2WZOA

The structure of the fyr domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
146
structure length
146
Chain Sequence
GRPVFPIGLGGLTVYSLGEIITDRPGFHDESAIYPVGYCSTRIYASMKCPDQKCLYTCQIKDGGVQPQFEIVPEDDPQNAIVSSSADACHAELLRTISTTMGKLMPNLLPAGADFFGFSHPAIHNLIQSCPGARKCINYQWVKFDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of the Fyr Domain of Transforming Growth Factor Beta Regulator 1 (Tbrg1)(Pna)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords TRANSFORMING GROWTH FACTOR BETA REGULATOR 1
total genus 35
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2009-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05964 FYRN F/Y-rich N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.360 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2wzoA01
2WZOA
chains in the Genus database with same CATH superfamily
2EPXA 3P1XA 4ZYDA 2GLIA 2B7TA 2JOXA 5A6AA 3ZOQB 2GPIA 4IS1C 2EOSA 5A69A 2EMAA 3MSWA 1O0WA 3THOB 5AE2A 4JI5E 3VYXA 1L4SA 1EH7A 2YTIA 4YHHE 2L92A 2VQEE 2ENAA 4P78A 4LF4E 2RS6A 2H36X 2V88A 4DV7E 2JR1A 3J81C 4LU9A 4BC9A 2EJ4A 2V83A 2L2NA 2L6MA 4JI3E 2V87A 2VE7C 4ZYEA 2EORA 2LBSB 3TQMA 4O5GA 2EMHA 1HNZE 2HHHE 4O43A 4DV6E 1KYQA 2RSIA 2UUBE 2UXCE 4ZYHA 4MLVA 4O24A 2V86A 2I9IA 2B3TB 3FIGA 5CFFE 2K7IA 4BCAA 2GHFA 4F54A 2EPAA 2V89A 2DLQA 2R76A 4I8OA 3F6HA 1A1HA 4M9VC 1DI2A 2EN1A 2DMIA 2RS7A 1TF3A 1G2DC 2JY9A 5A6KA 1T39A 1BB8A 5IXMB 2L3CA 4WXCA 3VK6A 2BBGA 2LRSA 3C4BA 3QG5C 4B3TE 4NZVA 4LF7E 2N3GA 2YPNA 4WSGA 1X47A 4KWYA 2ZM6E 2EMLA 2DLKA 4R2QA 2EPNA 4LFAE 1PJQA 1X48A 3M99B 1B69A 3H09A 2ELYA 2ODRD 1EH6A 1ZAAC 1UILA 3MHHC 2EN4A 1WJPA 4X9JA 1TF6A 3IWBA 4F2JC 1F2IG 4JI6E 2LT7A 1JK2A 2L33A 2EE8A 4M0VA 4R2AA 2CTDA 1YUIA 2L2MA 3IWDA 5LMNE 2EN8A 2RQLA 4P7DA 1A1GA 1AAYA 3HQ1A 4YY3E 2UUCE 1YYWA 4NHRA 3K6QA 2JXPA 2YU8A 4R2PA 1WHQA 3THNA 2M7QA 2VF1A 1KJKA 3IWCA 4JI8E 5LLQA 2EM5A 2E72A 2V8QB 2EOQA 2YT4A 5IV8B 5AE3A 2ENCA 4OX9E 2YTOA 5A6BA 2A25A 3DJWA 3EPJA 2ELZA 1PKPA 2LCEA 1XNQE 4WYQB 3HPZA 1X6EA 3VYYA 1IBME 2DSYA 2YTPA 1LLMC 2V85A 2MKDA 3HTXA 2DRPA 1YYKA 4LFCE 1RQ0A 2YTEA 4LF8E 1YSAC 2EPRA 