1MGTA

Crystal structure of o6-methylguanine-dna methyltransferase from hyperthermophilic archaeon pyrococcus kodakaraensis strain kod1
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
169
structure length
169
Chain Sequence
MLSVEKFRVGERVVWIGVIFSGRVQGIAFAFDRGTLMKRIHDLAEHLGKRGVSISLDVQPSDYPEKVFKVLIGELDNASFLRELSFEGVTPFEKKVYEWLTKNVKRGSVITYGDLAKALNTSPRAVGGAMKRNPYPIVVPCHRVVAHDGIGYYSSGIEEKKFLLEIEGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (O6-METHYLGUANINE-DNA METHYLTRANSFERASE)
publication title Hyperthermostable protein structure maintained by intra and inter-helix ion-pairs in archaeal O6-methylguanine-DNA methyltransferase.
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Transferase
total genus 57
structure length 169
sequence length 169
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 1999-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF09153 DUF1938 Domain of unknown function (DUF1938)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mgtA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1mgtA01
5JFRA 2DAOA 2STWA 5ILVA 4PGHA 4FX4A 5HLGA 3HSEA 4EJOA 2GA2A 1W4MA 1ON1A 1P2FA 3MFKA 4BYYA 2JZYA 4Q4ZF 1AWCA 4G94A 5D6EA 5JHUA 3HOTA 3R6SA 2EFNA 4QWQA 2XAGA 2ZNZA 4UHTA 3MZYA 1YQAA 3KEOA 2EFWA 3P9KA 4JQFA 3E5QA 3H3UA 4ZYEA 4RGXA 3SFZA 4KMUX 4EVIA 3WTUC 4CXFA 5ILSA 4FHTA 4XBFA 3R4KA 4RB0A 1J9IA 2IPQX 3HUGA 1R5GA 3P9IA 1SD7A 3K2ZA 2QQBA 3WTSC 3Q5FA 4IRHA 2EFPA 5D6FA 1IXCA 3L00A 3HHGA 2HOEA 3LSTA 4YG2F 1KU3A 4HW0A 5J6XA 4KUMA 3LAJA 1J75A 2FF4A 3E6CC 2ELHA 2HFHA 5FB2A 5D4SA 1FSEA 2V1UA 2KRFA 3EUHA 5H6QA 4CICA 4Q5SF 2MLGA 2ZXJA 4M9XA 2JSCA 3EDPA 2EV0A 1QGPA 1Z9CA 2QQAA 2XUBA 1O3QA 5DD8A 4LJZF 4IHSA 1YTYA 1Z7UA 1QPMA 1USTA 2W84A 1SD6A 4KICA 1Q1HA 4HAMA 2Q8KA 3B73A 5FO5A 5J8FA 4KIBA 2WC2A 4LG0A 1B6AA 1R5HA 4HYEA 4RS8A 3ZP5A 3T0YA 3BZ6A 5HDNA 2IA1A 1IN5A 2KJCA 5BPIA 3FM3A 3HTUA 5FD6A 2UZKA 4OINF 1FBQA 1TLHB 2E1NA 4HV5A 1XMKA 2V79A 1S7AA 3T8TA 2HYFA 3I58A 2OD5A 1TQPA 1O3TA 1SFUA 3Q9SA 2VN2A 4QLCU 4FX0A 4O3MA 1IN4A 3HTSB 1TBXA 3O3KA 1FT9A 4G7ZF 2NRAC 2H94A 3RIRA 4LFUA 3ULQB 4L0ZB 4I01A 4F7ZA 2ZO4A 3ZMVA 5D8KB 5K5RA 4HZFA 2NNNA 1IRGA 3GFIA 5CLSA 1MJAA 5ICCA 1HSJA 1BI1A 2NNYA 3EQLF 5E1ZB 3CO7C 5HLHA 4G7HF 1WWXA 1HW1A 2A3SA 3LWFA 2RNJA 3R0AA 5L3BA 3WTVC 5LGTA 3V7RA 1XDSA 3FMQA 3L9FA 3WODF 2VXZA 3DKWA 3TKYA 3IHUA 3BOQA 1BBYA 4AIHA 5DDGA 1MJ9A 1G3TA 2DO7A 4NB5A 4KMFA 3SHFA 3SQNA 5HS7A 1F9NA 2FMYA 1ZG3A 1XMAA 4NQWA 2HWVA 4HQMA 3KEQA 3L09A 4GYGA 4WX9A 4WXDA 3DQVC 3K1MA 1K78B 2EJRA 3SZPA 2ETHA 3FMRA 5TRDA 4Y13A 1JE8A 1ZLKA 1BC7C 2NS0A 2JPCA 2WV0A 2MD5A 2H6CA 2KJBA 5HDGA 4L5JA 1KQ0A 1YS6A 4LD5A 4HDVA 2YX4A 3FXUA 5LHGA 3WE2A 1K7AA 3Q9VA 2HR3A 1HW5A 4BQAA 1Z6RA 1XSVA 3BJ6A 4UXNA 4M6YA 1UHMA 2GZWA 3D5LA 1TW3A 3WTTC 5D8LB 2EV6A 2M45A 2XV4S 4MEYF 1WI9A 2Z3YA 2BBYA 3FX3A 3JSOA 5FLXK 2MBFA 4HBLA 1IXRC 3KE2A 3CLOA 1T2KA 1FPQA 5L3EA 4S04A 2BV6A 2IJLA 3QOPA 1BIAA 5HDKA 3KETA 1XDUA 1ZRCA 1R22A 3BP8A 2HQNA 4BHPA 1HSTA 3E6MA 4U7DA 4WCGA 2JT1A 2ZJ2A 2PN6A 3CUOA 1STZA 3ML6A 2Z99A 3RKWA 3QU3A 2CSOA 5TJJA 3RYRA 5AIQA 5KVRA 3HSFA 2V9VA 2MH9A 1RZ4A 1OMIA 4LLNA 2BYVE 4CDGA 1T98A 3DEUA 3WG9A 4R8HA 1DPUA 2DPDA 1OPCA 4UVCA 1LEAA 4M72A 1R36A 2M5WA 1B1BA 2ZCWA 2AS5F 1A04A 4ESJA 1G4DA 4A0ZA 4A5MA 2IVMA 2HEOA 3HHHA 2DT5A 1SD4A 2EK5A 2IA2A 1U2WA 3AAFA 1J2XA 3HSRA 1Z91A 2QM3A 4L9NA 4UVBA 3H3ZA 2E7XA 4IRGA 2IT0A 3QP5A 1GVJA 1S3JA 2YR2A 3T8RA 1FP1D 4EM2A 4HF0A 1Y0UA 4ZH4F 3IKTA 2HTJA 1HBXG 1BI0A 1TQMA 3LA2A 2L54A 2FSWA 2FU4A 3IRQA 2DQLA 2PFBA 3DPLC 5DCMB 1TTYA 2L02A 2XAHA 2PG4A 2XIGA 1J59A 3VFZA 4OIQF 3QRFF 4LB5A 1FWZA 2Q2EA 2B0LA 3D0SA 2IW5A 4IPAA 3VODA 2G9WA 3V7CA 3I0TA 1T38A 1FOKA 3GFMA 4FT8A 3I64A 5CJ9A 2A61A 4EM1A 4RB3C 1K78A 1U5TC 1MKMA 5E8IA 5LLQA 4HA8A 4U0VA 4CYDA 2K4BA 2DW4A 3NEUA 4I98B 2OZUA 1FBSA 2PBIA 4XRFA 3DXJF 1GHCA 1Z6TA 1G3YA 3MAJA 2D1HA 3F8FA 1QZYA 4LMYA 3M9AA 1HW2A 2DK5A 2F5DA 5KK1A 3RTRA 5H20A 1FYKA 2AXLA 3MZHA 1I6XA 2R3SA 1KU9A 4RGUA 5DEQA 3G73A 1W5SA 1FYMA 1FBUA 2FOKA 4M74A 3V8LA 5HVQC 4WXCA 1J7KA 3E5XA 1JXSA 3DV8A 1R23A 2EB7A 1XN7A 4L9JA 3DPTA 3T1BA 2KIUA 1YLFA 2WTEA 2G7UA 3GXOA 3T5XA 1XSDA 3I54A 5ICFA 4G7OF 2A07F 1SFXA 2QLZA 3TOAA 3C1DA 5LHIA 1BI3A 5IT9Z 1U5TB 2LDUA 5HOOA 1W7PA 5CVIA 4HDUA 4A0XA 2XKOA 2DPUA 5F1RA 2HTSA 3KP2A 4YFNF 2TDXA 5BMZA 1L3LA 1FZPB 5LEKA 4WK8F 5LRSA 1MDMB 4IJAA 3RKXA 1KQ8A 3JAMZ 3U9GA 1P92A 3FF5A 1LQ1A 2X4HA 2DU9A 4S05A 1V4RA 4N9HA 4P9FA 3RI4A 4LGWA 2LF8A 5E1WA 3HYIA 3U1DA 3CO6C 3H92A 2O8XA 3WGGA 3ZMDA 4KYWA 2OBPA 1QQIA 1ZHFA 1S7OA 2L4MA 2EA4A 3GEZA 1U6GA 1SMTA 5J8CA 4HF2A 2VE8A 2L01A 2XKPA 3PQKA 1MD0A 3TO6A 1UCRA 3M8FA 3E5UA 3R60A 3E3VA 3KZYA 4DNCA 2O61A 5DCMA 1DUXC 2J5PA 3PFIA 1HQCA 1HXDA 2G7HA 3QP6A 4IXAA 4EV0A 1OYWA 2GIVA 2D2WA 4P9UA 4WF2A 4UNOA 2MLKA 2W24A 1S8NA 4MQ9F 3W6KB 2BGCA 5FFXA 4OIPF 1BOAA 1QO0D 1Z05A 2DBBA 3MCZA 1LEBA 1E17A 1MJBA 4E70A 4HX4A 4WXHA 2OQGA 4A2UA 1FC3A 4ENNA 3CJNA 2PLYA 5FD5A 2OQRA 5BQTA 4HLYA 3ZMTA 1F4KA 2GQQA 4ZYHA 3ZMSA 2UXNA 2F5FA 3K69A 5L3FA 1OR7A 1R1TA 4ESFA 4RAZA 5EEGA 4LK0F 1J0RA 1O7FA 1IXSB 3CDHA 3MWMA 3GF2A 2K7LA 2XAJA 2P5LC 3IWZA 