4 A;  5TSE A;  2K7I A;  3ECR A;  3DJW A;  5A6B D;  2EMG A;  1KYQ A;  3ADJ A;  3BID A;  1T4L B;  2GLI A;  2EMC A;  1YUI A;  4GEQ B;  3EPJ A;  2RQL A;  4DV1 E;  2EM8 A;  2JVA A;  2KOU A;  1G2F C;  4BMJ A;  3AUZ A;  1WRJ A;  1ZBT A;  1PKP A;  2ELY A;  2EL4 A;  2L2M A;  1LLM C;  1WXR A;  2EOZ A;  4DMI A;  3J81 C;  4JI0 E;  4O5G A;  2NUF A;  2EN1 A;  3FIG A;  2ENA A;  5AE2 A;  4R2D A;  3BF2 A;  4NHR A;  5KL4 A;  4R2R A;  3JU0 A;  4BC7 A;  4JI2 E;  3OTO E;  4DR1 E;  4LF6 E;  2VQF E;  4LF9 E;  2ENH A;  2E1M A;  1DQ3 A;  2EP3 A;  2HC5 A;  2EPC A;  4R03 A;  1YYK A;  4WSG A;  2VF1 A;  1A1I A;  2YPN A;  1BB8 A;  2B7T A;  5A6J A;  1UN6 B;  2EPP A;  3F6G A;  2RSM A;  2YTE A;  2EM3 A;  3ADI A;  2H36 X;  1QU6 A;  5KL7 A;  2JWO A;  2EMB A;  3ZOQ B;  2EPK X;  1X5W A;  4YHH E;  2YWQ A;  4O24 A;  4IS1 C;  3QG5 C;  2YTO A;  1PJT A;  1KJK A;  4R2P A;  3VYX A;  4P78 A;  4B3T E;  4JI7 E;  2LT7 A;  2EM9 A;  4M9V C;  1X6F A;  2LJH A;  2EMH A;  3C6M A;  1FJG E;  3ADL A;  4JV5 E;  2LE2 A;  3UK3 C;  2EM5 A;  4DV2 E;  1PDA A;  2UXD E;  4GKK E;  4ZYD A;  2EMI A;  1EKZ A;  4LFC E;  2RS6 A;  1Z1B A;  4LU9 A;  2EOS A;  2F4V E;  1T4N A;  3T1H E;  1GTK A;  2HJJ A;  2EOY A;  2V89 A;  3IWB A;  4X64 E;  2ZM6 E;  4R2Q A;  2EMF A;  3ADG A;  2DSY A;  2I9I A;  1XNQ E;  2DB2 A;  1ZAA C;  4B3S E;  3AV0 A;  2WBS A;  2B9D A;  3T1Y E;  1N34 E;  4F9C B;  2DMY A;  2YZT A;  2A25 A;  4ZYH A;  4JI1 E;  1IBM E;  1G2D C;  2NA2 A;  4Q35 B;  4DV3 E;  2EPX A;  5KL5 A;  2EMK A;  4F9A B;  5ADZ A;  4BCA A;  3JAM C;  3LLH A;  2CSH A;  2RPC A;  2ELZ A;  4GZN C;  2E72 A;  5AAS A;  2HHH E;  1IBK E;  4DV7 E;  2YTN A;  2YTJ A;  5IV8 B;  2UUC E;  2EMZ A;  2WCC 3;  2FV4 B;  2B3T B;  1RC7 A;  1PJS A;  2LUQ A;  1A1J A;  2LTS A;  3EPK A;  3OML A;  4J8Z A;  2VQE E;  3L00 A;  1ZU1 A;  2GPI A;  4JI8 E;  3HTX A;  4X9J A;  2EQ3 A;  2L6M A;  2L92 A;  2MKN A;  1EH8 A;  4FK5 C;  1ZBQ A;  2D9H A;  2LJU A;  2IHR 1;  1PJQ A;  2EM4 A;  1YYO A;  1X48 A;  1HR0 E;  3VK6 A;  2EN8 A;  2JR1 A;  3J80 C;  4R2C A;  1AAY A;  5AE3 A;  4O43 A;  2B7V A;  2YRM A;  3K6Q A;  4NZV A;  4DR5 E;  4AQY E;  1B69 A;  2EPL X;  3HPZ A;  5LMN E;  2CTD A;  4JYA E;  4DKK A;  2EM0 A;  2N3H A;  2MKD A;  2YSO A;  2YTQ A;  3THO B;  1STU A;  3H09 A;  2EM6 A;  2EPM X;  4R2E A;  3M99 B;  3HPS A;  1P47 A;  3DF6 A;  4HTG A;  1O0W A;  1EH7 A;  4KZS A;  4RH8 A;  3VHT B;  4DR3 E;  4OOG C;  1UIL A;  2JPA A; 
#chains in the Genus database with same CATH homology
