1MGTA

Crystal structure of o6-methylguanine-dna methyltransferase from hyperthermophilic archaeon pyrococcus kodakaraensis strain kod1
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
169
structure length
169
Chain Sequence
b'MLSVEKFRVGERVVWIGVIFSGRVQGIAFAFDRGTLMKRIHDLAEHLGKRGVSISLDVQPSDYPEKVFKVLIGELDNASFLRELSFEGVTPFEKKVYEWLTKNVKRGSVITYGDLAKALNTSPRAVGGAMKRNPYPIVVPCHRVVAHDGIGYYSSGIEEKKFLLEIEGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (O6-METHYLGUANINE-DNA METHYLTRANSFERASE)
publication title Hyperthermostable protein structure maintained by intra and inter-helix ion-pairs in archaeal O6-methylguanine-DNA methyltransferase.
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Transferase
total genus 57
structure length 169
sequence length 169
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 1999-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF09153 DUF1938 Domain of unknown function (DUF1938)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mgtA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1mgtA01
2X4HA 5FFXA 2BBYA 2ISZA 3V8KA 2EV5A 5D8LB 1FBUA 2XAFA 2XAHA 4HX8A 4DNCA 3REOA 4IHSA 1B6AA 3RTRA 4B09A 2V6CA 1OR7A 2JSCA 5IT3A 3IKTA 2HQNA 5DV5A 3M8EA 4I98B 2HTSA 1J5YA 2LF8A 3FM5A 4LD5A 1ODDA 2COMA 4UNOA 2CFXA 1ULYA 3K1MA 5ICFA 3FMSA 2P5LC 2F5FA 5E8IA 4WX9A 4MTDA 1B9NA 4Q4ZF 2HYGD 3TO9A 4K2EA 1F4KA 3W6JB 3ZP5A 1QZYA 2K4JA 5EEGA 2F5EA 3GFIA 4HF2A 2DQRA 4UVAA 3M1EA 3FX3A 4MTEA 4ZYDA 4AIHA 3BP8A 3MZHA 5FO5A 2EA2A 3E6CC 2FU4A 2LKPA 1GXPA 1BC7C 1K78B 5CJ9A 2WV0A 3DV8A 4ON0A 3HTSB 1ZG3A 3P9IA 3HSFA 3K9TA 2ZBKA 2JRTA 4DQ2A 4UHTA 5A2QK 1YFHA 2PFBA 3CLOA 3ECOA 2MBFA 1O7LA 4AWXB 1V3FA 4AVPA 2PLYA 2XAQA 1T39A 2DPUA 3K1PA 4PGHA 2H94A 4Y13A 3D0SA 2L01A 2V1UA 3WTSC 2VXZA 1MD0A 1KGSA 4UV9A 3ECHA 2M8EA 4LK0F 3DP7A 4AIJA 2P7VB 2RDPA 3L9FA 1RUNA 4IF4A 1J75A 1XMKA 2XAGA 2DI3A 1D5VA 2PI0A 5HLIA 4ESFA 1NHAA 1IW7F 3F8MA 2HDCA 2M1BA 4O5VA 1KU9A 2FE3A 2Y48A 3F22A 3ZMTA 1FBQA 3EYIA 3HRSA 1GHCA 1IRFA 3EDPA 3BY6A 4IRHA 1TQPA 5H20A 1UHWA 3M9AA 3E6DA 1T98A 1E17A 2IP2A 1XSDA 1TW2A 2A5YB 3LWFA 1OPCA 3FZVA 5ILUA 4UV8A 5E20A 4G94A 2A69F 1QQIA 2V1DA 2VOOA 1IN6A 5DD4A 3BPXA 5DCMB 4UVCA 1R22A 5HS8A 3M7GA 1ZLJA 3TO7A 3VEPA 2CG4A 5BQTA 3U2RA 3QP5A 1U8RA 1ONVA 1IF1A 1IUYA 2WTEA 1R5HA 3K69A 2VE8A 4KUMA 3EUHA 1IN4A 2R7FA 4WF2A 3N4MA 4L9NA 1XGSA 1U5TC 4N0BA 1XB4A 4MEYF 5KVRA 1BOAA 2Y75A 3F8CA 1ZHFA 2DLLA 2FOKA 4YFXF 3WTYC 3F8BA 4EGZA 5BS6A 1KU3A 3WGGA 2LNBA 5HS9A 1FX7A 5JHUA 2QQ9A 1Z1DA 2ZJ2A 5L3FA 3E97A 5HLGA 4ZYHA 4H0EA 2NYXA 3IRRA 3U9GA 1HSJA 2K27A 1SD4A 4KIFA 3RDIA 4TV7A 2NRAC 5DYMA 3MAJA 2Q0OA 2HR3A 4WXHA 1T2KA 1MDMB 1P2FA 3KEOA 2IW5A 1D8JA 2EFPA 2D1VA 1ZLKA 1OYIA 2V9VA 4O3MA 2FRHA 1YW7A 3GZ5A 2D45A 2IJLA 1LNWA 2M5WA 3J80K 3E6MA 5DUKA 1OYYA 2IA2A 1O57A 2Z33A 2J5OA 2XRNA 1EH6A 1Z6RA 4HQEA 3RPQA 1KA8A 1BBYA 3LQRA 1O3RA 1MGTA 3C7JA 2HFHA 2QYOA 4HDVA 4NB5A 2QWWA 5ILSA 2E1NA 5E1WA 4ZH4F 1HW2A 3GZ6A 1TW3A 5J8FA 2CO5A 1TLHB 4ENNA 1KQ9A 2EK5A 3ISPA 5JFRA 2GWRA 4YIFA 2RKHA 1B9MA 3LA2A 4L5IA 1I6XA 1LEAA 1FSEA 1AOYA 2HWVA 4S04A 5D8KB 2LDUA 3V8LA 4D0PA 4EJWA 3WODF 4HF1A 4KFCA 1F5TA 2UZKA 2UXNA 4ENJA 2FMLA 4ENKA 3JAMK 2GIVA 3HUGA 4MHGA 3ZMSA 1MJAA 3E6BA 1EH8A 3WG9A 1REPC 5HVQC 4E70A 2IRFG 4CICA 1X3UA 4ZYGA 2WWYA 2ZXJA 2ESHA 3QU3A 4U88A 3JSPA 1A04A 3K0LA 3CUOA 4OMZA 1IXRC 1PDNC 1Z9CA 2ZMEA 2UXXA 3T8RA 3J7AO 2FNAA 3JW4A 1I1GA 4KDPA 2IT0A 1YYVA 1U2WA 1WKMA 4PZJA 5HOOA 2MLKA 4AD9A 3MQ0A 1Q1HA 2A61A 1FPQA 1UFMA 2ZFWA 1USTA 3NEUA 4YFNF 3CTAA 4N9IA 2KKOA 2R3SA 2H6BA 2ELHA 5HDGA 5K5QA 2K7LA 1QGPA 3VOEA 4JK1X 3WGHA 1HSTA 3RKXA 2DBBA 1ZRFA 1RIOH 4ZYEA 1F1ZA 1U3EM 1TTYA 3T8TA 1OMIA 1YIOA 2VBWA 2ACJA 4WXCA 3GWZA 3CJNA 1SFXA 2FF4A 3V7RA 4G7HF 4RS8A 5DUIA 1O3QA 3LSTA 3JTGA 1FBSA 1I1SA 2P5VA 1J59A 2OAZA 4ENMA 4WXDA 3F21A 3CO7C 1H9TA 1TQMA 3H3ZA 4BXUA 1J7KA 2Q8KA 2IA1A 3V8JA 1IRGA 4HLYA 2Y0MA 2DTRA 5K5OA 1HXDA 4LJZF 1CGPA 5DCFA 3GUDA 4P96A 3D5LA 1C0WA 3H92A 3CDHA 2FBKA 2L54A 5LEJA 1LDDA 5HS7A 4BHCA 1U5TB 4N9HA 1FC3A 2A07F 4HDUA 4BYYA 3QOPA 1BN5A 2XKOA 1G3TA 4F7ZA 2CWEA 3KP3A 4HOBA 2XAJA 3B73A 3E5QA 3VB2A 1BI3A 1W7PD 2VE9A 2CYYA 5KK1A 1XDSA 2UWMA 5F6FA 1FP1D 1TBXA 1Z05A 1S29A 2BV6A 2O61A 1WRJA 2MH9A 3GYHX 1ZH5A 5IT9K 3HTUA 2PEXA 2VN2A 4XLPF 3GO5A 3BJOA 5CVRA 2AS5F 5HDKA 5BOXA 3W6KB 5L3BA 3I64A 4KT5C 4IJAA 4QWQA 4EGYA 3C3WA 1R58A 2PMUA 5TRDA 1I27A 4HZFA 4HAMA 2VC0A 2G9WA 3ZN1A 1OYWA 3IC7A 4RB3C 2PJPA 2ZMEB 2G7UA 4IVNA 1HKSA 3SZTA 3KEQA 1O3TA 4PGGA 1FNNA 4OIQF 3O6BB 4KICA 3V7SA 4EM1A 1CF7B 4EVIA 3COAC 5D6FA 3Q5FA 4U7DA 5ICCA 2DT5A 1AWCA 4G7OF 3I59A 4A6EA 2BEOA 1SMYF 3G3ZA 2DQLA 2RV8A 1F9NA 1DDNA 5FLXK 1UHMA 2FEZA 2RGVA 5L3GA 1HW5A 2YPRA 3JSOA 1IN7A 1G6NA 3QAHA 3TQNA 2EFWA 1UB9A 4LK1F 4M9XA 5FD5A 4MQVA 1EH7A 2ZNYA 2VC1A 4KIGA 1ON1A 3O3KA 2VODA 1U78A 1IXSB 2ZNZA 4L9JA 5ICEA 1JXSA 2F2EA 3CO6C 4R79A 1HBXG 4EJTA 1W5TA 4RB2C 3BPVA 1BJAA 4CGZA 4IPAA 1W7PA 4G6QA 2FMYA 4R8HA 1FYKA 3WTVC 4IXAA 4I09A 1WI9A 3SFZA 5D6EA 2XKPA 2G7HA 3F23A 2CW0F 5HDNA 3WTZA 2DK8A 5ERIA 2EJRA 2L4AA 4EV0A 3P9KA 5D5VB 5J8CA 2QQAA 1O7FA 4AIKA 1YO5C 4KMUX 3R6SA 2EFOA 