1KU7A 2ISYA 5E8GA 1IRFA 4AIJA 2V1DA 2VBWA 3DF8A 3PQJA 3REOA 2VBZA 1U3EM 1D8JA 1BC8C 1IN8A 1ZAOA 2OA4A 4ZZLA 1F1ZA 3M8EA 3WE3A 4R79A 5DD4A 1YIOA 2WWYA 2FBKA 1O7LA 1K6OA 2A69F 1GXPA 1ZG1A 2QUFA 4MNUA 5DV5A 4OOIA 5ILUA 4RGSA 5JI6A 3LA3A 4BH9A 2IP2A 2ADUA 3I53A 2JPBA 4MTEA 3P9CA 3M7GA 3F8BA 3ELKA 4RB2C 1U5TA 4BXUA 2O0YA 1L0OC 2M30A 3RDIA 2ACJA 3J7AO 2RQPA 2ZFWA 1K79A 4D0PA 2FBIA 4GCVA 1BN5A 4ESBA 4I0AA 1MDMA 1UHWA 1O3SA 5ED4A 2L3DA 1BIBA 3NRVA 4G8XA 5ICEA 1ZLJA 4BHBA 2FNAA 5DUKA 2VBXA 3TOBA 4A0YA 3J81Z 3L2CA 4L18B 3K9TA 2UWMA 2NYXA 5E20A 5FLXZ 3KP4A 3HOSA 4ENKA 2A5YB 3C7JA 3E6BA 4PZJA 3I71A 2RVCA 1SAXA 4EJVA 1IAWA 3RPUA 3IC7A 1XB4A 1TNSA 3TQNA 3DP7A 2P7VB 2OU2A 3ISPA 2KIFA 1R7JA 2VC0A 3FXRA 1I1SA 3WU1B 3ZMZA 4UV9A 1FYLA 1W7PB 3WGHA 4EJWA 3HRUA 3ZQ7A 2Z33A 2XVCA 5IT3A 2VOPA 5D4RA 2VBYA 2JRTA 3MQ0A 1RIOH 4XSZF 5CYVA 1IW7F 4H0EA 1IF1A 5A2QZ 3F72A 4A5NA 3IKVA 3IWFA 1H0MA 4PDKA 2FA5A 2L4AA 2DFIA 2GXGA 3I59A 3F6OA 5DYMA 2MC3A 5E18F 1ZGJA 1BJAA 2JTVA 1ULYA 1KQ9A 4HX7A 4BHCA 3F6VA 2DQRA 1PP8F 3JW4A 3W6JB 1O3RA 5E17F 1JGSA 3N97A 2MH2A 1PP7U 3QPTA 2CYYA 4HF1A 2PQ8A 2YSRA 4UV8A 3KCCA 2GXBA 1T39A 3F8CA 3CTAA 2DLLA 1R00A 1F5TA 4IF4A 2FMLA 3F22A 3TDZC 3R0JA 4ENJA 1LJ9A 4L9VA 2MA3A 2XHKA 1KA8A 2C6YA 2QVOA 3BDDA 3BPXA 2P4WA 1IN7A 3JSPA 2OAZA 1O57A 4B8XA 1MGTA 1PDNC 2YX7A 2HS5A 1JHHA 3L7WA 3FM5A 1UB9A 4P55A 3EYYA 1JHFA 3F23A 3ECOA 3LQQA 4HQEA 1YW9A 4ASNA 1X3UA 3QPHA 4EQQA 5LBQA 1G3SA 4ZYGA 3TO7A 1XGNA 4OU0A 2CGPA 3EETA 5DUIA 2VOOA 1XGOA 1SD5A 4KIGA 4RGRA 1MZBA 1I1GA 3HIFA 4N0BA 3QAHA 2CG4A 2K4JA 2PEXA 4U7BA 1YO5C 4KDPA 2Z9OA 3ZN0A 1QZZA 4KN4X 4KIFA 2HDCA 2W25A 4GGGA 1ZRDA 1J5YA 2ISZA 5HLIA 1H9TA 4A12A 3J80Z 1REPC 2COMA 5LHHA 4ZZDA 3M1EA 3WTYC 2P5KA 3JTGA 3RPQA 2QZ8A 2D1VA 4LK1F 2YU3A 5BS6A 1FNNA 2KIMA 2F2EA 3GZ5A 3G3ZA 4ZYDA 4M71A 3TDUC 5K1YA 1DP7P 3BWGA 2IRFG 4L9TA 2XAFA 1ZRFA 2VC1A 1CGPA 5L3GA 2K27A 3KLOA 3WTZA 4G9YA 2F5CA 1USSA 1YG2A 5LGNA 4I02A 3O6BB 4NHJA 1W5TA 4O5VA 2H6BA 5D5WB 2W57A 5IT9K 2QBYB 1EH6A 2CWEA 3GVAA 4XLPF 2HKXA 2EFQA 3LFKA 4AVPA 4EGYA 3FZVA 2ZBKA 3ABUA 3ECHA 4EGZA 1WRJA 5F64A 3BY6A 2HYGD 4UVAA 1BI2A 3JAMK 3GFLA 3GFJA 4B09A 1I27A 4P5OA 2F5EA 5DCFA 1ZREA 4KA4A 3JTHA 4ON0A 1KGSA 2E7WA 4CZZA 2XGXA 4JBAA 2A6EF 1LDDA 1XCVA 4OIRF 3KP3A 3ZPLA 3ERED 4OMZA 3RKYA 3K0LA 2OZ6A 4KNYA 1FSHA 2P6TA 4GYIA 3HRSA 2ZMEB 1R58A 2XAQA 3KP5A 2R7DA 4YIIA 1YYVA 1CF7B 1U8RA 1I5ZA 2QQ9A 1EV7A 2P7CB 3FMSA 2XRNA 1WQ2A 1WSUA 3IL2A 2LSOA 1SMYF 5E1XA 4MQVA 2CQKA 1FX7A 3HRTA 5BOXA 4M9SA 2ESNA 2P6SA 3V8KA 5BPDA 2GWRA 3GLXA 5FFZA 1QNTA 3I4PA 2VONA 1FY7A 3FXQA 1ON2A 4Y17A 3I59B 3GYHX 2QYOA 5JR3A 1DPRA 3ZN1A 1B59A 1LVAA 3CUQC 4A6DA 1OYYA 2LNBA 1B9MA 4M73A 4MTDA 2HGCA 2XROA 2EV5A 5CVVA 4IHTA 4CO8A 4Q47A 3COAC 2ESHA 1YW8A 5LGUA 4XSXF 4YFKF 1D3YA 4LB6B 3F21A 4YFXF 3V4GA 4ENMA 1AOYA 2X0LA 5CVJA 3I5UA 4RB1A 3F8MA 4XLNF 2DK8A 3OV8A 2O3FA 1UFMA 2FEZA 4YIFA 4LLGF 2FE3A 3OOPA 1XSXA 1EH7A 3E97A 4AWXB 3BROA 2RKHA 1Z1DA 1B4AA 2E1CA 3C3WA 2BE5F 4IRIA 2FRHA 2M1BA 3SXYA 2DI3A 2CW0F 1D8KA 3BPVA 3QU6A 2ZNYA 2VT2A 4KN7X 1P4AA 4CHUA 4EJUA 3BJAA 3O2PE 4CGZA 3E6DA 1P4WA 1HKSA 5HS8A 4K2EA 4JK1X 2EFOA 1IN6A 1XCBA 1GXQA 3KP7A 2H09A 2M8EA 5ERIA 4I2OA 2V1XA 4GXOA 4LLLA 3R61A 2R7FA 4KFCA 1D5VA 2CO5A 3WTWC 4EM0B 3RYPA 3V8JA 4O6JA 1OKRA 5AIPA 3HRMA 4HX8A 5ICGA 2QBYA 2P5VA 1PUEE 3CUQB 3TGNA 1ZG5A 1IZ1A 3LQRA 4AIKA 2FBHA 4PCQA 1T0FA 2GAUA 3TO9A 6PAXA 4EJTA 2K02A 4MEXF 4OIOF 4RAYA 1KYWA 3NQOA 1LNWA 2Z5UA 3KZZA 4P96A 2V6CA 3KP6A 1B9NA 1YFHA 3EYIA 2HQRA 4M6XA 2EA2A 3GUDA 5LEJA 4HOBA 3J81K 2PI0A 1ZN2A 4U0WA 1G6NA 4BAYA 3GO5A 3ROUA 3VEPA 2PMHA 1KU2A 4M9ZA 2O03A 1VTNC 3VB2A 1C0WA 4Q48A 2ZMEA 5FGMA 2A6HF 1R1VA 1NHAA 3WGIA 1KYZA 2PJPA 1HKQA 1S6LA 2K86A 2KKOA 4WWCA 1CF7A 2RV8A 5K5OA 1LDKB 1E2XA 1QBJA 3RJPA 3V7SA 2O6GE 3DFGA 1TW2A 2VODA 5A2QK 2HZTA 5JVTA 2BEOA 5D5XB 4A6EA 4I7HA 3F8NA 3B02A 3S2WA 5D5VB 1W7PD 3GW2A 3KFWX 1P6RA 1T6SA 4L5IA 1WKMA 1FLIA 2QWWA 1OYIA 3ZMUA 2QENA 5L3DA 2RN7A 5L3CA 2J5OA 4AD9A 3C18A 2LF7A 3WU0A 3BJOA 3SZTA 1TQIA 1G3WA 5HS9A 4TV7A 3ABTA 2RDPA 3LAPA 1V3FA 1YS7A 1BM9A 2STTA 4UUVA 3WTXC 5D5UB 1DDNA 1ZARA 2P8TA 2W85A 3FHZA 1RI7A 4I0BA 2PMUA 3GZ6A 1ZGAA 2DTRA 2RC4A 2HKOA 1R1UA 1YW7A 4U0YA 3GX4X 1XD7A 4LG0B 3FWEA 4KT5C 5CVRA 4OMYA 4I09A 3K1NA 5CVUA 1SFEA 3KLNA 3P7NA 2Y0MA 3F3XA 2VT3A 1S29A 5AONA 1EH8A 4Y15A 4IVNA 2YPRA 4HLXA 2XASA 3VOEA 1IUYA 2FXAA 4Z2YA 4GO1A 5K5QA 4L0YB 4BNCA 4ETSA 1LB2A 5F6FA 2CFXA 4U88A 1RNLA 1H9GA 1RUOA 4DQ2A 2VE9A 1ZYRF 4MGRA 2UXXA 2Q0OA 1U78A 1ODDA 4HV6A 1ZH5A 3GWZA 2FNPA 2LKPA 4MHGA 2D45A 2FQ3A 5EEHA 2GA1A 3CUQA 1LDJA 2NAZA 3J80K 2M87A 4R1HA 4PGGA 1XGSA 3K1PA 2EWNA 2H27A 3U2RA 3LA7A 1XGMA 5H6RA 4G6DA 4G6QA 2IA0A 1P4XA 1FP2A 4EMSA 2RGVA 2ZKZA 3N4MA 4N9IA 1ONVA 2Y75A 2Y48A 2A68F 1HKTA 3IRRA 1TNTA 5LRRA 1RUNA 3MEXA
chains in the Genus database with same CATH superfamily
