2WZOA

The structure of the fyr domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
146
structure length
146
Chain Sequence
GRPVFPIGLGGLTVYSLGEIITDRPGFHDESAIYPVGYCSTRIYASMKCPDQKCLYTCQIKDGGVQPQFEIVPEDDPQNAIVSSSADACHAELLRTISTTMGKLMPNLLPAGADFFGFSHPAIHNLIQSCPGARKCINYQWVKFDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSFORMING GROWTH FACTOR BETA REGULATOR 1
publication title The Structure of the Fyr Domain of Transforming Growth Factor Beta Regulator 1 (Tbrg1)(Pna)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 35
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2009-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05964 FYRN F/Y-rich N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.360 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2wzoA01
2WZOA
chains in the Genus database with same CATH superfamily
2WCC3 2EPRA 3DJWA 4FK5C 2EMXA 2LUQA 3UK3C 2I9IA 4JI3E 2RSIA 2R1FA 1BB8A 4NXME 3J7AG 1WHQA 5LMUE 4BS9A 3IWDA 2L92A 3QG5C 4X62E 2UUCE 2B3TB 4J8ZA 3KZYA 2DLKA 1B69A 4MLQA 2DSYA 1J5EE 1WJPA 3EPJA 2EL4A 2YTNA 1PDAA 2EOMA 4MLVA 2YRMA 2EORA 4JI6E 4M0VA 3VYXA 3C6MA 1N33E 4B3ME 4B3RE 2Q8UA 4ZYDA 1STUA 2HC5A 4Q28A 2V83A 2K7IA 2L6MA 2PRTA 2H36X 3DF6A 2LMZA 4R2EA 3ZOQB 2UU9E 4I8OA 2I13A 4JI1E 1X6HA 2M7QA 2YTEA 1AH5A 1PJQA 4P78A 4X8WA 3ADJA 5KL3A 2EOJA 1A1JA 4TUIA 2LUPB 1A1HA 5KL2A 4WFTA 2EM7A 1FKAE 4X66E 4RHBB 1X6EA 3HPSA 1L4SA 4L8NA 2FV4B 1EH8A 4JV5E 1MGTA 1G2FC 2VQFE 4LF4E 2EPMX 4ZYHA 4LF8E 4KHPE 1T38A 2FTXB 4P7DA 1PJTA 4JI8E 2BB8A 3TQMA 2J7JA 4LF7E 4DR4E 2F4VE 5IT9C 2B7TA 1YUIA 4WSPA 5DNYA 2EOZA 2EM3A 2EMWA 1A1GA 3HQ1A 2V8QB 3VYYA 3ADIA 2KHXA 1YYWA 1X48A 2ELYA 4WXDA 4WSGA 4GEQB 5A6KA 1KYQA 2NA2A 2EMIA 2ZM6E 1YYKA 4DR6E 1MEYC 2MKDA 5AASA 5LL6R 3MSWA 2DLQA 4L5NC 2LE2A 2EMCA 2EMLA 3F6GA 3C4TA 4R2CA 2YSOA 2ADRA 2VQEE 3EPLA 2V85A 2EN7A 5AE1A 4R2RA 2B7VA 5IXMB 2EQ3A 2M1SA 5KL4A 1YUJA 2JP9A 4X64E 1X47A 4DR3E 4YHHE 4N4RB 5KL6A 1UN6B 2VRDA 5KL7A 2EOHA 2V87A 1T4OA 2EN6A 2YTFA 1ZR9A 2L8TA 3L00A 3OTOE 2EM6A 1N36E 2JY9A 2RS7A 4KZSA 1A1IA 2EL5A 2EM0A 2L2KB 4OX9E 2EJ4A 4R2PA 2WBSA 3HTXA 