4HBLA 3MEXA 3KLNA 1FP2A 3VFZA 4YIIA 3NQOA 4UVBA 2ZKZA 4PCQA 2W24A 4EMSA 3IL2A 3MCZA 5D5WB 4M6XA 4ZZDA 2XHKA 4A0XA 3JAMZ 3FHZA 3KP6A 4XRFA 3AAFA 4A12A 4P9FA 1YS7A 2PMHA 1YW8A 1YQAA 2E1CA 2ZCWA 2HKXA 5AIQA 5E1ZB 2WC2A 2EV0A 5CVJA 4NHJA 3QU6A 5D5XB 2EFNA 2MC3A 1ZN2A 3LQQA 4HV5A 1HQCA 4HYEA 1SFEA 4MGRA 4CXFA 1WWXA 2H09A 1ZGJA 3DKWA 5LHGA 3PQJA 5JR3A 3HOSA 2FA5A 1GXQA 3R60A 5BPIA 2DK5A 3U1DA 3R0JA 4M73A 2PQ8A 4PDKA 4LGWA 3HRMA 1YG2A 1BC8C 3ZMVA 3GF2A 3E5UA 2B0LA 4CO8A 1SD5A 3WE2A 1QBJA 1SD6A 2VONA 1TNSA 1FY7A 2EFQA 2QZ8A 4M74A 1QNTA 4A5NA 4O6JA 4BHPA 5BPDA 3ZN0A 2DU9A 1O3SA 2KIUA 3J81K 4I01A 4LLLA 3I59B 5H6RA 2XV4S 2KJCA 3DEUA 1MJBA 3JTHA 1R36A 1DPUA 3OOPA 1J9IA 2EB7A 3T5XA 2D2WA 2QVOA 2YU3A 4HLXA 5J6XA 4LMYA 2OZ6A 5LEKA 1QPMA 4L9TA 1KYWA 3NRVA 3WGIA 3I71A 1ZYRF 5LGNA 3VODA 2E7XA 1D8KA 3ULQB 3R4KA 1B4AA 1T0FA 3DXJF 1IAWA 3R0AA 4M9SA 2STWA 4I2OA 4JQFA 3V7CA 2V1XA 1SD7A 5ILVA 3HSRA 3RPUA 1WQ2A 1BIBA 2YX4A 2QM3A 3KP4A 4RAYA 1R1VA 2MLGA 2IA0A 1XCVA 1W7PB 4S05A 3FM3A 1ZGAA 2HQRA 4Y15A 4LB6B 1PP8F 1RUOA 2L4MA 4KYWA 4A2UA 4RB0A 4HX7A 2F5DA 3DPTA 3O2PE 2IVMA 3HRUA 1IZ1A 3QP6A 5E18F 2NS0A 3TGNA 1ZG1A 2P4WA 3Q9VA 4KNYA 2MH2A 2JPCA 4OINF 5D5UB 2Z99A 4YFKF 4LB5A 2W85A 2NNYA 3LAJA 5FFZA 3WE3A 4Y17A 3KZYA 2VT3A 4G9YA 4GCVA 1H0MA 4HW0A 2HOEA 5FGMA 4ASNA 4L18B 1XN7A 1RNLA 2VT2A 2KIMA 4HQMA 1PP7U 1S8NA 4MEXF 3HHGA 5IT9Z 2DPDA 3TO6A 2E7WA 5DD8A 2DAOA 2VBZA 4UXNA 4G8XA 3BOQA 4L5JA 4IHTA 3KFWX 5LRSA 3BJAA 3ROUA 5H6QA 3DFGA 4L0ZB 3ZQ7A 3TDUC 1L3LA 4OMYA 2BE5F 1FYLA 2QBYA 2DW4A 1XSXA 4EQQA 2DO7A 1FT9A 4ESJA 2XIGA 1USSA 4EM0B 4EJOA 1QO0D 1R23A 5FB2A 2CSOA 1Y0UA 2A68F 5E17F 5DDGA 1E2XA 3V4GA 1KU7A 5LGUA 1HW1A 1HKTA 4RB1A 3EYYA 5A2QZ 1P92A 1FSHA 3OV8A 3FF5A 2FQ3A 2H6CA 5AONA 2GXGA 1STZA 4RAZA 3FMRA 3WTUC 4OOIA 2HS5A 2VBXA 1XCBA 1PUEE 3P9CA 2Z3YA 3F3XA 4A0ZA 3EQLF 4Q47A 3GVAA 4OIRF 1KQ8A 2STTA 1ZRCA 4RGSA 1G4DA 3GFJA 2X0LA 3BROA 5FLXZ 3C18A 3LA3A 5L3DA 3KP5A 3WTXC 2M45A 3HSEA 3KCCA 4FX0A 4KN7X 2W84A 5D4RA 1TNTA 1MDMA 4P5OA 4A0YA 5JI6A 1U6GA 4LFUA 2HYFA 1YW9A 3I58A 1KYZA 3CUQC 1OKRA 4GO1A 5LHIA 3GXOA 2O8XA 4P55A 3WTWC 3P7NA 6PAXA 1S6LA 2GXBA 4BQAA 1ZAOA 4MQ9F 4OU0A 3L2CA 4I0BA 2XVCA 4WWCA 1K6OA 1MKMA 3ELKA 3N97A 1S7AA 5ED4A 4BH9A 1LDKB 1R1TA 5TJJA 2M87A 5AIPA 1JE8A 2YX7A 4IRIA 4FHTA 3HIFA 4MNUA 1MJ9A 3S2WA 4RGXA 4CDGA 2ETHA 4IRGA 3SZPA 1LQ1A 1J0RA 2W25A 2F5CA 1V4RA 3GW2A 1I5ZA 3MFKA 2HGCA 3L00A 3RJPA 4Q48A 2QLZA 3TOAA 4GGGA 4LLNA 3GX4X 3I53A 3PQKA 3I5UA 5FD6A 3ML6A 2ADUA 4Q5SF 1VTNC 2YSRA 3T1BA 2EWNA 4XSZF 2J5PA 3CUQA 4UUVA 2CQKA 1Z91A 3HYIA 1R1UA 5E8GA 3I0TA 2QENA 2RVCA 4FT8A 2ZO4A 4U7BA 1GVJA 2P7CB 4KIBA 2AXLA 3WU1B 3GLXA 1W4MA 2O6GE 2OQRA 2RQPA 1MZBA 4L0YB 3KE2A 4A6DA 3BZ6A 1XDUA 1DP7P 2OZUA 4EJVA 2Q2EA 3J80Z 3FXQA 2RC4A 3IHUA 1BIAA 3IWZA 1B59A 3E3VA 3IKVA 4WCGA 3RIRA 3RKWA 2KIFA 3LAPA 5LLQA 2QBYB 1P4WA 5L3EA 4HV6A 5JVTA 1SAXA 4LG0A 1YTYA 5CLSA 2VOPA 2A3SA 3WU0A 5CVVA 5ICGA 5BMZA 5LBQA 4M9ZA 3KLOA 1YS6A 2Z9OA 5L3CA 2DFIA 1LDJA 3DQVC 1FZPB 4KN4X 1XGOA 3RYRA 3QPTA 4P9UA 1JHFA 4RGUA 2PN6A 3GEZA 2O0YA 3KP7A 1XMAA 2PG4A 2TDXA 3T0YA 2QUFA 3J81Z 5K5RA 5LGTA 2HEOA 1R7JA 3TOBA 3K1NA 5K1YA 4ETSA 2K4BA 2P6TA 4XLNF 2M30A 3LA7A 3ERED 3QRFF 2FSWA 2OQGA 1LEBA 2LSOA 2OD5A 4M72A 3KP2A 1H9GA 3F6OA 4R1HA 4FX4A 1ZG5A 4A5MA 2PBIA 4I7HA 1HKQA 2W57A 1JHHA 2LF7A 3L09A 4U0VA 1QZZA 1P6RA 1EV7A 5F1RA 1P4XA 1IN8A 3QPHA 2GZWA 1DPRA 3L7WA 3RYPA 2O3FA 4GXOA 1XD7A 2EA4A 4QLCU 1FLIA 2ESNA 3SXYA 1LB2A 1T6SA 4EM2A 2P6SA 5CVUA 4YG2F 2K86A 1RI7A 1SFUA 3ABUA 3MWMA 3M8FA 1U5TA 1SMTA 4HX4A 3GFMA 2P8TA 2JT1A 1ZREA 5DEQA 2XROA 1KQ0A 2OA4A 1J2XA 2L02A 2KJBA 1S3JA 2HZTA 1DUXC 3TDZC 4BAYA 2MA3A 2EV6A 4G6DA 4U0WA 4HA8A 2RN7A 5F64A 2JZYA 1ZARA 2VBYA 1D3YA 1S7OA 1K7AA 2C6YA 2NNNA 1UCRA 2NAZA 3HRTA 3ZMUA 3SQNA 1BI1A 2R7DA 5D4SA 3CUQB 4EJUA 1IXCA 2OU2A 2BGCA 2P5KA 4LLGF 1FYMA 4M71A 1LVAA 3BDDA 5LHHA 4G7ZF 2O03A 3Q9SA 4GYGA 3GFLA 3E5XA 2CGPA 1IN5A 3ABTA 5EEHA 1ON2A 4JBAA 3KETA 4HF0A 2GA2A 1K78A 2D1HA 1Z6TA 3RI4A 4OIPF 1T38A 2K02A 3B02A 2FXAA 1ZRDA 3C1DA 4BNCA 2HTJA 1K79A 2XASA 3ZMDA 4XBFA 1BM9A 3R61A 2OBPA 4I0AA 3PFIA 3F72A 4BHBA 1RZ4A 1TQIA 3RKYA 1CF7A 2JPBA 3BJ6A 4LG0B 2KRFA 1BI2A 1G3SA 3TKYA 1G3WA 4XSXF 5CYVA 1YLFA 2V79A 5CVIA 4RGRA 4Z2YA 3DPLC 1Z7UA 1XGNA 3FXRA 1WSUA 3I54A 2GQQA 3K2ZA 3DF8A 3ZPLA 1L0OC 2JTVA 2GAUA 3WTTC 2H27A 4B8XA 2FBIA 4CHUA 1R00A 2FBHA 2ISYA 2A6EF 2A6HF 4L9VA 1FOKA 3EETA 2YR2A 3I4PA 4I02A 3LFKA 4ESBA 1P4AA 1LJ9A 2XUBA 3F8FA 3F6VA 3FMQA 3BWGA 3SHFA 2Z5UA 3IRQA 3FWEA 4WK8F 3ZMZA 3G73A 3MZYA 2L3DA 4KA4A 4CZZA 3HHHA 3KZZA 1FWZA 2GA1A 3F8NA 1BI0A 3IWFA 1KU2A 1JGSA 2RNJA 4CYDA 4KMFA 5HLHA 4GYIA 1W5SA 1R5GA 4U0YA 2XGXA 5LRRA 2IPQX 3H3UA 2MD5A 3HOTA 2FNPA 2QQBA 1XGMA 4NQWA 4OIOF 1B1BA 1XSVA 5E1XA 5DCMA 3FXUA 2HKOA 4M6YA 4ZZLA 2BYVE 1G3YA
chains in the Genus database with same CATH superfamily
