1MGTA

Crystal structure of o6-methylguanine-dna methyltransferase from hyperthermophilic archaeon pyrococcus kodakaraensis strain kod1
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
169
structure length
169
Chain Sequence
MLSVEKFRVGERVVWIGVIFSGRVQGIAFAFDRGTLMKRIHDLAEHLGKRGVSISLDVQPSDYPEKVFKVLIGELDNASFLRELSFEGVTPFEKKVYEWLTKNVKRGSVITYGDLAKALNTSPRAVGGAMKRNPYPIVVPCHRVVAHDGIGYYSSGIEEKKFLLEIEGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hyperthermostable protein structure maintained by intra and inter-helix ion-pairs in archaeal O6-methylguanine-DNA methyltransferase.
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Transferase
molecule keywords PROTEIN (O6-METHYLGUANINE-DNA METHYLTRANSFERASE)
total genus 57
structure length 169
sequence length 169
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 1999-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF09153 DUF1938 Domain of unknown function (DUF1938)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mgtA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1mgtA01
3DEUA 4GO1A 2V1UA 1RZ4A 3M1EA 3H92A 1LB2A 2HFHA 2A6EF 1S7AA 3I53A 2CFXA 4NHJA 4Q47A 4ENMA 1U2WA 4O6JA 4R8HA 1KQ0A 2QYOA 1BBYA 3M9AA 1TW3A 3CUQA 1W5SA 2KIMA 4RAYA 1PP8F 2W57A 2E1NA 2LNBA 4ESFA 2Q8KA 2MH9A 2IA1A 2Y75A 4U7BA 2M45A 2CSOA 2VOPA 4WF2A 3WTXC 2L4MA 1HW2A 3ABUA 2L3DA 3DKWA 4NQWA 2IJLA 3GXOA 4ZH4F 4RGXA 1B9MA 4LG0A 3JW4A 1HW5A 2PMHA 4M9XA 1QBJA 3RKYA 1YW8A 3WU1B 1HQCA 2RDPA 4Y17A 5IT9K 2LSOA 5CVVA 3DQVC 3TOAA 4IVNA 3MQ0A 4OMZA 2K27A 2P6TA 4WCGA 4GYIA 4LMYA 2O0YA 2YR2A 1BI3A 1KYZA 4N0BA 4LG0B 5A2QK 3W6KB 2KKOA 1IXCA 2GXBA 5H20A 3KCCA 3R0JA 4G7OF 2DO7A 4A12A 2O3FA 5AIQA 3FWEA 2RNJA 2X0LA 1UCRA 2XKPA 4Y15A 1FLIA 4PCQA 1WWXA 1TBXA 3GFLA 4IHTA 1R1TA 5DCFA 1IN8A 2IP2A 5EEGA 2GZWA 1T39A 1FYKA 2CQKA 2KRFA 2ELHA 2Z99A 2WC2A 3FXUA 5J8FA 1W7PD 1ZGAA 4IRGA 3U1DA 4M9ZA 3F21A 1TNSA 1HBXG 2O6GE 4KICA 1Y0UA 4IXAA 1G4DA 2RGVA 3KP6A 5ED4A 1LEBA 5FD6A 3HRUA 1BIBA 3ML6A 2VBYA 5HDGA 2VT2A 3GYHX 4U0WA 4U88A 1JE8A 1KU3A 5L3CA 3F6OA 1IN4A 1TQMA 2WWYA 2XRNA 2DFIA 2FEZA 2VOOA 3IHUA 3HTUA 2V1XA 2ZMEB 1K78A 3EQLF 2K02A 3T1BA 1ZARA 2QUFA 4OINF 3DP7A 1SD6A 3R0AA 2PLYA 3GZ6A 1X3UA 2CG4A 3QP6A 3KZZA 3TDZC 3MWMA 3B02A 1TQPA 2WV0A 2VODA 1S6LA 1Z9CA 4EJTA 4KYWA 1A04A 3CJNA 2R7DA 2TDXA 1J9IA 1JHFA 1R58A 4ESJA 3I64A 4K2EA 1MJAA 4KMUX 3ELKA 3BJOA 1BI2A 4JK1X 2D1HA 2EK5A 2FMYA 3F22A 1BC8C 4S05A 2EFOA 3WGGA 5LGNA 4MEYF 4UUVA 4RGRA 4BAYA 5ICCA 4HLXA 1R36A 1I1SA 4IF4A 1DP7P 3I0TA 2FMLA 5LGUA 4HQEA 1GXQA 5ERIA 2A6HF 2ACJA 1IN5A 2P4WA 1T2KA 3L9FA 5L3FA 1AWCA 4KIGA 4KNYA 1JXSA 5HLHA 1USTA 3DPTA 3C1DA 2HEOA 3K0LA 3VFZA 3TO6A 2P8TA 3IWFA 3KE2A 2HKXA 1PDNC 2XASA 3KLNA 3LAJA 1Z1DA 1FYMA 2JTVA 5LHIA 3RJPA 5LHHA 2O8XA 1KGSA 4L9TA 3V7SA 1XGSA 2MH2A 1AOYA 2ADUA 1YYVA 5H6QA 2QQ9A 1VTNC 4A6DA 1ZN2A 2COMA 3ECHA 1S29A 3K1MA 2VN2A 2P5VA 3HSEA 3HHHA 4YFXF 4CYDA 2EFWA 2EV0A 2RVCA 4HDVA 2BEOA 4PDKA 1RUNA 5LEKA 1SMYF 4Q48A 3BJ6A 4KN7X 1R7JA 1RNLA 3J80Z 3OOPA 5E18F 3W6JB 3SZTA 5ICGA 1SD5A 4NB5A 1YLFA 2FBHA 3F8BA 1T98A 1F9NA 2H6BA 3IL2A 1XCBA 2GQQA 1F1ZA 4OIOF 2FQ3A 1FY7A 2BBYA 4YIFA 1RIOH 1JHHA 2XAHA 3FZVA 3M8EA 3E5QA 3VODA 2L54A 1O3RA 2DU9A 3RTRA 1GVJA 1XDSA 4MNUA 3F8FA 3J81Z 1ZLJA 4G9YA 3R6SA 3IC7A 5ICEA 2FBKA 4G94A 4R79A 3RIRA 2P7VB 2QM3A 4TV7A 1ZGJA 1UFMA 2STTA 2DI3A 3BROA 1YFHA 5K5QA 2GAUA 3DPLC 3HIFA 3RKXA 3DFGA 1O7FA 4H0EA 4P55A 1XSDA 2CGPA 1OPCA 4I7HA 2AXLA 3T8TA 1LDKB 5HDNA 1FBUA 2QBYA 2HTJA 3T8RA 2F5EA 2IT0A 4BNCA 1Z91A 2XGXA 3VB2A 2NRAC 2GWRA 4LLNA 4DNCA 3B73A 3LA7A 1F4KA 3G3ZA 4L18B 2E1CA 1Z7UA 2V1DA 3WGHA 4ZYGA 4RB3C 4AWXB 2ETHA 4RB0A 4L0ZB 3CTAA 3ZN1A 3IKTA 3LA2A 2FRHA 3WE2A 1J7KA 2P5KA 3C3WA 4EGZA 3IRRA 5A2QZ 4HQMA 1MKMA 2XHKA 3E5UA 5DD8A 1W7PB 4MEXF 2JT1A 5CJ9A 3BPXA 4HBLA 4M6XA 1YQAA 4EM0B 1E17A 5LBQA 3SXYA 1G6NA 1KA8A 2DQRA 1R00A 4XBFA 3T5XA 2CWEA 3RKWA 4LB6B 2ZKZA 1G3WA 4BHPA 2PFBA 3HOTA 3F23A 3V8LA 3F8CA 5E8GA 1OMIA 2D2WA 1SAXA 5DD4A 4P5OA 1ZG3A 4KIBA 2DT5A 4S04A 3QPHA 3V4GA 1XMKA 2QVOA 5JHUA 2CYYA 2A69F 1PUEE 4EVIA 5E1XA 1O3QA 3ZMVA 2MC3A 1KU7A 4M71A 2CO5A 3ZP5A 2HTSA 1U8RA 4AD9A 3WTSC 1E2XA 4FX0A 1LQ1A 1G3SA 4LK1F 4AVPA 5FFZA 4ENKA 5JFRA 2GA1A 3WU0A 2H94A 5JR3A 3WODF 1IRGA 2R7FA 4HV6A 3ABTA 4JQFA 5DUKA 1SFEA 2D45A 2FBIA 2OAZA 2JSCA 3LAPA 1D8KA 2M5WA 2E7WA 4M9SA 2UXNA 2K4JA 3FXQA 2ISYA 3Q5FA 3LA3A 5E8IA 5D5UB 1LEAA 2Z3YA 3E3VA 1SMTA 3DF8A 5LRRA 1P4WA 4HAMA 3TOBA 4Z2YA 5HLIA 1ULYA 2HDCA 3BZ6A 5E1WA 3GO5A 4U0VA 1W7PA 3KP4A 4KN4X 1FP2A 3WTUC 5DUIA 4ENNA 2OA4A 1UB9A 3R61A 1STZA 3E6BA 4G7ZF 4WXCA 3ECOA 1IN6A 3ROUA 2MD5A 4ZZDA 4CDGA 3HTSB 2G7HA 4IRHA 3EETA 1P6RA 1OYIA 4PGGA 1TNTA 2XIGA 5CYVA 2FE3A 2RKHA 3CO7C 3T0YA 1QZZA 2VC0A 2V79A 1S8NA 4P9FA 2HZTA 2YU3A 2UZKA 2M1BA 3J81K 3P9CA 2UWMA 2DPDA 2STWA 1V4RA 4LK0F 5D4RA 3M7GA 2XUBA 4CXFA 2BE5F 1W5TA 1CGPA 2IA2A 5LGTA 4RAZA 1ON2A 2KIUA 1R5GA 2VONA 3GX4X 5HS8A 3TDUC 3J80K 2JPBA 4HV5A 3BP8A 2VBZA 1EH7A 4GXOA 2M30A 5DDGA 4MQVA 3F8NA 1CF7B 1JGSA 4RGUA 1S3JA 1U5TB 1OYWA 1W4MA 4XRFA 1ODDA 3E6CC 4PZJA 4IRIA 3NQOA 5DV5A 4AIJA 3NEUA 4L5JA 2XAGA 5BS6A 1RI7A 4BXUA 