4D7NA 5JFRA 2DAOA 2Y2ZA 4ITVA 2STWA 2ZJQF 1YZ9A 5ILVA 1YIJI 2HJJA 4PGHA 5EG0B 2K4VA 4A3JJ 2UXDE 2YU5A 4FX4A 5HLGA 1LKXA 2ZXIA 1MMGA 2ZSHB 2DA6A 3HSEA 4EJOA 3W6VA 2GA2A 1Z0XA 3JCUC 2WY8Q 1W4MA 1ON1A 3BTJA 1P2FA 4CYCA 3MFKA 4BYYA 3J81C 3S2DJ 2EIJH 4A3IJ 4PJMA 2M7QA 1JKOC 2JZYA 4Q4ZF 2L2MA 3UK3C 1AWCA 2KISA 4G94A 2CUZA 5D6EA 5JHUA 4RBOA 3BGHA 2GM4A 4RA2A 2LY9A 3HOTA 3R6SA 2EFNA 4U87A 4QWQA 2DOFA 2XAGA 2Z16A 2B7VA 5FLXC 4NUBA 4F6NA 2EIMH 2ZNZA 4UHTA 3VYXA 2EMCA 3MZYA 1YQAA 1OCPA 1SVOA 2ZJPF 3KEOA 2EFWA 1XPXA 2CW7A 3P9KA 4JQFA 3E5QA 3H3UA 4KT6A 3Q3SA 4ZYEA 1LE8B 4RGXA 3GTPJ 3SFZA 1V55H 3BQYA 4KMUX 4EVIA 3WTUC 4CXFA 5ILSA 4FHTA 2HXOA 2KZVA 2XGEA 4HRIA 4XBFA 4M0VA 3R4KA 1MW7A 4RB0A 1G2HA 2XSDC 1J9IA 1WHQA 2IPQX 1WJCA 1KJKA 3HUGA 1R5GA 1BJZA 2B63J 3P9IA 1SD7A 2EH3A 3K2ZA 2QQBA 2ZSIB 3WTSC 4GKKE 3Q5FA 2NVQJ 4IRHA 2EFPA 3OYLA 5IPAA 4JI1E 2E2JJ 2Y9YA 5D6FA 3PFYA 2YTIA 1IXCA 3L00A 2K85A 1VQ7I 3HHGA 4M3DA 4BEHB 5A2QC 1NG7A 3VYRB 2UUCE 4LFBE 2HOEA 2X6WA 4HSRA 3LSTA 4YG2F 3RZOJ 1APLC 1JT6A 4XMYA 2L2NA 1KU3A 2YWQA 4DR7E 4HW0A 4C3HJ 2VL8A 5J6XA 1WJEA 4KUMA 2EL5A 3LAJA 2YSPA 1J75A 2LY1A 2FF4A 4N4OB 2K9LA 4GDFA 2IS4A 2EOIA 4O43A 2RQQA 1X49A 3KWRA 1NG6A 3E6CC 2ELHA 1Z7LA 4CA0A 4C2UA 2HFHA 4N4NB 5FB2A 4R2AA 4BDZA 3W2AA 5D4SA 1FSEA 2V1UA 4HNUA 2KRFA 3EUHA 2VQGA 2MDRA 3VPRA 3A03A 5H6QA 4CICA 4Q5SF 1WJAA 1NCSA 2MLGA 2ZXJA 3HTXA 4M9XA 4Z6YA 2JSCA 3EDPA 2Y0SA 3RMPA 2K3PA 1V5EA 3FIWA 1Y1VJ 2KDZA 1YYWA 2EV0A 1TWAJ 1QGPA 5FKLA 3I9V2 5E3MA 1Z9CA 2QQAA 2XUBA 4E7SA 1O3QA 4R03A 5DD8A 4LJZF 4IHWA 2ECBA 4LFCE 5K7FA 3HL2A 4IHSA 1YTYA 4XKVA 1Z7UA 1QPMA 2L33A 2JRMA 1OCZH 2NXNB 1USTA 3DWLE 2W84A 1SD6A 3BR0A 4AVZA 3FKJA 4KICA 3H5RA 1Q1HA 4HTGA 4HAMA 2Q8KA 3B73A 4YY3E 5FO5A 1GVDA 2CFOA 1WHNA 3H35A 2K9NA 3JREA 3DEEA 5J8FA 1BBOA 4KIBA 3G6EI 2LK2A 2WC2A 4LG0A 1D0YA 2ZJRF 1JKQC 1B6AA 3KYDB 1BB8A 1MBHA 1R5HA 3F6GA 2Q8UA 2X1CA 3H0GJ 4HYEA 2CSHA 4RS8A 1XX5A 3SYTA 3ZP5A 2EILH 5F0CA 2EN1A 3T0YA 3BZ6A 5HDNA 1W0TA 2E5NA 2IA1A 1IN5A 1R4NB 5K7ZA 3CCEI 1YHQI 4L5NC 3BQZA 2KJCA 5BPIA 3CP8A 3FM3A 3C4TA 3HTUA 2QKLB 2H8RA 1LFBA 5FD6A 2UZKA 1EKEA 4OINF 1FBQA 1TLHB 2R7RA 2E1NA 4BS9A 3K4JA 4X64E 3DF6A 4HV5A 2RAEA 1SVLA 1TZLA 4A3EJ 1XMKA 2R5ZB 4BE0A 2XF6A 2V79A 4KJZA 1QZEA 4G12A 3GTGJ 2EPLX 1S7AA 4RAGA 3T8TA 2HYFA 3I58A 2DB2A 4AQYE 1WI3A 2WB1N 5EZGA 5A6BA 2OD5A 4AM3A 3BF2A 1TQPA 1ETVA 2ELZA 1O3TA 1FOYA 1SFUA 3C2BA 3Q9SA 3ZOQB 2VN2A 1JK1A 4QLCU 4K0KE 4FX0A 4O3MA 1IN4A 3ZQIA 5A69A 4M2ZA 2JYAA 3HTSB 3ABLH 2IGOA 4XLHA 4NNJA 1YRNA 1TBXA 3O3KA 4BKXA 1FT9A 4G7ZF 2NRAC 4BJ6C 2VPLA 5TSEA 2H94A 3RIRA 4LFUA 3BTCA 3ULQB 1EJ9A 4I01A 4L0ZB 1I39A 4F7ZA 3ZR8X 2ZO4A 3ZMVA 1RMDA 1FMVA 5D8KB 5K5RA 2RQLA 1LFPA 4HZFA 2NNNA 2BHYA 1IRGA 4X6AJ 3GFIA 5CLSA 5IP6A 1AKHA 1MJAA 5GAGJ 2GOXB 4DV3E 2Q1ZB 1XNRE 2CQQA 5ICCA 3P1XA 1HSJA 5FJ8J 2WBUA 1BI1A 2NNYA 3EQLF 5E1ZB 2W48A 3CO7C 5HLHA 1GDTA 2RPCA 3SEZA 1E3HA 1WWXA 5CQGA 4G7HF 1HW1A 2LC2A 3TP3A 1CQTA 2A3SA 3LWFA 3QPLA 3H9GA 4DOZA 4EEFG 2ICWG 2RNJA 3R0AA 1QRYA 5L3BA 2E5LE 4DV7E 3CF2A 3WTVC 1TN9A 5LGTA 2DCEA 3V7RA 1WZ2A 1XDSA 3FMQA 3L9FA 4XN0A 3WODF 2VXZA 2B3TB 1N36E 5JHFA 2MKDA 3DKWA 3TKYA 3IHUA 1ZR4A 3BG5A 1JGGA 3LSIA 2Q2EB 3BOQA 1BBYA 4AIHA 5DDGA 1HA8A 2O9LA 1MJ9A 2CMPA 1G3TA 2DO7A 3FHNA 4NB5A 1QPIA 4KMFA 2FV4B 3SHFA 3J80C 1MMAA 3HKZN 3SQNA 4H4KC 5HS7A 2IGNA 1F9NA 2FMYA 1ZG3A 2HPMA 1XMAA 1IGNA 2EM4A 2CUJA 2HWVA 4NQWA 4HQMA 5FROA 2EMGA 2H36X 2GLOA 3KEQA 3JU0A 3L09A 4GYGA 4WX9A 3LSMA 4Y7NJ 3BTLA 1HNXE 4WXDA 3ZQGA 5DM6F 1W5CC 3DQVC 4XLFA 1R71A 2HZDA 2ZC2A 2BB8A 1QVUA 4QPOA 3CCVI 5EG0A 2HOTA 3K1MA 1VF9A 1Y56A 2EJRA 1K78B 3S93A 2I5UA 3SZPA 1JUSA 2ETHA 2QSFX 2R7XA 1V5FA 3FMRA 4RLQA 5TRDA 2EM3A 4Y13A 1JE8A 5IOYA 2CH0A 3T1YE 1BA5A 3K4NA 5HODA 2IGMA 1X6EA 3S8PA 4AYBN 3BG9A 1ZLKA 1BC7C 1PJSA 2NS0A 2JPCA 5M5XJ 2WV0A 3KZIC 2MD5A 2KRHA 3HGGA 3MN2A 4XRMA 2H6CA 2KJBA 5CPRB 3ZQFA 2VQCA 2E1MA 5HDGA 4L5JA 4Y52J 2E34A 2F48A 4II2A 4CCNA 3EUHC 2DA7A 3WHBA 1KQ0A 4DV1E 5FRMA 1FKAE 4DR4E 2ZM6E 1YS6A 4LD5A 4HDVA 4F9BB 2YX4A 4OWRB 1LE8A 3ESWB 3FXUA 3E7LA 2ID6A 5LHGA 3H0DA 3WE2A 1K7AA 3Q9VA 3FIGA 2HR3A 2V9PA 2V7FA 1DI2A 2LMZA 1HW5A 3BIDA 1BBGA 1JUPA 2DTZA 4BQAA 1X6HA 5C4JJ 3WHCA 1Z6RA 4E7KA 2HVQA 1XSVA 3BJ6A 4UXNA 1JTXA 4M6YA 3WG7H 3ZQHA 3G4SI 1UHMA 1D5YA 2GZWA 3RQ4A 5K7HA 2CV1A 1P9QC 3D5LA 1TW3A 4BEHA 5D8LB 3WTTC 5E3NA 2EV6A 1ZQ3P 2M45A 2XV4S 2EQ0A 3TQMA 2EORA 4MEYF 2VB6A 1JJ8C 1WI9A 2Z3YA 4MLVA 2BBYA 3FX3A 3OR1C 3JSOA 5FLXK 3H1CA 2MBFA 4HBLA 1VQPI 1IXRC 2G0EA 1XNQE 3KE2A 2I10A 3CLOA 2X85A 4AC0A 4FASD 1T2KA 3SJMA 3UKGA 1FPQA 1WJBA 2LKSA 5L3EA 3X2QH 2LTPA 2DA2A 4S04A 2BV6A 2IJLA 2DMNA 4IO9F 3QOPA 1EKZA 1BIAA 5HDKA 4FE7A 1IG7A 4WSGA 3KETA 1XDUA 5FLMJ 1STUA 5DNYA 1ZRCA 1E3PA 3D5RC 1R22A 3BP8A 2HQNA 3PNYA 4DZPA 3ZQCA 4BHPA 4JI2E 1HSTA 3E6MA 4UY8I 4U7DA 4WCGA 2JT1A 2ZJ2A 3A2KA 1VQMI 4J8ZA 2PN6A 3CUOA 3P5JA 1UAAA 2R92J 1MMSA 1STZA 3ML6A 2Z99A 3W2WA 3RKWA 2NVTJ 1WVRA 3QU3A 4DYRA 2CSOA 5TJJA 3RYRA 2JMWA 2L2KB 5AIQA 3S2HJ 5KVRA 3LLHA 3HSFA 2V9VA 3BG6A 3H09A 2MH9A 1RZ4A 5GTHC 3RCOA 1OMIA 2ZB9A 4LLNA 1EF4A 2BYVE 3C2HA 4PJJA 4CDGA 1T98A 3DEUA 4FETA 4R8HA 3WG9A 4PSXA 1DPUA 1PJRA 2DPDA 2R1FA 1OPCA 2LVSA 2JVHA 5B3SH 4UVCA 2M4GA 1LEAA 3HDDA 1GV2A 2R7OA 4M72A 1T56A 4X1EA 2BXYA 5EGOB 2XSJC 4IL6C 2GBYA 2JP9A 4ANJA 2V86A 2UUBE 1IMUA 1T08B 1Z3YA 2JVAA 5F0HA 3GZNB 1QU6A 1R36A 2M5WA 1GZ6A 2R7ZJ 1B1BA 2ZCWA 2AS5F 2E35A 2O8KA 1A04A 4ESJA 1G4DA 