2ODRC 4BCAA 2G7HA 1A1LA 1XMQE 1G2DC 2YU8A 1GTKA 5ADZA 1WHNA 4X65E 2MDGA 4JI2E 4GKKE 5CFFE 2NUGA 1RC7A 1IBME 4LFCE 2RSMA 4WX9A 3KWRA 4R8OA 2DMIA 2EL6A 3BGHA 4LF9E 2EPKX 2NUFA 2JOXA 2L2MA 1X6FA 2YPNA 2FGGA 4NXNE 2YZTA 5LMNE 3THNA 3EQ1A 1YFHA 3AV0A 4YY3E 1JK1A 2ENAA 4F9BB 2E72A 2L33A 3AUZA 4F9CB 4JI0E 2UUAE 2EMFA 4KWYA 5TSEA 1IMUA 1IBKE 1T4LB 1UILA 2UXCE 2EM5A 1KJKA 4GKJE 2EOSA 3OMLA 4IJDA 2LT7A 4M9VC 1YSAC 2EOXA 2WBTA 4DV0E 1LLMC 2DRPA 1DI2A 1BBGA 2N3GA 2YTOA 1NEIA 2EZ6A 2EWLA 4F6NA 1TF3A 3VHTB 3HXLA 4BHCA 2EMZA 4IS1C 5T6JA 4BMJA 4DUZE 4K0KE 1IQOA 1ZAAC 2JXPA 2LO3A 1X5WA 2EM2A 2JWOA 4DR5E 2EE8A 2VF1A 5LLQA 3P1XA 3F6HA 1XMOE 2RTXA 4DV4E 2EMYA 3C6KA 3IWCA 4RH8A 2MKNA 5IV8B 2LTRA 2V86A 2JYAA 4LU9A 2EN3A 2WBUA 2EN4A 2EOFA 2KONA 2BBGA 4LFAE 4O24A 3HPZA 3BIDA 1HNXE 2HGHA 2B9DA 4F2JC 2EMHA 1QU6A 2LCEA 3ECRA 1HR0E 3T1YE 1T39A 1RMDA 3LLHA 4JI4E 1EH7A 2M4IA 1ZBTA 3MHSC 4DR7E 2LJUA 1AAYA 2EMAA 1F2IG 1YPNA 1IQSA 4B3SE 1HNWE 2EMBA 3BBGA 4DV2E 1X49A 1PKPA 2JR1A 2NUEA 2VE7C 2GLIA 2LTSA 3LMLA 5AE3A 1WXRA 5A6BD 5F3WA 1TN9A 2EOQA 1ZBQA 2YTPA 1A1KA 1XNQE 2LVHA 4DV1E 2CT1A 2HHHE 2MDRA 2EPLX 2DIXA 2MC5A 2EMGA 4R2AA 4JI5E 4ZYGA 3KZZA 1X3CA 2JPAA 2GPIA 5AE2A 2M9AA 2RPCA 2E5LE 4M2ZA 1A1FA 2V89A 4F9AB 2LV2A 1PJSA 4LF6E 1O0WA 4R03A 4F6MA 3JTZA 4DV5E 4B3TE 1GQEA 2YTQA 4DR1E 4NHRA 2YU5A 2KOUA 2EN2A 2EPOA 3M99B 5FLXC 2K4VA 4R2SA 1N3GA 2YTIA 4ZYEA 2EOEA 2HJJA 4BC9A 4AQYE 1YYOA 2EPXA 2CSHA 5AC4A 2EP3A 2RS6A 2UXBE 2WZOA 2UXDE 4DR2E 4GZNC 2YT4A 1T4NA 4HTGA 4JI7E 2IHR1 4LTYA 2EPAA 3C4BA 2DB2A 4WPYA 2L3CA 2YSPA 4OOGC 2GHFA 5AC5A 2EN8A 2EPNA 3H09A 5A69A 4TUGA 2RQLA 3ADGA 2EOOA 3RMPA 2F8BA 2N3HA 4O43A 2EQ0A 2EOYA 1DQ3A 1GZ6A 1SR9A 2EPZA 4LFBE 1Z1BA 3K6QA 4BBYA 4DMIA 2ELZA 5KL5A 1YZ9A 2V88A 1HNZE 1DGCA 4X9JA 2YTGA 2N8XA 2R76A 1NCSA 2EQ1A 4DKKA 3JAMC 1BBOA 4BC7A 2NABA 1N32E 5A6BA 2E1MA 1ZU1A 4WYQB 2DMYA 2EPCA 2CTDA 4R2DA 3MHHC 4DV7E 2ODRD 4LF5E 1EH6A 2EM8A 2EMKA 5A2QC 2L3JA 2LRSA 3J80C 1UHZA 1XNRE 3BF2A 2L2NA 1RQ0A 1QNTA 5IWAE 1TF6A 4F54A 2EN1A 2EM4A 2LBSB 5A6AA 2EOIA 3T1HE 4O5GA 3JU0A 2DGCA 3VK6A 3THOB 5BR8E 3EPKA 4Q35B 2EPPA 2ENCA 4BHBA 1J26A 1JK2A 4DUYE 1N34E 2YTJA 4DV6E 2D9HA 5A6JA 2YRHA 2YWQA 1SFEA 4NZVA 4M30A 2EM9A 3J7Yp 2CPNA 3EPHA 3IWBA 4O4KA 2UUBE 4JYAE 1I94E 3J81C 1P47A 2YTDA 2JOBA 2JVAA 4HEIA 1EKZA 2MC6A 1WRJA 4DV3E 4R2QA 2LJHA 1IBLE 2ENHA 2A25A 3FIGA 1UBDC 3ADLA 2EPUA 4WXCA 1FJGE 2YRKA