3I58A 3IWZA 5FLXZ 2KIFA 4OU0A 1FPQA 4UV8A 3ZN0A 4JBAA 2GA2A 2BYVE 4Y13A 4U7DA 4MTEA 5K5RA 4HYEA 5HOOA 2DPUA 2EV6A 2PG4A 5K1YA 2OBPA 2A68F 1SFUA 2K86A 3GWZA 3ZMZA 4OIQF 4BYYA 3VEPA 3C18A 4MHGA 2C6YA 3SQNA 3KETA 3V7RA 1U78A 2RQPA 3CDHA 3Q9VA 1J0RA 3OV8A 1B59A 2J5PA 4OMYA 2ZCWA 3F3XA 1XMAA 1I5ZA 2O61A 1IAWA 5BMZA 3O6BB 1O57A 4IHSA 3AAFA 4BHBA 3JSPA 1XD7A 3L2CA 1FX7A 3FF5A 1OKRA 2YX4A 2AS5F 1U5TA 3KLOA 4M74A 4KUMA 3SHFA 1YS7A 3WTYC 2VXZA 1HKSA 1Z6TA 2XV4S 1WRJA 1FBQA 1D8JA 4CZZA 2A5YB 2HS5A 1SD7A 5L3DA 5EEHA 3IRQA 1UHWA 1IXSB 1HSTA 4L5IA 4UVAA 4ZYHA 4HX4A 3DV8A 1BJAA 2QQBA 2LDUA 3L09A 3BPVA 5D6EA 2DTRA 3FX3A 4KMFA 1J75A 3HYIA 1ZAOA 3RDIA 1FC3A 4HDUA 4G7HF 3JSOA 2X4HA 1HXDA 3I59B 2GXGA 3K1PA 1IN7A 2OZ6A 3P7NA 1ZH5A 1IF1A 3F6VA 2FA5A 4BQAA 2HWVA 1L3LA 3S2WA 4UXNA 3TGNA 1ZG5A 3JTHA 3I4PA 4HA8A 1R5HA 3F8MA 1T6SA 2BGCA 4EM1A 3BJAA 1BIAA 4ETSA 1IXRC 2FOKA 3COAC 5F1RA 4LFUA 2LF8A 4FX4A 3HRTA 4E70A 1TTYA 2VE9A 3FMRA 4I0BA 1DDNA 3JAMK 4KT5C 4GYGA 2PMUA 2HKOA 1WKMA 3CUQB 1QNTA 2QLZA 2FSWA 3RPQA 2EB7A 2P7CB 1HW1A 5L3EA 2YPRA 4P96A 1P92A 2W24A 3I5UA 1WSUA 2KJBA 4RB2C 4EJOA 1KU2A 1L0OC 2WTEA 2Y0MA 4EJUA 4LGWA 2DBBA 3ZQ7A 1LDDA 2ZJ2A 3ERED 1TW2A 2PEXA 1ZG1A 3RI4A 2DLLA 3L7WA 1Z6RA 2VBXA 1GXPA 1FYLA 3REOA 1QO0D 4M6YA 3GFMA 3LSTA 4FT8A 4O5VA 2EA4A 4ZYDA 3BOQA 3D0SA 4PGHA 5BQTA 1IUYA 2ZFWA 3TO7A 5CLSA 2HYFA 3H3UA 4EJWA 3CO6C 5DEQA 4I98B 3LQRA 1KQ8A 4EGYA 2FNAA 2DW4A 1T0FA 1R23A 1K6OA 3CUQC 1B9NA 4I02A 3IKVA 1FT9A 5FFXA 2Z33A 1NHAA 4F7ZA 2DQLA 1EV7A 4KIFA 3WGIA 1FSEA 2V9VA 2LKPA 4Q4ZF 4ZYEA 1QPMA 4HW0A 2IA0A 3EYIA 4FHTA 5IT3A 2LF7A 1XSVA 2DK5A 3GUDA 1KYWA 2H27A 2VT3A 1KQ9A 5L3BA 4L9JA 2Z9OA 3JAMZ 1Q1HA 5ILVA 1FZPB 1XGOA 5D8KB 2VE8A 4O3MA 2DK8A 5BPDA 1BM9A 4WXHA 3GFJA 2ESNA 4KFCA 3GEZA 5FO5A 2IPQX 2K4BA 2PN6A 1YTYA 3M8FA 4LLLA 2F5FA 2JRTA 3L00A 3GZ5A 5TRDA 2YSRA 1XDUA 2Y48A 2HOEA 2FXAA 3WTWC 4RS8A 4D0PA 4XSZF 3ZMUA 1V3FA 1B1BA 1WQ2A 1R1UA 1YW7A 3SFZA 2QWWA 2W84A 2QQAA 5LHGA 4KA4A 2G9WA 1G3YA 1U6GA 1XSXA 3ZMDA 4GGGA 2VBWA 3WG9A 2GIVA 5E1ZB 4G8XA 3HSRA 4AIHA 3WTVC 4A5NA 2KJCA 2PJPA 3TO9A 4EQQA 5D5XB 1I6XA 4I09A 4WK8F 3BDDA 3JTGA 1O3SA 3GF2A 4CICA 2L4AA 1MJ9A 3MZYA 2ISZA 5J6XA 1T38A 2DAOA 3ZMTA 1YG2A 2PI0A 2OQGA 1DPRA 4HX8A 3I71A 3VOEA 1XGMA 5DCMB 1MD0A 1RUOA 3KEQA 1FOKA 2FU4A 2H09A 2JZYA 3TKYA 3MFKA 1FP1D 1J5YA 3E6MA 1ZRFA 1HSJA 2OQRA 4WXDA 1IW7F 2HR3A 2EFNA 3H3ZA 1FNNA 4N9HA 2XAQA 1BOAA 4OOIA 3V8JA 4A2UA 1D5VA 1I1GA 3NRVA 3E5XA 1PP7U 4ENJA 3I54A 1U3EM 5D6FA 3J7AO 3N4MA 2IVMA 3HRMA 3Q9SA 1KU9A 2JPCA 4MQ9F 3QOPA 3KZYA 5HDKA 5CVJA 2H6CA 3GW2A 3TQNA 1QQIA 1YIOA 4UHTA 3K9TA 3EUHA 2NNYA 4N9IA 4ZZLA 4R1HA 2B0LA 5AONA 4HLYA 2FF4A 2VC1A 4HX7A 2RN7A 3HHGA 1REPC 2HYGD 1BC7C 3G73A 3FHZA 4YG2F 1XCVA 1IRFA 1P4AA 1SD4A 2P6SA 4GCVA 2XVCA 2M8EA 4L9NA 2F5CA 4UVBA 1XGNA 5HS9A 5FD5A 4CHUA 2V6CA 2IRFG 4HZFA 4IPAA 2RC4A 5JI6A 4EM2A 3RYRA 1ZYRF 5F64A 1EH6A 1YO5C 4OIPF 1MDMA 1ZREA 3BWGA 2G7UA 3RPUA 2ZO4A 4DQ2A 3KP2A 1ZRDA 3N97A 5LEJA 2ZNYA 3U2RA 4UVCA 4P9UA 1H9TA 2IW5A 2RV8A 5HVQC 1BI1A 5BPIA 3U9GA 3ZPLA 1K79A 3ZMSA 1MGTA 5HLGA 1HKQA 2ZBKA 5ICFA 4M72A 4I2OA 1OYYA 3QRFF 4XSXF 1S7OA 4RB1A 1FWZA 3R60A 5FLXK 1C0WA 4A5MA 3SZPA 1MJBA 1ZLKA 4EV0A 2OZUA 3O3KA 4HF2A 2ZXJA 2XAFA 5CVRA 3FM5A 1I27A 3RYPA 1K78B 1LDJA 2EA2A 5LLQA 1USSA 1G3TA 2QBYB 3P9KA 2QENA 3I59A 3PQKA 2CW0F 5ILSA 1WI9A 3HUGA 3K1NA 4LLGF 1ZRCA 3ULQB 2PBIA 3GVAA 2K7LA 1FBSA 4BHCA 1B4AA 3BY6A 3GFIA 3F72A 2EFQA 1R22A 2A61A 3LWFA 3FXRA 5D4SA 2Q2EA 2D1VA 3MEXA 2Q0OA 3KP3A 2XKOA 1OR7A 2QZ8A 4B09A 1H0MA 1EH8A 1GHCA 1ONVA 4UV9A 4HOBA 1H9GA 4CGZA 3PFIA 3QPTA 2NS0A 5D5VB 3EDPA 4XLPF 4A0ZA 2ESHA 4HF0A 3MCZA 4I01A 4BH9A 3HSFA 1IZ1A 2YX7A 5J8CA 5AIPA 2F2EA 3QAHA 2M87A 1DPUA 2BV6A 5LRSA 5CVUA 1LVAA 1K7AA 1CF7A 1LNWA 4AIKA 2PQ8A 2Z5UA 2HQRA 1SFXA 4L9VA 1R1VA 2ZNZA 4MGRA 1MDMB 4CO8A 4MTDA 4YFNF 1XB4A 4ASNA 3HRSA 3EYYA 3V7CA 2O03A 5E20A 5ILUA 1YS6A 5DCMA 1QZYA 4RGSA 4WX9A 1D3YA 4UNOA 5CVIA 4U0YA 4G6DA 4A0YA 1F5TA 3LFKA 4IJAA 1BI0A 5FB2A 1LJ9A 4EJVA 1BN5A 3P9IA 2HQNA 4QLCU 1Z05A 4KDPA 5F6FA 3R4KA 1U5TC 6PAXA 2F5DA 3HOSA 4ESBA 4EMSA 1P2FA 3MAJA 5DYMA 2NAZA 2R3SA 3O2PE 4LB5A 1XN7A 5D5WB 3KP7A 4OIRF 3WTTC 2NNNA 3KEOA 2MLGA 1ON1A 2HGCA 4YIIA 1P4XA 2ZMEA 2OU2A 2A07F 4L0YB 1TQIA 4A0XA 2EFPA 1FSHA 1ZHFA 4XLNF 5JVTA 1UHMA 2MA3A 3CLOA 3PQJA 4HF1A 3WTZA 5H6RA 1J2XA 5D8LB 1DUXC 2OD5A 2MBFA 3QP5A 4ON0A 3QU6A 1TLHB 4LJZF 3FMSA 2XAJA 4G6QA 1O3TA 2W25A 2FNPA 5KK1A 5BOXA 1MZBA 2L02A 4YFKF 3QU3A 3FM3A 1HKTA 3CUOA 3MZHA 2UXXA 2J5OA 3D5LA 1O7LA 2A3SA 2NYXA 3GLXA 2W85A 5E17F 2XROA 5FGMA 1B6AA 3ISPA 2P5LC 2EJRA 5IT9Z 3DXJF 3E6DA 4M73A 2MLKA 5TJJA 2E7XA 3KFWX 3V8KA 5KVRA 4I0AA 5K5OA 1QGPA 3LQQA 1J59A 5HS7A 4WWCA 3E97A 3K2ZA 4A6EA 3KP5A 4B8XA 1YW9A 4LD5A 4QWQA 5L3GA 3FMQA 2L01A 4Q5SF 2EV5A 2EWNA 3WE3A 3K69A 3C7JA
chains in the Genus database with same CATH superfamily