3C6KA 4DV0E 4F92B 4A0ZA 4BDYA 3I3LA 2LP0A 1DP3A 4A5MA 2IVMA 4LF4E 1JKPC 1YX5A 2EWLA 5IY5H 3HHHA 3LSJA 2DT5A 2HEOA 2QKMB 4E7ZA 4QTRA 1H8AC 1SD4A 2EK5A 4QSHA 3VK6A 4JI4E 2IA2A 1U2WA 3AAFA 1A1KA 1J2XA 3J7YJ 3HSRA 3GLLA 1Z91A 2N3HA 1RRJA 3BR1A 2KQRA 4DR1E 3LSPA 2QM3A 4L9NA 4UVBA 3H3ZA 3CF5F 2EM0A 1ETKA 2EPFA 2E7XA 4IRGA 1ZBQA 3W2VA 3S3OA 3BZCA 2IT0A 2LCEA 3QP5A 2BOLA 1GVJA 5A6AA 2KLOA 3CCMI 2ZXWH 1GQEA 2CRGA 1S3JA 2YR2A 3T8RA 1FP1D 4EM2A 4HF0A 3TBIA 1TWGJ 1Y0UA 1UG2A 5JVGF 2M9AA 4ZH4F 3IKTA 4OX9E 2HTJA 1HBXG 4PK4A 1BI0A 2L92A 1TQMA 3LA2A 2YU9J 2L54A 2K3FA 2FSWA 2A05A 2FU4A 5HNHA 3OYIA 3IRQA 2DQLA 2PFBA 3DPLC 5DCMB 1TTYA 4J01A 2EMAA 2L02A 2XAHA 2PG4A 3OYCA 2BVMA 2XIGA 2AQFA 1J59A 3F9KA 3VFZA 3F6HA 4OIQF 3QRFF 1A5JA 4YIRX 1JTYA 2MFZA 4LB5A 1U0JA 1FEXA 3OS0A 1FWZA 2Q2EA 2B0LA 2HQ5A 3D0SA 5DTDA 4ZC3A 1W36C 2PX9A 1ORKA 4CCJA 2E1MC 2IW5A 4IPAA 4NHRA 4BMJA 3VODA 2G9WA 3V7CA 3DU5A 3OMYA 4ZYAA 1XTAA 3I0TA 2VJIA 1T38A 5GAHJ 1FOKA 2JJ7A 3GFMA 4FT8A 3VYSB 3HPSA 3MHSC 3I64A 3GMEA 5CJ9A 2A61A 4EM1A 1PJQA 3IWBA 3CC7I 2HDWA 3CJTB 3QYEA 4IQ4A 2L9RA 4RB3C 1K78A 1U5TC 2CW8A 1MKMA 5E8IA 5LLQA 1P7JA 3LSGA 4HA8A 3FXJA 4U0VA 4CYDA 4V19K 1H88C 2K4BA 1X3WB 3DBHB 4FE4A 3FISA 2PRTA 2DW4A 3NEUA 4I98B 2OZUA 1PJTA 1UHZA 1FBSA 2WZOA 3S1RJ 2PBIA 3MMYB 2JSPA 4XRFA 3M07A 5A6BD 1FTZA 3OIQA 1WJFA 3DXJF 2YTEA 3CCUI 1GHCA 1Z6TA 2NVXJ 1Z67A 1IBKE 1G3YA 1RR7A 1SC7A 3NAUA 2H1LA 3MAJA 1J26A 2D1HA 3DBRB 1IC8A 3F8FA 1HDPA 1QZYA 1YPNA 2M8GX 1A1IA 4LMYA 4Q28A 3M9AA 1HW2A 2EM8A 2DK5A 5E3LA 2F5DA 2XC7A 5KK1A 2EPXA 4DV5E 4XQFA 4M9VC 3RTRA 4TUGA 4CSWA 2YU8A 3FXOA 5H20A 1UJ8A 1FYKA 2EM9A 2AXLA 3MZHA 1I6XA 2R3SA 4IX7A 1KU9A 4RGUA 2DRPA 5DEQA 3G73A 1F36A 2RNGA 5A6JA 2GHFA 2EPPA 1W5SA 2MABA 2R7UA 1FYMA 1FBUA 4RLFA 2FOKA 4BBSJ 1EA3A 1WJPA 1DQUA 4ZDLA 4DR3E 5TGTA 4M74A 2DYRH 1X1BA 3K10A 2EN8A 4R2RA 3V8LA 9ANTA 4W1UA 2BVLA 5HVQC 3S14J 1ETQA 4WXCA 1LLMC 3F0CA 1MBGA 2UXBE 5IYCJ 1JK2A 1J7KA 3E5XA 1JXSA 3DV8A 1R23A 1O0WA 4LTYA 2VKDA 1DGCA 2EB7A 3VYUB 1XN7A 2R7TA 2IHR1 4L9JA 2V88A 2MKNA 1RPWA 3DPTA 3T1BA 4M30A 3M4OJ 3K4BA 2KIUA 1YLFA 2WTEA 1TWFJ 2O5RA 1Y39A 4ABZA 4E7LA 2EIKH 2NUEA 4HEA2 2NOGA 2G7UA 2X1DA 1IRXA 1X19A 3GXOA 3T5XA 2Y30A 1MMNA 2V8QB 4MLQA 2M9HA 5LFAA 1RKTA 4DGWB 5EEAA 2LBFB 1LPQA 5ADZA 1XSDA 3I54A 4DKKA 2E1MB 5ICFA 4IHXA 3IWDA 4IZZA 4G7OF 2IEKA 3VWBA 1PUFB 4R2SA 5IWAE 4XKCA 2A07F 5EYRA 2YRKA 3FXMA 3EPKA 3HG9A 1SFXA 1Y8RB 5BNGA 4KWYA 3S16J 3OYDA 2VF1A 4WSPA 2QLZA 3EUKL 4F93B 3HPHA 3TOAA 1K83J 2GXAA 2Y31A 2XF5A 3C1DA 5LHIA 2HDDA 1BI3A 5IT9Z 4MFEA 4B1RA 3HC7A 1U5TB 2LDUA 5HOOA 1VQ6I 3J7AG 1W7PA 2QSHX 3CDLA 5CVIA 2KHXA 1ZAAC 4HDUA 4A0XA 2XKOA 2DPUA 5F1RA 4A3CJ 1N3GA 3OYEA 2ZFUA 2HTSA 3KP2A 4XN3A 2F4OB 2M4KA 2LO3A 4YFNF 2TDXA 5BMZA 1L3LA 1FZPB 5LEKA 2CU7A 1PDAA 3CCSI 4WK8F 2YPNA 5EGOA 2ENHA 3ASNH 2EZHA 2EMYA 5LRSA 1MDMB 2KMUA 4IJAA 3RKXA 1KQ8A 3JAMZ 1DGWY 2ZXHA 2PJRB 2L7ZA 4UB8C 3U9GA 1P92A 3FF5A 1B8IB 1LQ1A 1WGXA 1YI2I 3HEFA 2I9IA 2X4HA 2DU9A 4S05A 2E60A 2LLKA 2AXTC 3CCYA 4IQJA 1V4RA 3G1OA 4N9HA 1X47A 1DU6A 5LD2C 1ACIA 5HLTA 4P9FA 4E4HA 3RI4A 4LGWA 2UXCE 2LF8A 1ZK8A 4NDLA 5E1WA 2EPRA 2M0MA 1WH5A 3HYIA 3U1DA 3CO6C 3MKLA 3OYFA 5GPCA 3H92A 2O8XA 4E6KG 3WGGA 3ZMDA 4KYWA 1X1AA 2OBPA 1QQIA 3B6CA 2XRLA 4F9AB 1ZHFA 1S7OA 4NC7A 5KL3A 2HHHE 4FTHA 3K70D 2L4MA 3CMAI 2KPMA 2IGKA 2EA4A 2BXZA 3GEZA 2TCTA 2LRSA 2EL4A 2EM6A 2HU9A 4LOCA 1I3QJ 2R76A 1U6GA 1T95A 2YRMA 1SMTA 3HPGA 5J8CA 1D1BA 4HF2A 1MMDA 4A3GJ 2VE8A 2L01A 2XKPA 4ZDPA 1XMOE 3PQKA 2KFDA 1MD0A 3LSKA 1RR8C 5CFFE 3TO6A 1UCRA 2Y0SN 2L7KA 3M8FA 3TL4X 1X2MA 2X6XA 3E5UA 3R60A 3E3VA 3KZYA 2WBMA 4DNCA 3OS1A 2MYSA 4V2GA 2O61A 2EOFA 2LYCA 5DCMA 5IXMB 1DUXC 2J5PA 2XB5A 3PFIA 1HQCA 2K9SA 4RMNA 5DM7F 2M34A 1HXDA 2FOWA 2LD5A 4JI8E 3ZRGA 2G7HA 3KYLA 1MH4A 4NXNE 3QP6A 4M3FA 4IXAA 4M6VA 4EV0A 4E7JA 4GKJE 1OYWA 2GIVA 2D2WA 4P9UA 4WF2A 4UNOA 1UHSA 4XKWA 2MLKA 2UV1A 2W24A 2EL6A 1S8NA 3OL4A 2JQ7A 4JI3E 2WV1A 3KX2A 2KDOA 4MQ9F 3W6KB 2BGCA 5FFXA 4OIPF 2CS3A 3L2RA 1BOAA 1QO0D 1Z05A 2DBBA 2JWTA 3MCZA 1LEBA 1E17A 2E5ZA 2MW8A 3VSLA 2YTOA 2LOOA 3AG1H 1MJBA 4E70A 2B9SA 1XS9A 2H8WA 4HX4A 1YUJA 4WXHA 1HCRA 4BL0B 2OQGA 4A2UA 1FC3A 3FK6A 3CJNA 4CH7A 5TISC 4ENNA 1U8BA 2PLYA 1L4SA 5FD5A 1G59A 2EPNA 2OQRA 4IHVA 2F4MB 5BQTA 4HLYA 3ZMTA 3HB9A 4LF8E 2JK3A 1F4KA 2GQQA 3M8JA 4AIDA 4ZYHA 3K2AA 3ZMSA 2UXNA 2F5FA 3OIPA 3K69A 4LF7E 5L3FA 2EOOA 3FDYA 1OLTA 4LIVA 2LJHA 3ADJA 1OR7A 4D7MA 2M7BA 2LMDA 2V26A 1R1TA 1ZTRA 3C2GA 1MBFA 4C2MJ 4YELA 5EJCA 4ESFA 4RAZA 5EEGA 4EATA 2HC5A 2H1KA 1VNDA 2B7EA 2E1OA 2R7SA 1SEUA 1K4SA 4LK0F 2KOUA 2DA3A 1J0RA 1O7FA 1IXSB 1PVEA 4M3BA 2FJ1A 2R5YB 3CDHA 2DA4A 1A1LA 3MWMA 3GF2A 3ASOH 2TRTA 2K7LA 2XAJA 2P5LC 3IWZA 3A0HC 1ZKGA 3HOVJ 2VKEA 2EMKA 1KU7A 2ISYA 5E8GA 2DMQA 1IRFA 4AIJA 2DLKA 2JN6A 4DJAA 2V1DA 2VBWA 2O7OA 4LFAE 3DF8A 2E36A 3PQJA 2M3AA 4D5CA 4X66E 3DKYA 3REOA 2VBZA 1U3EM 1D8JA 1BC8C 2GOMA 1KONA 1IN8A 4FISA 3FXKA 1ZAOA 4MLOA 4DBQA 2OA4A 2EMXA 5C44J 2OCCH 4ZZLA 1F1ZA 4HPQA 3M8EA 3WE3A 4R79A 5DD4A 3T1HE 3MSWA 1YIOA 2X51A 2WWYA 3MD2A 1NK3P 2EMHA 2FBKA 1O7LA 1XC5A 1K6OA 2A69F 1Y6IA 4F52A 1GXPA 4BCAA 1UILA 1ZG1A 2QUFA 