3EPZA 1NK3P 5F08A 2X4HA 1GV5A 4RBOA 4AQYE 4RLQA 4B44A 5FFXA 2GIZA 2BBYA 4WSPA 2LBFA 2ISZA 4K0KE 3V8KA 1YOVB 2EV5A 2EQ0A 2DJNA 4YIRX 3G1MA 5D8LB 1FBUA 2XAFA 3CP8A 1U0JA 3ABMH 3K4CA 2XAHA 4HX8A 4II3A 1TT0A 4BY7J 3GTJJ 2E2HJ 4DNCA 4C2MJ 2IAIA 2V89A 3REOA 3W2WA 3M99B 1A36A 2WBTA 4IHSA 1B6AA 2XGEA 3K4BA 3RTRA 2L2KB 4JOMA 4B09A 2V6CA 3CF2A 1LFBA 1OR7A 2JSCA 3CDLA 3OWTA 5IT3A 2HQNA 3IKTA 2HC5A 1VF9A 2MDGA 5DV5A 2DYRH 2ELJA 3M8EA 2HYJA 3J80C 5GADJ 2GXAA 4XQFA 1IQOA 4I98B 2O5RA 4IQ4A 1MH3A 2HTSA 1J5YA 1IC8A 2EN4A 2DT6A 2LF8A 3FM5A 4LD5A 2O9LA 2XC7A 1ODDA 2COMA 4KT6A 5IPAA 2CFXA 1ULYA 3K1MA 3QWLA 4UNOA 3HGGA 1JTYA 4BQNA 5EGOA 3DEEA 3LSMA 2HQ5A 5B3SH 2HDDA 4C2TA 2HGHA 1RC7A 5ICFA 4CYCA 3FMSA 4B43A 4DYQA 1HDPA 2P5LC 2F5FA 2EIMH 5E8IA 2CSHA 4WX9A 3HOWJ 1MNMC 2CQQA 4DMIA 4MTDA 2MG4A 1B9NA 4Q4ZF 2HYGD 5EYRA 3HJEA 2EN8A 4IEJA 3TO9A 4K2EA 1F4KA 3K70C 4O4KA 3W6JB 4PJJA 3ZP5A 1TC3C 1N33E 5IYBJ 1WH5A 3JRIA 1QZYA 2K4JA 5EEGA 3DBLB 2KZVA 3OIPA 2F5EA 3BTLA 2EMFA 3GFIA 4HF2A 3TQMA 2KMUA 2DQRA 1JT6A 3JCUC 3O8HA 4UVAA 4JI1E 1VFCA 3M1EA 2HPIA 3FX3A 4MTEA 3FKJA 1WJAA 4ZYDA 1XX5A 3JRGA 1Y1VJ 4IQJA 1P7IA 3Q0WA 2KRCA 3SFIA 4AIHA 1VQ8I 3J7Yp 3BP8A 1V5EA 3JREA 4IS1C 1PUFB 4FE4A 4OX9E 3G1OA 3J81C 4Z6YA 3MZHA 5FO5A 4IJDA 2EA2A 3E6CC 2MKDA 4DR5E 2FU4A 2LKPA 2ZC2A 1GXPA 2EN7A 1EF4A 1BC7C 1K78B 2E1MA 5CJ9A 2RTXA 1A1IA 1YUIA 1OCCH 2BY1A 2WV0A 4JX5A 3DV8A 5C44J 4ON0A 3G6EI 3I56I 3HTSB 2B7VA 1ZG3A 3P9IA 2OJED 3HSFA 5GAHJ 3K9TA 2ZBKA 3TEDA 2L9VA 2JRTA 4DQ2A 4UHTA 4AC0A 3BZCA 1QU3A 1N3GA 3C2GA 3HG9A 5A2QK 2IGMA 1YFHA 4LF4E 2CV1A 2VPLA 2PFBA 5F0FA 3CLOA 3ECOA 5FKOA 4GKKE 4DZPA 1NTCA 2MBFA 1J09A 3QODA 3E0JB 3WHBA 1O7LA 4AWXB 1K6YA 1V3FA 3ABKH 4AVPA 1T8IA 4O5GA 5IXMB 2PLYA 2XAQA 1K61A 1T39A 2DPUA 4OOGC 3K1PA 4PGHA 2WAQN 2H94A 4Y13A 5K7FA 1E3OC 1I3AA 4Y3OA 1DQUA 1T56A 2DMPA 3A0HC 2L01A 3D0SA 4UB8C 5M5YJ 1OCRH 1H8AC 2V1UA 2EOOA 2M4GA 2K9QA 3WTSC 2VXZA 1MD0A 4YELA 1KGSA 4UV9A 3ECHA 2JWTA 1TL8A 4IHWA 4LIUA 2M8EA 5A69A 4M3BA 2R92J 1MEYC 3CJRB 3T1HE 4OAZA 4BE1A 4LK0F 4XICA 3DP7A 4AIJA 4C30A 1R4MB 3AV0A 2EH3A 4HTGA 3WHCA 2NVTJ 4M0VA 4JI0E 3VSKA 2B7EA 2PRTA 2P7VB 2RDPA 3L9FA 1RUNA 3ZR8X 4IF4A 1J75A 1Y6IA 1XMKA 2VB6A 2XAGA 3PIOF 2DI3A 1D5VA 2VUMJ 3KIOA 3A1YA 2PI0A 2Q1ZB 2CMPA 2CU7A 5HLIA 4ESFA 4XNFA 1NHAA 1GZ6A 1ZR2A 5GP9A 1IW7F 2R0QC 2JUGA 3F8MA 4A3FJ 2HDCA 2M1BA 4O5VA 1KU9A 2FE3A 4I99C 2Y48A 3F22A 3ZMTA 3LOCA 1UHZA 2P81A 1FBQA 3EYIA 3HRSA 1GHCA 3F6HA 2E1OA 1IRFA 3EDPA 3AG2H 3BY6A 2GOMA 1STUA 4IRHA 3PSFA 4MLVA 1TQPA 5H20A 2GM4A 1UHWA 1IO2A 3M9AA 5DTDA 1IMUA 3E6DA 5TGTA 1T98A 4KITB 1E17A 2IP2A 3WU2C 1D0XA 1XSDA 2KDZA 1TW2A 3PNYA 1IG7A 2A5YB 3LWFA 4RAGA 1OPCA 3FZVA 3ADJA 3OR1C 3DBHB 5ILUA 1FOWA 2F4OB 3KEYA 1HCRA 1DQ3A 4GDFA 2WA0A 4UV8A 5E20A 1UG0A 2QKMB 2A69F 4G94A 5EF6A 1QQIA 4J01A 2V1DA 2VOOA 1IN6A 2MGQA 5DD4A 2L2OA 1MW7A 4A3BJ 2OCEA 3BPXA 1XMOE 4BEHB 2YTNA 5DCMB 3LSPA 4DV6E 4UVCA 2CV2A 2BXZA 5FKNA 1R22A 3MVPA 5HS8A 3M7GA 1ZLJA 3TO7A 3VEPA 2CG4A 2EZLA 4H4KC 5BQTA 3OYDA 3ZXSA 3U2RA 2EPRA 3QP5A 1U8RA 4D9JA 1ONVA 1IF1A 3LSGA 2WTEA 1IUYA 2ID6A 1R5HA 2GHFA 3K69A 1IV8A 2VIXA 3IH2A 1AH5A 4BC9A 2VE8A 4KUMA 4IHXA 2LBFB 3EUHA 1IN4A 2R7FA 4WF2A 3IWDA 3N4MA 4L9NA 1X6HA 2M4KA 1XGSA 2RREA 1U5TC 2CFOA 4N0BA 1XB4A 4G6TB 4MEYF 4R2EA 2R7XA 5KVRA 4XMYA 3HM5A 1BOAA 2Y75A 4MLQA 3EPJA 3ADLA 4PSXA 3EPLA 3A0BC 3F8CA 1ZHFA 2DLLA 2FOKA 2HXOA 5KL4A 2PMZN 4YFXF 3JRDA 2EMLA 3WTYC 1ETYA 3F8BA 4EGZA 5BS6A 1KU3A 3WGGA 1N36E 2LNBA 5HS9A 2HJJA 3IH3A 1FX7A 5JHUA 4BDYA 2COBA 2QQ9A 3JRCA 1LPQA 4JI4E 1Z1DA 1FTTA 2ZJ2A 3BQZA 5L3FA 3E97A 5HLGA 4ZYHA 2GBYA 2IS2A 4H0EA 1Y1WJ 3Q0VA 2NYXA 4FTHA 3HZJA 4C3IJ 1ZQ3P 4QIWN 3IRRA 3HOUJ 1I39A 5EGOB 5IY5H 1B8IB 3U9GA 1HSJA 1I94E 2NXNB 2NS8A 2K27A 1SD4A 3A2KA 2VKDA 3OMYA 3MZ8A 4KIFA 4CYCB 2WB1N 2DT7B 3RDIA 4CCJA 2JYAA 2JXPA 2VF1A 2YTOA 2Z1DA 4TV7A 1K83J 2NRAC 4YY3E 3KYDB 4GRIA 3MAJA 5DYMA 2Q0OA 2HR3A 4WXHA 1T2KA 1MDMB 1KYQA 3NARA 1P2FA 2R7RA 4B3XA 4BDZA 1NH3A 3FIGA 3S3MA 4KISA 3G71I 5HNHA 1YHQI 4DV2E 3MMYB 4V2FA 3KEOA 2IW5A 5TISC 3C6MA 1D8JA 4DYCA 2EFPA 2D1VA 1WJ5A 4HPQA 4LG3A 5C3EJ 2LKXA 1ZLKA 2B9DA 2MDRA 2UXDE 1OYIA 2VQGA 3GMEA 2V9VA 1XG1A 4O3MA 3KWRA 3W2VA 2FRHA 1YW7A 3GZ5A 2D45A 2H8RA 4R2RA 1FMWA 2IJLA 1LNWA 2M5WA 3E6MA 3J80K 5DUKA 3BR1A 2DA1A 1OYYA 1MNDA 2V86A 2IA2A 5LMNE 1O57A 4MFDA 2Z33A 2J5OA 2CTDA 2HU9A 2MW8A 2XRNA 1EH6A 2Q8UA 5LL6R 1O0WA 3HXLA 4CCMA 1Z6RA 4HQEA 3RPQA 4X1EA 1KA8A 4DBQA 2O7OA 2UXCE 2OF7A 1BBYA 3LQRA 1O3RA 1X3CA 1MGTA 3C7JA 2HFHA 3I9V2 3WG7H 4AIDA 4C9YA 4NHRA 4A3DJ 4DV4E 2QYOA 4HDVA 1NG7A 2V8QB 4NB5A 4ZTJA 2QA4I 5FRNA 2QWWA 1N25A 5ILSA 3C2HA 5M3MJ 3BTJA 3AFHA 2E1NA 5E1WA 1K4TA 1A31A 3VK6A 4ZH4F 3RCOA 1HW2A 3M1CA 3GZ6A 3BG7A 3RKQA 1TW3A 5J8FA 2BZTA 3VYXA 2CO5A 2HPMA 3HOZJ 4W1UA 2XPWA 3OYNA 1TLHB 1UILA 1ZTRA 2DSYA 2VASA 2ZMEC 3ZRGA 5E3LA 4P7DA 4ENNA 2Y9ZA 1JGGA 1KQ9A 4YRVA 3KZIC 2EK5A 3ISPA 5JFRA 1LUJB 3PM1A 1WFXA 2GWRA 3ONQA 2RKHA 4YIFA 3JTZA 1YRNA 1G2FC 1B9MA 2Y0SA 3LA2A 2L5QA 1I6XA 2M3AA 4L5IA 5J40A 1LEAA 1FSEA 2LTRA 3OYBA 1AOYA 2LT7A 1YITI 2HWVA 4S04A 5A6JA 5D8KB 3H0DA 2LDUA 3H36A 4FETA 3PSIA 3V8LA 3SJMA 3OYAA 4D0PA 1ZU1A 4EJWA 3WODF 2CS3A 2UUZA 4DV7E 4HF1A 4XLCA 1HA8A 1ZELA 3IV5A 2OPTA 3ZOBA 4KFCA 2EPKX 2ID3A 5JLWA 4NXME 3TBIA 1BR4A 1F5TA 2UZKA 2UXNA 4XKVA 5GPCA 4ENJA 2E5LE 2FMLA 3HEFA 4ENKA 3JAMK 2GIVA 2ME6A 4ITVA 1E3HA 3HUGA 3GTPJ 4MHGA 3ZMSA 1MJAA 3E6BA 1EH8A 3OYIA 2EN1A 4IL6C 