1MGTA

Crystal structure of o6-methylguanine-dna methyltransferase from hyperthermophilic archaeon pyrococcus kodakaraensis strain kod1
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
169
structure length
169
Chain Sequence
MLSVEKFRVGERVVWIGVIFSGRVQGIAFAFDRGTLMKRIHDLAEHLGKRGVSISLDVQPSDYPEKVFKVLIGELDNASFLRELSFEGVTPFEKKVYEWLTKNVKRGSVITYGDLAKALNTSPRAVGGAMKRNPYPIVVPCHRVVAHDGIGYYSSGIEEKKFLLEIEGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hyperthermostable protein structure maintained by intra and inter-helix ion-pairs in archaeal O6-methylguanine-DNA methyltransferase.
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Transferase
molecule keywords PROTEIN (O6-METHYLGUANINE-DNA METHYLTRANSFERASE)
total genus 57
structure length 169
sequence length 169
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 1999-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF09153 DUF1938 Domain of unknown function (DUF1938)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mgtA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1mgtA01
3JTGA 2GA1A 3QRFF 1W5TA 3HRSA 1VTNC 3CO6C 2QWWA 1ZRCA 2E1CA 5DUIA 1K78A 1JXSA 3FHZA 3K2ZA 2MH9A 3P9IA 2ACJA 3VB2A 1AOYA 3I0TA 3QU3A 5TJJA 2RGVA 3ABTA 5LGUA 1ULYA 2XVCA 1YQAA 3V4GA 2J5OA 1IRFA 2QQ9A 1J7KA 1R5GA 2FNPA 2GXGA 2PEXA 3WU1B 1SD7A 3K0LA 3HYIA 4AD9A 2NYXA 1KU2A 3CLOA 4N0BA 3ISPA 5L3EA 2OQGA 2Z9OA 5H6RA 1G3YA 3F21A 2M30A 2PMUA 1JHHA 2H94A 3RKXA 2ZJ2A 2Z99A 1GVJA 1XGMA 5FGMA 4I2OA 2JPBA 5HDGA 4FX0A 4XBFA 4HYEA 4Q5SF 1XSDA 3LA7A 3W6KB 2H27A 5E20A 4Q4ZF 1HSJA 2RQPA 2HWVA 3VOEA 4KIFA 4WK8F 5JFRA 1O3SA 1G3TA 4O3MA 2GAUA 2EFWA 3LA3A 1D8JA 3CUQC 1BN5A 3M7GA 1OYWA 5KK1A 5DD4A 4EGZA 1R7JA 4BQAA 4KN7X 4IRIA 2FXAA 1FY7A 1IZ1A 2K4JA 3FZVA 3MWMA 2K7LA 