2IHR1 4R03A 4FK5C 2YZTA 2KONA 1QU6A 1NCSA 1N33E 1UBDC 3BF2A 1IBLE 2ODRC 1DGCA 4HEIA 2EMGA 4DUZE 4F6MA 2WBUA 4BHBA 1YUJA 1IQSA 2EPKX 1JK1A 2M1SA 3ADIA 2EOEA 5LL6R 3EQ1A 2PRTA 4KHPE 2EM7A 2JOBA 4R2EA 3EPLA 3ADGA 2EL5A 3OMLA 1IBKE 1P47A 2NUFA 4LF5E 5KL6A 2D9HA 2JVAA 5BR8E 2MDRA 2KHXA 5AC5A 2EOHA 3ADJA 1AH5A 4JYAE 4JI4E 4J8ZA 1GTKA 2E1MA 4Q35B 2CT1A 1X3CA 1A1IA 2EPMX 2F4VE 2EMCA 4IJDA 1YPNA 2DMYA 4GKKE 4F9BB 2B7VA 2EM0A 4O4KA 4BMJA 2EQ0A 2LTRA 4HTGA 3T1YE 4DR1E 2LJUA 2YTGA 4LFBE 4ZYGA 1TN9A 4X66E 1T4NA 2EM3A 2M9AA 5A2QC 2JP9A 2YTQA 4B3SE 5IT9C 2EMYA 1A1FA 4R8OA 3T1HE 2EOZA 4BC7A 2EQ1A 2N3HA 3J7Yp 2EL6A 5KL5A 3J7AG 1EH8A 1UN6B 4R2SA 1PJTA 2EL4A 1MEYC 2KOUA 1SFEA 2EOIA 2UU9E 4NXNE 4WFTA 2WCC3 4M30A 5AC4A 3RMPA 5KL3A 2EPCA 5A6JA 2L8TA 2RTXA 2LUPB 1J26A 3C4TA 3KZZA 2Q8UA 4DV0E 1ZU1A 3EPKA 3UK3C 4NXME 3VHTB 4DV3E 1A1LA 1G2FC 2EM2A 3EPHA 2B9DA 1X49A 2NA2A 5F3WA 4F9CB 1NEIA 2LO3A 2F8BA 2EMWA 3AV0A 3KZYA 2MDGA 1A1KA 2YTFA 5AE1A 4WSPA 4L5NC 1PJSA 1HNXE 4BBYA 5LMUE 2EMBA 2HGHA 2EPZA 2L3JA 1ZBQA 4JV5E 4B3ME 1YZ9A 2YU5A 3BGHA 4X8WA 2YRHA 5T6JA 4LTYA 2NUEA 4DUYE 2DGCA 4TUIA 2UXDE 2EN2A 2DB2A 1N32E 4R2DA 3ADLA 3ECRA 2MKNA 3J80C 4AQYE 1HR0E 2LV2A 4X64E 1X6HA 4DV4E 2VRDA 1BBGA 2R1FA 4OOGC 3HXLA 4DR2E 2VQFE 4BHCA 1STUA 1YYOA 2EWLA 4Q28A 4DR3E 2LTSA 1PDAA 4GKJE 4GZNC 2N8XA 4MLQA 2EM8A 4RH8A 4X65E 3KWRA 2M4IA 1WHNA 2LE2A 2WZOA 1I94E 2EMZA 2EPPA 2LUQA 2HJJA 1GZ6A 2EZ6A 5ADZA 4GEQB 2YTJA 4WXDA 1XMOE 2G7HA 3F6GA 1GQEA 2EM9A 2CPNA 1HNWE 4JI2E 2EOOA 4JI0E 1RMDA 3LLHA 4KZSA 4R2RA 3OTOE 4X62E 4JI1E 2L2KB 3DF6A 5AASA 1N3GA 4DKKA 2EOMA 3BIDA 2EPLX 4F9AB 1X6FA 2YRKA 4F6NA 4TUGA 1ZR9A 2E5LE 2JPAA 4LF6E 1IMUA 2YWQA 1BBOA 3C6MA 4BS9A 2FV4B 3LMLA 2DIXA 2EPOA 1QNTA 1YFHA 2ENHA 2YTDA 3JTZA 2EN3A 1FJGE 3HPSA 2EPUA 4DR5E 5TSEA 5A6BD 2UUAE 1UHZA 2K4VA 2WBTA 4DMIA 1EKZA 2JWOA 1WXRA 2EM6A 2YTNA 1T38A 1N34E 1T4OA 1SR9A 4WX9A 2EMXA 3L00A 2MC5A 2RPCA 1FKAE 2LMZA 1A1JA 4LF9E 4DR4E 2RSMA 2LJHA 2HC5A 2EMIA 2FGGA 3JAMC 2J7JA 5KL4A 3JU0A 1N36E 1IQOA 1Z1BA 2EOJA 1X5WA 4DR6E 2EOXA 2EN7A 4RHBB 2YSOA 3AUZA 1ZBTA 4WPYA 2EM4A 2YRMA 4K0KE 2EN6A 4DV2E 5FLXC 1XMQE 1RC7A 5IWAE 2LVHA 4DV1E 2JYAA 5KL2A 2UXBE 2EOFA 5DNYA 4N4RB 2ADRA 4DV5E 4DR7E 2EOYA 1DQ3A 2FTXB 2CSHA 2EQ3A 2EP3A 4L8NA 1T4LB 3BBGA 2I13A 4M2ZA 2NUGA 3C6KA 2NABA 2BB8A 2WBSA 2YSPA 4JI7E 4B3RE 1J5EE 5KL7A 2EMFA 2EMKA 1WRJA 2MC6A 1XNRE 1MGTA 3MHSC 4R2CA