3Q0VA 4MNUA 3QYBA 5DV5A 3ZGKA 4OOIA 4PJNA 2F4VE 2BY2A 1AA7A 1MBEA 5ILUA 2EM2A 4B3SE 5BR8E 4Q35B 4BC9A 4RGSA 5JI6A 3LA3A 4BH9A 2VRDA 4LF9E 5EDNA 3CZ6A 3OYHA 2IP2A 4L5EA 3B6AA 2LBFA 1A31A 5F08A 1N75A 1I50J 2ADUA 2K5CA 3ECRA 3I53A 2ME6A 1PUFA 2CUEA 1VQNI 2JPBA 4B4CA 2VLAA 4YRVA 3JRIA 3PNVA 1N78A 1FOXA 4MTEA 3P9CA 1HNWE 1OQYA 4A3LJ 3M7GA 2LTRA 3F8BA 4A3MJ 3ELKA 4RB2C 1UMQA 1X1DA 1XMXA 3CQZJ 3BCAA 3HBLA 5AE2A 4A93J 3C4BA 1N77A 1U5TA 1Z21A 4BXUA 2O0YA 1K4TA 1O4XA 1L0OC 2M30A 3HQ1A 3TW7A 3RDIA 2ACJA 3J7AO 3G1MA 1XMQE 2DOAA 2HGHA 2RQPA 5KL7A 3NWSA 2ZFWA 1K79A 1RC9A 4D0PA 1G2FC 2FBIA 4CCLA 1MNEA 4GCVA 1YJWI 1BN5A 4M3GA 2CJJA 4ESBA 1GTKA 5IT9C 4G6TB 5KAIC 2EZLA 2MGQA 4I0AA 3A0BC 1MDMA 1UHWA 1O3SA 2R4GA 1YX3A 5ED4A 3PSIA 2PJRA 2L3DA 2VI6A 2FUG2 2EINH 1B8IA 4CCOA 2CT1A 1BIBA 3ZXSA 2EQRA 3H5AA 3NRVA 4G8XA 5ICEA 1MSFC 1ZLJA 2XB0X 4BHBA 2FNAA 1VQLI 5DUKA 2VBXA 3TOBA 4A0YA 2M7AA 3J81Z 3CJQB 2V1NA 4IS1C 4OAYA 4F55A 3L2CA 4L18B 3K4CA 2ODRC 3H9QA 3JAMC 3CC4I 2HQAA 3CESA 3CP2A 3FKIJ 3GTMJ 3K9TA 3S15J 2UWMA 2NYXA 1ETXA 5E20A 4I6ZA 4DIQA 5FLXZ 3KP4A 2VJ5A 3HOSA 4ENKA 2A5YB 4JV5E 1POGA 1ZR9A 3C7JA 3E6BA 4JOMA 3BCBA 3EUAA 1SFOJ 4PZJA 3DTKA 3I71A 4B43A 2RVCA 4PJLA 1SAXA 4RH8A 3GBGA 4EJVA 1IAWA 2CQ7A 3RPUA 3NWTA 3IC7A 1XB4A 1TNSA 2HI3A 4E7IA 4JYKA 3TQNA 3DP7A 3K4LA 2P7VB 2LFBA 4A3FJ 2M0CA 2OU2A 2MC4A 3ISPA 3IP4B 2KIFA 4BJ5C 4DYCA 4X65E 5E79C 1R7JA 2VC0A 3FXRA 3BR6A 1GV5A 3WU1B 1I1SA 4LF6E 3ZMZA 4UV9A 1FYLA 3LMLA 1P7IA 1W7PB 2KONA 3WGHA 3QG5C 2JUCA 1WH7A 4C9YA 3HRUA 4B3AA 4EJWA 3ZQ7A 1GUUA 4XRSG 2Z33A 2OUMA 2HNHA 2XVCA 1FTTA 5IT3A 2VOPA 5LL6R 5KL2A 1R4MB 2RSIA 5D4RA 4UB6C 2VBYA 3CMEI 2JRTA 1A6QA 3MQ0A 1OR7C 4XSZF 5CYVA 3QWLA 1IW7F 4QPQA 3L2UA 4H0EA 1RIOH 5A2QZ 1IF1A 2JR1A 3F72A 1TWCJ 4A5NA 3IKVA 3IWFA 1S5LC 2QF7A 2FTXB 2EPKX 2DA5A 1H0MA 2QEXI 4MFDA 2NA2A 4B3ME 2X9DA 3EPJA 4PDKA 5F1JA 4P78A 2EPOA 2WAEA 2FA5A 2L3JA 2L4AA 2LRDA 1AAYA 2DFIA 2GXGA 2ELJA 4IJDA 2EMIA 3I59A 3F6OA 5FKNA 5DYMA 1I3AA 2MC3A 5E18F 2CV2A 4WFTA 4DV2E 1NK2P 1ZGJA 1DGRM 1BJAA 1ZU1A 2JTVA 1BOBA 1ULYA 3S3MA 1KQ9A 3SDBA 4HX7A 4BHCA 1QA6A 4B3TE 3F6VA 1VFCA 2EE8A 2DQRA 2PMZN 1D1CA 3QPSA 1X58A 5B66C 2VIXA 1PP8F 3JW4A 2AO9A 3AFHA 5FKKA 3W6JB 4XKBA 3JRFA 1O3RA 4S0HB 5E17F 3DEWA 1N25A 2V85A 2EN6A 1WPKA 2VQLA 2EOMA 4FK5C 1JGSA 4BQQA 3N97A 3JR9A 2MH2A 1PP7U 4KZSA 1MBKA 3QPTA 4XORA 1QVTA 3QODA 2DIXA 1BR4A 2CYYA 4HF1A 2PQ8A 2F6CA 2YSRA 2VQFE 3LMMA 2R7WA 4UV8A 3CCJI 1TF6A 2IS1A 2MSYA 3KCCA 2GXBA 5KL5A 2WAQN 1T39A 3F8CA 2CTDA 1YE9A 3CTAA 3AKZA 2DLLA 5CQEA 3VHTB 2P81A 4WPYA 2YTQA 3JRCA 5IYDJ 1R00A 2R5YA 5KCMA 2EPZA 3OY9A 1F5TA 4IF4A 5DS9A 2NUGA 2FMLA 3OSGA 1JJ6C 1BW6A 4B3RE 3F22A 5J1UA 4R2CA 2KIQA 3TDZC 1H89C 3R0JA 5IOZA 4ENJA 4R2QA 1WJDA 2DJNA 2EJ4A 1LJ9A 2BY1A 2EQ1A 2NS7A 1NTCA 4L9VA 2MA3A 4CUGA 4C3IJ 2XHKA 1KA8A 2YTJA 2WBTA 3KIOA 3ZQQA 1FJLA 2C6YA 2QVOA 2JWOA 3BDDA 3BPXA 2EMLA 2P4WA 1HF0A 1ETOA 1IN7A 3JSPA 4A3DJ 2OAZA 2QQ8A 1O57A 3U21A 5J40A 4B8XA 5EF6A 2XGDA 1MGTA 5KNLA 1PDNC 2YX7A 4XONA 2HS5A 1N32E 1JHHA 3L7WA 3S1NJ 1HNZE 3FM5A 1UB9A 2E2HJ 2KHMA 4P55A 5GADJ 1R49A 4UUSB 3EYYA 1JHFA 3F23A 2WBSA 3ECOA 3LQQA 4HQEA 3E1SA 3HOZJ 2IBDA 2JUGA 1YW9A 4ASNA 1X3UA 2XDVA 3QPHA 3SZGA 4EQQA 1R9TJ 3GTJJ 3GTLJ 3ERMA 5LBQA 3DKXA 1G3SA 4ZYGA 3TO7A 2GIZA 4KITB 1XGNA 4OU0A 2CGPA 4JI6E 3EETA 5DUIA 2XAUA 2VOOA 1XGOA 1SD5A 3GCMA 4KIGA 4KISA 4RGRA 1MZBA 2IXSA 2RSMA 1V5GA 1I1GA 2Y9ZA 4TUIA 2YRHA 3HIFA 2YTNA 4N0BA 3QAHA 2HOSA 2CG4A 3A01A 2V6EA 2V89A 3LSRA 1OCRH 2B7TA 3LOCA 1TF3A 2K4JA 2PEXA 3KEYA 4U7BA 1YO5C 4W97A 1LVKA 4KDPA 2Z9OA 3ZN0A 1QZZA 1Q1VA 4KN4X 2UU9E 1B72A 3BC8A 4KIFA 2HDCA 3PJRA 2W25A 4GGGA 1ZRDA 4R2PA 1IQSA 3JRGA 1J5YA 4PJ0C 2ISZA 3S1MJ 5HLIA 2XF7A 1H9TA 4A12A 4HG2A 2HVRA 4BXFA 1QU3A 4DR5E 4NXME 1U9NA 2ZMEC 5AE3A 3J80Z 1REPC 1X5WA 3ZQLA 2COMA 3K4MA 5LHHA 4DR6E 3EQ1A 1SVMA 1AU7A 2OPTA 2EOYA 3IV5A 4ZZDA 3M1EA 3DCFA 4KHPE 4Y33A 3DLLF 3WTYC 2IS2A 3BG7A 2P5KA 3JTGA 5GPAA 5AC5A 3RPQA 2QZ8A 1HDDC 4P1WA 5M5WJ 1IDZA 3QOEA 4XR6A 2D1VA 3HOWJ 2R7VA 4CCKA 1ENHA 2FD5A 2RREA 3CMMA 2EN4A 3Q0UA 3FK7A 4LK1F 1K61A 2YU3A 5BS6A 1FNNA 3FXLA 3PO2J 2N3GA 2KIMA 2F2EA 4DYQA 3GZ5A 4JX6A 2LY2A 3G3ZA 5J3LA 2FGGA 4ZYDA 1R5ID 4M71A 3TDUC 5K1YA 1DP7P 2EZKA 3BWGA 2IRFG 3JRHA 4F91B 2UUAE 4AUXA 4L9TA 1ZELA 2XAFA 5FLVA 2EMFA 2YTDA 4AU7A 4LIUA 2VC1A 1ZRFA 4NZVA 3VYYA 2DMIA 4M3EA 1CGPA 2W7NA 5CKTA 2K27A 5L3GA 3VSKA 4A69C 3KLOA 3G1LA 3WTZA 4G9YA 2F5CA 3FBNB 1ETWA 2R0QC 1WCMJ 1USSA 1YG2A 5LGNA 4I02A 3O6BB 5FRNA 2EPCA 4NHJA 2GPIA 1W5TA 4O5VA 2RTXA 2H6BA 1UG0A 4B3XA 5D5WB 4I76A 3CC2I 1Y8QB 3BTIA 2W57A 5IT9K 2UUZA 2QBYB 1EH6A 2CWEA 2VPRA 1MSEC 3GVAA 3IH3A 4XLPF 2HKXA 1W36D 2WY7Q 2EFQA 3LFKA 4AVPA 1S9HA 4EGYA 3FZVA 2ZBKA 3ABUA 3ECHA 1T8IA 2EMBA 4EGZA 1WRJA 2COBA 2LR8A 3DJWA 5F64A 2EOJA 3BY6A 3SDGA 4PUSA 1AHDP 2ENAA 2HYGD 4GRIA 4UVAA 3LFUA 3OS2A 1SFKA 2L2OA 5EZHA 3LSHA 3PIOF 1BI2A 4MO7A 2E71A 3JAMK 2Z2SB 3GFLA 3GFJA 4B09A 4R2DA 1FMWA 4RHBB 2LBSB 1FJGE 1I27A 3H5NA 4P5OA 2F5EA 3TEDA 5DCFA 3VYTB 2YTPA 1ZREA 4KA4A 4RM3A 1LFUP 1X4OA 3JTHA 4XNFA 1IV6A 2R7QA 4ON0A 1KGSA 2F8BA 2E7WA 4CZZA 2AHQA 2XGXA 2V83A 2BZTA 4JBAA 2A6EF 2R93J 