2EA2A 3J81K 3E3VA 2HEOA 4IHTA 2CW0F 4U0WA 1J2XA 2A68F 2UXNA 4R1HA 4A5NA 2QLZA 4O6JA 4LG0A 1V4RA 2J5PA 3FM5A 4ESFA 3SZPA 4LB6B 1W4MA 2VBXA 2EB7A 3HOTA 1WSUA 4LJZF 3T0YA 3Q9SA 1EH8A 2L54A 3TO9A 1MGTA 4AIHA 4U7BA 4OMYA 3ZN1A 2P5KA 2JT1A 5FFZA 5J8FA 3NEUA 1YW9A 4ZYDA 2UWMA 5HDKA 1PP8F 1H0MA 4LK0F 1SD6A 4Y13A 3SZTA 4XLNF 4RGSA 3JSOA 3QAHA 4KNYA 1DUXC 4UV8A 1HW1A 3H3UA 3RKYA 4PCQA 4EJWA 2V1UA 2O8XA 2DAOA 2IA2A 1P4WA 1QQIA 2VN2A 1B59A 1I6XA 4DQ2A 2LF8A 3BJ6A 3WGGA 3KP4A 1CF7A 4ENJA 4U88A 2VC0A 1HKSA 4IJAA 4YFXF 3FMRA 4EJOA 1ZARA 2E1NA 4A5MA 1FP1D 3BOQA 5ICEA 2P6SA 2F5EA 4RB1A 3EUHA 3TO6A 1YS6A 1T38A 3M1EA 2Q8KA 2LDUA 2VT2A 3LFKA 2M8EA 3HOSA 2FMYA 3KFWX 2IW5A 4HX7A 2A61A 2FU4A 5KVRA 3R0AA 2MLGA 5ICGA 3J81Z 3ULQB 3FM3A 3RJPA 1KYWA 4ON0A 3F22A 4AIKA 1Z05A 1R1UA 3BY6A 3WTUC 1G3WA 3R6SA 2DFIA 3T1BA 5LEJA 4OIRF 1SD4A 2G7HA 2E7WA 3QU6A 4Z2YA 2FEZA 5D5VB 3W6JB 2XAQA 3T8RA 3ZMUA 2JPCA 2WC2A 4M9ZA 4I02A 2Z5UA 3MZYA 1BIBA 3CJNA 1QNTA 4RGRA 1OR7A 2B0LA 4KICA 3D0SA 3QP5A 1WQ2A 2HOEA 4UVCA 4JQFA 4LB5A 4LLLA 3E6CC 2OBPA 2DK8A 2AXLA 2P4WA 3WTYC 4HBLA 3M8EA 2RKHA 2WV0A 1Q1HA 2HGCA 5TRDA 2DO7A 3E5UA 2PG4A 1JGSA 5E8GA 5HOOA 4KMFA 1RNLA 4ZZLA 2HYFA 1XSVA 1UHWA 5F64A 1D8KA 3RPQA 2KIFA 1MKMA 4BHBA 3RKWA 4KDPA 2DQLA 1I5ZA 4WXHA 3R61A 4K2EA 5F6FA 5FLXZ 2ZMEA 4CYDA 2QQAA 2NS0A 4P5OA 3GFJA 2PMHA 1MJAA 2YX4A 4GCVA 2A6HF 3F6OA 2KJBA 5CJ9A 2X4HA 3GLXA 1LEBA 4N9IA 2COMA 1ZN2A 4E70A 5DV5A 3N4MA 2MLKA 3ECHA 3ZMZA 2GA2A 5HS7A 1H9TA 4BNCA 4OOIA 4LLGF 4GO1A 2A07F 4HA8A 3L00A 5ERIA 2V9VA 1P4AA 1YIOA 2D1VA 5D4RA 1UHMA 2BEOA 2QUFA 2VODA 2YPRA 1ZG5A 2FOKA 3D5LA 3WTXC 4EJUA 2IPQX 1IN8A 3GZ6A 2HFHA 1IF1A 3PQKA 4WF2A 5D8LB 2Z33A 1B6AA 2BV6A 3U1DA 3E5QA 1IN6A 4XSXF 4XRFA 1USSA 2DU9A 3FXRA 4Q47A 3MZHA 4KT5C 3HTSB 2LNBA 1FPQA 1YW8A 3IHUA 