chains in the Genus database with same CATH topology
5LMNE 4R8OA 3P1XA 3T1HE 2CPNA 1HNWE 4BC7A 4JI2E 2B7TA 2JOXA 2N3HA 4P7DA 3ZOQB 3J7Yp 4JI0E 3MSWA 1O0WA 3LLHA 3J7AG 4KZSA 3HQ1A 5AE2A 4YY3E 3OTOE 4X62E 4JI5E 4JI1E 3VYXA 2UUCE 2KOUA 2L2KB 2UU9E 1YYWA 3DF6A 4WFTA 5AASA 4YHHE 3K6QA 4DKKA 4NXNE 1WHQA 2L92A 4M30A 2VF1A 3F6GA 2M7QA 2VQEE 3IWCA 4F9AB 4P78A 3RMPA 4LF4E 4TUGA 2E5LE 2RS6A 4JI8E 2H36X 4LF6E 2L8TA 2RTXA 2V88A 2V8QB 4BS9A 2YT4A 4DV7E 2LUPB 5AE3A 1J26A 3C4TA 2JR1A 4OX9E 2FV4B 3LMLA 2DIXA 3DJWA 4DV0E 4NXME 3J81C 4LU9A 3JTZA 4BC9A 2V83A 1PKPA 2L2NA 2L6MA 1FJGE 4JI3E 2V87A 2VE7C 3HPSA 4DR5E 1XNQE 4WYQB 3HPZA 4DV3E 3VYYA 2UUAE 2LBSB 1IBME 2DSYA 1UHZA 2B9DA 1X49A 2K4VA 2NA2A 4F9CB 4DMIA 5F3WA 1EKZA 1HNZE 2JWOA 1WXRA 2F8BA 2V85A 3HTXA 3AV0A 4DV6E 2UUBE 1YYKA 5AE1A 2UXCE 1N34E 1T4OA 1SR9A 2V86A 2B3TB 4LFCE 3FIGA 4WSPA 1RQ0A 4L5NC 2MC5A 5CFFE 1FKAE 2LMZA 4LF8E 4BCAA 1HNXE 4BBYA 4LF9E 2IHR1 4DR4E 4R03A 4F54A 5LMUE 2RSMA 2V89A 2YZTA 2KONA 1QU6A 1N33E 2LJHA 2L3JA 1ZBQA 2FGGA 3JAMC 1IBLE 2ODRC 4I8OA 3F6HA 3JU0A 1N36E 4B3ME 1YZ9A 4JV5E 1DI2A 4X8WA 5T6JA 4LTYA 2NUEA 4DUZE 4DUYE 4TUIA 2UXDE 2RS7A 4DR6E 2JY9A 2DB2A 1N32E 3AUZA 1ZBTA 2M1SA 4WPYA 3VK6A 5LL6R 2L3CA 3ADIA 2LRSA 2JOBA 3C4BA 3ADLA 4B3TE 4KHPE 4LF7E 3J80C 4AQYE 2N3GA 1HR0E 3ADGA 4K0KE 4X64E 3OMLA 4DV2E 1IBKE 5FLXC 4DV4E 1XMQE 1X47A 2NUFA 1RC7A 4LF5E 2JVAA 5IWAE 2ZM6E 4OOGC 3HXLA 5BR8E 4DR2E 2VQFE 2MDRA 4DV1E 2KHXA 1STUA 3ADJA 2EWLA 1YYOA 4Q28A 4DR3E 4LFAE 2LTSA 4JYAE 2UXBE 4GKJE 1X48A 5DNYA 4DV5E 4JI4E 4J8ZA 4DR7E 2E1MA 1DQ3A 2FTXB 2F4VE 3H09A 2DMYA 4GKKE 4X65E 4L8NA 3KWRA 2ODRD 4F9BB 2B7VA 1T4LB 4M2ZA 2NUGA 2M4IA 4BMJA 2LTRA 1WHNA 1UILA 2HHHE 2LE2A 2WZOA 1I94E 3T1YE 2LUQA 4DR1E 3IWBA 1GZ6A 4LFBE 4JI7E 4X66E 5ADZA 2EZ6A 1J5EE 4B3RE 4GEQB 1T4NA 4JI6E 2L33A 5A2QC 1XMOE 4M0VA 4B3SE 5IT9C 2G7HA 2L2MA 2MC6A 1XNRE 1GQEA 3IWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WZO A; 