1JKQC 1R49A 3GLLA 2Z16A 4DR6E 3WG9A 1IBKE 4A69C 2M8GX 1REPC 5E79C 2KONA 2NUFA 5HVQC 4E70A 2IRFG 2B63J 4CICA 2DOEA 1X3UA 4XOTA 4ZYGA 2QKLB 5K7ZA 4KHPE 2JUCA 2WWYA 2V83A 4J8ZA 3DTKA 3BF2A 1IDYA 1MMNA 2ZXJA 2ESHA 3QU3A 2TRTA 4U88A 2ODRD 3JSPA 1D1AA 1A04A 3K0LA 2F8BA 1VQOI 1Y8QB 2BY0A 3BC8A 3CUOA 4ZYAA 4OMZA 1IXRC 2CT1A 2EOHA 1PDNC 1FOYA 5T6JA 1Z9CA 2ZMEA 4PFPA 1BW6A 2EMIA 1X2NA 2UXXA 2DMQA 1YPNA 3T8RA 2WY8Q 4CCNA 5CFFE 3J7AO 2FNAA 1UHSA 1YJWI 3JW4A 1I1GA 4KDPA 2YWQA 2IT0A 3A03A 4R2DA 1YYVA 1U2WA 3UNGC 1HF0A 1WKMA 2JPAA 4PZJA 1R71A 3NAUA 5HOOA 2MLKA 4AD9A 2V4JC 1XPXA 3S2DJ 4KZSA 5JHFA 4FASD 3MQ0A 2UXBE 2IGKA 1Q1HA 2JA8J 2A61A 5FLMJ 4OAYA 1FPQA 1UFMA 2ZFWA 2WY7Q 1USTA 5J1YA 2OTJI 2X6OA 1TWAJ 3BZKA 3NEUA 1W5CC 4YFNF 4RAFA 4R8OA 4NXNE 4A3IJ 4BJ5C 2KHMA 4F54A 3CTAA 4N9IA 2KKOA 2R3SA 5DNYA 2H6BA 3FKIJ 1WXRA 2ELHA 3IUOA 5HDGA 5K5QA 2K7LA 1QGPA 3VOEA 3MKYB 3DLLF 3I4MJ 1F43A 2YT4A 4JK1X 2M7AA 3CD6I 5KL6A 1A1FA 3WGHA 4RDUA 2XDVA 2L3JA 4B3TE 1HSTA 3RKXA 2DBBA 3H9GA 3TW6A 2VRDA 3S3OA 3L2UA 4QSHA 1ZRFA 1RIOH 4B47A 4X0GA 2B3TB 1OR7C 4ZYEA 5EJCA 3CQZJ 1F1ZA 1U3EM 2L7KA 3UKGA 1TTYA 2FV4B 3T8TA 1OMIA 1YIOA 2VBWA 2ACJA 4WXCA 3GWZA 2ODRC 2Y0SN 3CJNA 2LTSA 4D5CA 1SFXA 2FF4A 3V7RA 2R5ZA 3ZGKA 1ZBTA 4DV5E 4G7HF 4RS8A 5DUIA 1O3QA 3LSTA 3JTGA 1ITYA 1FBSA 1BL0A 1I1SA 1QRYA 2P5VA 1J59A 2DODA 3QYBA 3CCJI 2OAZA 3S93A 4WXDA 3L2QA 4J00A 4ENMA 4LIVA 2R7SA 3A02A 3OR2C 2LOOA 3MN2A 2N3GA 1MSEC 1N34E 3F21A 1YJ9I 3DBRB 1GV2A 4DOZA 2Y2ZA 3CO7C 1OISA 3MHSC 2LBSB 4C3JJ 1T4OA 3VDXA 1H9TA 2HVQA 4CUGA 3OYHA 4HSTA 1TQMA 2MC4A 3H3ZA 4A3MJ 4XL9A 4PUSA 4HEA2 5CQGA 4UUSA 4WYQB 4BXUA 4BCAA 1J7KA 2Q8KA 1SR9A 1BR1A 2IA1A 3V8JA 4BBSJ 1VNDA 3HBLA 1B72B 1IRGA 3CF5F 4HLYA 2WAQA 3OS2A 2Y0MA 5KCMA 2DTRA 5IYCJ 5K5OA 3DCFA 2IBDA 2YTEA 2JY9A 1HXDA 4LJZF 1CGPA 3S17J 1PDAA 1Q1VA 1LKXA 2GLOA 1LLMC 1OLTA 2RSIA 3TMOA 1V5FA 3GUDA 5DCFA 3CCUI 4P96A 2EZKA 2ENAA 4DBRA 4X65E 2X48A 2EJ4A 3D5LA 4HNUA 1C0WA 3H92A 3CDHA 2IXSA 2FBKA 2L54A 5LEJA 1LDDA 3UK3C 1RMDA 1IJWC 2LKSA 4XK4A 5HS7A 1Z0XA 4BHCA 3HOXJ 2M9AA 3PL8A 5AC5A 4DR3E 1U5TB 2K40A 1UAAA 4N9HA 2BY3A 2E5ZA 2ZSHB 1FC3A 2E1MC 4CA0A 2A07F 4HDUA 2YU5A 1FTZA 2LRSA 2AO9A 4BBYA 2LC2A 2PJRA 4BYYA 3QOPA 4Q35B 1BN5A 2XKOA 1E0EA 5FJ8J 1G3TA 4F7ZA 2CWEA 2EM6A 4P1WA 3PO3J 1Z67A 1UJ8A 3U1KA 1X1AA 3KP3A 4FCYA 4XLAA 4HOBA 2XAJA 3B73A 1X4OA 2EM0A 3E5QA 2EQ3A 5HODA 1JTXA 4LFAE 3VB2A 1BI3A 3UR3C 1TT5B 1W7PD 2VE9A 4F9AB 2CYYA 5KK1A 1FKAE 1Z7LA 1XDSA 2UWMA 5F6FA 1FP1D 1TBXA 1Z05A 5KAIC 2M7QA 1GLNA 3LSKA 1MMDA 1S29A 5IP9J 1G2DC 2BV6A 1QVTA 1VQ6I 2O61A 3LMMA 2XSJC 4GKJE 2EINH 1WRJA 2K3PA 3M3YJ 1RKWA 2MH9A 3GYHX 4B48A 2EM2A 3H5RA 5IP7J 2R4GA 2L2NA 1ZH5A 1A35A 5IT9K 3HQ1A 3A01B 3HTUA 3K4KA 2PEXA 2LJHA 5KNLA 2E2IJ 2VN2A 3HUGB 4XLPF 2VXDA 3GO5A 1QPIA 4IHYA 2ZJPF 4BL0B 2YSPA 2YTGA 1CQTA 1E3PA 3BJOA 4CSWA 4JI6E 5CVRA 2AS5F 5HDKA 5BOXA 4XKCA 3W6KB 2QSFX 5L3BA 3HPSA 5HNFA 1LFPA 2W00A 1SFKA 3I64A 3BIDA 4KT5C 4UB6C 4DV0E 4IJAA 4QWQA 2VKVA 4EGYA 3C3WA 1R58A 2PMUA 2KOUA 1HNZE 2RS6A 4HEIA 5TRDA 1I27A 5BR8E 3FK6A 4HZFA 4BJ6C 2Y31A 4HAMA 4BGDA 2VC0A 1XMQE 1FOXA 2G9WA 2V26A 2DN0A 2EMXA 5A6BA 3S1RJ 3ZN1A 1OYWA 3IC7A 2I10A 1HNWE 1XMXA 3ZQGA 2F4MB 4WPYA 1PJTA 4RB3C 4M30A 2PJPA 1Y0NA 2ZMEB 2G7UA 2PMZA 3DF6A 4X6AJ 4IVNA 1HKSA 1ACIA 3SZTA 3KEQA 1QHGA 2E72A 4RMNA 1O3TA 1LE8B 2MC6A 1WZ2A 4PGGA 1FNNA 3OYJA 4OIQF 3O6BB 3CC7I 4KICA 4C2UA 2IEKA 2VQCA 3V7SA 4EM1A 2Y30A 1CF7B 4EVIA 1MMSA 4F91B 1GT0C 4JI8E 3COAC 3Q0UA 1VQLI 3H0GJ 5D6FA 3SDBA 3Q5FA 2EN6A 1N32E 4U7DA 1D1BA 5ICCA 2MYSA 2WB1A 1YI2I 5KL7A 3FK7A 2DT5A 1X2MA 2EOXA 1AWCA 1BR2A 3CCYA 1ZK8A 4G7OF 3I59A 4A6EA 4GFBA 2BEOA 1A1LA 1SMYF 3G3ZA 2DQLA 1TP4A 2E19A 2XF7A 1U9NA 2RV8A 4E7ZA 4I8OA 1F9NA 5H2FC 1WGXA 1DDNA 2EE8A 2DFEA 5FRMA 5FLXK 1UHMA 4A3JJ 2FEZA 3EUHC 3ERMA 3CMEI 2RGVA 1RPWA 3RMPA 3RQ4A 2XGDA 5L3GA 2M0MA 4JX4A 3FBIB 1HW5A 2YPRA 3JSOA 3J7AY 5M5XJ 5AE2A 1JK1A 3CCEI 1IN7A 2BHZA 1G6NA 5GPAA 3QAHA 2L7MP 2QQ8A 2WV1A 2F48A 2GOXB 3TQNA 1ETOA 3VYRB 2EFWA 2EQRA 2L0KA 1JJ8C 3NWTA 1UB9A 4LK1F 2YTFA 4M9XA 5F0CA 2XRLA 4BBRJ 1XNRE 2EL5A 2NS7A 1APLC 3HOVJ 4M9VC 2V1NA 5FD5A 2HHHE 2VL8A 3BCAA 2R5ZB 2E71A 1PVEA 2FOWA 2DMNA 4MQVA 1LVKA 1EH7A 2ZNYA 2VC1A 1JKOC 1VQ7I 2E2JJ 1PJQA 1IBLE 3K10A 1UBDC 4KIGA 5J3LA 3S2HJ 3ASOH 1ON1A 3O3KA 2EPZA 2WBSA 2VODA 2XF6A 1U78A 3BR6A 4TUIA 1YX5A 2JN6A 1VQMI 2NOGA 1IXSB 3LSHA 2DLKA 2EZIA 2ZNZA 4L9JA 5ICEA 1JXSA 1XC5A 2F2EA 3L2RA 3CO6C 4R79A 3SZGA 1HBXG 4EJTA 1W5TA 4RB2C 4B3SE 3BPVA 1BJAA 4CGZA 1VI0A 2YSOA 3PIPF 1T33A 4ZTFA 2V88A 4IPAA 1W7PA 4G6QA 2FMYA 4LTYA 4R8HA 3OSFA 1KONA 2AHQA 1FYKA 3WTVC 1P47A 2UV1A 4IXAA 1A6QA 3FISA 4I09A 1IDZA 1WI9A 3SFZA 1UG2A 2WBUA 2DOAA 2E36A 2M34A 3HKZA 2I5UA 3HGYA 5D6EA 4NQWB 2XKPA 4F6NA 4XORA 3Q3SA 2G7HA 3K2AA 4CCKA 3F23A 2XGCA 2E34A 1N77A 2RPCA 2CW0F 1FIAA 5HDNA 3DTIA 2RQQA 1POGA 1X49A 3D1NI 1A1JA 3JRHA 2KL4A 3WTZA 3BR5A 2DDBA 2LMZA 2OCCH 5B5EC 3H35A 2CH0A 2DK8A 5ERIA 1UELB 2EJRA 5IOYA 3S3NA 2LVHA 3F0CA 1D1CA 1I6HJ 2L4AA 2CUJA 3P9KA 4EV0A 1O4XA 4DJAA 1FJLA 3HDDA 1B69A 3O8GA 5D5VB 4WSGA 2KDOA 2K9MA 3CCSI 2DB2A 4RHBB 2I9IA 5J8CA 2EMGA 2Z2SB 2QQAA 1O7FA 2QGUA 