3DEUA 3PO3J 2GM4A 4GO1A 1LE8B 2V1UA 1RZ4A 4LU9A 4DMIA 3HGGA 3M1EA 3H92A 1LB2A 5FRNA 2E35A 2L3JA 1HR0E 2KLOA 1MBJA 1QRYA 4XIDA 4NC7A 1DGWY 3RCOA 2JP9A 2HFHA 1ITYA 2A6EF 2CQXA 1S7AA 3I53A 2EPMX 5A6KA 2HPMA 4KITB 3LSMA 2KDZA 2CFXA 2Y69H 5B1AH 4NHJA 3JRDA 4Q47A 3K4BA 2W4SA 2DIXA 4ENMA 1U2WA 1D1AA 3EUHC 3CF2A 4O6JA 4R8HA 2AQEA 1KQ0A 3U1KA 4BQQA 3H9QA 2QYOA 1LKXA 1BBYA 3M9AA 5C3EJ 1TW3A 5GPAA 1AU7A 3CUQA 4ITVA 4IHWA 1W5SA 5J1YA 3S32A 1GLNA 4AIDA 2HI3A 1IO2A 5M5WJ 4HSRA 3HPGA 4C2MJ 1MMGA 3HXLA 2KIMA 4RAYA 2COBA 2JA5J 1PP8F 2EN3A 2W57A 3VYRB 3AUZA 4J19A 2TRTA 3TL4X 2E1NA 4FISA 1T4LB 2L6MA 3HOWJ 2LNBA 4CCLA 2EPZA 2YSOA 4ESFA 2EMCA 2Q8KA 5LMNE 2MH9A 2IA1A 2UUZA 2Y75A 4U7BA 2M45A 1SC7A 2KHXA 1HDDC 2CSOA 2VOPA 4WF2A 3WTXC 1GV5A 2L4MA 1HW2A 3ABUA 2L3DA 3DKWA 5B5EC 4NQWA 1MSEC 2NOJB 5IT9C 2IJLA 3GXOA 4ZH4F 3DTEA 1B9MA 2K9QA 4RGXA 4LG0A 1IG7A 4ZYAA 3JW4A 1HW5A 1OFCX 4V19K 4Q35B 2PMHA 4M9XA 4F9BB 1QBJA 2RNGA 4F9AB 2LKXA 3RKYA 1YJNI 5AASA 1YW8A 2NUGA 1A36A 3WU1B 1X1PA 3W3CA 1HQCA 4M0VA 2RDPA 2LP0A 1STUA 2CT1A 2EM2A 4Y17A 1X58A 5IT9K 4ZDLA 2LSOA 3RQ4A 5CVVA 3DQVC 3TOAA 4IVNA 3MQ0A 4OMZA 2K27A 2P6TA 2EMFA 2YTDA 1EKZA 2V89A 3LSIA 4HSTA 4Y3OA 3OSFA 4WCGA 4GYIA 4RHBB 4LMYA 4NXME 2O0YA 3O8GA 2YR2A 1S7EA 1BI3A 1KYZA 4RM3A 2BHYA 3ZCOA 4N0BA 4LG0B 1JI8A 4PFOA 5A2QK 1HF0A 4M30A 3W6KB 5IYBJ 3CCJI 2ME6A 2LY2A 2KKOA 1IXCA 2KQRA 5EYRA 1ZTRA 3S2DJ 2O5RA 2GXBA 3K10A 5H20A 3KCCA 3R0JA 3CLQA 1GV2A 4G7OF 4TUIA 4EEFG 4A93J 1JTYA 4N4RB 2DO7A 4A12A 4M2ZA 2O3FA 3MD2A 3F0CA 5AIQA 3FWEA 3TMOA 2RNJA 2X0LA 1I3AA 1UCRA 4JI2E 2XKPA 1X4PA 4Y15A 1FLIA 1U0JA 4PCQA 1WWXA 1TBXA 2XB0X 3GFLA 4IHTA 2YTOA 1VQLI 1R1TA 5DCFA 2KIQA 4D7MA 3BLYA 4HEIA 2CV0A 1IN8A 4R2DA 2PJRB 3M8JA 2IP2A 2KPMA 5EEGA 2EPLX 2GZWA 4R2EA 5EZHA 1T39A 1UBDC 2EMYA 3HC7A 2CQKA 2EZHA 2KRFA 2ELHA 1FYKA 2Z99A 4BY7J 2X1DA 2WC2A 2F4MB 1QA6A 2EPRA 3AKZA 1MIJA 3FXUA 4CZCA 2UUAE 5J8FA 1W7PD 3OYCA 1ZGAA 4IRGA 1YSAC 3U1DA 4M9ZA 3F21A 1TNSA 1HBXG 1X4OA 2O6GE 4KICA 1F2IG 1Y0UA 4NZVA 3JRHA 3RMPA 3CDLA 4IXAA 5EG0A 1G4DA 1MBEA 2DFEA 3PIOF 1WZ2A 1A6QA 4OWRB 4D5FA 1UMQA 2RGVA 3KP6A 5ED4A 1LEBA 3QG5C 5FD6A 2EBIA 2R7SA 3HRUA 3CCLI 1B69A 4I6ZA 1ZBTA 1BIBA 3ML6A 2VBYA 5HDGA 2VT2A 3GYHX 5M3MJ 1GDTA 4LG3A 1UHZA 3MMYB 4U0WA 1N77A 3CJQB 4U88A 1JE8A 2EMLA 5GTHC 2GLIA 3HJEA 1KU3A 4DYQA 3K6GA 5L3CA 3DBLB 1Z7LA 1IN4A 3F6OA 1TQMA 2WWYA 1YUIA 3ZRGA 2XRNA 5HLTA 2DFIA 3FISA 4P1WA 4XRMA 2OC6A 2A6TA 4CH7A 2MW8A 2LBSB 2FEZA 2VOOA 1L4SA 3IHUA 1YX3A 1IC8A 4NHRA 3HTUA 2V1XA 2V4JC 3LSGA 4J00A 1YOVB 2ZMEB 1K78A 1VQMI 3EQLF 2K02A 3T1BA 1ZARA 2DOAA 2QUFA 4OINF 3DP7A 3VWBA 1D0XA 1SD6A 4LOCA 4CA0A 3R0AA 5IOYA 2RS7A 2PLYA 3GZ6A 1X3UA 1HCRA 2CG4A 3QP6A 4A3BJ 1LFBA 3L2QA 3KZZA 2D9HA 3TDZC 2I5UA 3MWMA 3B02A 3CCQI 1TQPA 2WV0A 2VODA 1S6LA 4IS1C 1NG7A 1Z9CA 3OYJA 1A1GA 5DS9A 2HVQA 2R5YA 2EPAA 4EJTA 4YY3E 4KYWA 2FGGA 1QVTA 1A04A 2MD0A 2R7DA 3CJNA 3OYFA 3FIGA 3BG7A 2TDXA 1J9IA 2YTJA 2XF6A 2LRSA 1JHFA 1R58A 4ESJA 3I64A 4K2EA 1MJAA 4KMUX 3ELKA 2HVSA 3BJOA 1BI2A 3MZ8A 4JK1X 2EPUA 2D1HA 1N34E 2EK5A 2FMYA 3F22A 4GDFA 1BC8C 4S05A 2OCCH 2EFOA 3WGGA 1UAAA 5LGNA 1JJ8C 3EUAA 4MEYF 4UUVA 4DV3E 3K70D 4RGRA 5KAIC 4BAYA 5ICCA 2E72A 4HLXA 4G12A 2V87A 1R36A 1UG2A 3OL4A 1I1SA 4IF4A 1DP7P 1N33E 3I0TA 2ZSIB 3CQZJ 4B44A 1PKPA 2FMLA 5LGUA 2NVXJ 4HQEA 1X1CA 1GXQA 3FK6A 4XOPA 1JKQC 2KZVA 5ERIA 3A4CA 2K9NA 3CP8A 4XRSG 2EL4A 4DR2E 2A6HF 2IS4A 2ACJA 1IN5A 3OWTA 3L2RA 2P4WA 1T2KA 2P81A 3L9FA 5L3FA 2HHHE 1I50J 3IWCA 5EG0B 5TISC 4PJ0C 1Z21A 2VQHA 4FCYA 2MKNA 1AWCA 4KIGA 4KNYA 5J1RA 1JXSA 5HLHA 2AQFA 1USTA 3DPTA 2EOIA 2ZC2A 3C1DA 4R2AA 2HEOA 3K0LA 2X6XA 3VFZA 2TCTA 3S1NJ 3TO6A 2P8TA 2EMHA 2I10A 1P47A 5TGTA 3IWFA 5M5YJ 3KE2A 4R2CA 2OUMA 1MBFA 1ZELA 2BW3B 3JTZA 2NUEA 2HKXA 3QYBA 1PDNC 3THOB 2XASA 3KLNA 3LAJA 1Z1DA 1FYMA 2CQNA 2JTVA 5LHIA 2DA5A 4BQOA 2LCEA 1D5YA 3RJPA 2BVMA 2K9SA 2ME0A 5LHHA 2CV2A 5TSEA 2O8XA 1KGSA 2JPAA 3IH4A 3H35A 4L9TA 1B72B 4WSPA 3V7SA 4B3XA 4A3DJ 1XGSA 2MH2A 4RH8A 1AOYA 2AHQA 3BTIA 1VI0A 3JAMC 2VE7C 4IHYA 2ADUA 1SVOA 2H1KA 3I56I 1YYVA 5H6QA 4X66E 4R2QA 2QQ9A 1VTNC 2ELZA 1BBOA 1MBKA 2EOJA 3E0JB 4A6DA 2LV2A 5A2QC 3LL7A 1ZN2A 2COMA 3ECHA 5GADJ 1S29A 2X1EA 3K1MA 1FMVA 1FJLA 2VN2A 2P5VA 2XAUA 2YPNA 2LUPB 4BMJA 2IS6A 1N36E 3HSEA 4BEHB 2EOMA 3HHHA 4YFXF 1R49A 1RKTA 3IH2A 4CYDA 2EFWA 2EV0A 2RVCA 2K5CA 2ENAA 2JOXA 4F92B 4HDVA 3KYCB 3MSWA 2BEOA 2YUSA 4PDKA 1RUNA 2PX9A 3GLLA 5LEKA 1KYQA 1SMYF 4Q48A 3BJ6A 4KN7X 1R7JA 1RNLA 2KRCA 4CCJA 5E79C 5IYDJ 3J80Z 4RA2A 3G4SI 1SVLA 3OOPA 1D0YA 5E18F 3KEYA 3W6JB 4L8NA 4ZC3A 3NAUA 3SZTA 3K70C 3AL0C 2FOWA 5ICGA 1SD5A 1N75A 4NB5A 1YLFA 1Z67A 5T6JA 2FBHA 3F8BA 1SR9A 2YRKA 1T8IA 3NARA 1T98A 3JRBA 2AO9A 2RSMA 1OR7C 1F9NA 2H6BA 2WAFA 4PJJA 2KDOA 3IL2A 2X6WA 1POGA 3PSFA 1VQ5I 2CTDA 1XCBA 3NWSA 2GQQA 2HQ5A 2BW3A 3H1CA 1F1ZA 4OIOF 2FQ3A 2YRHA 3IAM2 1FY7A 4IZZA 2EORA 2BBYA 4YIFA 5F0HA 1YZ9A 4BC7A 1RIOH 2EL5A 4LFCE 2B7VA 1JHHA 1HNWE 1RKWA 2XAHA 3FZVA 3QOEA 4D1QA 3M8EA 3E5QA 3VODA 4X0GA 2QKMB 2V1NA 3BG5A 3EPZA 2L54A 1O3RA 2DA2A 2LLKA 2DU9A 3RTRA 2WB1A 3OMYA 2QSFX 2HDDA 2HZDA 1GVJA 1M1EB 3IV5A 1XDSA 4MNUA 2EN8A 3F8FA 4BBRJ 2M1SA 3J81Z 1ZLJA 4G9YA 1A6IA 3P5JA 3R6SA 5C44J 3IC7A 5ICEA 2X6YA 5A6AA 2FBKA 2M8GX 4G94A 4R79A 1EA3A 2JRMA 3HKZN 2R7WA 5FLMJ 5DNYA 3ZQIA 5K7ZA 2VJJA 3RIRA 3KWRA 2P7VB 3G1OA 4B4CA 1MMAA 2L9SA 2QM3A 4TV7A 2W1OA 1ENHA 1ZR2A 2W00A 1ZGJA 1IRZA 1UFMA 1X1BA 2STTA 2DI3A 