 5AE1 A;  4X66 E;  4R8O A;  1J26 A;  3J7Y p;  1RC7 A;  4B3M E;  4GKK E;  1T4O A;  2JY9 A;  3C4B A;  1N33 E;  1GQE A;  2DIX A;  1X47 A;  1EKZ A;  4LF4 E;  4LFA E;  4LFC E;  2RS6 A;  2UXB E;  2ODR D;  2L33 A;  2LRS A;  3C4T A;  4LU9 A;  4L8N A;  4M0V A;  4M2Z A;  2F4V E;  1T4N A;  3T1H E;  1IBL E;  2LBS B;  4DR6 E;  5LL6 R;  2V89 A;  4WFT A;  4JI5 E;  3IWB A;  4X64 E;  2EWL A;  3P1X A;  2ZM6 E;  2V83 A;  2WZO A;  4JI2 E;  1HNW E;  2G7H A;  4LF8 E;  1X49 A;  4DR2 E;  1YZ9 A;  2F8B A;  2L3C A;  3F6H A;  4BS9 A;  1N32 E;  4X8W A;  4F9B B;  3RMP A;  3ADG A;  2DSY A;  4DV0 E;  1XNQ E;  2DB2 A;  3DJW A;  5DNY A;  5BR8 E;  4LF7 E;  2V88 A;  4B3S E;  3AV0 A;  4DV6 E;  4LF5 E;  2B9D A;  4X65 E;  1XMO E;  3ADJ A;  3T1Y E;  1N34 E;  2KHX A;  1T4L B;  4DR4 E;  4F9C B;  2DMY A;  4X62 E;  2YZT A;  4WYQ B;  3MSW A;  5FLX C;  4B3R E;  3J7A G;  4DUZ E;  3VYY A;  4GEQ B;  4JI1 E;  1IBM E;  2M7Q A;  2EZ6 A;  4DV1 E;  2L2N A;  4P7D A;  2NA2 A;  2CPN A;  2FTX B;  2JVA A;  2KOU A;  2MDR A;  3IWD A;  5LMU E;  4JI6 E;  4BMJ A;  3AUZ A;  4TUI A;  2VE7 C;  4YY3 E;  1ZBT A;  1PKP A;  2L2M A;  2L3J A;  1DI2 A;  5A2Q C;  3IWC A;  1WXR A;  4DV3 E;  4DMI A;  3J81 C;  4F9A B;  5ADZ A;  4JI0 E;  2ODR C;  4BCA A;  3JAM C;  3LLH A;  2NUF A;  3FIG A;  2L2K B;  5AE2 A;  5AAS A;  2HHH E;  2NUE A;  2NUG A;  1IBK E;  4DR7 E;  4DV7 E;  3HQ1 A;  2UUC E;  1XNR E;  5IWA E;  2FV4 B;  4LTY A;  4BBY A;  2B3T B;  4LFB E;  3HXL A;  3JU0 A;  2LUQ A;  3JTZ A;  4BC7 A;  2M4I A;  2LTS A;  3OTO E;  2MC6 A;  4BC9 A;  4DR1 E;  3OML A;  4J8Z A;  4LF6 E;  2VQE E;  2VQF E;  2V85 A;  4LF9 E;  4Q28 A;  5IT9 C;  2KON A;  2FGG A;  2JOX A;  2E1M A;  4JI8 E;  1DQ3 A;  3HTX A;  1GZ6 A;  4DUY E;  1SR9 A;  4R03 A;  2UUB E;  1XMQ E;  1YYK A;  4JI3 E;  2L6M A;  2L92 A;  2VF1 A;  2E5L E;  4JI4 E;  2N3G A;  2K4V A;  2JOB A;  1ZBQ A;  2B7T A;  2IHR 1;  2MC5 A;  1YYW A;  4WSP A;  2M1S A;  1YYO A;  4DV5 E;  1X48 A;  3F6G A;  2RSM A;  1HR0 E;  4DV4 E;  1HNX E;  2V86 A;  3VK6 A;  2JR1 A;  1I94 E;  5T6J A;  4F54 A;  3J80 C;  4NXN E;  3ADI A;  1HNZ E;  4K0K E;  4OX9 E;  5AE3 A;  2H36 X;  1RQ0 A;  1QU6 A;  3LML A;  2B7V A;  2UU9 E;  3K6Q A;  2JWO A;  4DR5 E;  4AQY E;  3ZOQ B;  3KWR A;  2YT4 A;  2V87 A;  1WHQ A;  3HPZ A;  4YHH E;  4TUG A;  2LTR A;  5LMN E;  5F3W A;  2L8T A;  4JYA E;  4I8O A;  4DKK A;  2N3H A;  3VYX A;  2LUP B;  1J5E E;  4KHP E;  1WHN A;  4NXM E;  1UHZ A;  4P78 A;  1FKA E;  1STU A;  3H09 A;  4B3T E;  5CFF E;  2UUA E;  4L5N C;  2RTX A;  3HPS A;  4JI7 E;  4WPY A;  1FJG E;  2LJH A;  2RS7 A;  3ADL A;  3DF6 A;  2V8Q B;  1O0W A;  4M30 A;  2LMZ A;  2LE2 A;  4KZS A;  4DV2 E;  1N36 E;  4JV5 E;  2UXC E;  2UXD E;  4DR3 E;  4GKJ E;  4OOG C;  1UIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...