4EM2A 1E17A 2V79A 1O7FA 1B9NA 2L4MA 1ZG1A 2CGPA 5H6QA 4OIPF 3E6MA 5ILSA 2JZYA 1Z7UA 4AIJA 5LHGA 2ZCWA 1IN5A 3V8JA 5HDNA 1XD7A 2IA1A 1ON1A 1T6SA 3JAMZ 3F8BA 4F7ZA 1OPCA 3Q5FA 3BPVA 3CDHA 4A0ZA 5IT3A 3HRMA 1D3YA 1IN7A 1WKMA 4HV6A 2P7VB 4PZJA 4BH9A 3O3KA 2ZBKA 5FD5A 2D1HA 1UCRA 4LFUA 1TNSA 3IRQA 2GXBA 2OZ6A 2CFXA 5BMZA 2QENA 3FF5A 1PP7U 1F4KA 5LLQA 3CUQB 2CWEA 3JW4A 4L9TA 1R1VA 1Z1DA 1BIAA 1B4AA 1OMIA 3DP7A 2DPUA 3RPUA 4QLCU 3R4KA 2A6EF 4WXDA 3S2WA 2BBYA 4IXAA 4L9NA 1W5SA 2H6BA 2QM3A 4ESBA 2YSRA 3F8CA 3J80K 4P9FA 3ZMDA 5K5QA 1LNWA 2M5WA 1LB2A 2L02A 4CZZA 2M45A 1P2FA 3C1DA 4HV5A 1FYLA 2PLYA 4WCGA 1K7AA 1GXPA 1SMYF 2E7XA 3VODA 2R7DA 2ADUA 1S8NA 4FHTA 3CTAA 1ZYRF 3M9AA 2PFBA 5EEGA 4M72A 2HYGD 4KYWA 1BBYA 3BZ6A 1KA8A 4BXUA 3WGHA 1MZBA 3KP2A 4WXCA 1SMTA 2HQRA 3I59A 2XROA 5CVVA 3GX4X 4UHTA 5JI6A 5IT9Z 4A6EA 3KCCA 2QQBA 1O57A 1K79A 1HQCA 3JSPA 3GXOA 4RGUA 3COAC 1ZLKA 5ED4A 2M1BA 4BYYA 1BI1A 4BHCA 5DD8A 2ZXJA 3K69A 2QVOA 3MCZA 2MBFA 3BJOA 3E5XA 3E97A 2KIMA 1HKTA 1HW5A 4ZZDA 3KP5A 3ZQ7A 1RZ4A 4HQMA 5AIQA 4B8XA 5K5RA 4M6XA 4RAZA 1I27A 2Q2EA 3HSRA 4ENNA 4BAYA 1YG2A 3PFIA 3P9CA 3F72A 5D5WB 1R22A 1S3JA 4R8HA 2XKPA 1XB4A 4IHSA 5LRSA 4ETSA 1LJ9A 1LVAA 3B73A 2HZTA 5DDGA 2RV8A 3IWZA 3HRTA 5CVRA 2EA4A 3C18A 3RIRA 1XDUA 4A6DA 3GF2A 1IAWA 5BQTA 2LF7A 4MQ9F 2V1XA 2G9WA 3WTTC 4KIBA 3BP8A 4ESJA 4QWQA 1DDNA 4NQWA 1I1GA 3I58A 2H09A 1F1ZA 4LMYA 2YR2A 1S6LA 2RVCA 3ZMVA 2EJRA 2P5LC 1T39A 3BWGA 2NAZA 2ESNA 1F5TA 5JR3A 1AWCA 2ELHA 4KFCA 2W84A 2DTRA 2YU3A 1ONVA 2GWRA 4MTDA 4YIFA 4S05A 3WTWC 1U3EM 4RB2C 5D6FA 2IRFG 3TGNA 1STZA 4IF4A 1SFXA 3DEUA 1TQPA 3I64A 4U0VA 2STTA 1KQ8A 3ZP5A 3CO7C 1BI2A 1ZRFA 1DPUA 4G6QA 1FOKA 4UNOA 2W25A 2XGXA 4GXOA 1USTA 5LEKA 3GEZA 2HQNA 1EV7A 3KP7A 4PGHA 2EFOA 4NHJA 4ZYEA 2NNYA 1S29A 3ROUA 