4AIKA 1YO5C 4R2PA 2NVYJ 2LUQA 4KMUX 3R6SA 1GTKA 2EFOA 2R7ZJ 4HBLA 3MEXA 4D7NA 4IOCF 3KLNA 1FP2A 3DJWA 2EOJA 3VFZA 5HLTA 3H09A 2DCEA 1JUSA 4YIIA 1YIJI 3NQOA 3RPUD 1RETA 3BR0A 5C4JJ 2BW3A 4UVBA 1IUFA 2ZKZA 4PCQA 2W24A 1Y56A 4EMSA 2YS9A 2BHYA 2JVAA 2VLAA 2JVHA 3IL2A 1X6EA 1YYWA 3MCZA 4CCLA 1YYOA 1DP3A 5D5WB 3U21A 4M6XA 3IWBA 4ZZDA 2XHKA 4A0XA 3JAMZ 5J1RA 3FHZA 3KP6A 2E35A 1L4SA 4LF6E 1WJFA 4XRFA 2LE2A 2RSMA 1YUJA 3AAFA 2CQ7A 4JI3E 4A12A 2UUCE 5J4YA 2EMHA 4P9FA 1YS7A 2PMHA 1YW8A 1K4SA 1S7EA 1OCOH 2CQXA 1YQAA 2V9PA 3HPHA 2E1CA 2ZCWA 4NZVA 2HKXA 5AIQA 5E1ZB 1PKPA 2M9HA 2K85A 2EV0A 2WC2A 4I6ZA 3BG9A 3J7ZI 2DOFA 1X1PA 5CVJA 4IHVA 4NHJA 2D9HA 3QU6A 5D5XB 2EPCA 2EFNA 2MC3A 1ZN2A 3LQQA 1SEUA 3EQ1A 5CQEA 4HV5A 1MNEA 4IZZA 1HQCA 1XTAA 4CH7A 4HYEA 4JYKA 5M5WJ 2CUEA 1TF6A 2EPLX 3CC2I 1SFEA 2RQLA 4MGRA 1QHHD 4CXFA 3ZQHA 4QPQA 4F2JC 1WWXA 2H09A 1ZGJA 4ZDLA 2EOEA 3G4SI 4RM2A 3DKWA 5LHGA 4MO7A 3PQJA 5JR3A 3HOSA 2EL6A 2FA5A 1ETXA 1GXQA 3JRAA 2VJJA 3R60A 2EORA 2E1MB 5BPIA 1Y8RB 2DA4A 2DK5A 2NVUB 1P7JA 2K9LA 3R0JA 4M73A 3U1DA 3HL2A 2FQ4A 3H9QA 3AL0B 4LF7E 2PQ8A 3L2WA 4PDKA 2EPXA 4LGWA 3HRMA 3VYUB 1YG2A 4XN3A 1BC8C 1A1KA 3ZMVA 3GF2A 3JU0A 4E7KA 3E5UA 2B0LA 4CO8A 2EOFA 4R2QA 1ETKA 1SD5A 1SVOA 1X4PA 3WE2A 5FKKA 5DM6F 3CCQI 1QBJA 1SD6A 3HPGA 1VQ9I 2VONA 2DTZA 2XPUA 1TNSA 1FY7A 2HZDA 2EFQA 1U9OA 1X1CA 2QZ8A 3K7AJ 1U8BA 3HKZN 2EBIA 4M74A 3MHHC 1QNTA 2M7BA 2DMIA 4A5NA 4O6JA 3EUKL 4BHPA 2KFDA 5BPDA 1BW5A 3ZN0A 1D0YA 2QEXI 3RQIA 1W0UA 3GTOJ 2LRDA 2DU9A 1O3SA 2KIUA 1Z3YA 3J81K 4I01A 2KRHA 3A4CA 4XN0A 4LLLA 2OC6A 3I59B 5H6RA 1I3QJ 2XV4S 2KJCA 1QU6A 1G8XA 5F04A 1PJRA 5CKTA 5EZHA 1IV6A 1BBOA 2EOQA 3DEUA 1MJBA 3ZQCA 2R7QA 3JTHA 1R36A 2ELYA 4AYBN 3E7LA 4ABZA 3OOPA 5J47A 1DPUA 1J9IA 2EB7A 3T5XA 5IWAE 1TWCJ 2D2WA 2QVOA 2YU3A 4HLXA 4ZJZA 4LMYA 5J6XA 2MC5A 2OZ6A 2K9SA 5LEKA 1QPMA 4XLFA 2KLOA 2FUG2 3BTIA 2HOTA 4L9TA 3JRFA 2L2MA 2EOIA 1KYWA 3MKWB 3NRVA 3WGIA 4F9BB 3S15J 4QPOA 2XPVA 2VJIA 3VYSB 2X6XA 3VYYA 3I71A 3I4NJ 4M6VA 2YZTA 1ZYRF 3P5JA 4F6MA 5IV8B 2EMAA 5LGNA 3VODA 3GTQJ 2E7XA 1D8KA 2BVMA 3ULQB 3R4KA 1B4AA 4NUBA 4YEJA 1T0FA 2JJ7A 3DXJF 1IAWA 2R7UA 3R0AA 4M9SA 4E6KG 2STWA 4F93B 3OYLA 5AASA 2X9DA 4I2OA 5KHDA 4U87A 4DUZE 1X3WB 2EZ6A 1MBEA 2EMBA 2YUSA 1ETVA 4JQFA 3V7CA 9ANTA 1AU7A 3CMYA 2DGCA 2DLQA 2V1XA 1SD7A 4LITA 2EM3A 5ILVA 5E3MA 2DMYA 2R76A 3HSRA 2LLKA 3RPUA 1WQ2A 1XNQE 1BIBA 2YX4A 5JVGF 2J7JA 2QM3A 2Y69H 3KP4A 4RAYA 2OUMA 1MBFA 1R1VA 4JI5E 2MLGA 2EWLA 3OOUA 1S9HA 2IA0A 1MMAA 1V5GA 1XCVA 1W7PB 3FXKA 1YE9A 4N4RB 4S05A 3GTMJ 3FM3A 3BGHA 1ZGAA 2HQRA 2KIQA 2CQNA 4NC7A 4Y15A 4LB6B 1PP8F 2L9SA 1RUOA 2H1LA 3GTLJ 2L4MA 4XRSG 4KYWA 1QVUA 2ENCA 3THNA 5DM7F 3T1YE 3CMMA 3E1SA 4A2UA 2W82A 4RB0A 1Z1BA 2R5YA 3HTXA 4HX7A 1F36A 1P9QC 3SDGA 4X9JA 3MSWA 2F4IA 3K4NA 3M8JA 2R1FA 2F5DA 4A3EJ 3S16J 3DPTA 2JQ7A 3O2PE 4JP0A 2XAUA 1X1DA 2ZJRF 1JT0A 2IVMA 4X66E 3HRUA 2EILH 1I50J 4M3GA 1IZ1A 5F27A 3QP6A 5E18F 2NS0A 3TGNA 1ZG1A 2P4WA 1NG6A 3Q9VA 4KNYA 2MH2A 2JPCA 3CDIA 3QPSA 1RKTA 4OINF 1WHUA 1MMGA 4JYAE 2MABA 3IAM2 5D5UB 2Z99A 1FMVA 2JRMA 3OL4A 4YFKF 3QYEA 2W85A 3BLYA 2NNYA 1W36D 4LB5A 5A6BD 3HOYJ 1ZR4A 1JI8A 3G2BA 3LAJA 5FFZA 3VWBA 3WE3A 2F5VA 3KPHA 4C3HJ 2H8WA 1R9TJ 4Y17A 2MFZA 3KZYA 4F3QA 2VT3A 4AUXA 4G9YA 4BACA 4Q28A 4GCVA 3OSGA 4HW0A 2HOEA 5FGMA 1H0MA 3ECRA 4JV5E 4ASNA 4L18B 2HOAA 4J19A 1WHQA 5E3NA 2BW3B 1J5EE 1YX3A 4Y7NJ 1XN7A 1ZR9A 1RNLA 2VT2A 3LSIA 3ZOQB 2KIMA 3LSJA 4HQMA 2PX9A 5GTHC 1PP7U 1X5WA 2EMWA 1S8NA 4MEXF 3B6CA 3HHGA 2EPUA 1UN6B 4A3KJ 5IT9Z 2DPDA 3TO6A 2E7WA 5DD8A 3ZQLA 1R5ID 2DAOA 2VBZA 3OTOE 1YZ9A 2L7ZA 1VQKI 4UXNA 4G8XA 3BOQA 2XSDC 3H9JA 4NC6A 1OCZH 3P1XA 4O43A 2M2EA 4L5JA 5GTIC 4IHTA 3KFWX 4Y33A 3DU6A 2YTPA 2QSHX 4LF9E 1MIJA 5LRSA 3BJAA 3ROUA 4YHHE 5H6QA 3DFGA 2VQHA 5A6AA 4L0ZB 3DLAA 3ZQ7A 1S5LC 1X3ZB 5JLXA 3TDUC 4LU9A 1L3LA 1A6IA 3BR2A 4HG2A 2IS4A 4OMYA 2BE5F 2KP6A 1FYLA 2QBYA 4M3DA 4DR4E 2DW4A 2JVGA 1XSXA 4EQQA 4CZCA 2DO7A 1FT9A 4ESJA 3BT9A 4GEQB 2XIGA 4UUTA 4HRIA 1USSA 4EM0B 4EJOA 3L1PA 1QO0D 1HDDC 4MLOA 2ZFUA 1R23A 2YRMA 1BJZA 2DDAA 5FB2A 1T95A 1VZ0A 2CSOA 1Y0UA 2A68F 1J26A 5E17F 5DDGA 2HNHA 2EM8A 1E2XA 5B1AH 3V4GA 1KU7A 3H5NA 2JSPA 5LGUA 1HW1A 3IP4B 5EDNA 3S8PA 2XB0X 1HKTA 2EMCA 5TSEA 2L9RA 4RB1A 3EYYA 3ZQQA 2BBGA 5A2QZ 1W36C 1P92A 2HOSA 1FSHA 2E60A 3AL0C 3OV8A 1X19A 2ZB9A 3FF5A 3HC7A 1R4NB 2FQ3A 3FXLA 2LUPB 3FBNB 2BY2A 2H6CA 5AONA 2WAEA 2GXGA 5BNGA 1ETQA 1STZA 2NUGA 4RAZA 4E7IA 3LLHA 2FGGA 2L33A 2LO3A 2VI6A 3FMRA 3S32A 1MBGA 3WTUC 1GDTA 4OOIA 2HS5A 1SANA 2AXTC 1MBHA 2VBXA 1XCBA 3TP0A 4AVZA 1PUEE 4XKBA 1YRNB 2O8KA 3ZQIA 3CCLI 2EZHA 2MKNA 3P9CA 2Z3YA 3F3XA 4BUPA 3K4MA 2X1EA 3CC4I 1QZEA 1X48A 3FXJA 4A0ZA 1NK2P 4IOAF 4DUYE 3EQLF 4Q47A 3GVAA 4OIRF 3VSLA 3LSRA 1T4LB 2DRPA 1KQ8A 3S1QJ 2KISA 2LY1A 2DJIA 4RGSA 1ZRCA 1G4DA 2STTA 3GFJA 2YTDA 2X0LA 2A05A 1WVRA 3BROA 5FLXZ 1QA6A 3C18A 3LA3A 4XRSA 2DIXA 2D5VA 3K6GA 5L3DA 4HSRA 2K3FA 2CUZA 2AQFA 1RQ0A 1B8IA 3KP5A 3ADIA 4PJMA 2AQEA 3WTXC 2KPMA 1TWHJ 1Z21A 2YTJA 2M45A 3HSEA 2EN3A 2FD5A 3KCCA 3C2BA 2ME0A 4FX0A 4KN7X 4GZNC 2W84A 5D4RA 1TNTA 1SC7A 1MDMA 3AG4H 1S72I 2ELZA 4A3GJ 4LOCA 2FTXB 3B6AA 4PJ0C 