3BROA 2QKLB 1YFHA 5K5QA 4I99C 2GAUA 3DPLC 1T56A 5CFFE 3HIFA 4A3EJ 1VQ6I 3OIOA 3RKXA 2KT0A 1R71A 3DFGA 2LUQA 3BQYA 1PJTA 1HDPA 2R7XA 2HNHA 1G8XA 2EZIA 1O7FA 4BJ5C 4F6NA 4H0EA 1JUMA 2MKDA 4P55A 2EM7A 2DODA 3A02A 1XSDA 2CGPA 3H0GJ 1OPCA 4I7HA 2WCC3 4DR3E 2EIKH 4KZSA 3BC8A 2JQ7A 1T4NA 2DYSH 2AXLA 4I76A 4CCNA 4YRVA 2DTZA 3T8TA 1LDKB 3H09A 3Q0WA 1F36A 3ZOBA 1FBUA 4V2FA 5HDNA 2HTJA 2VL8A 3F9KA 3G71I 2QBYA 5LMUE 3T8RA 4XLEA 2F5EA 1RR8C 2IT0A 4BNCA 1Z91A 1H88C 2XGXA 3VB2A 2NRAC 4RLFA 4BGDA 4M6VA 2LVHA 2GWRA 4LLNA 2D5VA 4DNCA 3HL2A 3F6GA 3B73A 3OMLA 2EM3A 3FXOA 2EQRA 3LA7A 1F4KA 3G3ZA 3OYDA 4L18B 2M4GA 3E7LA 2E1CA 2H36X 2QGUA 4X65E 1UG0A 1Z7UA 2V1DA 3WGHA 2DDAA 4ZYGA 4DV6E 4RB3C 1CQTA 4AWXB 2ETHA 4NC8A 4RB0A 4XL9A 2LG4A 3MKYB 4L0ZB 3CTAA 3ZN1A 1RESA 1SVMA 3ZQHA 3LA2A 3IKTA 2CUZA 1MH4A 2FRHA 3WE2A 3OYNA 1J7KA 5CQGA 2L2MA 3JRGA 2P5KA 3C3WA 3IRRA 4EGZA 1NEIA 5A2QZ 2N3GA 4HQMA 5GAGJ 5JLWA 5FKLA 2HXIA 1BOBA 1GUUA 1MKMA 3C2HA 2JOBA 2XHKA 3E5UA 1DQ3A 2L9NA 2YTIA 1ZBQA 5DD8A 4ZDPA 3G6EI 1W7PB 4MEXF 2MYSA 4BUPA 2HC5A 2JT1A 5CJ9A 3A2KA 1NTCA 3BPXA 2GLOA 3TP0A 4HBLA 4M6XA 2O8KA 1ERDA 1YQAA 1P9QC 4EM0B 1E17A 5LBQA 3OIPA 3SXYA 2L92A 4CCMA 2NXNB 1G6NA 1KA8A 2BZTA 1R00A 2BXZA 2DQRA 4XBFA 1JT0A 3UR3C 2CFOA 4X62E 3T5XA 2CWEA 3KPHA 5J4YA 5M5XJ 4DYRA 3FBIB 1B8IB 1UJ8A 1OCCH 5FKKA 3RKWA 3JRAA 1I94E 4LB6B 2ZKZA 1WGXA 1G3WA 4BHPA 2PFBA 3HOTA 2JWTA 3F23A 3OYMA 2WBMA 1UILA 3V8LA 4UUSB 3F8CA 5E8GA 1OMIA 4ZDOA 3SEQA 4PK4A 1IBLE 1FOYA 3OOUA 2D2WA 1NH3A 2NUFA 4A3FJ 3DBRB 1SAXA 5DD4A 4P5OA 1ZG3A 4KIBA 1XPXA 2ICWG 4II2A 2ZJRF 3ZQQA 3I4NJ 1SAUA 1WPKA 2LYCA 3SEZA 2DT5A 2K9LA 2Y0SA 2IBDA 4S04A 2EM0A 3QPHA 3V4GA 3GBGA 2CPNA 1XMKA 2QVOA 5JHUA 2CYYA 1WH7A 2VQGA 1XNRE 2A69F 2Q2EB 1PUEE 2LD5A 2E2IJ 5EEAA 5GPCA 3K6QA 4EVIA 5E1XA 1XX5A 4X8WA 1O3QA 3ZMVA 1MH3A 2H1LA 2N3HA 2MC3A 2DN0A 4R2PA 2L5QA 1N78A 3DPUA 2R1FA 3HPZA 1KU7A 3T1HE 4F54A 4JI6E 4M71A 2CO5A 4R8OA 1X1DA 3CESA 3ZP5A 2HTSA 4CSWA 1U8RA 4I8OA 2F5VA 4AD9A 4JI4E 2N8GA 1E2XA 4DOZA 3WTSC 1LFPA 2V88A 4FX0A 3Q0UA 1IJWC 2A05A 3H5RA 3RZDJ 5CQEA 4HNTA 1LQ1A 1G3SA 4XLCA 4LK1F 1WJCA 3BG6A 4AVPA 1D1BA 2IEKA 3LSHA 5FFZA 1XG1A 2IGKA 4LIUA 2HQAA 5F0FA 3S15J 4ENKA 3S2HJ 2OTJI 3AFHA 2RQLA 5JFRA 1MMSA 2GA1A 4IQ4A 1NK3P 3A0HC 3JREA 3WU0A 2H94A 5JR3A 5C4XJ 1X3WB 3WODF 3HGYA 1IRGA 2R7FA 4HV6A 3ABTA 4JQFA 4FE7A 5DUKA 3FKIJ 1SFEA 5M3FJ 3AV0A 2EMZA 1A1LA 4R2RA 4U87A 2D45A 2FBIA 2R7RA 4MLOA 4B48A 4BC9A 2OAZA 2DCEA 5IPAA 1PUFA 2L8TA 2JSCA 3VSKA 5JLXA 4NDLA 2OV7A 2NS8A 3LAPA 3TP3A 2DA3A 1D8KA 2M5WA 4IOAF 2E7WA 1QPIA 3OYIA 4M9SA 2UXNA 2IGOA 4AQYE 1AKHB 2K4JA 3K4MA 3EPKA 1IV6A 2DA4A 3FXQA 1Z77A 2ISYA 3Q5FA 3DJWA 4OAZA 3RZOJ 3LA3A 1VQPI 3ESWB 4FTHA 1HNXE 1R5ID 5E8IA 1W5CC 4II3A 5D5UB 1LEAA 2Z3YA 3E3VA 2EPCA 1SMTA 3DF8A 1X49A 5LRRA 1P7JA 3C4TA 2ZJQF 3KIOA 2LTRA 1P4WA 5FKOA 3ASNH 2JK3A 4BQNA 4B47A 4HAMA 1ZU1A 2XB5A 4DV0E 3TOBA 2E5LE 2B63J 2M7BA 1VQ9I 3IWDA 4Z2YA 2ELKA 5HLIA 3ERMA 5AE3A 4LTYA 4RMNA 1VNDA 5BR8E 4FK5C 1ULYA 2XRLA 5EGOB 2NOGA 2XF5A 3BZ6A 2HDCA 1MNDA 5FKMA 1MSFC 3K4KA 5E1WA 3GO5A 1YJWI 4U0VA 4ZTJA 2JWOA 4GFBA 1W7PA 1IBKE 3KP4A 4KN4X 3K4JA 1FP2A 1WHUA 4L5NC 3WTUC 5DUIA 4ENNA 2OA4A 5C4JJ 1UB9A 3R61A 1STZA 4G6TB 4ZJZA 4XORA 3E6BA 4G7ZF 2B9DA 3K4CA 4MLVA 2LTPA 4WXCA 3ECOA 1QZEA 2NVTJ 1IN6A 3ROUA 2MD5A 1RQ0A 4KWYA 4F9CB 3EPLA 4ZZDA 4CDGA 1R4NB 3SJMA 2G7HA 3HTSB 1OCOH 4IRHA 2E5ZA 3EETA 1LE8A 3OS1A 2XF7A 1P6RA 2WAQN 3CCMI 2R7UA 1OYIA 3T1YE 4PGGA 2DLKA 2EPKX 3HG9A 4Y4RA 2EOYA 2K40A 4UUTA 4DR7E 2QSGX 1TNTA 1MMDA 2XIGA 5CYVA 2FE3A 4XKBA 2RKHA 2R93J 2I9IA 2YTFA 3CO7C 4Y7NJ 2IGMA 3THNA 3T0YA 1D1CA 2R7OA 2BBGA 1QZZA 1KONA 1U9NA 2VC0A 3DLAA 2DA7A 1YIJI 2VQCA 2V79A 1S8NA 3B6AA 1ZQ3P 1JK1A 4IHXA 2LK2A 4P9FA 3OTOE 1N32E 2HZTA 2YU3A 2B3TB 2DFHA 1WHNA 2UZKA 1HOMA 2M1BA 2Z16A 3PM1A 4XRSA 3J81K 1IQSA 3P9CA 2UWMA 2DPDA 2STWA 2IS1A 2DMYA 1ETWA 1V4RA 4LK0F 5D4RA 3CMEI 5ADZA 2LREA 3M7GA 4CCOA 1OCZH 2F6CA 2IAIA 3OR1C 2XUBA 2K3FA 4CXFA 2BE5F 1W5TA 1A35A 4DR1E 1CGPA 3O8HA 3FK7A 1AKHA 2IA2A 1YRNB 5LGTA 4RAZA 1AH5A 1ON2A 2KIUA 1R5GA 2VONA 4O43A 2VQFE 3GX4X 1BL0A 5JHFA 5HS8A 4LFAE 3TDUC 4L5EA 3J80K 5DTDA 2JPBA 3FXJA 4HV5A 3BP8A 4DBRA 3RQIA 4Q28A 1K4TA 5EGOA 2VBZA 3H5NA 2LY9A 4E6KG 1PDAA 1EH7A 5E3OA 4GXOA 2M30A 4PJNA 5DDGA 4FE4A 2ODRD 1ETKA 1ZGWA 2L2NA 4MQVA 3F8NA 3GTPJ 1UELB 2F4IA 5FLXC 1MNMC 1CF7B 1JGSA 4RGUA 1TT0A 1S3JA 3VDXA 1NK2P 1U5TB 1OYWA 1Y0NA 1W4MA 1IDZA 3CCYA 1LVKA 2KRHA 4XRFA 1HNZE 1ODDA 2VXDA 4RDUA 3EUKL 3E6CC 4PZJA 4BE2A 4KJZA 4IRIA 2IHR1 4DZPA 3NQOA 4A69C 1BB8A 5DV5A 1WJDA 3NEUA 3FXMA 4AIJA 4L5JA 2XAGA 5BS6A 2EPNA 2M7QA 1OCPA 2LBFA 2R7VA 2R5YB 2R4GA 1RI7A 5B1BH 1ZR4A 4BXUA 2DJIA 3I58A 1MW7A 3IWZA 3PNTA 5FLXZ 2E1MA 2KIFA 4N4OB 4QIWN 4OU0A 2BY2A 1FPQA 3G1LA 4MO7A 4UV8A 2YTNA 2QF7A 1JT6A 3ZN0A 4JBAA 2YT4A 2KMUA 2GA2A 2BYVE 1UN6B 3ZQLA 4Y13A 4U7DA 1I6HJ 4MTEA 4LF4E 5K5RA 4HYEA 4RBOA 2XSDC 2W48A 1PVEA 1VQKI 4A3GJ 5HOOA 2DPUA 2EV6A 2PG4A 3DTKA 5K1YA 3BIDA 3QWLA 5KHDA 4P7DA 2OBPA 3X2QH 3JRCA 2M34A 2A68F 1SFUA 2K86A 3GWZA 3QPSA 3ZMZA 4OIQF 4BYYA 1YUJA 3VEPA 3C18A 4MHGA 3WHCA 2C6YA 3CD6I 3AG4H 2CV1A 2M2EA 3SQNA 3KETA 2JJ7A 1AAYA 