chains in the Genus database with same CATH topology
2DB2A 4WPYA 2V85A 4OOGC 2L3CA 5AE1A 3DJWA 2JWOA 2LUQA 4DR5E 2VF1A 2B7VA 3H09A 4JI3E 4TUGA 2M1SA 3P1XA 3F6HA 3ADGA 1XMOE 4NXME 2RTXA 4DV4E 2F8BA 2N3HA 3RMPA 1WHQA 3J7AG 5LMUE 3IWCA 4BS9A 3IWDA 2L92A 4X62E 2UUCE 4X64E 1DQ3A 1GZ6A 1X47A 2B3TB 4J8ZA 4DR3E 1SR9A 2LTRA 2V86A 4YHHE 4LU9A 4LFBE 2DSYA 2KONA 3K6QA 2V87A 4BBYA 1T4OA 4DMIA 1J5EE 1YZ9A 2V88A 2L8TA 4LFAE 3OTOE 1HNZE 1N36E 2JY9A 2RS7A 4KZSA 3HPZA 1HNXE 2B9DA 1QU6A 4DKKA 2L2KB 3JAMC 3T1YE 1HR0E 3LLHA 4M0VA 4JI4E 4BC7A 4JI6E 4OX9E 2M4IA 1N32E 3HTXA 2E1MA 2ODRC 4BCAA 3VYXA 2G7HA 1ZBTA 4WYQB 1N33E 4B3ME 4B3RE 1XMQE 4DR7E 2DMYA 1STUA 4Q28A 4DV7E 2ODRD 5ADZA 1WHNA 2V83A 4X65E 4B3SE 2L6MA 4LF5E 1HNWE 2H36X 3DF6A 2LMZA 3ZOQB 2UU9E 4DV2E 1X49A 1PKPA 4I8OA 2JR1A 1FJGE 5A2QC 4JI1E 2VE7C 2L3JA 4JI2E 5CFFE 2NUEA 2LRSA 2M7QA 3J80C 1RC7A 1UHZA 1XNRE 1IBME 2NUGA 4LFCE 2L2NA 2RSMA 4P78A 4X8WA 1RQ0A 3KWRA 4R8OA 5IWAE 2LTSA 3ADJA 4F54A 4TUIA 2LBSB 3LMLA 2LUPB 4LF9E 5AE3A 1WXRA 2NUFA 3T1HE 2JOXA 2L2MA 4WFTA 5F3WA 2FGGA 3JU0A 4NXNE 3VK6A 2YZTA 5BR8E 5LMNE 1FKAE 1ZBQA 4X66E 1XNQE 4DV1E 3HPSA 3AV0A 4YY3E 4L8NA 2HHHE 4DUZE 4GKKE 2MDRA 2FV4B 4K0KE 2DIXA 4F9BB 1J26A 4JV5E 2MC5A 2VQFE 4JI5E 4DUYE 4LF4E 5AE2A 1N34E 2L33A 3AUZA 4DV6E 4LF8E 2E5LE 4M2ZA 4KHPE 2V89A 2FTXB 4F9CB 4P7DA 4F9AB 4JI0E 2UUAE 4LF6E 4JI8E 1O0WA 4R03A 4LF7E 4DR4E 3JTZA 4DV5E 4B3TE 1GQEA 4M30A 1IBKE 1T4LB 1UILA 3J7Yp 2B7TA 2CPNA 4WSPA 4DR1E 3IWBA 3OMLA 5DNYA 5IT9C 2UUBE 2KOUA 4GKJE 3HQ1A 2V8QB 4JYAE 5FLXC 3VYYA 1I94E 2K4VA 3ADIA 4DV0E 2KHXA 3J81C 1DI2A 1YYWA 1X48A 4BC9A 4AQYE 2JOBA 2JVAA 2N3GA 4GEQB 1YYOA 1EKZA 2UXCE 2MC6A 2NA2A 2ZM6E 1YYKA 4DR6E 4DV3E 2EZ6A 5AASA 2EWLA 2RS6A 5LL6R 3MSWA 2UXBE 4L5NC 2LE2A 2LJHA 2WZOA 1IBLE 3FIGA 3HXLA 2UXDE 4DR2E 3ADLA 3F6GA 3C4TA 5T6JA 2YT4A 1T4NA 4BMJA 4JI7E 2IHR1 2VQEE 4LTYA 2F4VE 3C4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WZO A; 