5BS6A 4I0AA 4EJVA 3U9GA 5L3FA 1FBSA 2MA3A 2YX7A 1YYVA 2CYYA 3KETA 2XAHA 3G3ZA 5HVQC 4UXNA 5D8KB 2F5FA 3WGIA 1U5TC 4CDGA 4GGGA 2OD5A 4I98B 3R0JA 1Z91A 5L3DA 3I53A 1UB9A 3BPXA 3RDIA 1A04A 1RUOA 5D5XB 3GZ5A 5LBQA 3TOBA 2Y0MA 2FBIA 4AWXB 1U2WA 1PDNC 2RDPA 4MNUA 3HRUA 5EEHA 4YG2F 2FMLA 1G3SA 3ERED 2K86A 1YFHA 4M6YA 1B1BA 5DCFA 2VE9A 4EV0A 1G4DA 5LRRA 3MAJA 1ZGJA 2EK5A 1NHAA 2FE3A 1FSHA 1J5YA 3U2RA 4G6DA 5FB2A 2QBYB 3HIFA 4RB0A 3P9KA 5H20A 2VT3A 1XN7A 3SXYA 4G94A 3ECOA 3LWFA 4HX4A 2HR3A 3N97A 5ILVA 2O3FA 2XAFA 1L3LA 5DEQA 3GVAA 1XMAA 5DCMA 3KLOA 4HZFA 5AIPA 4LK1F 3IC7A 4CGZA 1IN4A 1BJAA 2KJCA 3B02A 3KEOA 3P7NA 3GFLA 1RI7A 2BE5F 3L7WA 1DP7P 1DPRA 3T8TA 2X0LA 1XSXA 2WTEA 1X3UA 3MQ0A 3WE3A 4DNCA 1FSEA 1O7LA 3PQJA 2GQQA 1V3FA 3L2CA 1KGSA 2BGCA 3DF8A 2ZKZA 4ZH4F 2Y75A 3BJAA 4L18B 4FX4A 1YO5C 1REPC 3F23A 2HDCA 4RB3C 2EV0A 1P6RA 1KU3A 1R1TA 2QBYA 2F5DA 1IXRC 1E2XA 4HQEA 3O2PE 4IRHA 3ZMTA 1HSTA 1QBJA 1PUEE 2NRAC 4A2UA 1XDSA 2XASA 2ZO4A 1U5TA 3ABUA 3DKWA 4EMSA 2JSCA 2VBWA 2VOOA 5E1ZB 2P7CB 3KP3A 3RYPA 5LGNA 2DQRA 4OINF 5D4SA 3QPTA 2PN6A 3LSTA 2D2WA 2XAJA 2R7FA 1KYZA 4ZYGA 1HKQA 3IL2A 4PDKA 4U7DA 3R60A 2Y48A 1Z6TA 5A2QK 1MDMA 5JHUA 4TV7A 4I0BA 4UVBA 1ZAOA 2IVMA 5BPDA 1XGSA 3F6VA 3T5XA 1BM9A 4YIIA 4MEXF 1ON2A 2ZMEB 1J0RA 1Z6RA 3I59B 5A2QZ 4M74A 3EYIA 2Q0OA 2XV4S 3Q9VA 3ZMSA 5LHHA 2OAZA 2JRTA 1P4XA 2O03A 1W7PA 3H92A 4P96A 3GFMA 4BHPA 4LG0B 1C0WA 3GYHX 3F8NA 4HF1A 2L4AA 3SQNA 4XSZF 1RIOH 2DT5A 1FBQA 2IJLA 2VXZA 2EWNA 4KUMA 4KN4X 2EFNA 3GUDA 2IA0A 1BC8C 3HHHA 2L3DA 2EV5A 2OZUA 4Y17A 4HF0A 3FX3A 2PJPA 3C7JA 5F1RA 4YFNF 1BI3A 2XUBA 4OU0A 3TO7A 4L9JA 1TBXA 3RI4A 2K27A 1U78A 2L01A 3E6DA 2EV6A 1FP2A 1OYYA 3AAFA 3KZZA 4P9UA 4I01A 4UV9A 2RNJA 2PBIA 4HLXA 1XGNA 1XMKA 1R00A 2HKXA 3IKVA 3LQQA 4M73A 2FBHA 3KP6A 