3V7RA 4CCKA 1U78A 2VQLA 2RQPA 1UHSA 3CDHA 2WBSA 3Q9VA 3ADGA 2FX0A 1BR4A 1J0RA 2O9LA 1X2NA 4IX7A 3OV8A 2Y0SN 1B59A 3H0DA 2J5PA 4OMYA 2V26A 2ZCWA 3F3XA 1XMAA 1I5ZA 2O61A 1IAWA 5BMZA 1X3CA 3O6BB 3BTJA 4O4KA 2NS7A 1O57A 2K9MA 4IHSA 4BHBA 1LUJB 3AAFA 2EZ6A 2F8BA 2DMUA 3EPJA 3M1CA 2ZM6E 5CPRB 3JSPA 2VJ4A 2JSPA 1XD7A 3L2CA 4DJAA 4IHVA 1FX7A 3FF5A 2YTPA 1OKRA 4DUZE 2UXBE 1ETYA 5AC5A 3S3OA 2R76A 2HU9A 4OX9E 3HOYJ 4A3MJ 2YX4A 2RQQA 2AS5F 2GPIA 3DTIA 1U5TA 3KLOA 5GAHJ 2YTGA 4M74A 3ASOH 2EILH 4KUMA 4EATA 2L7ZA 3SHFA 2LC2A 1S5LC 2YU9J 1YS7A 3WTYC 2VXZA 2GOXB 4PJMA 2PJRA 1OQYA 3OS0A 3I3LA 4IKFA 1HKSA 1Z6TA 3K7AJ 2L2KB 2LMZA 1QHHD 4DBQA 2XV4S 1WRJA 1PUFB 1X6EA 1FBQA 2ID6A 2W7NA 1D8JA 4CZZA 1NG6A 3H5AA 1GVDA 2OPTA 2X85A 2R0QC 2EM4A 2A5YB 3VPRA 1LFUP 3UK3C 2HS5A 3S1MJ 1RC7A 1SD7A 3NWTA 5L3DA 4NQWB 4YELA 1X48A 1KJKA 3S93A 5IOZA 5EEHA 3JU0A 4O5GA 5A6BD 3IRQA 1UHWA 1IXSB 4JYAE 1HSTA 2IGNA 4R2SA 1I3QJ 4L5IA 3BR2A 4UVAA 4ZYHA 4HX4A 3DV8A 1BJAA 2QQBA 2LDUA 2EN7A 3L09A 2E2HJ 3GTKJ 2ZXHA 3BPVA 5D6EA 2DTRA 1ETQA 3BG3A 2HOAA 1XS9A 3FX3A 4IQJA 2UUBE 4OAYA 3S3MA 4KMFA 1J75A 3HYIA 5IP6A 1ZAOA 3E1SA 1FC3A 3RDIA 4HDUA 3JSOA 2X4HA 4G7HF 1HXDA 4AC0A 3IP4B 5IP9J 1D0ZA 3I59B 2YU8A 2GXGA 2ZJPF 3K1PA 3UKGA 5IXMB 2I13A 2CW7A 1TP4A 2E34A 5F04A 4J01A 1IN7A 1Y39A 2OZ6A 3P7NA 2BVLA 2LH9A 5AC4A 1I39A 3V42A 4GEQB 1WJPA 2WBUA 5K7FA 1ZH5A 1IF1A 3F6VA 2FA5A 4BQAA 1HLVA 5B3SH 2BY3A 2HWVA 4JV5E 3J7ZI 1L3LA 3S2WA 4UXNA 3TGNA 1ZG5A 3JTHA 3I4PA 1VFCA 4HA8A 1QU6A 1R5HA 4BL0B 3J7Yp 4XKCA 3F8MA 1T6SA 2BGCA 4EM1A 3BJAA 2BY1A 4BJ6C 3Q3SA 4JX6A 3PUFA 4HNVA 4C2UA 2EMKA 1BIAA 4JOMA 4ETSA 2HXOA 3A0BC 1Y1WJ 1IXRC 2FOKA 1TWGJ 2ADRA 3COAC 2DMQA 3DBHB 3OIQA 5KNLA 2JA8J 3QODA 5F1RA 3BZCA 2LF8A 4LFUA 4FX4A 1AHDP 2DXIA 4DV1E 1EKEA 3VYUB 3HRTA 4E70A 1TTYA 1XTAA 3QQAA 2VE9A 1XMOE 2F4VE 3VYXA 3FMRA 5LL6R 4I0BA 4XM3A 2JVHA 2LVSA 1RC9A 3LSJA 4S0HB 2M0CA 4BCAA 3QPLA 4RAFA 3JAMK 1DDNA 3D5SC 2FTXB 2CU7A 2EOFA 4KT5C 4GYGA 1RETA 1BBGA 3BT9A 4YEJA 2PMUA 2HKOA 4XICA 1WKMA 3CUQB 2PRTA 4LF6E 1K4SA 1JUPA 1QNTA 3OYBA 1T0FC 2QLZA 2JR1A 2FSWA 1Z3XA 2UU9E 3RPQA 5DM6F 1J26A 2EB7A 2P7CB 1HW1A 4BDZA 5L3EA 2YPRA 3CMAI 3HOZJ 3JRFA 4P96A 1P92A 2W24A 3I5UA 1WSUA 2JVGA 2CJJA 2CQQA 2KJBA 3CJRB 4RB2C 4EJOA 2EN1A 1O4XA 4DR4E 1KU2A 5HNHA 3BGHA 1A1KA 1L0OC 1VZ0A 2LMDA 2WTEA 4X6AJ 2Y0MA 4QTRA 4EJUA 4LGWA 2UXDE 3G1MA 2M9HA 2ECCA 2DBBA 3ZQ7A 2EINH 5HNFA 3MKLA 4B3SE 1B8IA 2R92J 2EOQA 2EP3A 1LDDA 1FKAE 2ZJ2A 5BNGA 3GZNB 2EMXA 2EL6A 3ERED 1TW2A 3N05A 3PFYA 3FXKA 2PEXA 1ZG1A 3RI4A 2DLLA 3L7WA 2VJIA 4F2JC 5H2FC 1Z6RA 2VBXA 4W1UA 2EQ0A 2MC6A 4A3JJ 1GT0C 1GXPA 2DOEA 5J1UA 1FYLA 4X9JA 3REOA 1QO0D 4M6YA 2JN6A 4MLQA 3GFMA 3LSTA 4FT8A 4O5VA 2EA4A 4ZYDA 2ZXWH 1ETOA 1WJAA 1PJQA 3BOQA 3D0SA 4C3IJ 4PGHA 4XK4A 3QYEA 2NVQJ 5BQTA 2EOOA 1IUYA 3A1YA 2ZFWA 4HG2A 3TO7A 2DFFA 2DT6A 3ABMH 4JX4A 2LKSA 3ZXSA 1ZK8A 5CLSA 2HYFA 4WYQB 1WH5A 3GTMJ 3HB9A 3A01A 3HTXA 3H3UA 3IH3A 4EJWA 3CO6C 5DEQA 2DT7B 4I98B 3LQRA 1KQ8A 4EGYA 3W6VA 3IAS2 1RR7A 2FNAA 2JUGA 2Y30A 3CJTB 1IMUA 3PL8A 2DW4A 2KOUA 1T0FA 1R23A 2E2JJ 2Y9ZA 2UXCE 1K6OA 3CUQC 2XGEA 3FBNB 4E7SA 4LF8E 1B9NA 4I02A 3FDYA 3IKVA 1FT9A 1U9OA 3PNVA 5FFXA 2LFBA 3M07A 2Z33A 2KZGA 3ONQA 1NHAA 4C30A 4F7ZA 2DQLA 3ECRA 1EV7A 4KIFA 3WGIA 1FSEA 2V9VA 2EPXA 1E3OC 1VF9A 1NCSA 2EN4A 2VKHA 1BR2A 2V83A 3BTLA 2LKPA 5F08A 4Q4ZF 3OYAA 1WFXA 4ZYEA 1IGNA 4NBQA 1W0UA 1A1JA 1QPMA 4HW0A 3GCMA 1FTTA 3UNGC 1Z3YA 4UUSA 5KL5A 2IA0A 3VYTB 3EYIA 3Q0VA 2BY0A 3DEWA 4FHTA 3C2GA 5IT3A 2L7MP 2LF7A 4KISA 1XSVA 2DK5A 3GUDA 1KYWA 3MN2A 2R5ZA 2H27A 2GIZA 1KQ9A 2VT3A 5L3BA 2RREA 4L9JA 5FROA 2XPUA 2Z9OA 3JAMZ 3KYDB 1OLTA 1Q1HA 3ZQFA 5ILVA 1FZPB 1XGOA 1TF3A 5D8KB 1K61A 3ZOQB 3ABLH 4NUBA 4IO9F 3A03A 2VE8A 4O3MA 2DK8A 5BPDA 1DGCA 1BM9A 4WXHA 2BHZA 3GFJA 2ESNA 4DGWB 1AA7A 3TQMA 3C2BA 4AYBN 4KFCA 1YHQI 3LNQA 5IP7J 2JXPA 2WAEA 3H36A 4D9JA 3RKQA 2EPOA 2I8DA 3GEZA 5FO5A 2GHFA 2IPQX 2K4BA 2L0KA 2LE2A 1G2FC 2HOTA 3LSKA 1KZHA 2PN6A 3L2WA 3MVPA 3VK6A 1YTYA 3M8FA 1V55H 2JYAA 1YYOA 4LLLA 2QCOA 3SDGA 5KCMA 2F5FA 3CC4I 2JRTA 3GMEA 3L00A 5AE2A 2PMZN 3GZ5A 3PO2J 2VPRA 2HJJA 3S1QJ 2VQEE 1X19A 5TRDA 5HODA 4E7LA 1G59A 2H8WA 4PFPA 3BG9A 2YSRA 2CSHA 3CC7I 5DM7F 1XDUA 2Y48A 1BW5A 2HOEA 2FXAA 2HYJA 4JI3E 3EPHA 4XKVA 2KP6A 3ZQCA 3EQ1A 3JCUC 3H9JA 4F6MA 1OISA 1JK2A 3WTWC 2M0MA 2Q8UA 1YI2I 4RS8A 4D0PA 2EN2A 4XSZF 4CYCB 3OR2C 3ZMUA 1V3FA 2DA6A 1B1BA 2WZOA 1WQ2A 2B7TA 1ORKA 1R1UA 1YW7A 2VLAA 1JKRC 3J7AY 2LTSA 1BA5A 1Y56A 3SFZA 2QWWA 2W84A 3CC2I 2QQAA 5LHGA 4UY8I 4XLAA 4J8ZA 1DI2A 3TW6A 4KA4A 2G9WA 1G3YA 1U6GA 4DV5E 5EZGA 1XSXA 4AM3A 4UB8C 3ZMDA 5J4VA 4GGGA 2VBWA 3WG9A 5FKNA 2GIVA 5E1ZB 2LOOA 1T33A 4G8XA 3BQZA 1OJLA 3HSRA 4AIHA 1N3GA 1A1IA 1ZAAC 3WTVC 4A5NA 2KJCA 2YS9A 2PJPA 3TO9A 4EQQA 2V9KA 4B1RA 3IUOA 1QHGA 1FIAA 1I6XA 2JMWA 4I09A 5D5XB 4F3QA 1V54H 3DEEA 4WK8F 4DV7E 3BDDA 1X5WA 4DR5E 2V8QB 1DQUA 1X1AA 3BR0A 1FOXA 3JTGA 1O3SA 2ZB9A 2MC5A 1HC8A 4JP0A 1ACIA 3GF2A 4FASD 4BACA 2FD5A 1LLMC 4PSXA 4CICA 2L4AA 2G0EA 1MJ9A 3MZYA 2ISZA 5J6XA 1T38A 2ENCA 3SZGA 2DAOA 3ZMTA 1FJGE 1YG2A 2WY7Q 2E19A 4BKXA 2PI0A 2OQGA 1DPRA 2K85A 4HX8A 5CKTA 3I71A 3VOEA 4A3KJ 