#chains in the Genus database with same CATH topology
 2WCC 3;  2EPR A;  3DJW A;  4FK5 C;  2EMX A;  2LUQ A;  3UK3 C;  2I9I A;  4JI3 E;  2RSI A;  2R1F A;  1BB8 A;  4NXM E;  3J7A G;  1WHQ A;  5LMU E;  4BS9 A;  3IWD A;  2L92 A;  3QG5 C;  4X62 E;  2UUC E;  2B3T B;  4J8Z A;  3KZY A;  2DLK A;  1B69 A;  4MLQ A;  2DSY A;  1J5E E;  1WJP A;  3EPJ A;  2EL4 A;  2YTN A;  1PDA A;  2EOM A;  4MLV A;  2YRM A;  2EOR A;  4JI6 E;  4M0V A;  3VYX A;  3C6M A;  1N33 E;  4B3M E;  4B3R E;  2Q8U A;  4ZYD A;  1STU A;  2HC5 A;  4Q28 A;  2V83 A;  2K7I A;  2L6M A;  2PRT A;  2H36 X;  3DF6 A;  2LMZ A;  4R2E A;  3ZOQ B;  2UU9 E;  4I8O A;  2I13 A;  4JI1 E;  1X6H A;  2M7Q A;  2YTE A;  1AH5 A;  1PJQ A;  4P78 A;  4X8W A;  3ADJ A;  5KL3 A;  2EOJ A;  1A1J A;  4TUI A;  2LUP B;  1A1H A;  5KL2 A;  4WFT A;  2EM7 A;  1FKA E;  4X66 E;  4RHB B;  1X6E A;  3HPS A;  1L4S A;  4L8N A;  2FV4 B;  1EH8 A;  4JV5 E;  1MGT A;  1G2F C;  2VQF E;  4LF4 E;  2EPM X;  4ZYH A;  4LF8 E;  4KHP E;  1T38 A;  2FTX B;  4P7D A;  1PJT A;  4JI8 E;  2BB8 A;  3TQM A;  2J7J A;  4LF7 E;  4DR4 E;  2F4V E;  5IT9 C;  2B7T A;  1YUI A;  4WSP A;  5DNY A;  2EOZ A;  2EM3 A;  2EMW A;  1A1G A;  3HQ1 A;  2V8Q B;  3VYY A;  3ADI A;  2KHX A;  1YYW A;  1X48 A;  2ELY A;  4WXD A;  4WSG A;  4GEQ B;  5A6K A;  1KYQ A;  2NA2 A;  2EMI A;  2ZM6 E;  1YYK A;  4DR6 E;  1MEY C;  2MKD A;  5AAS A;  5LL6 R;  3MSW A;  2DLQ A;  4L5N C;  2LE2 A;  2EMC A;  2EML A;  3F6G A;  3C4T A;  4R2C A;  2YSO A;  2ADR A;  2VQE E;  3EPL A;  2V85 A;  2EN7 A;  5AE1 A;  4R2R A;  2B7V A;  5IXM B;  2EQ3 A;  2M1S A;  5KL4 A;  1YUJ A;  2JP9 A;  4X64 E;  1X47 A;  4DR3 E;  4YHH E;  4N4R B;  5KL6 A;  1UN6 B;  2VRD A;  5KL7 A;  2EOH A;  2V87 A;  1T4O A;  2EN6 A;  2YTF A;  1ZR9 A;  2L8T A;  3L00 A;  3OTO E;  2EM6 A;  1N36 E;  2JY9 A;  2RS7 A;  4KZS A;  1A1I A;  2EL5 A;  2EM0 A;  2L2K B;  4OX9 E;  2EJ4 A;  4R2P A;  2WBS A;  3HTX A;  2ODR C;  4BCA A;  2G7H A;  1A1L A;  1XMQ E;  1G2D C;  2YU8 A;  1GTK A;  5ADZ A;  1WHN A;  4X65 