#chains in the Genus database with same CATH topology
 2EPX A;  3P1X A;  4ZYD A;  2GLI A;  2B7T A;  2JOX A;  5A6A A;  3ZOQ B;  2GPI A;  4IS1 C;  2EOS A;  5A69 A;  2EMA A;  3MSW A;  1O0W A;  3THO B;  5AE2 A;  4JI5 E;  3VYX A;  1L4S A;  1EH7 A;  2YTI A;  4YHH E;  2L92 A;  2VQE E;  2ENA A;  4P78 A;  4LF4 E;  2RS6 A;  2H36 X;  2V88 A;  4DV7 E;  2JR1 A;  3J81 C;  4LU9 A;  4BC9 A;  2EJ4 A;  2V83 A;  2L2N A;  2L6M A;  4JI3 E;  2V87 A;  2VE7 C;  4ZYE A;  2EOR A;  2LBS B;  3TQM A;  4O5G A;  2EMH A;  1HNZ E;  2HHH E;  4O43 A;  4DV6 E;  1KYQ A;  2RSI A;  2UUB E;  2UXC E;  4ZYH A;  4MLV A;  4O24 A;  2V86 A;  2I9I A;  2B3T B;  3FIG A;  5CFF E;  2K7I A;  4BCA A;  2GHF A;  4F54 A;  2EPA A;  2V89 A;  2DLQ A;  2R76 A;  4I8O A;  3F6H A;  1A1H A;  4M9V C;  1DI2 A;  2EN1 A;  2DMI A;  2RS7 A;  1TF3 A;  1G2D C;  2JY9 A;  5A6K A;  1T39 A;  1BB8 A;  5IXM B;  2L3C A;  4WXC A;  3VK6 A;  2BBG A;  2LRS A;  3C4B A;  3QG5 C;  4B3T E;  4NZV A;  4LF7 E;  2N3G A;  2YPN A;  4WSG A;  1X47 A;  4KWY A;  2ZM6 E;  2EML A;  2DLK A;  4R2Q A;  2EPN A;  4LFA E;  1PJQ A;  1X48 A;  3M99 B;  1B69 A;  3H09 A;  2ELY A;  2ODR D;  1EH6 A;  1ZAA C;  1UIL A;  3MHH C;  2EN4 A;  1WJP A;  4X9J A;  1TF6 A;  3IWB A;  4F2J C;  1F2I G;  4JI6 E;  2LT7 A;  1JK2 A;  2L33 A;  2EE8 A;  4M0V A;  4R2A A;  2CTD A;  1YUI A;  2L2M A;  3IWD A;  5LMN E;  2EN8 A;  2RQL A;  4P7D A;  1A1G A;  1AAY A;  3HQ1 A;  4YY3 E;  2UUC E;  1YYW A;  4NHR A;  3K6Q A;  2JXP A;  2YU8 A;  4R2P A;  1WHQ A;  3THN A;  2M7Q A;  2VF1 A;  1KJK A;  3IWC A;  4JI8 E;  5LLQ A;  2EM5 A;  2E72 A;  2V8Q B;  2EOQ A;  2YT4 A;  5IV8 B;  5AE3 A;  2ENC A;  4OX9 E;  2YTO A;  5A6B A;  2A25 A;  3DJW A;  3EPJ A;  2ELZ A;  1PKP A;  2LCE A;  1XNQ E;  4WYQ B;  3HPZ A;  1X6E A;  3VYY A;  1IBM E;  2DSY A;  2YTP A;  1LLM C;  2V85 A;  2MKD A;  3HTX A;  2DRP A;  1YYK A;  4LFC E;  1RQ0 A;  2YTE A;  4LF8 E;  1YSA C;  2EPR A;  2IHR 1;  4R03 A;  4FK5 C;  2YZT A;  2KON A;  1QU6 A;  1NCS A;  1N33 E;  1UBD C;  3BF2 A;  