3M1CA 3I4MJ 1WJ5A 3IH4A 1LDDA 1XCVA 4OIRF 4JI7E 3KP3A 3I55I 1YJNI 3ZPLA 1IRZA 3ADLA 3ERED 2M2EA 4OMZA 3RKYA 3K0LA 1I94E 2L6MA 3OSFA 2OZ6A 4KNYA 4JX5A 5C4XJ 2D5VA 4E7HA 1FSHA 2P6TA 1OCCH 4GYIA 3HRSA 4LF5E 2ZMEB 5JLWA 2XGCA 3CCQI 1R58A 2VQHA 2XAQA 4I99C 1MNDA 2JOXA 4Y3OA 3HOUJ 3KP5A 1X3CA 3CLQA 2R7DA 1X1PA 2V4JC 3O8GA 4YIIA 3WU2C 3J7AY 4I8OA 2QA4I 1YYVA 3RKQA 1W1WE 1CF7B 2KT0A 2IAIA 1U8RA 3OYJA 5GAEJ 1I5ZA 2EOHA 2M4IA 4D1QA 2L7MP 2QQ9A 1EV7A 4XIDA 1FIAA 3FMSA 2P7CB 2GLIA 5IP7J 3QYFA 3L2WA 4DUYE 2XRNA 1FOWA 1WQ2A 1OCTC 3RPUD 1WSUA 3IL2A 4JI5E 5LMNE 2LSOA 3GTOJ 1SMYF 4BY7J 4HSTA 2HYJA 5E1XA 4MQVA 2CQKA 1FX7A 3HRTA 5BOXA 2EBIA 3CD6I 4M9SA 1OCOH 2BW3A 2ESNA 2P6SA 3V8KA 5BPDA 2GWRA 5FKOA 3K6GA 4DBRA 3GLXA 1E0EA 5FFZA 5M3FJ 4QIWN 1MH3A 2AQEA 1VQKI 2ENCA 2WB1A 1QNTA 3I56I 3PM1A 2A6TA 3I4PA 3AUZA 2VONA 4O24A 1FY7A 3FXQA 2NABA 1ON2A 4Y17A 2JOBA 2F4IA 3I59B 1XG1A 4XICA 2HOAA 2YSOA 3A02A 3GYHX 1BR2A 1X48A 4LG3A 2QYOA 5JR3A 2QSGX 1DPRA 3ZN1A 3S3NA 3D5SC 4O5GA 1B59A 1LVAA 3CUQC 1DQ3A 3FBIB 1JI8A 3BZKA 2JVGA 5F04A 4UUSA 4A6DA 1A36A 1OYYA 2LNBA 2EOZA 1B9MA 4M73A 3MKWB 4MTDA 1IUFA 3M99B 2I13A 2ELYA 2DDBA 3PNTA 2V87A 4OAZA 2HGCA 2XROA 5F27A 2EV5A 5CVVA 3OOUA 2V9KA 4XLAA 4IHTA 4CO8A 3OYAA 5AC4A 4BACA 2DFEA 4F2JC 4Q47A 3ADGA 4ZJZA 3COAC 2EOQA 2ESHA 1YW8A 5LGUA 2DJIA 4XSXF 4YFKF 1D3YA 4LB6B 2DGCA 3F21A 4NC6A 4YFXF 4R2EA 3V4GA 1WFXA 5JLXA 3JRDA 4ENMA 1VQ5I 1AOYA 3E0JB 2X0LA 5CVJA 1TL8A 2XPVA 3I5UA 4RB1A 3OYNA 1IBLE 3F8MA 5M5YJ 4XLNF 2E72A 2DK8A 2KRCA 2W1OA 3OV8A 2O3FA 1RKWA 1UFMA 4V2FA 4B48A 4CZCA 1UN6B 5FKMA 2FEZA 1J09A 2JA8J 3PSFA 3S32A 4YIFA 1T33A 4LLGF 2QGUA 1IQOA 3PUFA 4ZTJA 2YZTA 3CCRI 2DODA 3BR5A 2EZ6A 2FE3A 3OOPA 3K4KA 4BQNA 4J00A 3HKZA 1XSXA 1EH7A 3E97A 2MC5A 2K40A 5AASA 4AWXB 3I4NJ 4DZJA 3BROA 1VZ0A 2DXIA 2RKHA 1Z1DA 1B4AA 2E1CA 3C3WA 4D9JA 1T4NA 1Z1BA 4J19A 2OTLI 2BE5F 4IOAF 1K6YA 3U1KA 2FQ4A 5A6KA 3ONQA 1RESA 2LV2A 5J4YA 3GTQJ 2DT6A 1D0ZA 2L9VA 4IRIA 2FRHA 2M1BA 2W4SA 1OFCX 3SXYA 2A5WA 2DI3A 1SAUA 2CW0F 1A1HA 1D8KA 2L9NA 3BPVA 3QU6A 2ZNYA 3HXLA 2VT2A 3DBLB 4KN7X 1P4AA 2B9DA 4CHUA 2LREA 3HPZA 4OOGC 3G2BA 4EJUA 1GT0C 1B69A 4BGDA 1DU0A 3UNGC 3BJAA 3O2PE 1YYKA 3OYMA 3K6QA 5B5EC 1JUMA 3OYBA 2DDAA 1ZR2A 4CGZA 3E6DA 1P4WA 1HKSA 4A3BJ 5HS8A 4HEIA 2KL4A 5HNFA 4K2EA 4JK1X 4AYBA 2EFOA 1IN6A 3L1PA 3TP0A 1XCBA 1E3OC 2VUMJ 2DSYA 2L7FP 3OR2C 1TWHJ 1GXQA 3KP7A 2H09A 2M8EA 5ERIA 3BR2A 1A1FA 3EPHA 4RAFA 4I2OA 4YHHE 4C3JJ 3IAS2 2V1XA 4GXOA 2JA2A 4YEJA 3A01B 2LJUA 3AL0C 4BE2A 3K7AJ 2EQ3A 4LLLA 2F5VA 3R61A 2EOSA 2R7FA 1X4PA 2EN2A 4KFCA 2QCOA 3DTIA 2LUQA 5GTIC 1D5VA 2VASA 2W00A 2CO5A 5C3EJ 1GLNA 3WTWC 5T6JA 3J7Yp 1B72B 4EM0B 1HOMA 3G71I 2DMTA 3RYPA 3V8JA 2OF7A 4O6JA 4X0GA 1OKRA 3O8HA 1X3ZB 5AIPA 1T4OA 3AV0A 3THNA 2OJED 3HRMA 4HX8A 5ICGA 1RQ0A 2CUFA 2QBYA 2P5VA 3V42A 3BR3A 1BR1A 2DMYA 1PUEE 1VQ4I 1VQ9I 3CUQB 2EPUA 4GEQB 1A1JA 3A1YA 1G2DC 3TGNA 1ZG5A 1IZ1A 3LQRA 3IAM2 2DFHA 2EP3A 4ZTFA 4AIKA 2FBHA 4PCQA 1UBDC 1T0FA 3MVPA 4BE1A 2DMUA 3QQAA 2GAUA 3TO9A 6PAXA 4EJTA 2K02A 4MEXF 2NOJB 5F0FA 3L2VA 4OIOF 3BBGA 1ZGWA 1Z77A 4RAYA 1KYWA 2LH9A 4F6MA 3NQOA 1LNWA 3N05A 4B47A 2Z5UA 3KZZA 4BQOA 2JA7J 3H3VK 4P96A 2V6CA 2DYSH 1N33E 2OC6A 1A6IA 2DA1A 2X6OA 2HVSA 1BW5A 1TT5B 2JPAA 4JX4A 3OL3A 1OJLA 5J4VA 3KP6A 4DV4E 1B9NA 1YOVB 3ABMH 1YFHA 3VDXA 5M3MJ 3EYIA 1QHGA 2HQRA 2K7IA 4F9CB 2FX0A 3IUOA 1HLVA 4M6XA 2I8DA 4DW6A 2DOEA 2EA2A 3ADIA 2RS6A 3GUDA 2CQXA 1Y1WJ 5LEJA 4HOBA 3J81K 3CCLI 2EN7A 2PI0A 1ZN2A 2OV7A 4PSWA 3PL8A 3THOB 1IDYA 3D1NI 4U0WA 1OISA 1G6NA 3ZOBA 4BAYA 1F43A 5AE1A 2NVYJ 3TMOA 2ME0A 4BU2A 3GO5A 3ROUA 1LUJB 4RDUA 2LT7A 3KYCB 3VEPA 2PMHA 3IWCA 3AG2H 2L8TA 1KU2A 2VJJA 3ABKH 1I6HJ 2EMWA 5IYBJ 4M9ZA 2O03A 4LU9A 4BC7A 1VTNC 5IV8B 5H2FC 4BXXJ 2ID3A 3IH2A 3VB2A 1C0WA 2WCC3 4CYCB 1UZCA 4Q48A 2ZMEA 5FGMA 2JA5J 2A6HF 4CCMA 1R1VA 2DFFA 3OTOE 1NHAA 3WGIA 1KYZA 5J47A 2PJPA 1HKQA 2EZIA 4XL9A 1JKRC 1S6LA 2CQNA 2K86A 1BL0A 2L9SA 1TC3C 3J7ZI 2KKOA 1AH5A 4WWCA 1CF7A 2KZGA 3JRBA 3S1QJ 1G8XA 2RV8A 2J7JA 1MIJA 5K5OA 1YUIA 1LDKB 3PUBA 4XK4A 1YSAC 4O4KA 1E2XA 1A35A 1QBJA 3RJPA 1KZHA 3V7SA 2O6GE 3DFGA 2EOEA 2X1EA 4F3QA 1W0UA 2RS7A 1TW2A 2VODA 4FQGA 3HOYJ 2LTSA 4NBQA 2VQEE 1J5EE 4PFPA 1F2IG 2E19A 1P47A 5A2QK 2WADA 2HZTA 5JVTA 1QHHD 2BEOA 2BY0A 3OYKA 2XPUA 4IKFA 5D5XB 4A6EA 4I7HA 2NVUB 3W3CA 1X1CA 3OYGA 3F8NA 3HUGB 3B02A 3JTZA 3S2WA 2JA6J 5D5VB 3BG3A 3LNQA 5KHDA 1MBJA 1W7PD 3GW2A 3JRAA 4F54A 3KFWX 3AL0B 1P6RA 1T6SA 3H36A 3CMYA 4L5IA 4X8WA 3L2QA 3C6MA 1PKPA 1WKMA 1D0XA 4UUTA 3DPUA 1FLIA 2ELKA 1ITYA 4JP0A 2QWWA 2DT7B 2HXIA 4XOPA 5B1AH 1OYIA 3DTEA 2VKHA 3Q0WA 3ZMUA 2QENA 2PMZA 1Z3XA 2CPNA 5L3DA 2RN7A 3DLAA 3HGYA 2J5OA 5L3CA 2EMZA 4AD9A 4HNVA 3C18A 1U9OA 2LE2A 2LF7A 1NEIA 2EOXA 4A3KJ 3PO3J 3OMLA 4XLEA 3WU0A 4DUZE 3BJOA 2L0KA 3SZTA 2MDGA 1TQIA 2R5ZA 3ZCOA 1ZBTA 1G3WA 5HS9A 4FCYA 3UR3C 3HM5A 2LVHA 4TV7A 2XPWA 5KL4A 3ABTA 1IV8A 1TP4A 2LG4A 2RDPA 4NC8A 3LAPA 1VQOI 4L8NA 4WYQB 2DMPA 4DV6E 1V3FA 1MEYC 1YS7A 3A4CA 1IJWC 1BM9A 3LL7A 2STTA 4UUVA 3WTXC 5D5UB 2WAQA 4MIMA 1DDNA 1ZARA 2P8TA 2W85A 3RQIA 2E2IJ 3HOXJ 1HC8A 5J1YA 3BT9A 1IO2A 3FHZA 2VKVA 1RI7A 3TW6A 4I0BA 2EN3A 4P7DA 