5FKLA 3EPKA 4P5OA 4A0YA 5JI6A 1HLVA 1VQNI 1U6GA 2EPNA 4PJNA 4LFUA 1MH4A 2HYFA 4BQQA 1Y39A 1YW9A 3I58A 1JKPC 5J4VA 1KYZA 3FIWA 3CUQC 1Z77A 2TCTA 1AA7A 1YYKA 4A93J 2H1KA 4F9CB 2X6YA 1M1EB 1OKRA 1HOMA 2E5NA 4LFBE 4GO1A 5LHIA 2VKEA 4R2AA 3GXOA 2EOSA 2O8XA 3F9KA 4XONA 3PUBA 4P55A 4L8NA 3WTWC 3P7NA 1JK2A 2EPMX 2EM7A 6PAXA 3VYTB 3CJQB 1S6LA 2GXBA 1BOBA 4BQAA 1ZAOA 4MQ9F 4OU0A 1RR7A 3L2CA 4I0BA 2XVCA 4WWCA 1K6OA 3SYTA 1MKMA 4BU2A 2VPRA 3ELKA 3N97A 1BA5A 3OMLA 2WAFA 1S7AA 5ED4A 4E7JA 3JAMC 1AHDP 4BH9A 1LDKB 1R1TA 5TJJA 3CESA 3LNQA 1DGWY 3QQAA 5GAEJ 1EKZA 2M87A 2EMZA 2RS7A 3CCMI 5AIPA 1DI2A 1JE8A 1ORKA 2V87A 1GQEA 2L8TA 2YX7A 2CUFA 5KL3A 2QSGX 4IRIA 4FHTA 3HIFA 4MNUA 5KL5A 1V55H 2RNGA 2EIJH 2IS1A 2M0CA 1MJ9A 1OFCX 2R5YB 2LYCA 3S2WA 2N3HA 4Y4RA 3C4BA 4RGXA 4DW6A 1YSAC 4CDGA 2ETHA 4IRGA 3PNTA 3IWCA 5F3WA 3C4TA 3SZPA 1LQ1A 5FROA 1J0RA 3ASNH 2LJUA 4BXXJ 2HVRA 2W25A 2F5CA 2JA7J 4E4HA 4BJTA 2W7NA 1V4RA 3GW2A 1WI3A 2RAEA 4N4OB 3GTGJ 2EL4A 2EPAA 1I5ZA 4PK4A 2LFBA 3MFKA 4DV1E 3J7AG 1V54H 4WFTA 2HGCA 2VQLA 3L00A 3MD2A 3CCVI 2VE7C 1GVDA 3RJPA 2IHR1 4Q48A 4II2A 2IGOA 5IYDJ 2QLZA 3W6VA 1VQ4I 2EMYA 2LY9A 1JJ6C 4B3ME 4ZDOA 3TOAA 4GGGA 3X2QH 3K4LA 4LLNA 3BG3A 2K4VA 3GX4X 2NOJB 5EEAA 3I53A 3PQKA 3I5UA 5FD6A 3ML6A 2ADUA 4Q5SF 4B1RA 4IKFA 4TUGA 5M3FJ 2YSRA 1VTNC 1WCMJ 2EWNA 3T1BA 1WJPA 2K9NA 2J5PA 3CUQA 2DFFA 4XSZF 2DA5A 4UUVA 2CQKA 1RC9A 1Z91A 4JX6A 4RLFA 1H89C 3HYIA 1IRZA 3L2VA 3GZNB 1G2HA 1R1UA 5E8GA 3I0TA 2QENA 2RVCA 2ICWG 4FT8A 2ZO4A 4FK5C 4U7BA 1GVJA 3CZ6A 2CW7A 4D1QA 2JR1A 2P7CB 3DWLE 4KIBA 3BCBA 5ADZA 2LREA 1HC8A 3I3LA 3ZQFA 2AXLA 1OJLA 3WU1B 2DA2A 1AKHA 1TN9A 3GLXA 3QOEA 1W4MA 2O6GE 5AE1A 2NUEA 2F6CA 2MD0A 2OQRA 2WADA 2RQPA 1MZBA 4A3LJ 1ENHA 1ERDA 4L0YB 1FIPA 3OYKA 3KE2A 1W0TA 4A6DA 3BZ6A 2JP9A 1A5JA 2DMTA 4OWRB 5IP6A 4B4CA 1XDUA 1DP7P 2OZUA 4EJVA 2Q2EA 2P0WA 3J80Z 4L5NC 1Z3XA 3FXQA 4UUSB 2RC4A 3IHUA 1BIAA 3DKXA 2R7WA 3IWZA 2L7FP 4NC8A 1B59A 3E3VA 2LY2A 3BG6A 1IGNA 3CJTB 3IKVA 4WCGA 3RIRA 3RKWA 1IRXA 2KIFA 5EG0A 3LAPA 1TF3A 5LLQA 2QBYB 1P4WA 4FISA 2R7OA 5L3EA 3CCRI 5LD2C 4HV6A 5JVTA 3OYMA 1SAXA 3OYGA 3HPZA 3QPLA 2I13A 2DMUA 4LG0A 4AYBA 1YTYA 1X58A 5CLSA 2VOPA 4MFEA 4M3FA 2A3SA 2EQ1A 3WU0A 5F1JA 5CVVA 5ICGA 5BMZA 2A6TA 5LBQA 1FJGE 1UZCA 1NEIA 1WJEA 3J7YJ 4HNTA 1WJDA 4M9ZA 4XM3A 3ADGA 3JRBA 2EP3A 5DS9A 3KLOA 1IBME 2CV0A 2FX0A 4XRMA 1YS6A 2X1DA 2NVXJ 2PJRB 4O24A 2Z9OA 5L3CA 3RZOJ 2DFIA 1LDJA 3DQVC 2QCOA 1FZPB 4KN4X 1PYVA 3KYLA 1XGOA 2LV2A 3BBGA 3RYRA 2JOXA 3BTCA 3QPTA 2VQFE 4P9UA 4A3CJ 2ECBA 4LF5E 1RR8C 1JHFA 2G0EA 1WJCA 2PN6A 3GEZA 4RGUA 3W2AA 2DA7A 2O0YA 2ELKA 3KP7A 3FXMA 3S14J 1XMAA 2PG4A 1OQYA 2W1OA 2QUFA 2TDXA 2ZXHA 3T0YA 3J81Z 4IO9F 1VQPI 2JA6J 2N8XA 5K5RA 3OIOA 3DEWA 3TL4X 2IS6A 1XS9A 5LGTA 1ZAAC 3OYEA 2LR8A 2JWOA 1AAYA 2HEOA 4HNVA 3PNVA 1DGRM 2I8DA 4PSWA 2YU9J 2R7TA 1R7JA 3BQYA 3K1NA 3TOBA 2LG4A 1EKEA 5K1YA 4M2ZA 4ETSA 2GPIA 2K4BA 2B7TA 2P6TA 4XLNF 2M30A 3LA7A 3ERED 3QRFF 2FSWA 2OQGA 1LEBA 2LSOA 2XB5A 2OD5A 4M72A 4DKKA 2GLIA 2ZXIA 3F6GA 4JI7E 2YTQA 4ZDPA 3KP2A 1H9GA 2EM4A 3F6OA 4R1HA 2R7VA 3FXOA 3D5SC 3IAS2 4FX4A 1ZG5A 3W3CA 2KT0A 4BMJA 2R93J 4LF8E 4A5MA 2PBIA 4NNJA 4I7HA 1HKQA 1MBKA 2L3CA 3V42A 2W57A 5A6KA 1JHHA 2LF7A 3L09A 4U0VA 1VQ5I 5FKMA 1QZZA 1P6RA 1EV7A 4XKWA 5LMUE 4S0HB 5F1RA 4XLEA 2UUBE 1B72A 1P4XA 1RESA 3DTEA 4N4NB 4DR7E 1IN8A 1T0FC 3CMAI 2YU8A 2HVSA 3QPHA 2GZWA 2UUAE 2NA2A 1DPRA 3ESWB 1SAUA 3L7WA 2WZOA 3RYPA 3LMLA 2JOBA 2O3FA 3H1CA 3OS0A 2EMKA 4GXOA 2EM5A 1XD7A 1WJBA 2CW8A 4XIDA 2EA4A 3I55I 3NWSA 4QLCU 1FLIA 2ESNA 1G59A 1TWFJ 3SXYA 1LB2A 4CCOA 5E3OA 2DXIA 1T6SA 2EIKH 3KYCB 4EM2A 2V6EA 2P6SA 3H5AA 5CVUA 2DA6A 4YG2F 2K86A 1RI7A 4R2CA 4FQGA 1SFUA 2JK3A 2NVQJ 1W1WE 3ABUA 3FHNA 3MWMA 3M8FA 1U5TA 1D5YA 2HXIA 1SMTA 4KWYA 5IT9C 1DU0A 4FE7A 4HX4A 5J1UA 1X47A 5AE3A 3GFMA 4F55A 3DU5A 2P8TA 4XLHA 2K5CA 2JT1A 1SVLA 1ZREA 1WPKA 5DEQA 2XROA 2YRKA 4V19K 2LCEA 1KQ0A 2L6MA 2OA4A 1J2XA 2BOLA 2L02A 4RM3A 2KJBA 3PO2J 4BKXA 3QG5C 3TP3A 2WBMA 4B3AA 4KJZA 2X85A 3GCMA 1RRJA 2EN2A 1S3JA 2HZTA 1DUXC 4DIQA 1JUMA 2Y9YA 3TDZC 3D5RC 2M1SA 3EPHA 2LK2A 4R03A 2HI3A 1N75A 4IX7A 4BAYA 2MA3A 2EV6A 2IGNA 4G6DA 4U0WA 2KZGA 2EPPA 5IOZA 4HA8A 3AUZA 4D5FA 2RN7A 2V85A 5F64A 3ABLH 2JZYA 4E7HA 1ZARA 2VBYA 1D3YA 4EEFG 1S7OA 2JA5J 4B3RE 1K7AA 2C6YA 4E7LA 3K6QA 2EOYA 2NNNA 1ZBQA 3A01A 4ANJA 4F92B 4Y52J 1UCRA 2F4VE 2NAZA 1PJSA 2LVSA 5EZGA 1KZHA 2M4IA 3HRTA 3ZMUA 1WHNA 1A1GA 3OL3A 3SQNA 1SVMA 1BI1A 2R7DA 3MKLA 5A2QC 5D4SA 3CUQB 4EJUA 2A5WA 2EPOA 2VJ5A 1IXCA 3VPRA 2OU2A 4X8WA 2BGCA 3RSNA 3RZDJ 2P5KA 1X1BA 3KX2A 4LLGF 1KJKA 3OY9A 1ZKGA 3HB9A 1TZLA 5B66C 1DGCA 5C4XJ 1FYMA 4M71A 3C6KA 1LVAA 2N8GA 2VKHA 3BDDA 5LHHA 4PJLA 1AKHB 4G7ZF 4BE0A 2O03A 3AG3H 5K7HA 3Q9SA 4GYGA 3GFLA 3E5XA 2CGPA 2X51A 4DGWB 2V7FA 1D0ZA 2EOZA 2EPFA 5AC4A 1ZGWA 1IN5A 1PUFA 2X6WA 3N05A 4DR1E 3ABTA 5EEHA 1ON2A 3CP2A 1HNXE 4JBAA 3KETA 4V2GA 4HF0A 3ZCOA 2GA2A 1K78A 3IH4A 2D1HA 1Z6TA 2KQRA 1SFOJ 4DYRA 1LFUP 1HR0E 1F2IG 2Q2EB 3RI4A 4OIPF 3G1LA 2K02A 1T38A 2MSYA 3B02A 2FXAA 4BC7A 4R2SA 1ZRDA 3S1MJ 5FLXC 2FJ1A 2L9NA 2LP0A 3C1DA 4E7SA 2CJJA 4BNCA 1ETWA 2HTJA 3AG1H 2YTIA 2EOMA 1LE8A 