1IBL E;  2ODR C;  1DGC A;  4HEI A;  2EMG A;  4DUZ E;  4F6M A;  2WBU A;  4BHB A;  1YUJ A;  1IQS A;  2EPK X;  1JK1 A;  2M1S A;  3ADI A;  2EOE A;  5LL6 R;  3EQ1 A;  2PRT A;  4KHP E;  2EM7 A;  2JOB A;  4R2E A;  3EPL A;  3ADG A;  2EL5 A;  3OML A;  1IBK E;  1P47 A;  2NUF A;  4LF5 E;  5KL6 A;  2D9H A;  2JVA A;  5BR8 E;  2MDR A;  2KHX A;  5AC5 A;  2EOH A;  3ADJ A;  1AH5 A;  4JYA E;  4JI4 E;  4J8Z A;  1GTK A;  2E1M A;  4Q35 B;  2CT1 A;  1X3C A;  1A1I A;  2EPM X;  2F4V E;  2EMC A;  4IJD A;  1YPN A;  2DMY A;  4GKK E;  4F9B B;  2B7V A;  2EM0 A;  4O4K A;  4BMJ A;  2EQ0 A;  2LTR A;  4HTG A;  3T1Y E;  4DR1 E;  2LJU A;  2YTG A;  4LFB E;  4ZYG A;  1TN9 A;  4X66 E;  1T4N A;  2EM3 A;  2M9A A;  5A2Q C;  2JP9 A;  2YTQ A;  4B3S E;  5IT9 C;  2EMY A;  1A1F A;  4R8O A;  3T1H E;  2EOZ A;  4BC7 A;  2EQ1 A;  2N3H A;  3J7Y p;  2EL6 A;  5KL5 A;  3J7A G;  1EH8 A;  1UN6 B;  4R2S A;  1PJT A;  2EL4 A;  1MEY C;  2KOU A;  1SFE A;  2EOI A;  2UU9 E;  4NXN E;  4WFT A;  2WCC 3;  4M30 A;  5AC4 A;  3RMP A;  5KL3 A;  2EPC A;  5A6J A;  2L8T A;  2RTX A;  2LUP B;  1J26 A;  3C4T A;  3KZZ A;  2Q8U A;  4DV0 E;  1ZU1 A;  3EPK A;  3UK3 C;  4NXM E;  3VHT B;  4DV3 E;  1A1L A;  1G2F C;  2EM2 A;  3EPH A;  2B9D A;  1X49 A;  2NA2 A;  5F3W A;  4F9C B;  1NEI A;  2LO3 A;  2F8B A;  2EMW A;  3AV0 A;  3KZY A;  2MDG A;  1A1K A;  2YTF A;  5AE1 A;  4WSP A;  4L5N C;  1PJS A;  1HNX E;  4BBY A;  5LMU E;  2EMB A;  2HGH A;  2EPZ A;  2L3J A;  1ZBQ A;  4JV5 E;  4B3M E;  1YZ9 A;  2YU5 A;  3BGH A;  4X8W A;  2YRH A;  5T6J A;  4LTY A;  2NUE A;  4DUY E;  2DGC A;  4TUI A;  2UXD E;  2EN2 A;  2DB2 A;  1N32 E;  4R2D A;  3ADL A;  3ECR A;  2MKN A;  3J80 C;  4AQY E;  1HR0 E;  2LV2 A;  4X64 E;  1X6H A;  4DV4 E;  2VRD A;  1BBG A;  2R1F A;  4OOG C;  3HXL A;  4DR2 E;  2VQF E;  4BHC A;  1STU A;  1YYO A;  2EWL A;  4Q28 A;  4DR3 E;  2LTS A;  1PDA A;  4GKJ E;  4GZN C;  2N8X A;  4MLQ A;  2EM8 A;  4RH8 A;  4X65 E;  3KWR A;  2M4I A;  1WHN A;  2LE2 A;  2WZO A;  1I94 E;  2EMZ A;  2EPP A;  2LUQ A;  2HJJ A;  1GZ6 A;  2EZ6 A;  5ADZ A;  4GEQ B;  2YTJ A;  4WXD A;  1XMO E;  2G7H A;  3F6G A;  