E;  2MDG A;  4JI2 E;  4GKK E;  5CFF E;  2NUG A;  1RC7 A;  1IBM E;  4LFC E;  2RSM A;  4WX9 A;  3KWR A;  4R8O A;  2DMI A;  2EL6 A;  3BGH A;  4LF9 E;  2EPK X;  2NUF A;  2JOX A;  2L2M A;  1X6F A;  2YPN A;  2FGG A;  4NXN E;  2YZT A;  5LMN E;  3THN A;  3EQ1 A;  1YFH A;  3AV0 A;  4YY3 E;  1JK1 A;  2ENA A;  4F9B B;  2E72 A;  2L33 A;  3AUZ A;  4F9C B;  4JI0 E;  2UUA E;  2EMF A;  4KWY A;  5TSE A;  1IMU A;  1IBK E;  1T4L B;  1UIL A;  2UXC E;  2EM5 A;  1KJK A;  4GKJ E;  2EOS A;  3OML A;  4IJD A;  2LT7 A;  4M9V C;  1YSA C;  2EOX A;  2WBT A;  4DV0 E;  1LLM C;  2DRP A;  1DI2 A;  1BBG A;  2N3G A;  2YTO A;  1NEI A;  2EZ6 A;  2EWL A;  4F6N A;  1TF3 A;  3VHT B;  3HXL A;  4BHC A;  2EMZ A;  4IS1 C;  5T6J A;  4BMJ A;  4DUZ E;  4K0K E;  1IQO A;  1ZAA C;  2JXP A;  2LO3 A;  1X5W A;  2EM2 A;  2JWO A;  4DR5 E;  2EE8 A;  2VF1 A;  5LLQ A;  3P1X A;  3F6H A;  1XMO E;  2RTX A;  4DV4 E;  2EMY A;  3C6K A;  3IWC A;  4RH8 A;  2MKN A;  5IV8 B;  2LTR A;  2V86 A;  2JYA A;  4LU9 A;  2EN3 A;  2WBU A;  2EN4 A;  2EOF A;  2KON A;  2BBG A;  4LFA E;  4O24 A;  3HPZ A;  3BID A;  1HNX E;  2HGH A;  2B9D A;  4F2J C;  2EMH A;  1QU6 A;  2LCE A;  3ECR A;  1HR0 E;  3T1Y E;  1T39 A;  1RMD A;  3LLH A;  4JI4 E;  1EH7 A;  2M4I A;  1ZBT A;  3MHS C;  4DR7 E;  2LJU A;  1AAY A;  2EMA A;  1F2I G;  1YPN A;  1IQS A;  4B3S E;  1HNW E;  2EMB A;  3BBG A;  4DV2 E;  1X49 A;  1PKP A;  2JR1 A;  2NUE A;  2VE7 C;  2GLI A;  2LTS A;  3LML A;  5AE3 A;  1WXR A;  5A6B D;  5F3W A;  1TN9 A;  2EOQ A;  1ZBQ A;  2YTP A;  1A1K A;  1XNQ E;  2LVH A;  4DV1 E;  2CT1 A;  2HHH E;  2MDR A;  2EPL X;  2DIX A;  2MC5 A;  2EMG A;  4R2A A;  4JI5 E;  4ZYG A;  3KZZ A;  1X3C A;  2JPA A;  2GPI A;  5AE2 A;  2M9A A;  2RPC A;  2E5L E;  4M2Z A;  1A1F A;  2V89 A;  4F9A B;  2LV2 A;  1PJS A;  4LF6 E;  1O0W A;  4R03 A;  4F6M A;  3JTZ A;  4DV5 E;  4B3T E;  1GQE A;  2YTQ A;  4DR1 E;  4NHR A;  2YU5 A;  2KOU A;  2EN2 A;  2EPO A;  3M99 B;  5FLX C;  2K4V A;  4R2S A;  1N3G A;  2YTI A;  4ZYE A;  2EOE A;  2HJJ A;  4BC9 A;  4AQY E;  1YYO A;  2EPX A;  2CSH A;  5AC4 A;  2EP3 A;  2RS6 A;  2UXB E;  2WZO A;  2UXD