1XGMA 5DCMB 4B43A 1MD0A 1RUOA 3KEQA 1FOKA 2FU4A 2H09A 2H8RA 2DB2A 2DSYA 1YRNA 2JZYA 3TKYA 3MFKA 1FP1D 4E7HA 1J5YA 2RPCA 1IDYA 3E6MA 3VYYA 4N4NB 2ZMEC 1S72I 1J5EE 1ZRFA 1HSJA 2F4OB 5A6JA 3GTGJ 2OQRA 3MHHC 4WXDA 3OYLA 1IW7F 4NC6A 2HR3A 2EFNA 1R9TJ 4BXXJ 4QSHA 4JI8E 3H3ZA 4DUYE 2E60A 1WVRA 1FNNA 4N9HA 2XAQA 4DV2E 1BOAA 4OOIA 3VHTB 3V8JA 1K83J 4A2UA 5JVGF 4JI7E 2PMZA 3FXLA 5KL6A 1V5EA 1D5VA 2DA1A 1I1GA 3CCEI 4E7KA 1W36C 3MHSC 3NRVA 3E5XA 3DWLE 2LR8A 3HOXJ 4BBYA 3PUBA 2M4KA 1PP7U 3VYSB 2QSHX 2R5ZB 3I54A 4ENJA 2GOMA 2KHMA 1X6HA 2M3AA 1OCRH 5D6FA 1U3EM 5FRMA 3OL3A 4A3LJ 3J7AO 2Z1DA 1E3HA 3N4MA 4KT6A 2IVMA 2EWLA 3HRMA 3Q9SA 4BE0A 1KU9A 2JPCA 4MQ9F 1PJRA 3OY9A 3QOPA 3KZYA 2LT7A 2RAEA 2NA2A 1BW6A 2FV4B 1K6YA 4ZTFA 1DGRM 5CVJA 5HDKA 3HZJA 4B3ME 2H6CA 3GW2A 3TQNA 3L2VA 1Y8QB 1QQIA 2CRGA 4XN0A 1YE9A 2DMIA 1YIOA 4F55A 4UHTA 1XMXA 3K9TA 3EUHA 3ADJA 2HGHA 2NNYA 4N9IA 3BR6A 4R03A 2DRPA 2L33A 1EJ9A 4ZZLA 1BR1A 2EZLA 3LLHA 2KISA 4CUGA 2CUFA 1MNEA 4R1HA 3S17J 2EM6A 2NVYJ 2Y2ZA 2B0LA 5AONA 4QPQA 4HLYA 2FF4A 3HPHA 3TW7A 2VC1A 2VIXA 1WJEA 4HX7A 2RN7A 3HHGA 1SFKA 3KZIC 4BEHA 1WHQA 2MC4A 1TWHJ 9ANTA 4LF5E 3RSNA 2ZSHB 5KAFC 1REPC 1P7IA 2HYGD 4XLFA 1BC7C 4M3DA 3G73A 3FHZA 1W36D 3SYTA 4YG2F 3I55I 3CCRI 1ETVA 1XCVA 4KHPE 3OYKA 1IRFA 1P4AA 1SD4A 4IEJA 3HM5A 5GP9A 2EMBA 2EOHA 2RSIA 1U8BA 2P6SA 2E5NA 4GCVA 2XVCA 2M8EA 1E0EA 4XONA 4L9NA 3K4LA 2V9PA 2F5CA 3ABKH 2XPVA 4UVBA 1XGNA 1F43A 2L7FP 2L7KA 5FD5A 5HS9A 3AG1H 4CHUA 1RPWA 1B72A 2M4IA 1X3ZB 1A31A 4RM2A 2L9VA 2V6CA 2WADA 1A1FA 2IRFG 1W1WE 2VJ5A 2EMGA 4HZFA 2CQ7A 4IPAA 2CUJA 1MBHA 2RC4A 3P1XA 1JKPC 3LSRA 5JI6A 2Z2SB 4EM2A 2OF7A 3RYRA 2V85A 2W82A 1ETXA 2EM9A 1ZYRF 5F64A 3QYFA 1YJ9I 1MMNA 4M3FA 4AU7A 2IS2A 1EH6A 2Y31A 1YO5C 2WA0A 4OIPF 1PJSA 2EOZA 1MDMA 1ZREA 3GTOJ 2DDBA 1X6FA 1ZKGA 5F1JA 3M99B 3BWGA 2G7UA 3BR1A 5FJ8J 5KL2A 5LFAA 3RPUA 4A3CJ 2ZO4A 1H8AC 3LMLA 2AXTC 4GRIA 3KP2A 4DQ2A 3S3NA 1ZRDA 3N97A 3W2VA 3SFIA 5LEJA 4B3RE 2X1CA 2VRDA 4F52A 2ZNYA 3U2RA 4ANJA 4IOCF 4UVCA 4P9UA 4E7JA 2MG4A 1H9TA 2IW5A 2RV8A 5HVQC 1BI1A 2CS3A 4AVZA 5BPIA 1J09A 3D1NI 2EMWA 1TWAJ 3WG7H 3U9GA 3ZPLA 1K79A 2YSPA 3C4BA 2IXSA 4C3JJ 3C6MA 2BXYA 1VQ4I 4JX5A 3VSLA 1V5FA 3ZMSA 2ECBA 5EF6A 3BTCA 3W2WA 1HA8A 3L2UA 1MGTA 2VKDA 5HLGA 4Y33A 1HKQA 2ZBKA 5ICFA 4M72A 2MFZA 4I2OA 1OYYA 3QRFF 4H4KC 2EPPA 4XSXF 4ABZA 1S7OA 4RB1A 4IJDA 1FWZA 3R60A 5FLXK 1Q1VA 2DJNA 1C0WA 2EMIA 4A5MA 3DKXA 3SZPA 1MJBA 4XLHA 3OSGA 1ZLKA 2JY9A 3BF2A 4EV0A 2OZUA 3O3KA 4HF2A 4X64E 2ZXJA 2DOFA 2N8XA 2XAFA 5LD2C 5CVRA 3FM5A 3ZQGA 1I27A 1JUSA 3RYPA 2MDGA 1K78B 1LDJA 2EA2A 5LLQA 1USSA 1G3TA 2CW8A 2QBYB 4XN3A 3P9KA 2QENA 3I59A 4MFEA 3PQKA 3W2AA 2DMPA 2HPIA 4JI0E 2CW0F 2HDWA 1LPQA 2JA6J 3AG2H 2ID3A 5ILSA 1TC3C 4DZJA 1WI9A 2ENHA 3HUGA 4NXNE 3K1NA 1A1HA 2FJ1A 4BJTA 2B9SA 1APLC 2UV1A 4LLGF 1ZRCA 2LY1A 4XR6A 3ULQB 2VUMJ 2PBIA 2XPWA 3GVAA 1W0TA 2FUG2 2DGCA 2K7LA 1FBSA 5F3WA 4BHCA 4B3AA 3J81C 4Y52J 3LFUA 2R7ZJ 2YRMA 1RMDA 2HVRA 1WJBA 1TN9A 4QPOA 5EJCA 5GAEJ 1B4AA 4MIMA 1YYWA 3BY6A 2OJED 1JTXA 3GFIA 5B66C 4W97A 2QEXI 3F72A 1Y6IA 1BJZA 2EFQA 2A25A 1TWCJ 4XMYA 3IWBA 3KYLA 1R22A 1FOWA 2L9RA 1GTKA 2A61A 3LWFA 3FXRA 5IY5H 5E3NA 4WPYA 3FHNA 5D4SA 2Q2EA 1SEUA 4LF9E 4M3BA 2MSYA 1VQNI 1JGGA 2EOXA 4YHHE 4M3GA 2D1VA 3MEXA 2XC7A 2Q0OA 1Y1VJ 1PYVA 3KP3A 2M9AA 2WAQA 2XKOA 4WSGA 1OR7A 3H3VK 4P78A 4GKKE 1IRXA 2QZ8A 3GTQJ 2VKEA 3TBIA 2GXAA 1T4OA 2L3CA 3ADLA 1WXRA 2MABA 4E4HA 2EN6A 1RRJA 4B09A 5FLVA 1H0MA 2EM5A 1EH8A 1GHCA 1ONVA 2V7FA 1X2MA 1H9GA 4HOBA 4UV9A 2A5WA 4CGZA 3BCBA 3PFIA 2LJUA 3CP2A 4X1EA 4C3HJ 2VF1A 4HPQA 4FETA 3OS2A 3MKWB 4BBSJ 3QPTA 2NS0A 5J3LA 5D5VB 2JUCA 2VKVA 3EDPA 4XLPF 3K2AA 3L1PA 4A0ZA 1TWFJ 1FTZA 2RTXA 2ESHA 3CCSI 5AE1A 4HF0A 4DIQA 2DMNA 3G2BA 3MCZA 3DLLF 2VI6A 4I01A 3PJRA 2E1MB 4BH9A 2EE8A 1TZLA 3HSFA 2KONA 2YTQA 1IZ1A 3DKYA 2BB8A 2EZKA 3TEDA 4GKJE 2YX7A 5J8CA 5AIPA 3DCFA 2F2EA 2EMAA 3QAHA 2M87A 4LF7E 4UB6C 4RAGA 1DPUA 2BV6A 5LRSA 5CVUA 2YZTA 1LVAA 1DU6A 3BR5A 4K0KE 1H89C 1K7AA 1CF7A 4BS9A 1OCTC 1LNWA 3JR9A 2VASA 2EJ4A 4AIKA 2Z5UA 2PQ8A 1FIPA 1TT5B 2EH3A 3KX2A 2HQRA 1SFXA 1A5JA 3H9GA 4L9VA 1R1VA 2ZNZA 2CMPA 4MGRA 2X9DA 2DLQA 2LO3A 5KL7A 1MDMB 2P0WA 3HUGB 4CO8A 4YFNF 4MTDA 1XB4A 4M3EA 4ASNA 4F93B 3BBGA 5E3MA 3HRSA 2EPFA 3EYYA 1FEXA 2GBYA 2MDRA 2WBTA 3I9V2 3BZKA 1EF4A 4D7NA 3V7CA 2O03A 2JA7J 2E71A 5E20A 3HOUJ 3HKZA 1XMQE 5ILUA 2QA4I 1Z1BA 1YS6A 5DCMA 2WV1A 3S1RJ 4HRIA 5J47A 4JI1E 3DU5A 1QZYA 2E36A 3OYGA 4RGSA 4WX9A 3CDIA 1D3YA 4UNOA 2E1OA 5J40A 2CUEA 2F48A 4AYBA 5CVIA 4JI5E 1Z0XA 2K3PA 2Y9YA 5EDNA 3WHBA 4U0YA 4G6DA 2ELYA 2QQ8A 3SDBA 4A0YA 3CMYA 3WU2C 1ZR9A 4E7IA 3C6KA 1F5TA 3LFKA 3FKJA 4BXFA 4PJLA 4IJAA 1BI0A 5FB2A 1LJ9A 4EJVA 1YYKA 1BN5A 2ZXIA 3P9IA 4PUSA 2HQNA 4QLCU 1JKOC 1O0WA 1Z05A 4V2GA 4KDPA 5F6FA 2XGCA 3R4KA 1U5TC 1YITI 6PAXA 2F5DA 3HOSA 2K4VA 4ESBA 3CCVI 4A3IJ 3ADIA 2X48A 4EMSA 1P2FA 3MAJA 3J7AG 3FIWA 1FMWA 2JA2A 1DP3A 1SANA 1MBGA 5DYMA 2NAZA 5KL3A 1WI3A 1XC5A 3PNYA 1IQOA 2R3SA 5KL4A 4Z6YA 2UUCE 3O2PE 2VB6A 3S14J 4LB5A 1MEYC 1IV8A 1XN7A 4JYKA 4B3TE 4E7ZA 4HNUA 4LIVA 1G2HA 4MFDA 5D5WB 2M7AA 3KP7A 4IL6C 1WJ5A 4OIRF 3U21A 3WTTC 3GTJJ 1JJ6C 3LSPA 