1FBUA 2ESHA 3REOA 1LEAA 2ZNZA 2A69F 4AVPA 2ZNYA 4KMUX 3KEQA 4B09A 4L5JA 1IXCA 3RYRA 3QPHA 1ZLJA 3GWZA 4L0ZB 3OOPA 2CQKA 3LAJA 1MJ9A 1YS7A 1YLFA 2R3SA 3FMSA 5CYVA 1J59A 1BOAA 1QZYA 4LD5A 2MD5A 1CGPA 3RTRA 5BPIA 2FSWA 3CUQA 4XLPF 4HAMA 2LSOA 1SFEA 1TTYA 4N9HA 2XAGA 4EQQA 1TNTA 3IKTA 4UUVA 3F8FA 1SFUA 1LDJA 1R5HA 2IP2A 1S7AA 3NRVA 3CUOA 3G73A 4HLYA 3KZYA 5ICFA 2VOPA 4HOBA 1U5TB 2XIGA 1ZGAA 2NNNA 1I1SA 4MTEA 1JHFA 2VC1A 2AS5F 2O0YA 1P92A 4M71A 2PI0A 3ELKA 1R36A 5CLSA 4RAYA 4EGYA 4YFKF 6PAXA 2O61A 5L3GA 2DLLA 3QOPA 5L3BA 2KKOA 2GZWA 4R79A 4IRGA 4HF2A 2G7UA 4P55A 1KU9A 5HS9A 2MC3A 5E8IA 4L9VA 1QZZA 1HXDA 2P8TA 1OKRA 2ISYA 1XCVA 2D45A 1UFMA 3VFZA 3LAPA 4A0XA 3K1NA 1Z9CA 4HX8A 2Z3YA 3DPTA 1TQMA 3K1PA 3MEXA 3IWFA 4JK1X 5ICCA 2KRFA 1U6GA 4OIOF 1L0OC 1XGOA 2DW4A 1EH6A 3V8KA 1WI9A 2VBYA 1QPMA 3IRRA 3KLNA 4ZYHA 1ZH5A 2HTJA 1KU7A 3NQOA 5D5UB 3TDZC 4G7ZF 1LDKB 3VEPA 4S04A 5HLIA 2UXXA 4IVNA 2V6CA 4OMZA 2KIUA 4JBAA 4Y15A 2HS5A 2P6TA 4L5IA 2CG4A 4RS8A 2TDXA 4WX9A 4D0PA 1BI0A 4H0EA 2FRHA 2JTVA 4ASNA 4G7OF 1D5VA 3QP6A 3WTSC 3I4PA 4PGGA 1G6NA 1W7PD 2IT0A 5J8CA 3MFKA 3OV8A 5HS8A 4MGRA 2UZKA 2F2EA 4G8XA 3L09A 1FYMA 5DYMA 3SHFA 3KE2A 3M8FA 5E17F 2MH2A 3HSFA 1GXQA 1FYKA 2WWYA 1FLIA 2FA5A 3WTVC 1ZRDA 3SFZA 5CVUA 2F5CA 2EFQA 2QZ8A 1MJBA 3GO5A 4EM0B 3WTZA 1S7OA 2DI3A 5CVJA 5E18F 1HBXG 3HUGA 4CO8A 1IW7F 2O6GE 3I71A 1QO0D 2OU2A 2M87A 3I5UA 3BDDA 3V8LA 3TQNA 2VE8A 3FXQA 1TQIA 1O3RA 1GHCA 3WG9A 1BC7C 3V7SA 2ISZA 1Y0UA 5LGTA 1R58A 3ML6A 2A3SA 1OYIA 5FLXK 2ETHA 4M9XA 1FC3A 1MD0A 2EFPA 4EJTA 2V1DA 1U8RA 4UVAA 2DBBA 5FFXA 3H3ZA 4MHGA 3WU0A 4RGXA 5IT9K 1HW2A 2HTSA 5L3CA 1FZPB 2A5YB 1ZREA 1O3TA 1FT9A 1MDMB 1TW3A 1SAXA 3E6BA 3HTUA 4A12A 1T98A 2VONA 2FF4A 2H6CA 2W24A 4GYIA 5JVTA 2BYVE 3FMQA 3FXUA 3ZPLA 3K1MA 3TDUC 4G7HF 