2IS6A 2PMUA 4IEJA 5E3OA 3GZ6A 1ZGAA 1X6FA 2WAFA 2MG4A 4BJTA 2YUSA 4X9JA 2DTRA 4ZDOA 2RC4A 2Y69H 2L3CA 4C2TA 2HKOA 3MZ8A 3OWTA 1R1UA 1ERDA 4R8OA 1YW7A 1JT0A 2P0WA 1WXRA 1RC7A 1Y0NA 2BW3B 1UELB 4U0YA 2NUFA 3GX4X 1YYOA 1XD7A 4LG0B 1SR9A 3FWEA 4KT5C 5CVRA 4OMYA 3KPHA 4I09A 3K1NA 5CVUA 2ADRA 4RM2A 3OIOA 2OCEA 3AG4H 3PIPF 1SFEA 3DU6A 3KLNA 4II3A 2CV0A 2YS9A 4HNTA 3CDIA 1S72I 3P7NA 2Y0MA 3F3XA 2VT3A 1S29A 4XLCA 4GZNC 5AONA 2ODRD 1EH8A 4DR2E 4Y15A 2YT4A 4IHYA 3SFIA 4IVNA 2YPRA 4HLXA 2XASA 1D1AA 3VOEA 1IUYA 2W82A 1T0FC 5KL6A 2FXAA 3H9JA 2VJ4A 4Z2YA 4GO1A 5K5QA 1V54H 2NS8A 2VXDA 2DLQA 2ECCA 4L0YB 5B1BH 4BNCA 3EPZA 4ETSA 4XRSA 4DMIA 1LB2A 4XOTA 5LMUE 1SANA 5F6FA 4Y4RA 2L5QA 2JY9A 2VE7C 1VI0A 2CFXA 2MD0A 4U88A 1RNLA 1H9GA 1RUOA 2M1SA 4BBRJ 2EM5A 1MNMC 1NH3A 1PYVA 2Z1DA 3AG3H 4DQ2A 4LITA 3BLYA 1YRNB 2WA0A 2VE9A 5F3WA 1ZYRF 4MGRA 2X48A 1ETYA 2Q0OA 2UXXA 2LKXA 2YTFA 2YTGA 3MHHC 1U78A 1ODDA 4BUPA 4HV6A 1A1GA 3M3YJ 1VQ8I 1R6RA 1ZH5A 2K9MA 4JYAE 3GWZA 2FNPA 2HPIA 2LKPA 4C30A 4MHGA 4GFBA 1AKHB 1M1EB 3MKZA 2D45A 2N8XA 2FQ3A 5EEHA 2MC6A 2GA1A 3CUQA 1LDJA 4X62E 2KP6A 2NAZA 3J80K 3K70C 2A25A 2M87A 4R1HA 3SEQA 1HR0E 1YJ9I 4D5FA 1IBME 3HZJA 2D9HA 2LUPB 4PGGA 1XGSA 3K1PA 2EWNA 5GP9A 1X2NA 1YITI 2N8GA 4PFOA 2H27A 2DN0A 3U2RA 5J1RA 1RETA 2BY3A 1FIPA 3LA7A 2EPAA 1XGMA 5H6RA 4G6DA 4BY1J 1N34E 3GTKJ 1TT0A 4BBYA 5KAFC 4G6QA 2IA0A 1T4LB 2JXPA 1P4XA 3HJEA 1FP2A 4IOCF 2BHZA 4EMSA 2OTJI 4B44A 2RGVA 3NARA 3RSNA 5IP9J 3S17J 2BBGA 2ZKZA 3N4MA 4N4RB 1S7EA 3MKYB 4N9IA 1ONVA 4XM3A 3EPLA 2K9QA 2Y75A 2A68F 2Y48A 3CJRB 4NQWB 2X6YA 1HKTA 2EPMX 3IRRA 2EM7A 1TNTA 1WHUA 5LRRA 1KYQA 1RUNA 4JI0E 3RZDJ 3MEXA
chains in the Genus database with same CATH topology
5JFRA 2DAOA 2STWA 5ILVA 4PGHA 4FX4A 5HLGA 3HSEA 4EJOA 2GA2A 1W4MA 1ON1A 1P2FA 3MFKA 4BYYA 2JZYA 4Q4ZF 1AWCA 4G94A 5D6EA 5JHUA 3HOTA 3R6SA 2EFNA 4QWQA 2XAGA 2ZNZA 4UHTA 3MZYA 1YQAA 3KEOA 2EFWA 3P9KA 4JQFA 3E5QA 3H3UA 4ZYEA 4RGXA 3SFZA 4KMUX 4EVIA 3WTUC 4CXFA 5ILSA 4FHTA 4XBFA 3R4KA 4RB0A 1J9IA 2IPQX 3HUGA 1R5GA 3P9IA 1SD7A 3K2ZA 2QQBA 3WTSC 3Q5FA 4IRHA 2EFPA 5D6FA 1IXCA 3L00A 3HHGA 2HOEA 3LSTA 4YG2F 1KU3A 4HW0A 5J6XA 4KUMA 3LAJA 1J75A 2FF4A 3E6CC 2ELHA 2HFHA 5FB2A 5D4SA 1FSEA 2V1UA 2KRFA 3EUHA 5H6QA 4CICA 4Q5SF 2MLGA 2ZXJA 4M9XA 2JSCA 3EDPA 2EV0A 1QGPA 1Z9CA 2QQAA 2XUBA 1O3QA 5DD8A 4LJZF 4IHSA 1YTYA 1Z7UA 1QPMA 1USTA 2W84A 1SD6A 4KICA 1Q1HA 4HAMA 2Q8KA 3B73A 5FO5A 5J8FA 4KIBA 2WC2A 4LG0A 1B6AA 1R5HA 4HYEA 4RS8A 3ZP5A 3T0YA 3BZ6A 5HDNA 2IA1A 1IN5A 2KJCA 5BPIA 3FM3A 3HTUA 5FD6A 2UZKA 4OINF 1FBQA 1TLHB 2E1NA 4HV5A 1XMKA 2V79A 1S7AA 3T8TA 2HYFA 3I58A 2OD5A 1TQPA 1O3TA 1SFUA 3Q9SA 2VN2A 4QLCU 4FX0A 4O3MA 1IN4A 3HTSB 1TBXA 3O3KA 1FT9A 4G7ZF 2NRAC 2H94A 3RIRA 4LFUA 3ULQB 4L0ZB 4I01A 4F7ZA 2ZO4A 3ZMVA 5D8KB 5K5RA 4HZFA 2NNNA 1IRGA 3GFIA 5CLSA 1MJAA 5ICCA 1HSJA 1BI1A 2NNYA 3EQLF 5E1ZB 3CO7C 5HLHA 4G7HF 1WWXA 1HW1A 2A3SA 3LWFA 2RNJA 3R0AA 5L3BA 3WTVC 5LGTA 3V7RA 1XDSA 3FMQA 3L9FA 3WODF 2VXZA 3DKWA 3TKYA 3IHUA 3BOQA 1BBYA 4AIHA 5DDGA 1MJ9A 1G3TA 2DO7A 4NB5A 4KMFA 3SHFA 3SQNA 5HS7A 1F9NA 2FMYA 1ZG3A 1XMAA 4NQWA 2HWVA 4HQMA 3KEQA 3L09A 4GYGA 4WX9A 4WXDA 3DQVC 3K1MA 1K78B 2EJRA 3SZPA 2ETHA 3FMRA 5TRDA 4Y13A 1JE8A 1ZLKA 1BC7C 2NS0A 2JPCA 2WV0A 2MD5A 2H6CA 2KJBA 5HDGA 4L5JA 1KQ0A 1YS6A 4LD5A 4HDVA 2YX4A 3FXUA 5LHGA 3WE2A 1K7AA 3Q9VA 2HR3A 1HW5A 4BQAA 1Z6RA 1XSVA 3BJ6A 4UXNA 4M6YA 1UHMA 2GZWA 3D5LA 1TW3A 3WTTC 5D8LB 2EV6A 2M45A 2XV4S 4MEYF 1WI9A 2Z3YA 2BBYA 3FX3A 3JSOA 5FLXK 2MBFA 4HBLA 1IXRC 3KE2A 3CLOA 1T2KA 1FPQA 5L3EA 4S04A 2BV6A 2IJLA 3QOPA 1BIAA 5HDKA 3KETA 1XDUA 1ZRCA 1R22A 3BP8A 2HQNA 4BHPA 1HSTA 3E6MA 4U7DA 4WCGA 2JT1A 2ZJ2A 2PN6A 3CUOA 1STZA 3ML6A 2Z99A 3RKWA 3QU3A 2CSOA 5TJJA 3RYRA 5AIQA 5KVRA 3HSFA 2V9VA 2MH9A 1RZ4A 1OMIA 4LLNA 2BYVE 4CDGA 1T98A 3DEUA 3WG9A 4R8HA 1DPUA 2DPDA 1OPCA 4UVCA 1LEAA 4M72A 1R36A 2M5WA 1B1BA 2ZCWA 2AS5F 1A04A 4ESJA 1G4DA 4A0ZA 4A5MA 2IVMA 2HEOA 3HHHA 2DT5A 1SD4A 2EK5A 2IA2A 1U2WA 3AAFA 1J2XA 3HSRA 1Z91A 2QM3A 4L9NA 4UVBA 3H3ZA 2E7XA 4IRGA 2IT0A 3QP5A 1GVJA 1S3JA 2YR2A 3T8RA 1FP1D 4EM2A 4HF0A 1Y0UA 4ZH4F 3IKTA 2HTJA 1HBXG 1BI0A 1TQMA 3LA2A 2L54A 2FSWA 2FU4A 3IRQA 2DQLA 2PFBA 3DPLC 5DCMB 1TTYA 2L02A 2XAHA 2PG4A 2XIGA 1J59A 3VFZA 4OIQF 3QRFF 4LB5A 1FWZA 2Q2EA 2B0LA 3D0SA 2IW5A 4IPAA 3VODA 2G9WA 3V7CA 3I0TA 1T38A 1FOKA 3GFMA 4FT8A 3I64A 5CJ9A 2A61A 4EM1A 4RB3C 1K78A 1U5TC 1MKMA 5E8IA 5LLQA 4HA8A 4U0VA 4CYDA 2K4BA 2DW4A 3NEUA 4I98B 2OZUA 1FBSA 2PBIA 4XRFA 3DXJF 1GHCA 1Z6TA 1G3YA 3MAJA 2D1HA 3F8FA 1QZYA 4LMYA 3M9AA 1HW2A 2DK5A 2F5DA 5KK1A 3RTRA 5H20A 1FYKA 2AXLA 3MZHA 1I6XA 2R3SA 1KU9A 4RGUA 5DEQA 3G73A 1W5SA 1FYMA 1FBUA 2FOKA 4M74A 3V8LA 5HVQC 4WXCA 1J7KA 3E5XA 1JXSA 3DV8A 1R23A 2EB7A 1XN7A 4L9JA 3DPTA 3T1BA 2KIUA 1YLFA 2WTEA 2G7UA 3GXOA 3T5XA 1XSDA 3I54A 5ICFA 4G7OF 2A07F 1SFXA 2QLZA 3TOAA 3C1DA 5LHIA 1BI3A 5IT9Z 1U5TB 2LDUA 5HOOA 1W7PA 5CVIA 4HDUA 4A0XA 2XKOA 2DPUA 5F1RA 2HTSA 3KP2A 4YFNF 2TDXA 5BMZA 1L3LA 1FZPB 5LEKA 4WK8F 5LRSA 1MDMB 4IJAA 3RKXA 1KQ8A 3JAMZ 3U9GA 1P92A 3FF5A 1LQ1A 2X4HA 2DU9A 4S05A 1V4RA 4N9HA 4P9FA 3RI4A 4LGWA 2LF8A 5E1WA 3HYIA 3U1DA 3CO6C 3H92A 