1QU3A 5IV8B 2NNNA 3KEOA 4AUXA 3J7YJ 1IUFA 1R6RA 2MLGA 3OYEA 1ON1A 4TUGA 4LFBE 2HGCA 5A6BA 4YIIA 1P4XA 2EQ3A 2ZMEA 2R7QA 2OU2A 4LITA 2OCEA 1Y8RB 2EIJH 2A07F 4L0YB 2K7IA 2ELJA 4DW6A 1TQIA 2CH0A 2LRDA 2B7EA 4A0XA 2EOEA 3A01B 1R4MB 2EFPA 1FSHA 3OYHA 1ZHFA 4XLNF 3PSIA 5JVTA 2EOSA 1UHMA 2MA3A 4F91B 3CLOA 3PQJA 4HF1A 3WTZA 4YIRX 3HBLA 2YWQA 5IYCJ 4FQGA 5H6RA 2FQ4A 4C9YA 2NABA 3F6HA 3M4OJ 1TL8A 1J2XA 5D8LB 1WCMJ 4DR6E 1T95A 3J80C 1DUXC 2X51A 1G2DC 2KFDA 2DYRH 2OD5A 2MBFA 3QP5A 2ODRC 4ON0A 2EQ1A 3QU6A 1TLHB 4O24A 4LJZF 4BY1J 3M3YJ 4HTGA 1T08B 4XOTA 3LMMA 3FMSA 2XSJC 2XAJA 4G6QA 1O3TA 4XKWA 2W25A 2FNPA 2O7OA 5KK1A 5BOXA 4BE1A 1MZBA 4HEA2 2LJHA 2L02A 4YFKF 3HPSA 3B6CA 3HQ1A 3QU3A 2YU5A 3FM3A 2V6EA 1HKTA 1IBME 2E1MC 4PSWA 2JVAA 1S9HA 3CUOA 1GZ6A 2XGDA 3MZHA 2UXXA 1E3PA 4BDYA 2DMTA 2EM8A 4GZNC 2J5OA 2WY8Q 3D5LA 5F27A 1O7LA 1QVUA 2A3SA 2BOLA 2L2OA 2NYXA 3LOCA 1SFOJ 2WB1N 3GLXA 2YTEA 1YX5A 4DYCA 2W85A 3D5RC 5E17F 4XNFA 4NNJA 3JRIA 1VQ7I 1VQ8I 3ZR8X 5F0CA 5K7HA 3K4NA 4OOGC 3MKZA 2XROA 3RPUD 1TF6A 4M9VC 5FGMA 1DU0A 1B6AA 4RLQA 3ISPA 2P5LC 2EJRA 3HOVJ 3CCUI 5IT9Z 3ZGKA 3DXJF 2R7TA 1YPNA 1UZCA 1X47A 3DU6A 5IWAE 1WJFA 3E6DA 3AG3H 4M73A 2Q1ZB 3I4MJ 2KL4A 2MLKA 1V5GA 5TJJA 4XQFA 2MGQA 3S16J 2VPLA 2XDVA 4BU2A 2NVUB 4D5CA 2E7XA 3PIPF 5A69A 3KFWX 2X6OA 1XNQE 2HOSA 2LBFB 4WFTA 4DV4E 5GTIC 2RS6A 3V8KA 2J7JA 5KVRA 2V86A 4I0AA 5K5OA 3CZ6A 1QGPA 3GTLJ 3LQQA 2EIMH 5E3LA 3HDDA 1J59A 5HS7A 4WWCA 2OTLI 4C2TA 3AL0B 3E97A 3K2ZA 4A6EA 3KP5A 4B8XA 1N25A 1YW9A 3BR3A 4LD5A 4QWQA 4CYCA 1GQEA 5L3GA 3FMQA 3DF6A 3BCAA 3K69A 2L01A 4Q5SF 2EV5A 3S8PA 2EWNA 3WE3A 4DKKA 3CMMA 1VQOI 3C7JA 2ZFUA 3HEFA 3CF5F
chains in the Genus database with same CATH topology
3DEUA 4GO1A 2V1UA 1RZ4A 3M1EA 3H92A 1LB2A 2HFHA 2A6EF 1S7AA 3I53A 2CFXA 4NHJA 4Q47A 4ENMA 1U2WA 4O6JA 4R8HA 1KQ0A 2QYOA 1BBYA 3M9AA 1TW3A 3CUQA 1W5SA 2KIMA 4RAYA 1PP8F 2W57A 2E1NA 2LNBA 4ESFA 2Q8KA 2MH9A 2IA1A 2Y75A 4U7BA 2M45A 2CSOA 2VOPA 4WF2A 3WTXC 2L4MA 1HW2A 3ABUA 2L3DA 3DKWA 4NQWA 2IJLA 3GXOA 4ZH4F 4RGXA 1B9MA 4LG0A 3JW4A 1HW5A 2PMHA 4M9XA 1QBJA 3RKYA 1YW8A 3WU1B 1HQCA 2RDPA 4Y17A 5IT9K 2LSOA 5CVVA 3DQVC 3TOAA 4IVNA 3MQ0A 4OMZA 2K27A 2P6TA 4WCGA 4GYIA 4LMYA 2O0YA 2YR2A 1BI3A 1KYZA 4N0BA 4LG0B 5A2QK 3W6KB 2KKOA 1IXCA 2GXBA 5H20A 3KCCA 3R0JA 4G7OF 2DO7A 4A12A 2O3FA 5AIQA 3FWEA 2RNJA 2X0LA 1UCRA 2XKPA 4Y15A 1FLIA 4PCQA 1WWXA 1TBXA 3GFLA 4IHTA 1R1TA 5DCFA 1IN8A 2IP2A 5EEGA 2GZWA 1T39A 1FYKA 2CQKA 2KRFA 2ELHA 2Z99A 2WC2A 3FXUA 5J8FA 1W7PD 1ZGAA 4IRGA 3U1DA 4M9ZA 3F21A 1TNSA 1HBXG 2O6GE 4KICA 1Y0UA 4IXAA 1G4DA 2RGVA 3KP6A 5ED4A 1LEBA 5FD6A 3HRUA 1BIBA 3ML6A 2VBYA 5HDGA 2VT2A 3GYHX 4U0WA 4U88A 1JE8A 1KU3A 5L3CA 3F6OA 1IN4A 1TQMA 2WWYA 2XRNA 2DFIA 2FEZA 2VOOA 3IHUA 3HTUA 2V1XA 2ZMEB 1K78A 3EQLF 2K02A 3T1BA 1ZARA 2QUFA 4OINF 3DP7A 1SD6A 3R0AA 2PLYA 3GZ6A 1X3UA 2CG4A 3QP6A 3KZZA 3TDZC 3MWMA 3B02A 1TQPA 2WV0A 2VODA 1S6LA 1Z9CA 4EJTA 4KYWA 1A04A 3CJNA 2R7DA 2TDXA 1J9IA 1JHFA 1R58A 4ESJA 3I64A 4K2EA 1MJAA 4KMUX 3ELKA 3BJOA 1BI2A 4JK1X 2D1HA 2EK5A 2FMYA 3F22A 1BC8C 4S05A 2EFOA 3WGGA 5LGNA 4MEYF 4UUVA 4RGRA 4BAYA 5ICCA 4HLXA 1R36A 1I1SA 4IF4A 1DP7P 3I0TA 2FMLA 5LGUA 4HQEA 1GXQA 5ERIA 2A6HF 2ACJA 1IN5A 2P4WA 1T2KA 3L9FA 5L3FA 1AWCA 4KIGA 4KNYA 1JXSA 5HLHA 1USTA 3DPTA 3C1DA 2HEOA 3K0LA 3VFZA 3TO6A 2P8TA 3IWFA 3KE2A 2HKXA 1PDNC 2XASA 3KLNA 3LAJA 1Z1DA 1FYMA 2JTVA 5LHIA 3RJPA 5LHHA 2O8XA 1KGSA 4L9TA 3V7SA 1XGSA 2MH2A 1AOYA 2ADUA 1YYVA 5H6QA 2QQ9A 1VTNC 4A6DA 1ZN2A 2COMA 3ECHA 1S29A 3K1MA 2VN2A 2P5VA 3HSEA 3HHHA 4YFXF 4CYDA 2EFWA 2EV0A 2RVCA 4HDVA 2BEOA 4PDKA 1RUNA 5LEKA 1SMYF 4Q48A 3BJ6A 4KN7X 1R7JA 1RNLA 3J80Z 3OOPA 5E18F 3W6JB 3SZTA 5ICGA 1SD5A 4NB5A 1YLFA 2FBHA 3F8BA 1T98A 1F9NA 2H6BA 3IL2A 1XCBA 2GQQA 1F1ZA 4OIOF 2FQ3A 1FY7A 2BBYA 4YIFA 1RIOH 1JHHA 2XAHA 3FZVA 3M8EA 3E5QA 3VODA 2L54A 1O3RA 2DU9A 3RTRA 1GVJA 1XDSA 4MNUA 3F8FA 3J81Z 1ZLJA 4G9YA 3R6SA 3IC7A 5ICEA 2FBKA 4G94A 4R79A 3RIRA 2P7VB 2QM3A 4TV7A 1ZGJA 1UFMA 2STTA 2DI3A 3BROA 1YFHA 5K5QA 2GAUA 3DPLC 3HIFA 3RKXA 3DFGA 1O7FA 4H0EA 4P55A 1XSDA 2CGPA 1OPCA 4I7HA 2AXLA 3T8TA 1LDKB 5HDNA 1FBUA 2QBYA 2HTJA 3T8RA 2F5EA 2IT0A 4BNCA 1Z91A 2XGXA 3VB2A 2NRAC 2GWRA 4LLNA 4DNCA 3B73A 3LA7A 1F4KA 3G3ZA 4L18B 2E1CA 1Z7UA 2V1DA 3WGHA 4ZYGA 4RB3C 4AWXB 2ETHA 4RB0A 4L0ZB 3CTAA 3ZN1A 3IKTA 3LA2A 2FRHA 3WE2A 1J7KA 2P5KA 3C3WA 4EGZA 3IRRA 5A2QZ 4HQMA 1MKMA 2XHKA 3E5UA 5DD8A 1W7PB 4MEXF 2JT1A 5CJ9A 3BPXA 4HBLA 4M6XA 1YQAA 4EM0B 1E17A 5LBQA 3SXYA 1G6NA 1KA8A 2DQRA 1R00A 4XBFA 3T5XA 2CWEA 3RKWA 4LB6B 2ZKZA 1G3WA 4BHPA 2PFBA 3HOTA 3F23A 3V8LA 3F8CA 5E8GA 1OMIA 2D2WA 1SAXA 5DD4A 4P5OA 1ZG3A 4KIBA 2DT5A 4S04A 3QPHA 3V4GA 1XMKA 2QVOA 5JHUA 2CYYA 2A69F 1PUEE 4EVIA 5E1XA 1O3QA 3ZMVA 2MC3A 1KU7A 4M71A 2CO5A 3ZP5A 2HTSA 1U8RA 4AD9A 3WTSC 1E2XA 4FX0A 1LQ1A 1G3SA 4LK1F 4AVPA 5FFZA 4ENKA 5JFRA 2GA1A 3WU0A 2H94A 5JR3A 3WODF 1IRGA 2R7FA 4HV6A 3ABTA 4JQFA 5DUKA 1SFEA 2D45A 2FBIA 2OAZA 2JSCA 3LAPA 1D8KA 2M5WA 2E7WA 4M9SA 2UXNA 2K4JA 3FXQA 2ISYA 3Q5FA 3LA3A 5E8IA 5D5UB 1LEAA 2Z3YA 3E3VA 1SMTA 3DF8A 5LRRA 1P4WA 4HAMA 3TOBA 4Z2YA 5HLIA 1ULYA 2HDCA 3BZ6A 5E1WA 3GO5A 4U0VA 1W7PA 3KP4A 