2FBKA 3O6BB 3V7CA 2RN7A 1ODDA 1R23A 2ZFWA 2RC4A 4Q48A 3ZN0A 1CF7B 4WWCA 2HKOA 2K4BA 1RUNA 2FNAA 1FWZA 5FO5A 1H9GA 3I54A 5FD6A 3J80Z 1FX7A 4I09A 3EDPA 1JE8A 4FT8A 3DV8A 4LLNA 2QYOA 5DUKA 4L0YB 3J7AO 1T2KA 4CICA 1EH7A 5HLGA 5K5OA 2XKOA 1WRJA 5E1XA 1TW2A 1IUYA 5E1WA 1KQ0A 4O5VA 5LHIA 3GW2A 3JTHA 3K9TA 1YW7A 2K02A 4KA4A 2OQRA 4I7HA 3DFGA 1XCBA 1W7PB 3EETA 3BROA 2PQ8A 3WODF 1ZG3A 2VBZA 4NB5A 4OIQF 2XHKA 3EQLF 1K78B 5DCMB 1F9NA 5BOXA 4CXFA 1FNNA 1LQ1A 1J9IA 4A0YA 2W57A 4GYGA 3TOAA 3JAMK 1IRGA 2FQ3A 1B9MA 1KQ9A 1K6OA 4KIGA 2XRNA 4LGWA 3LQRA 5K1YA 1O3QA 2DK5A 3LA2A 3DQVC 4HDUA 4ENKA 1ZHFA 2STWA 3TKYA 3DXJF 2LKPA 3FWEA 4HDVA 3DPLC 5D6EA 4G9YA 4EM1A 1J75A 1YTYA 4IPAA 3WE2A 5CVIA 5J6XA 4CHUA 3F3XA 2W85A 5ILUA 4MQVA 1LDDA 1TLHB 2CSOA 3HSEA 2C6YA 4MEYF 4EVIA 1WWXA 3HHGA 2DPDA 4HW0A 1QGPA 3F8MA 3C3WA 3EYYA 5AONA 2P5VA 3V7RA 3L9FA 2OA4A 1SD5A 2GIVA 1IXSB 4M9SA 3GFIA 4U0YA 1T0FA 2CO5A 4ENMA 5HLHA
chains in the Genus database with same CATH superfamily
1ORKA 3JTGA 1DQUA 2GA1A 4HNUA 1K4SA 5GAEJ 1W5TA 3QRFF 3J80C 3HRSA 1VTNC 1V54H 3CO6C 1JTXA 1DGCA 2QWWA 3IWCA 1ZRCA 1OCZH 2YTGA 1TN9A 4FISA 4BU2A 1L4SA 3TP0A 2FTXB 2VQGA 2E1CA 5DUIA 1K78A 5J4VA 1JXSA 3FHZA 2DOFA 3MHHC 3K2ZA 2MH9A 3P9IA 2WV1A 4LF7E 3EPKA 2ACJA 3VB2A 2Q1ZB 1AOYA 3A1YA 1VQ4I 3EPJA 2JJ7A 3VYUB 4IEJA 3I0TA 4ZDPA 3QYFA 3WU2C 2DT6A 2K9LA 3QU3A 5TJJA 2EN1A 2RGVA 2Z2SB 2MG4A 2WB1N 3RCOA 3ABTA 5LGUA 1IMUA 5J1UA 4AUXA 5GADJ 3O8GA 1ULYA 3BC8A 2VQEE 2HVRA 2CW7A 2BY1A 2XVCA 2HHHE 2ZMEC 1YQAA 1R4NB 3V4GA 1TF6A 2J5OA 3HPSA 4PJMA 3F6HA 1IRFA 1RR8C 2QQ9A 3THNA 4A3CJ 1J7KA 1T95A 1S7EA 2M0CA 1R5GA 4Q35B 2FNPA 3K2AA 3OYEA 3GTQJ 4NZVA 2GXGA 3V42A 4OOGC 3KZIC 4C2MJ 2PEXA 3WU1B 4C2UA 1SD7A 2UU9E 3K0LA 2DN0A 2MYSA 1QA6A 2M7QA 2UXDE 2VPLA 1WZ2A 2X6WA 3HYIA 4AD9A 