1JKRC 5EG0B 1K79A 4DR2E 2XASA 4F52A 1EJ9A 3ZMDA 4XBFA 1BM9A 3R61A 2OBPA 4I0AA 2CPNA 3PFIA 3F72A 4BHBA 2ENHA 1RZ4A 1TQIA 3K4JA 3RKYA 1CF7A 2JPBA 3OYCA 3THOB 2BVLA 4X62E 1WH7A 3BJ6A 2B9SA 4LG0B 2KRFA 1BI2A 3BR3A 1G3SA 2BB8A 2LH9A 5F0HA 3GTKJ 3TKYA 1JUPA 1G3WA 4XSXF 5CYVA 1YLFA 2K7IA 2V79A 5LFAA 1OCTC 5CVIA 4RGRA 4Z2YA 3DPLC 1Z7UA 1XGNA 3FXRA 1WSUA 2YRHA 3I54A 4LFCE 4BXFA 3DPUA 2GQQA 3K2ZA 3DF8A 3ZPLA 2W4SA 1L0OC 2ZSIB 4JI2E 2ADRA 4PFOA 2JTVA 2LD5A 2GAUA 3WTTC 1YJNI 2H27A 4B8XA 1BBGA 2FBIA 4CHUA 1R00A 1TWGJ 4I76A 2FBHA 3M07A 2ISYA 4BS9A 2A6EF 3H3VK 2VQEE 5FLVA 2A6HF 4L9VA 3PFYA 2XF5A 3EETA 5CPRB 1FOKA 2L92A 1A1HA 3SEZA 2YR2A 3I4PA 4I02A 3MKZA 3LFKA 2LMDA 2ZJQF 3EUAA 3FDYA 4ESBA 4QTRA 4L5EA 1MSFC 4XOPA 1DU6A 1P4AA 1LJ9A 4DZJA 2XUBA 2OV7A 3F6VA 3F8FA 1T08B 3BWGA 2VJ4A 3FMQA 3OYFA 2OTLI 3SHFA 4BY1J 2Z5UA 4P78A 3IRQA 2QF7A 3FWEA 3PJRA 4RA2A 1N78A 4XR6A 1IQSA 4NBQA 4WK8F 3ZMZA 1FEXA 4BE2A 3G73A 2X1CA 3MZYA 4MIMA 2H36X 2L3DA 2CRGA 2KHXA 2EM9A 4W97A 4KA4A 4CZZA 3HHHA 3KZZA 3PUFA 1R6RA 1FWZA 2GA1A 2JA2A 3F8NA 3TW7A 1H88C 1BI0A 4UY8I 4RH8A 3IWFA 1T4NA 3QYFA 1KU2A 1BB8A 1JGSA 2RNJA 2ECCA 4CYDA 5HLHA 4KMFA 4GYIA 1W5SA 4M3EA 5KL2A 2DYSH 1R5GA 3LFUA 4AM3A 4U0YA 2LTPA 2XGXA 3OIQA 2DA3A 5LRRA 4G12A 2WCC3 2W48A 2NABA 2IPQX 3H3UA 2MD5A 1MBJA 2A25A 3DKYA 3VHTB 4NDLA 2JMWA 3HOTA 1NCSA 1GUUA 2ZXWH 4ZC3A 5B1BH 2HDWA 3GBGA 3SEQA 2FNPA 3CLQA 2YPNA 3AKZA 2QQBA 1UMQA 4AU7A 1XGMA 2V9KA 2DFHA 4NQWA 2BXYA 3K70D 3M4OJ 4OIOF 4X64E 2UU9E 1B1BA 1OCPA 1XSVA 5E1XA 5GAGJ 3OS1A 2ZM6E 4EATA 4BEHA 5DCMA 1EA3A 4BQOA 3FXUA 2HKOA 3S1NJ 4D7MA 4M6YA 2HQAA 3JR9A 3LL7A 4ZZLA 5KAFC 1X6FA 4DV3E 3BG5A 2BYVE 1G3YA
chains in the Genus database with same CATH topology
2X4HA 5FFXA 2BBYA 2ISZA 3V8KA 2EV5A 5D8LB 1FBUA 2XAFA 2XAHA 4HX8A 4DNCA 3REOA 4IHSA 1B6AA 3RTRA 4B09A 2V6CA 1OR7A 2JSCA 5IT3A 3IKTA 2HQNA 5DV5A 3M8EA 4I98B 2HTSA 1J5YA 2LF8A 3FM5A 4LD5A 1ODDA 2COMA 4UNOA 2CFXA 1ULYA 3K1MA 5ICFA 3FMSA 2P5LC 2F5FA 5E8IA 4WX9A 4MTDA 1B9NA 4Q4ZF 2HYGD 3TO9A 4K2EA 1F4KA 3W6JB 3ZP5A 1QZYA 2K4JA 5EEGA 2F5EA 3GFIA 4HF2A 2DQRA 4UVAA 3M1EA 3FX3A 4MTEA 4ZYDA 4AIHA 3BP8A 3MZHA 5FO5A 2EA2A 3E6CC 2FU4A 2LKPA 1GXPA 1BC7C 1K78B 5CJ9A 2WV0A 3DV8A 4ON0A 3HTSB 1ZG3A 3P9IA 3HSFA 3K9TA 2ZBKA 2JRTA 4DQ2A 4UHTA 5A2QK 1YFHA 2PFBA 3CLOA 3ECOA 2MBFA 1O7LA 4AWXB 1V3FA 4AVPA 2PLYA 2XAQA 1T39A 2DPUA 3K1PA 4PGHA 2H94A 4Y13A 3D0SA 2L01A 2V1UA 3WTSC 2VXZA 1MD0A 1KGSA 4UV9A 3ECHA 2M8EA 4LK0F 3DP7A 4AIJA 2P7VB 2RDPA 3L9FA 1RUNA 4IF4A 1J75A 1XMKA 2XAGA 2DI3A 1D5VA 2PI0A 5HLIA 4ESFA 1NHAA 1IW7F 3F8MA 2HDCA 2M1BA 4O5VA 1KU9A 2FE3A 2Y48A 3F22A 3ZMTA 1FBQA 3EYIA 3HRSA 1GHCA 1IRFA 3EDPA 3BY6A 4IRHA 1TQPA 5H20A 1UHWA 3M9AA 3E6DA 1T98A 1E17A 2IP2A 1XSDA 1TW2A 2A5YB 3LWFA 1OPCA 3FZVA 5ILUA 4UV8A 5E20A 4G94A 2A69F 1QQIA 2V1DA 2VOOA 1IN6A 5DD4A 3BPXA 5DCMB 4UVCA 1R22A 5HS8A 3M7GA 1ZLJA 3TO7A 3VEPA 2CG4A 5BQTA 3U2RA 3QP5A 1U8RA 1ONVA 1IF1A 1IUYA 2WTEA 1R5HA 3K69A 2VE8A 4KUMA 3EUHA 1IN4A 2R7FA 4WF2A 3N4MA 4L9NA 1XGSA 1U5TC 4N0BA 1XB4A 4MEYF 5KVRA 1BOAA 2Y75A 3F8CA 1ZHFA 2DLLA 2FOKA 4YFXF 3WTYC 3F8BA 4EGZA 5BS6A 1KU3A 3WGGA 2LNBA 5HS9A 1FX7A 5JHUA 2QQ9A 1Z1DA 2ZJ2A 5L3FA 3E97A 5HLGA 4ZYHA 4H0EA 2NYXA 3IRRA 3U9GA 1HSJA 2K27A 1SD4A 4KIFA 3RDIA 4TV7A 2NRAC 5DYMA 3MAJA 2Q0OA 2HR3A 4WXHA 1T2KA 1MDMB 1P2FA 3KEOA 2IW5A 1D8JA 2EFPA 2D1VA 1ZLKA 1OYIA 2V9VA 4O3MA 2FRHA 1YW7A 3GZ5A 2D45A 2IJLA 1LNWA 2M5WA 3J80K 3E6MA 5DUKA 1OYYA 2IA2A 1O57A 2Z33A 2J5OA 2XRNA 1EH6A 1Z6RA 4HQEA 3RPQA 1KA8A 1BBYA 3LQRA 1O3RA 1MGTA 3C7JA 2HFHA 2QYOA 4HDVA 4NB5A 2QWWA 5ILSA 2E1NA 5E1WA 4ZH4F 1HW2A 3GZ6A 1TW3A 5J8FA 2CO5A 1TLHB 4ENNA 1KQ9A 2EK5A 3ISPA 5JFRA 2GWRA 4YIFA 2RKHA 1B9MA 3LA2A 4L5IA 1I6XA 1LEAA 1FSEA 1AOYA 2HWVA 4S04A 5D8KB 2LDUA 3V8LA 4D0PA 4EJWA 3WODF 4HF1A 4KFCA 1F5TA 2UZKA 2UXNA 4ENJA 2FMLA 4ENKA 3JAMK 2GIVA 3HUGA 4MHGA 3ZMSA 1MJAA 3E6BA 1EH8A 3WG9A 1REPC 5HVQC 4E70A 2IRFG 4CICA 1X3UA 4ZYGA 2WWYA 2ZXJA 2ESHA 3QU3A 4U88A 3JSPA 1A04A 3K0LA 3CUOA 4OMZA 1IXRC 1PDNC 1Z9CA 2ZMEA 2UXXA 3T8RA 3J7AO 2FNAA 3JW4A 1I1GA 4KDPA 2IT0A 1YYVA 1U2WA 1WKMA 4PZJA 5HOOA 2MLKA 4AD9A 3MQ0A 1Q1HA 2A61A 1FPQA 1UFMA 2ZFWA 1USTA 3NEUA 4YFNF 3CTAA 4N9IA 2KKOA 2R3SA 2H6BA 2ELHA 5HDGA 5K5QA 2K7LA 1QGPA 3VOEA 4JK1X 3WGHA 1HSTA 3RKXA 2DBBA 1ZRFA 1RIOH 4ZYEA 1F1ZA 1U3EM 1TTYA 3T8TA 1OMIA 1YIOA 2VBWA 2ACJA 4WXCA 3GWZA 3CJNA 1SFXA 2FF4A 3V7RA 4G7HF 4RS8A 5DUIA 1O3QA 3LSTA 3JTGA 1FBSA 1I1SA 2P5VA 1J59A 2OAZA 4ENMA 4WXDA 3F21A 3CO7C 1H9TA 1TQMA 3H3ZA 4BXUA 1J7KA 2Q8KA 2IA1A 3V8JA 1IRGA 4HLYA 2Y0MA 2DTRA 5K5OA 1HXDA 4LJZF 1CGPA 5DCFA 3GUDA 4P96A 3D5LA 1C0WA 3H92A 3CDHA 2FBKA 2L54A 5LEJA 1LDDA 5HS7A 4BHCA 1U5TB 4N9HA 1FC3A 2A07F 4HDUA 4BYYA 3QOPA 1BN5A 2XKOA 1G3TA 4F7ZA 2CWEA 3KP3A 4HOBA 2XAJA 3B73A 3E5QA 3VB2A 1BI3A 1W7PD 2VE9A 2CYYA 5KK1A 1XDSA 2UWMA 5F6FA 1FP1D 1TBXA 1Z05A 1S29A 2BV6A 2O61A 1WRJA 2MH9A 3GYHX 1ZH5A 5IT9K 3HTUA 2PEXA 2VN2A 4XLPF 3GO5A 3BJOA 5CVRA 2AS5F 5HDKA 5BOXA 3W6KB 5L3BA 3I64A 4KT5C 4IJAA 4QWQA 4EGYA 3C3WA 1R58A 2PMUA 5TRDA 1I27A 4HZFA 4HAMA 2VC0A 2G9WA 3ZN1A 1OYWA 3IC7A 4RB3C 2PJPA 2ZMEB 2G7UA 4IVNA 1HKSA 3SZTA 3KEQA 1O3TA 4PGGA 