E;  4DR2 E;  4GZN C;  2YT4 A;  1T4N A;  4HTG A;  4JI7 E;  2IHR 1;  4LTY A;  2EPA A;  3C4B A;  2DB2 A;  4WPY A;  2L3C A;  2YSP A;  4OOG C;  2GHF A;  5AC5 A;  2EN8 A;  2EPN A;  3H09 A;  5A69 A;  4TUG A;  2RQL A;  3ADG A;  2EOO A;  3RMP A;  2F8B A;  2N3H A;  4O43 A;  2EQ0 A;  2EOY A;  1DQ3 A;  1GZ6 A;  1SR9 A;  2EPZ A;  4LFB E;  1Z1B A;  3K6Q A;  4BBY A;  4DMI A;  2ELZ A;  5KL5 A;  1YZ9 A;  2V88 A;  1HNZ E;  1DGC A;  4X9J A;  2YTG A;  2N8X A;  2R76 A;  1NCS A;  2EQ1 A;  4DKK A;  3JAM C;  1BBO A;  4BC7 A;  2NAB A;  1N32 E;  5A6B A;  2E1M A;  1ZU1 A;  4WYQ B;  2DMY A;  2EPC A;  2CTD A;  4R2D A;  3MHH C;  4DV7 E;  2ODR D;  4LF5 E;  1EH6 A;  2EM8 A;  2EMK A;  5A2Q C;  2L3J A;  2LRS A;  3J80 C;  1UHZ A;  1XNR E;  3BF2 A;  2L2N A;  1RQ0 A;  1QNT A;  5IWA E;  1TF6 A;  4F54 A;  2EN1 A;  2EM4 A;  2LBS B;  5A6A A;  2EOI A;  3T1H E;  4O5G A;  3JU0 A;  2DGC A;  3VK6 A;  3THO B;  5BR8 E;  3EPK A;  4Q35 B;  2EPP A;  2ENC A;  4BHB A;  1J26 A;  1JK2 A;  4DUY E;  1N34 E;  2YTJ A;  4DV6 E;  2D9H A;  5A6J A;  2YRH A;  2YWQ A;  1SFE A;  4NZV A;  4M30 A;  2EM9 A;  3J7Y p;  2CPN A;  3EPH A;  3IWB A;  4O4K A;  2UUB E;  4JYA E;  1I94 E;  3J81 C;  1P47 A;  2YTD A;  2JOB A;  2JVA A;  4HEI A;  1EKZ A;  2MC6 A;  1WRJ A;  4DV3 E;  4R2Q A;  2LJH A;  1IBL E;  2ENH A;  2A25 A;  3FIG A;  1UBD C;  3ADL A;  2EPU A;  4WXC A;  1FJG E;  2YRK A; 
#chains in the Genus database with same CATH homology
 2DB2 A;  4WPY A;  2V85 A;  4OOG C;  2L3C A;  5AE1 A;  3DJW A;  2JWO A;  2LUQ A;  4DR5 E;  2VF1 A;  2B7V A;  3H09 A;  4JI3 E;  4TUG A;  2M1S A;  3P1X A;  3F6H A;  3ADG A;  1XMO E;  4NXM E;  2RTX A;  4DV4 E;  2F8B A;  2N3H A;  3RMP A;  1WHQ A;  3J7A G;  5LMU E;  3IWC A;  4BS9 A;  3IWD A;  2L92 A;  4X62 E;  2UUC E;  4X64 E;  1DQ3 A;  1GZ6 A;  1X47 A;  2B3T B;  4J8Z A;  4DR3 E;  1SR9 A;  2LTR A;  2V86 A;  4YHH E;  4LU9 A;  4LFB E;  2DSY A;  2KON A;  3K6Q A;  2V87 A;  4BBY A;  1T4O A;  4DMI A;  1J5E E;  1YZ9 A;  2V88 A;  2L8T A;  4LFA E;  3OTO E;  1HNZ E;  1N36 E;  2JY9 A;  2RS7 A;  4KZS A;  3HPZ A;  1HNX E;  2B9D A;  1QU6 A;  4DKK A;  2L2K