2O8XA 3WGGA 3ZMDA 4KYWA 2OBPA 1QQIA 1ZHFA 1S7OA 2L4MA 2EA4A 3GEZA 1U6GA 1SMTA 5J8CA 4HF2A 2VE8A 2L01A 2XKPA 3PQKA 1MD0A 3TO6A 1UCRA 3M8FA 3E5UA 3R60A 3E3VA 3KZYA 4DNCA 2O61A 5DCMA 1DUXC 2J5PA 3PFIA 1HQCA 1HXDA 2G7HA 3QP6A 4IXAA 4EV0A 1OYWA 2GIVA 2D2WA 4P9UA 4WF2A 4UNOA 2MLKA 2W24A 1S8NA 4MQ9F 3W6KB 2BGCA 5FFXA 4OIPF 1BOAA 1QO0D 1Z05A 2DBBA 3MCZA 1LEBA 1E17A 1MJBA 4E70A 4HX4A 4WXHA 2OQGA 4A2UA 1FC3A 4ENNA 3CJNA 2PLYA 5FD5A 2OQRA 5BQTA 4HLYA 3ZMTA 1F4KA 2GQQA 4ZYHA 3ZMSA 2UXNA 2F5FA 3K69A 5L3FA 1OR7A 1R1TA 4ESFA 4RAZA 5EEGA 4LK0F 1J0RA 1O7FA 1IXSB 3CDHA 3MWMA 3GF2A 2K7LA 2XAJA 2P5LC 3IWZA 1KU7A 2ISYA 5E8GA 1IRFA 4AIJA 2V1DA 2VBWA 3DF8A 3PQJA 3REOA 2VBZA 1U3EM 1D8JA 1BC8C 1IN8A 1ZAOA 2OA4A 4ZZLA 1F1ZA 3M8EA 3WE3A 4R79A 5DD4A 1YIOA 2WWYA 2FBKA 1O7LA 1K6OA 2A69F 1GXPA 1ZG1A 2QUFA 4MNUA 5DV5A 4OOIA 5ILUA 4RGSA 5JI6A 3LA3A 4BH9A 2IP2A 2ADUA 3I53A 2JPBA 4MTEA 3P9CA 3M7GA 3F8BA 3ELKA 4RB2C 1U5TA 4BXUA 2O0YA 1L0OC 2M30A 3RDIA 2ACJA 3J7AO 2RQPA 2ZFWA 1K79A 4D0PA 2FBIA 4GCVA 1BN5A 4ESBA 4I0AA 1MDMA 1UHWA 1O3SA 5ED4A 2L3DA 1BIBA 3NRVA 4G8XA 5ICEA 1ZLJA 4BHBA 2FNAA 5DUKA 2VBXA 3TOBA 4A0YA 3J81Z 3L2CA 4L18B 3K9TA 2UWMA 2NYXA 5E20A 5FLXZ 3KP4A 3HOSA 4ENKA 2A5YB 3C7JA 3E6BA 4PZJA 3I71A 2RVCA 1SAXA 4EJVA 1IAWA 3RPUA 3IC7A 1XB4A 1TNSA 3TQNA 3DP7A 2P7VB 2OU2A 3ISPA 2KIFA 1R7JA 2VC0A 3FXRA 1I1SA 3WU1B 3ZMZA 4UV9A 1FYLA 1W7PB 3WGHA 4EJWA 3HRUA 3ZQ7A 2Z33A 2XVCA 5IT3A 2VOPA 5D4RA 2VBYA 2JRTA 3MQ0A 1RIOH 4XSZF 5CYVA 1IW7F 4H0EA 1IF1A 5A2QZ 3F72A 4A5NA 3IKVA 3IWFA 1H0MA 4PDKA 2FA5A 2L4AA 2DFIA 2GXGA 3I59A 3F6OA 5DYMA 2MC3A 5E18F 1ZGJA 1BJAA 2JTVA 1ULYA 1KQ9A 4HX7A 4BHCA 3F6VA 2DQRA 1PP8F 3JW4A 3W6JB 1O3RA 5E17F 1JGSA 3N97A 2MH2A 1PP7U 3QPTA 2CYYA 4HF1A 2PQ8A 2YSRA 4UV8A 3KCCA 2GXBA 1T39A 3F8CA 3CTAA 2DLLA 1R00A 1F5TA 4IF4A 2FMLA 3F22A 3TDZC 3R0JA 4ENJA 1LJ9A 4L9VA 2MA3A 2XHKA 1KA8A 2C6YA 2QVOA 3BDDA 3BPXA 2P4WA 1IN7A 3JSPA 2OAZA 1O57A 4B8XA 1MGTA 1PDNC 2YX7A 2HS5A 1JHHA 3L7WA 3FM5A 1UB9A 4P55A 3EYYA 1JHFA 3F23A 3ECOA 3LQQA 4HQEA 1YW9A 4ASNA 1X3UA 3QPHA 4EQQA 5LBQA 1G3SA 4ZYGA 3TO7A 1XGNA 4OU0A 2CGPA 3EETA 5DUIA 2VOOA 1XGOA 1SD5A 4KIGA 4RGRA 1MZBA 1I1GA 3HIFA 4N0BA 3QAHA 2CG4A 2K4JA 2PEXA 4U7BA 1YO5C 4KDPA 2Z9OA 3ZN0A 1QZZA 4KN4X 4KIFA 2HDCA 2W25A 4GGGA 1ZRDA 1J5YA 2ISZA 5HLIA 1H9TA 4A12A 3J80Z 1REPC 2COMA 5LHHA 4ZZDA 3M1EA 3WTYC 2P5KA 3JTGA 3RPQA 2QZ8A 2D1VA 4LK1F 2YU3A 5BS6A 1FNNA 2KIMA 2F2EA 3GZ5A 3G3ZA 4ZYDA 4M71A 3TDUC 5K1YA 1DP7P 3BWGA 2IRFG 4L9TA 2XAFA 1ZRFA 2VC1A 1CGPA 5L3GA 2K27A 3KLOA 3WTZA 4G9YA 2F5CA 1USSA 1YG2A 5LGNA 4I02A 3O6BB 4NHJA 1W5TA 4O5VA 2H6BA 5D5WB 2W57A 5IT9K 2QBYB 1EH6A 2CWEA 3GVAA 4XLPF 2HKXA 2EFQA 3LFKA 4AVPA 4EGYA 3FZVA 2ZBKA 3ABUA 3ECHA 4EGZA 1WRJA 5F64A 3BY6A 2HYGD 4UVAA 1BI2A 3JAMK 3GFLA 3GFJA 4B09A 1I27A 4P5OA 2F5EA 5DCFA 1ZREA 4KA4A 3JTHA 4ON0A 1KGSA 2E7WA 4CZZA 2XGXA 4JBAA 2A6EF 1LDDA 1XCVA 4OIRF 3KP3A 3ZPLA 3ERED 4OMZA 3RKYA 3K0LA 2OZ6A 4KNYA 1FSHA 2P6TA 4GYIA 3HRSA 2ZMEB 1R58A 2XAQA 3KP5A 2R7DA 4YIIA 1YYVA 1CF7B 1U8RA 1I5ZA 2QQ9A 1EV7A 2P7CB 3FMSA 2XRNA 1WQ2A 1WSUA 3IL2A 2LSOA 1SMYF 5E1XA 4MQVA 2CQKA 1FX7A 3HRTA 5BOXA 4M9SA 2ESNA 2P6SA 3V8KA 5BPDA 2GWRA 3GLXA 5FFZA 1QNTA 3I4PA 2VONA 1FY7A 3FXQA 1ON2A 4Y17A 3I59B 3GYHX 2QYOA 5JR3A 1DPRA 3ZN1A 1B59A 1LVAA 3CUQC 4A6DA 1OYYA 2LNBA 1B9MA 4M73A 4MTDA 2HGCA 2XROA 2EV5A 5CVVA 4IHTA 4CO8A 4Q47A 3COAC 2ESHA 1YW8A 5LGUA 4XSXF 4YFKF 1D3YA 4LB6B 3F21A 4YFXF 3V4GA 4ENMA 1AOYA 2X0LA 5CVJA 3I5UA 4RB1A 3F8MA 4XLNF 2DK8A 3OV8A 2O3FA 1UFMA 2FEZA 4YIFA 4LLGF 2FE3A 3OOPA 1XSXA 1EH7A 3E97A 4AWXB 3BROA 2RKHA 1Z1DA 1B4AA 2E1CA 3C3WA 2BE5F 4IRIA 2FRHA 2M1BA 3SXYA 2DI3A 2CW0F 1D8KA 3BPVA 3QU6A 2ZNYA 2VT2A 4KN7X 1P4AA 4CHUA 4EJUA 3BJAA 3O2PE 4CGZA 3E6DA 1P4WA 1HKSA 5HS8A 4K2EA 4JK1X 2EFOA 1IN6A 1XCBA 1GXQA 3KP7A 2H09A 2M8EA 5ERIA 4I2OA 2V1XA 4GXOA 4LLLA 3R61A 2R7FA 4KFCA 1D5VA 2CO5A 3WTWC 4EM0B 3RYPA 3V8JA 4O6JA 1OKRA 5AIPA 3HRMA 4HX8A 5ICGA 2QBYA 2P5VA 1PUEE 3CUQB 3TGNA 1ZG5A 1IZ1A 3LQRA 4AIKA 2FBHA 4PCQA 1T0FA 2GAUA 3TO9A 6PAXA 4EJTA 2K02A 4MEXF 4OIOF 4RAYA 1KYWA 3NQOA 1LNWA 2Z5UA 3KZZA 4P96A 2V6CA 3KP6A 1B9NA 1YFHA 3EYIA 2HQRA 4M6XA 2EA2A 3GUDA 5LEJA 4HOBA 3J81K 2PI0A 1ZN2A 4U0WA 1G6NA 4BAYA 3GO5A 3ROUA 3VEPA 2PMHA 1KU2A 4M9ZA 2O03A 1VTNC 3VB2A 1C0WA 4Q48A 2ZMEA 5FGMA 2A6HF 1R1VA 1NHAA 3WGIA 1KYZA 2PJPA 1HKQA 1S6LA 2K86A 2KKOA 4WWCA 1CF7A 2RV8A 5K5OA 1LDKB 1E2XA 1QBJA 3RJPA 3V7SA 2O6GE 3DFGA 1TW2A 2VODA 5A2QK 2HZTA 5JVTA 2BEOA 5D5XB 4A6EA 4I7HA 3F8NA 3B02A 3S2WA 5D5VB 1W7PD 3GW2A 3KFWX 1P6RA 1T6SA 4L5IA 1WKMA 1FLIA 2QWWA 1OYIA 3ZMUA 2QENA 5L3DA 2RN7A 5L3CA 2J5OA 4AD9A 3C18A 2LF7A 3WU0A 3BJOA 3SZTA 1TQIA 1G3WA 5HS9A 4TV7A 3ABTA 2RDPA 3LAPA 1V3FA 1YS7A 1BM9A 2STTA 4UUVA 3WTXC 5D5UB 1DDNA 1ZARA 2P8TA 2W85A 3FHZA 1RI7A 4I0BA 2PMUA 3GZ6A 1ZGAA 2DTRA 2RC4A 2HKOA 1R1UA 1YW7A 4U0YA 3GX4X 1XD7A 4LG0B 3FWEA 4KT5C 5CVRA 4OMYA 4I09A 3K1NA 5CVUA 1SFEA 3KLNA 3P7NA 2Y0MA 3F3XA 2VT3A 1S29A 5AONA 1EH8A 4Y15A 4IVNA 2YPRA 4HLXA 2XASA 3VOEA 1IUYA 2FXAA 4Z2YA 4GO1A 5K5QA 4L0YB 4BNCA 4ETSA 1LB2A 5F6FA 2CFXA 4U88A 1RNLA 1H9GA 1RUOA 4DQ2A 2VE9A 1ZYRF 4MGRA 2UXXA 2Q0OA 1U78A 1ODDA