1FNNA 4OIQF 3O6BB 4KICA 3V7SA 4EM1A 1CF7B 4EVIA 3COAC 5D6FA 3Q5FA 4U7DA 5ICCA 2DT5A 1AWCA 4G7OF 3I59A 4A6EA 2BEOA 1SMYF 3G3ZA 2DQLA 2RV8A 1F9NA 1DDNA 5FLXK 1UHMA 2FEZA 2RGVA 5L3GA 1HW5A 2YPRA 3JSOA 1IN7A 1G6NA 3QAHA 3TQNA 2EFWA 1UB9A 4LK1F 4M9XA 5FD5A 4MQVA 1EH7A 2ZNYA 2VC1A 4KIGA 1ON1A 3O3KA 2VODA 1U78A 1IXSB 2ZNZA 4L9JA 5ICEA 1JXSA 2F2EA 3CO6C 4R79A 1HBXG 4EJTA 1W5TA 4RB2C 3BPVA 1BJAA 4CGZA 4IPAA 1W7PA 4G6QA 2FMYA 4R8HA 1FYKA 3WTVC 4IXAA 4I09A 1WI9A 3SFZA 5D6EA 2XKPA 2G7HA 3F23A 2CW0F 5HDNA 3WTZA 2DK8A 5ERIA 2EJRA 2L4AA 4EV0A 3P9KA 5D5VB 5J8CA 2QQAA 1O7FA 4AIKA 1YO5C 4KMUX 3R6SA 2EFOA 4HBLA 3MEXA 3KLNA 1FP2A 3VFZA 4YIIA 3NQOA 4UVBA 2ZKZA 4PCQA 2W24A 4EMSA 3IL2A 3MCZA 5D5WB 4M6XA 4ZZDA 2XHKA 4A0XA 3JAMZ 3FHZA 3KP6A 4XRFA 3AAFA 4A12A 4P9FA 1YS7A 2PMHA 1YW8A 1YQAA 2E1CA 2ZCWA 2HKXA 5AIQA 5E1ZB 2WC2A 2EV0A 5CVJA 4NHJA 3QU6A 5D5XB 2EFNA 2MC3A 1ZN2A 3LQQA 4HV5A 1HQCA 4HYEA 1SFEA 4MGRA 4CXFA 1WWXA 2H09A 1ZGJA 3DKWA 5LHGA 3PQJA 5JR3A 3HOSA 2FA5A 1GXQA 3R60A 5BPIA 2DK5A 3U1DA 3R0JA 4M73A 2PQ8A 4PDKA 4LGWA 3HRMA 1YG2A 1BC8C 3ZMVA 3GF2A 3E5UA 2B0LA 4CO8A 1SD5A 3WE2A 1QBJA 1SD6A 2VONA 1TNSA 1FY7A 2EFQA 2QZ8A 4M74A 1QNTA 4A5NA 4O6JA 4BHPA 5BPDA 3ZN0A 2DU9A 1O3SA 2KIUA 3J81K 4I01A 4LLLA 3I59B 5H6RA 2XV4S 2KJCA 3DEUA 1MJBA 3JTHA 1R36A 1DPUA 3OOPA 1J9IA 2EB7A 3T5XA 2D2WA 2QVOA 2YU3A 4HLXA 5J6XA 4LMYA 2OZ6A 5LEKA 1QPMA 4L9TA 1KYWA 3NRVA 3WGIA 3I71A 1ZYRF 5LGNA 3VODA 2E7XA 1D8KA 3ULQB 3R4KA 1B4AA 1T0FA 3DXJF 1IAWA 3R0AA 4M9SA 2STWA 4I2OA 4JQFA 3V7CA 2V1XA 1SD7A 5ILVA 3HSRA 3RPUA 1WQ2A 1BIBA 2YX4A 2QM3A 3KP4A 4RAYA 1R1VA 2MLGA 2IA0A 1XCVA 1W7PB 4S05A 3FM3A 1ZGAA 2HQRA 4Y15A 4LB6B 1PP8F 1RUOA 2L4MA 4KYWA 4A2UA 4RB0A 4HX7A 2F5DA 3DPTA 3O2PE 2IVMA 3HRUA 1IZ1A 3QP6A 5E18F 2NS0A 3TGNA 1ZG1A 2P4WA 3Q9VA 4KNYA 2MH2A 2JPCA 4OINF 5D5UB 2Z99A 4YFKF 4LB5A 2W85A 2NNYA 3LAJA 5FFZA 3WE3A 4Y17A 3KZYA 2VT3A 4G9YA 4GCVA 1H0MA 4HW0A 2HOEA 5FGMA 4ASNA 4L18B 1XN7A 1RNLA 2VT2A 2KIMA 4HQMA 1PP7U 1S8NA 4MEXF 3HHGA 5IT9Z 2DPDA 3TO6A 2E7WA 5DD8A 2DAOA 2VBZA 4UXNA 4G8XA 3BOQA 4L5JA 4IHTA 3KFWX 5LRSA 3BJAA 3ROUA 5H6QA 3DFGA 4L0ZB 3ZQ7A 3TDUC 1L3LA 4OMYA 2BE5F 1FYLA 2QBYA 2DW4A 1XSXA 4EQQA 2DO7A 1FT9A 4ESJA 2XIGA 1USSA 4EM0B 4EJOA 1QO0D 1R23A 5FB2A 2CSOA 1Y0UA 2A68F 5E17F 5DDGA 1E2XA 3V4GA 1KU7A 5LGUA 1HW1A 1HKTA 4RB1A 3EYYA 5A2QZ 1P92A 1FSHA 3OV8A 3FF5A 2FQ3A 2H6CA 5AONA 2GXGA 1STZA 4RAZA 3FMRA 3WTUC 4OOIA 2HS5A 2VBXA 1XCBA 1PUEE 3P9CA 2Z3YA 3F3XA 4A0ZA 3EQLF 4Q47A 3GVAA 4OIRF 1KQ8A 2STTA 1ZRCA 4RGSA 1G4DA 3GFJA 2X0LA 3BROA 5FLXZ 3C18A 3LA3A 5L3DA 3KP5A 3WTXC 2M45A 3HSEA 3KCCA 4FX0A 4KN7X 2W84A 5D4RA 1TNTA 1MDMA 4P5OA 4A0YA 5JI6A 1U6GA 4LFUA 2HYFA 1YW9A 3I58A 1KYZA 3CUQC 1OKRA 4GO1A 5LHIA 3GXOA 2O8XA 4P55A 3WTWC 3P7NA 6PAXA 1S6LA 2GXBA 4BQAA 1ZAOA 4MQ9F 4OU0A 3L2CA 4I0BA 2XVCA 4WWCA 1K6OA 1MKMA 3ELKA 3N97A 1S7AA 5ED4A 4BH9A 1LDKB 1R1TA 5TJJA 2M87A 5AIPA 1JE8A 2YX7A 4IRIA 4FHTA 3HIFA 4MNUA 1MJ9A 3S2WA 4RGXA 4CDGA 2ETHA 4IRGA 3SZPA 1LQ1A 1J0RA 2W25A 2F5CA 1V4RA 3GW2A 1I5ZA 3MFKA 2HGCA 3L00A 3RJPA 4Q48A 2QLZA 3TOAA 4GGGA 4LLNA 3GX4X 3I53A 3PQKA 3I5UA 5FD6A 3ML6A 2ADUA 4Q5SF 1VTNC 2YSRA 3T1BA 2EWNA 4XSZF 2J5PA 3CUQA 4UUVA 2CQKA 1Z91A 3HYIA 1R1UA 5E8GA 3I0TA 2QENA 2RVCA 4FT8A 2ZO4A 4U7BA 1GVJA 2P7CB 4KIBA 2AXLA 3WU1B 3GLXA 1W4MA 2O6GE 2OQRA 2RQPA 1MZBA 4L0YB 3KE2A 4A6DA 3BZ6A 1XDUA 1DP7P 2OZUA 4EJVA 2Q2EA 3J80Z 3FXQA 2RC4A 3IHUA 1BIAA 3IWZA 1B59A 3E3VA 3IKVA 4WCGA 3RIRA 3RKWA 2KIFA 3LAPA 5LLQA 2QBYB 1P4WA 5L3EA 4HV6A 5JVTA 1SAXA 4LG0A 1YTYA 5CLSA 2VOPA 2A3SA 3WU0A 5CVVA 5ICGA 5BMZA 5LBQA 4M9ZA 3KLOA 1YS6A 2Z9OA 5L3CA 2DFIA 1LDJA 3DQVC 1FZPB 4KN4X 1XGOA 3RYRA 3QPTA 4P9UA 1JHFA 4RGUA 2PN6A 3GEZA 2O0YA 3KP7A 1XMAA 2PG4A 2TDXA 3T0YA 2QUFA 3J81Z 5K5RA 5LGTA 2HEOA 1R7JA 3TOBA 3K1NA 5K1YA 4ETSA 2K4BA 2P6TA 4XLNF 2M30A 3LA7A 3ERED 3QRFF 2FSWA 2OQGA 1LEBA 2LSOA 2OD5A 4M72A 3KP2A 1H9GA 3F6OA 4R1HA 4FX4A 1ZG5A 4A5MA 2PBIA 4I7HA 1HKQA 2W57A 1JHHA 2LF7A 3L09A 4U0VA 1QZZA 1P6RA 1EV7A 5F1RA 1P4XA 1IN8A 3QPHA 2GZWA 1DPRA 3L7WA 3RYPA 2O3FA 4GXOA 1XD7A 2EA4A 4QLCU 1FLIA 2ESNA 3SXYA 1LB2A 1T6SA 4EM2A 2P6SA 5CVUA 4YG2F 2K86A 1RI7A 1SFUA 3ABUA 3MWMA 3M8FA 1U5TA 1SMTA 4HX4A 3GFMA 2P8TA 2JT1A 1ZREA 5DEQA 2XROA 1KQ0A 2OA4A 1J2XA 2L02A 2KJBA 1S3JA 2HZTA 1DUXC 3TDZC 4BAYA 2MA3A 2EV6A 4G6DA 4U0WA 4HA8A 2RN7A 5F64A 2JZYA 1ZARA 2VBYA 1D3YA 1S7OA 1K7AA 2C6YA 2NNNA 1UCRA 2NAZA 3HRTA 3ZMUA 3SQNA 1BI1A 2R7DA 5D4SA 3CUQB 4EJUA 1IXCA 2OU2A 2BGCA 2P5KA 4LLGF 1FYMA 4M71A 1LVAA 3BDDA 5LHHA 4G7ZF 2O03A 3Q9SA 4GYGA 3GFLA 3E5XA 2CGPA 1IN5A 3ABTA 5EEHA 1ON2A 4JBAA 3KETA 4HF0A 2GA2A 1K78A 2D1HA 1Z6TA 3RI4A 4OIPF 1T38A 2K02A 3B02A 2FXAA 1ZRDA 3C1DA 4BNCA 2HTJA 1K79A 2XASA 3ZMDA 4XBFA 1BM9A 3R61A 2OBPA 4I0AA 3PFIA 3F72A 4BHBA 1RZ4A 1TQIA 3RKYA 1CF7A 2JPBA 3BJ6A 4LG0B 2KRFA 1BI2A 1G3SA 3TKYA 1G3WA 4XSXF 5CYVA 1YLFA 2V79A 5CVIA 4RGRA 4Z2YA 3DPLC 1Z7UA 1XGNA 3FXRA 1WSUA 3I54A 2GQQA 3K2ZA 3DF8A 3ZPLA 1L0OC 2JTVA 2GAUA 3WTTC 2H27A 4B8XA 2FBIA 4CHUA 1R00A 2FBHA 2ISYA 2A6EF 2A6HF 4L9VA 1FOKA 3EETA 2YR2A 3I4PA 4I02A 3LFKA 4ESBA 1P4AA 1LJ9A 2XUBA 3F8FA 3F6VA 3FMQA 3BWGA 3SHFA 2Z5UA 3IRQA 3FWEA