1GQE A;  2EM9 A;  2CPN A;  1HNW E;  4JI2 E;  2EOO A;  4JI0 E;  1RMD A;  3LLH A;  4KZS A;  4R2R A;  3OTO E;  4X62 E;  4JI1 E;  2L2K B;  3DF6 A;  5AAS A;  1N3G A;  4DKK A;  2EOM A;  3BID A;  2EPL X;  4F9A B;  1X6F A;  2YRK A;  4F6N A;  4TUG A;  1ZR9 A;  2E5L E;  2JPA A;  4LF6 E;  1IMU A;  2YWQ A;  1BBO A;  3C6M A;  4BS9 A;  2FV4 B;  3LML A;  2DIX A;  2EPO A;  1QNT A;  1YFH A;  2ENH A;  2YTD A;  3JTZ A;  2EN3 A;  1FJG E;  3HPS A;  2EPU A;  4DR5 E;  5TSE A;  5A6B D;  2UUA E;  1UHZ A;  2K4V A;  2WBT A;  4DMI A;  1EKZ A;  2JWO A;  1WXR A;  2EM6 A;  2YTN A;  1T38 A;  1N34 E;  1T4O A;  1SR9 A;  4WX9 A;  2EMX A;  3L00 A;  2MC5 A;  2RPC A;  1FKA E;  2LMZ A;  1A1J A;  4LF9 E;  4DR4 E;  2RSM A;  2LJH A;  2HC5 A;  2EMI A;  2FGG A;  3JAM C;  2J7J A;  5KL4 A;  3JU0 A;  1N36 E;  1IQO A;  1Z1B A;  2EOJ A;  1X5W A;  4DR6 E;  2EOX A;  2EN7 A;  4RHB B;  2YSO A;  3AUZ A;  1ZBT A;  4WPY A;  2EM4 A;  2YRM A;  4K0K E;  2EN6 A;  4DV2 E;  5FLX C;  1XMQ E;  1RC7 A;  5IWA E;  2LVH A;  4DV1 E;  2JYA A;  5KL2 A;  2UXB E;  2EOF A;  5DNY A;  4N4R B;  2ADR A;  4DV5 E;  4DR7 E;  2EOY A;  1DQ3 A;  2FTX B;  2CSH A;  2EQ3 A;  2EP3 A;  4L8N A;  1T4L B;  3BBG A;  2I13 A;  4M2Z A;  2NUG A;  3C6K A;  2NAB A;  2BB8 A;  2WBS A;  2YSP A;  4JI7 E;  4B3R E;  1J5E E;  5KL7 A;  2EMF A;  2EMK A;  1WRJ A;  2MC6 A;  1XNR E;  1MGT A;  3MHS C;  4R2C A; 
#chains in the Genus database with same CATH homology
 5LMN E;  4R8O A;  3P1X A;  3T1H E;  2CPN A;  1HNW E;  4BC7 A;  4JI2 E;  2B7T A;  2JOX A;  2N3H A;  4P7D A;  3ZOQ B;  3J7Y p;  4JI0 E;  3MSW A;  1O0W A;  3LLH A;  3J7A G;  4KZS A;  3HQ1 A;  5AE2 A;  4YY3 E;  3OTO E;  4X62 E;  4JI5 E;  4JI1 E;  3VYX A;  2UUC E;  2KOU A;  2L2K B;  2UU9 E;  1YYW A;  3DF6 A;  4WFT A;  5AAS A;  4YHH E;  3K6Q A;  4DKK A;  4NXN E;  1WHQ A;  2L92 A;  4M30 A;  2VF1 A;  3F6G A;  2M7Q A;  2VQE E;  3IWC A;  4F9A B;  4P78 A;  3RMP A;  4LF4 E;  4TUG A;  2E5L E;  2RS6 A;  4JI8 E;  2H36 X;  4LF6 E;  2L8T A;  2RTX A;  2V88 A;  2V8Q B;  4BS9 A;  2YT4 A;  4DV7 E;  2LUP B;  5AE3 A;  1J26 A;  3C4T A;  2JR1 A;  4OX9 E;  2FV4 