B;  3JAM C;  3T1Y E;  1HR0 E;  3LLH A;  4M0V A;  4JI4 E;  4BC7 A;  4JI6 E;  4OX9 E;  2M4I A;  1N32 E;  3HTX A;  2E1M A;  2ODR C;  4BCA A;  3VYX A;  2G7H A;  1ZBT A;  4WYQ B;  1N33 E;  4B3M E;  4B3R E;  1XMQ E;  4DR7 E;  2DMY A;  1STU A;  4Q28 A;  4DV7 E;  2ODR D;  5ADZ A;  1WHN A;  2V83 A;  4X65 E;  4B3S E;  2L6M A;  4LF5 E;  1HNW E;  2H36 X;  3DF6 A;  2LMZ A;  3ZOQ B;  2UU9 E;  4DV2 E;  1X49 A;  1PKP A;  4I8O A;  2JR1 A;  1FJG E;  5A2Q C;  4JI1 E;  2VE7 C;  2L3J A;  4JI2 E;  5CFF E;  2NUE A;  2LRS A;  2M7Q A;  3J80 C;  1RC7 A;  1UHZ A;  1XNR E;  1IBM E;  2NUG A;  4LFC E;  2L2N A;  2RSM A;  4P78 A;  4X8W A;  1RQ0 A;  3KWR A;  4R8O A;  5IWA E;  2LTS A;  3ADJ A;  4F54 A;  4TUI A;  2LBS B;  3LML A;  2LUP B;  4LF9 E;  5AE3 A;  1WXR A;  2NUF A;  3T1H E;  2JOX A;  2L2M A;  4WFT A;  5F3W A;  2FGG A;  3JU0 A;  4NXN E;  3VK6 A;  2YZT A;  5BR8 E;  5LMN E;  1FKA E;  1ZBQ A;  4X66 E;  1XNQ E;  4DV1 E;  3HPS A;  3AV0 A;  4YY3 E;  4L8N A;  2HHH E;  4DUZ E;  4GKK E;  2MDR A;  2FV4 B;  4K0K E;  2DIX A;  4F9B B;  1J26 A;  4JV5 E;  2MC5 A;  2VQF E;  4JI5 E;  4DUY E;  4LF4 E;  5AE2 A;  1N34 E;  2L33 A;  3AUZ A;  4DV6 E;  4LF8 E;  2E5L E;  4M2Z A;  4KHP E;  2V89 A;  2FTX B;  4F9C B;  4P7D A;  4F9A B;  4JI0 E;  2UUA E;  4LF6 E;  4JI8 E;  1O0W A;  4R03 A;  4LF7 E;  4DR4 E;  3JTZ A;  4DV5 E;  4B3T E;  1GQE A;  4M30 A;  1IBK E;  1T4L B;  1UIL A;  3J7Y p;  2B7T A;  2CPN A;  4WSP A;  4DR1 E;  3IWB A;  3OML A;  5DNY A;  5IT9 C;  2UUB E;  2KOU A;  4GKJ E;  3HQ1 A;  2V8Q B;  4JYA E;  5FLX C;  3VYY A;  1I94 E;  2K4V A;  3ADI A;  4DV0 E;  2KHX A;  3J81 C;  1DI2 A;  1YYW A;  1X48 A;  4BC9 A;  4AQY E;  2JOB A;  2JVA A;  2N3G A;  4GEQ B;  1YYO A;  1EKZ A;  2UXC E;  2MC6 A;  2NA2 A;  2ZM6 E;  1YYK A;  4DR6 E;  4DV3 E;  2EZ6 A;  5AAS A;  2EWL A;  2RS6 A;  5LL6 R;  3MSW A;  2UXB E;  4L5N C;  2LE2 A;  2LJH A;  2WZO A;  1IBL E;  3FIG A;  3HXL A;  2UXD E;  4DR2 E;  3ADL A;  3F6G A;  3C4T A;  5T6J A;  2YT4 A;  1T4N A;  4BMJ A;  4JI7 E;  2IHR 1;  2VQE E;  4LTY A;  2F4V E;  3C4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...