4KN4X 1FP2A 3WTUC 5DUIA 4ENNA 2OA4A 1UB9A 3R61A 1STZA 3E6BA 4G7ZF 4WXCA 3ECOA 1IN6A 3ROUA 2MD5A 4ZZDA 4CDGA 3HTSB 2G7HA 4IRHA 3EETA 1P6RA 1OYIA 4PGGA 1TNTA 2XIGA 5CYVA 2FE3A 2RKHA 3CO7C 3T0YA 1QZZA 2VC0A 2V79A 1S8NA 4P9FA 2HZTA 2YU3A 2UZKA 2M1BA 3J81K 3P9CA 2UWMA 2DPDA 2STWA 1V4RA 4LK0F 5D4RA 3M7GA 2XUBA 4CXFA 2BE5F 1W5TA 1CGPA 2IA2A 5LGTA 4RAZA 1ON2A 2KIUA 1R5GA 2VONA 3GX4X 5HS8A 3TDUC 3J80K 2JPBA 4HV5A 3BP8A 2VBZA 1EH7A 4GXOA 2M30A 5DDGA 4MQVA 3F8NA 1CF7B 1JGSA 4RGUA 1S3JA 1U5TB 1OYWA 1W4MA 4XRFA 1ODDA 3E6CC 4PZJA 4IRIA 3NQOA 5DV5A 4AIJA 3NEUA 4L5JA 2XAGA 5BS6A 1RI7A 4BXUA 3I58A 3IWZA 5FLXZ 2KIFA 4OU0A 1FPQA 4UV8A 3ZN0A 4JBAA 2GA2A 2BYVE 4Y13A 4U7DA 4MTEA 5K5RA 4HYEA 5HOOA 2DPUA 2EV6A 2PG4A 5K1YA 2OBPA 2A68F 1SFUA 2K86A 3GWZA 3ZMZA 4OIQF 4BYYA 3VEPA 3C18A 4MHGA 2C6YA 3SQNA 3KETA 3V7RA 1U78A 2RQPA 3CDHA 3Q9VA 1J0RA 3OV8A 1B59A 2J5PA 4OMYA 2ZCWA 3F3XA 1XMAA 1I5ZA 2O61A 1IAWA 5BMZA 3O6BB 1O57A 4IHSA 3AAFA 4BHBA 3JSPA 1XD7A 3L2CA 1FX7A 3FF5A 1OKRA 2YX4A 2AS5F 1U5TA 3KLOA 4M74A 4KUMA 3SHFA 1YS7A 3WTYC 2VXZA 1HKSA 1Z6TA 2XV4S 1WRJA 1FBQA 1D8JA 4CZZA 2A5YB 2HS5A 1SD7A 5L3DA 5EEHA 3IRQA 1UHWA 1IXSB 1HSTA 4L5IA 4UVAA 4ZYHA 4HX4A 3DV8A 1BJAA 2QQBA 2LDUA 3L09A 3BPVA 5D6EA 2DTRA 3FX3A 4KMFA 1J75A 3HYIA 1ZAOA 3RDIA 1FC3A 4HDUA 4G7HF 3JSOA 2X4HA 1HXDA 3I59B 2GXGA 3K1PA 1IN7A 2OZ6A 3P7NA 1ZH5A 1IF1A 3F6VA 2FA5A 4BQAA 2HWVA 1L3LA 3S2WA 4UXNA 3TGNA 1ZG5A 3JTHA 3I4PA 4HA8A 1R5HA 3F8MA 1T6SA 2BGCA 4EM1A 3BJAA 1BIAA 4ETSA 1IXRC 2FOKA 3COAC 5F1RA 4LFUA 2LF8A 4FX4A 3HRTA 4E70A 1TTYA 2VE9A 3FMRA 4I0BA 1DDNA 3JAMK 4KT5C 4GYGA 2PMUA 2HKOA 1WKMA 3CUQB 1QNTA 2QLZA 2FSWA 3RPQA 2EB7A 2P7CB 1HW1A 5L3EA 2YPRA 4P96A 1P92A 2W24A 3I5UA 1WSUA 2KJBA 4RB2C 4EJOA 1KU2A 1L0OC 2WTEA 2Y0MA 4EJUA 4LGWA 2DBBA 3ZQ7A 1LDDA 2ZJ2A 3ERED 1TW2A 2PEXA 1ZG1A 3RI4A 2DLLA 3L7WA 1Z6RA 2VBXA 1GXPA 1FYLA 3REOA 1QO0D 4M6YA 3GFMA 3LSTA 4FT8A 4O5VA 2EA4A 4ZYDA 3BOQA 3D0SA 4PGHA 5BQTA 1IUYA 2ZFWA 3TO7A 5CLSA 2HYFA 3H3UA 4EJWA 3CO6C 5DEQA 4I98B 3LQRA 1KQ8A 4EGYA 2FNAA 2DW4A 1T0FA 1R23A 1K6OA 3CUQC 1B9NA 4I02A 3IKVA 1FT9A 5FFXA 2Z33A 1NHAA 4F7ZA 2DQLA 1EV7A 4KIFA 3WGIA 1FSEA 2V9VA 2LKPA 4Q4ZF 4ZYEA 1QPMA 4HW0A 2IA0A 3EYIA 4FHTA 5IT3A 2LF7A 1XSVA 2DK5A 3GUDA 1KYWA 2H27A 2VT3A 1KQ9A 5L3BA 4L9JA 2Z9OA 3JAMZ 1Q1HA 5ILVA 1FZPB 1XGOA 5D8KB 2VE8A 4O3MA 2DK8A 5BPDA 1BM9A 4WXHA 3GFJA 2ESNA 4KFCA 3GEZA 5FO5A 2IPQX 2K4BA 2PN6A 1YTYA 3M8FA 4LLLA 2F5FA 2JRTA 3L00A 3GZ5A 5TRDA 2YSRA 1XDUA 2Y48A 2HOEA 2FXAA 3WTWC 4RS8A 4D0PA 4XSZF 3ZMUA 1V3FA 1B1BA 1WQ2A 1R1UA 1YW7A 3SFZA 2QWWA 2W84A 2QQAA 5LHGA 4KA4A 2G9WA 1G3YA 1U6GA 1XSXA 3ZMDA 4GGGA 2VBWA 3WG9A 2GIVA 5E1ZB 4G8XA 3HSRA 4AIHA 3WTVC 4A5NA 2KJCA 2PJPA 3TO9A 4EQQA 5D5XB 1I6XA 4I09A 4WK8F 3BDDA 3JTGA 1O3SA 3GF2A 4CICA 2L4AA 1MJ9A 3MZYA 2ISZA 5J6XA 1T38A 2DAOA 3ZMTA 1YG2A 2PI0A 2OQGA 1DPRA 4HX8A 3I71A 3VOEA 1XGMA 5DCMB 1MD0A 1RUOA 3KEQA 1FOKA 2FU4A 2H09A 2JZYA 3TKYA 3MFKA 1FP1D 1J5YA 3E6MA 1ZRFA 1HSJA 2OQRA 4WXDA 1IW7F 2HR3A 2EFNA 3H3ZA 1FNNA 4N9HA 2XAQA 1BOAA 4OOIA 3V8JA 4A2UA 1D5VA 1I1GA 3NRVA 3E5XA 1PP7U 4ENJA 3I54A 1U3EM 5D6FA 3J7AO 3N4MA 2IVMA 3HRMA 3Q9SA 1KU9A 2JPCA 4MQ9F 3QOPA 3KZYA 5HDKA 5CVJA 2H6CA 3GW2A 3TQNA 1QQIA 1YIOA 4UHTA 3K9TA 3EUHA 2NNYA 4N9IA 4ZZLA 4R1HA 2B0LA 5AONA 4HLYA 2FF4A 2VC1A 4HX7A 2RN7A 3HHGA 1REPC 2HYGD 1BC7C 3G73A 3FHZA 4YG2F 1XCVA 1IRFA 1P4AA 1SD4A 2P6SA 4GCVA 2XVCA 2M8EA 4L9NA 2F5CA 4UVBA 1XGNA 5HS9A 5FD5A 4CHUA 2V6CA 2IRFG 4HZFA 4IPAA 2RC4A 5JI6A 4EM2A 3RYRA 1ZYRF 5F64A 1EH6A 1YO5C 4OIPF 1MDMA 1ZREA 3BWGA 2G7UA 3RPUA 2ZO4A 4DQ2A 3KP2A 1ZRDA 3N97A 5LEJA 2ZNYA 3U2RA 4UVCA 4P9UA 1H9TA 2IW5A 2RV8A 5HVQC 1BI1A 5BPIA 3U9GA 3ZPLA 1K79A 3ZMSA 1MGTA 5HLGA 1HKQA 2ZBKA 5ICFA 4M72A 4I2OA 1OYYA 3QRFF 4XSXF 1S7OA 4RB1A 1FWZA 3R60A 5FLXK 1C0WA 4A5MA 3SZPA 1MJBA 1ZLKA 4EV0A 2OZUA 3O3KA 4HF2A 2ZXJA 2XAFA 5CVRA 3FM5A 1I27A 3RYPA 1K78B 1LDJA 2EA2A 5LLQA 1USSA 1G3TA 2QBYB 3P9KA 2QENA 3I59A 3PQKA 2CW0F 5ILSA 1WI9A 3HUGA 3K1NA 4LLGF 1ZRCA 3ULQB 2PBIA 3GVAA 2K7LA 1FBSA 4BHCA 1B4AA 3BY6A 3GFIA 3F72A 2EFQA 1R22A 2A61A 3LWFA 3FXRA 5D4SA 2Q2EA 2D1VA 3MEXA 2Q0OA 3KP3A 2XKOA 1OR7A 2QZ8A 4B09A 1H0MA 1EH8A 1GHCA 1ONVA 4UV9A 4HOBA 1H9GA 4CGZA 3PFIA 3QPTA 2NS0A 5D5VB 3EDPA 4XLPF 4A0ZA 2ESHA 4HF0A 3MCZA 4I01A 4BH9A 3HSFA 1IZ1A 2YX7A 5J8CA 5AIPA 2F2EA 3QAHA 2M87A 1DPUA 2BV6A 5LRSA 5CVUA 1LVAA 1K7AA 1CF7A 1LNWA 4AIKA 2PQ8A 2Z5UA 2HQRA 1SFXA 4L9VA 1R1VA 2ZNZA 4MGRA 1MDMB 4CO8A 4MTDA 4YFNF 1XB4A 4ASNA 3HRSA 3EYYA 3V7CA 2O03A 5E20A 5ILUA 1YS6A 5DCMA 1QZYA 4RGSA 4WX9A 1D3YA 4UNOA 5CVIA 4U0YA 4G6DA 4A0YA 1F5TA 3LFKA 4IJAA 1BI0A 5FB2A 1LJ9A 4EJVA 1BN5A 3P9IA 2HQNA 4QLCU 1Z05A 4KDPA 5F6FA 3R4KA 1U5TC 6PAXA 2F5DA 3HOSA 4ESBA 4EMSA 1P2FA 3MAJA 5DYMA 2NAZA 2R3SA 3O2PE 4LB5A 1XN7A 5D5WB 3KP7A 4OIRF 3WTTC 2NNNA 3KEOA 2MLGA 1ON1A 2HGCA 4YIIA 1P4XA 2ZMEA 2OU2A 2A07F 4L0YB 1TQIA 4A0XA 2EFPA 1FSHA 1ZHFA 4XLNF 5JVTA 1UHMA 2MA3A 3CLOA 3PQJA 4HF1A 3WTZA 5H6RA 1J2XA 5D8LB 1DUXC 2OD5A 2MBFA 3QP5A 4ON0A 3QU6A 1TLHB 4LJZF 3FMSA 2XAJA 4G6QA 1O3TA 2W25A 2FNPA 5KK1A 5BOXA 1MZBA 2L02A 4YFKF 3QU3A 3FM3A 1HKTA 3CUOA 3MZHA 2UXXA 2J5OA 3D5LA 1O7LA 2A3SA