B;  3LML A;  2DIX A;  3DJW A;  4DV0 E;  4NXM E;  3J81 C;  4LU9 A;  3JTZ A;  4BC9 A;  2V83 A;  1PKP A;  2L2N A;  2L6M A;  1FJG E;  4JI3 E;  2V87 A;  2VE7 C;  3HPS A;  4DR5 E;  1XNQ E;  4WYQ B;  3HPZ A;  4DV3 E;  3VYY A;  2UUA E;  2LBS B;  1IBM E;  2DSY A;  1UHZ A;  2B9D A;  1X49 A;  2K4V A;  2NA2 A;  4F9C B;  4DMI A;  5F3W A;  1EKZ A;  1HNZ E;  2JWO A;  1WXR A;  2F8B A;  2V85 A;  3HTX A;  3AV0 A;  4DV6 E;  2UUB E;  1YYK A;  5AE1 A;  2UXC E;  1N34 E;  1T4O A;  1SR9 A;  2V86 A;  2B3T B;  4LFC E;  3FIG A;  4WSP A;  1RQ0 A;  4L5N C;  2MC5 A;  5CFF E;  1FKA E;  2LMZ A;  4LF8 E;  4BCA A;  1HNX E;  4BBY A;  4LF9 E;  2IHR 1;  4DR4 E;  4R03 A;  4F54 A;  5LMU E;  2RSM A;  2V89 A;  2YZT A;  2KON A;  1QU6 A;  1N33 E;  2LJH A;  2L3J A;  1ZBQ A;  2FGG A;  3JAM C;  1IBL E;  2ODR C;  4I8O A;  3F6H A;  3JU0 A;  1N36 E;  4B3M E;  1YZ9 A;  4JV5 E;  1DI2 A;  4X8W A;  5T6J A;  4LTY A;  2NUE A;  4DUZ E;  4DUY E;  4TUI A;  2UXD E;  2RS7 A;  4DR6 E;  2JY9 A;  2DB2 A;  1N32 E;  3AUZ A;  1ZBT A;  2M1S A;  4WPY A;  3VK6 A;  5LL6 R;  2L3C A;  3ADI A;  2LRS A;  2JOB A;  3C4B A;  3ADL A;  4B3T E;  4KHP E;  4LF7 E;  3J80 C;  4AQY E;  2N3G A;  1HR0 E;  3ADG A;  4K0K E;  4X64 E;  3OML A;  4DV2 E;  1IBK E;  5FLX C;  4DV4 E;  1XMQ E;  1X47 A;  2NUF A;  1RC7 A;  4LF5 E;  2JVA A;  5IWA E;  2ZM6 E;  4OOG C;  3HXL A;  5BR8 E;  4DR2 E;  2VQF E;  2MDR A;  4DV1 E;  2KHX A;  1STU A;  3ADJ A;  2EWL A;  1YYO A;  4Q28 A;  4DR3 E;  4LFA E;  2LTS A;  4JYA E;  2UXB E;  4GKJ E;  1X48 A;  5DNY A;  4DV5 E;  4JI4 E;  4J8Z A;  4DR7 E;  2E1M A;  1DQ3 A;  2FTX B;  2F4V E;  3H09 A;  2DMY A;  4GKK E;  4X65 E;  4L8N A;  3KWR A;  2ODR D;  4F9B B;  2B7V A;  1T4L B;  4M2Z A;  2NUG A;  2M4I A;  4BMJ A;  2LTR A;  1WHN A;  1UIL A;  2HHH E;  2LE2 A;  2WZO A;  1I94 E;  3T1Y E;  2LUQ A;  4DR1 E;  3IWB A;  1GZ6 A;  4LFB E;  4JI7 E;  4X66 E;  5ADZ A;  2EZ6 A;  1J5E E;  4B3R E;  4GEQ B;  1T4N A;  4JI6 E;  2L33 A;  5A2Q C;  1XMO E;  4M0V A;  4B3S E;  5IT9 C;  2G7H A;  2L2M A;  2MC6 A;  1XNR E;  1GQE A;  3IWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...