4RBOA 2I5UA 2NYXA 3DEEA 2QA4I 3S1QJ 1KU2A 1WJBA 2EL4A 4WYQB 4BQNA 3AL0C 2Y9ZA 4A3IJ 3CLOA 4N0BA 2IGKA 3ISPA 4UB8C 1AKHB 4V2FA 5L3EA 2OQGA 2KRCA 3PSIA 3S1RJ 2Z9OA 5H6RA 1G3YA 3F21A 1QHGA 2M30A 3M4OJ 1W1WE 2PMUA 1JHHA 4F55A 2H94A 3RKXA 2ZJ2A 2JVGA 3J7AY 2EMGA 2Z99A 2BHYA 1GVJA 2YTQA 2FGGA 1XGMA 5FGMA 3IH3A 5CQEA 4I2OA 2JPBA 5HDGA 2L7ZA 4FX0A 4BBRJ 4XBFA 4HYEA 4MO7A 4Q5SF 1YPNA 3EPHA 1XSDA 3LA7A 3W6KB 2AXTC 2H27A 4M3GA 3OR1C 5E20A 4Q4ZF 3GTLJ 3EQ1A 1HSJA 2RQPA 2HWVA 3VOEA 4KIFA 4M3EA 2KRHA 5EZHA 4WK8F 5JFRA 4DR2E 1O3SA 2EM8A 1TWFJ 3HJEA 1G3TA 4D5CA 4DR7E 4X8WA 4O3MA 1IDZA 4ZJZA 2GAUA 2EFWA 2AQEA 3LA3A 1WHNA 1D8JA 5FJ8J 2CV0A 3CUQC 1BN5A 1R71A 3CLQA 2KIQA 4R2RA 3M7GA 4XK4A 3OS0A 4MLVA 1RMDA 1ERDA 3ADJA 3QYBA 1OYWA 5KK1A 5DD4A 1POGA 4EGZA 1R7JA 4BQAA 4KN7X 4IRIA 5GTIC 4C3IJ 2FXAA 1MMDA 1FY7A 2R1FA 2M4KA 4OX9E 1IZ1A 3U1KA 2K4JA 1A6QA 3FZVA 4QPQA 3MWMA 2GBYA 5ADZA 2Y9YA 1YYOA 2K7LA 2YRHA 2EA2A 3WHBA 1XMQE 2YTDA 1ETVA 2FV4B 1FTTA 4L8NA 1QVTA 2W7NA 1HDDC 3J81K 3E3VA 2HEOA 4IHTA 2CW0F 3OYFA 2IXSA 3BF2A 4U0WA 2XGCA 2A6TA 2EOJA 2NS8A 3OYMA 2K9NA 2N8GA 1J2XA 1GUUA 2A68F 2UXNA 4F52A 4RMNA 3ZOBA 3TQMA 2M0MA 4R1HA 1Y1VJ 4A5NA 5M3FJ 2QLZA 4O6JA 3MSWA 4LG0A 1V4RA 2EZHA 2J5PA 2QF7A 3LSPA 4HNTA 3MKWB 3FM5A 4JI7E 4ESFA 3SZPA 3FXJA 4XN3A 4LB6B 3ZR8X 1W4MA 3ECRA 1ZK8A 4O4KA 3PIOF 2R5ZB 2VBXA 1N36E 1JTYA 2FX0A 3QG5C 2EB7A 1PYVA 2Q8UA 3HOTA 1WSUA 4LJZF 3BIDA 1A1GA 3T0YA 2HJJA 5KL5A 1U0JA 2L33A 3OOUA 3Q9SA 1EH8A 1XMOE 2LREA 1WGXA 2JXPA 2L54A 3TO9A 1MGTA 2L0KA 2MDRA 1SFKA 1VQOI 4AIHA 4JI5E 4U7BA 5J47A 4OMYA 1MMGA 3I4NJ 4AQYE 4XKVA 4XOTA 2Y30A 4F6MA 2BVMA 3GCMA 1BOBA 4DR5E 3ZN1A 2P5KA 2JT1A 5FFZA 2VKHA 5J8FA 2MW8A 3NEUA 1YW9A 4UB6C 1N25A 4ZYDA 2UWMA 5HDKA 3K6GA 1PP8F 1H0MA 3OYJA 1K6YA 3FDYA 4LK0F 2DIXA 2EMLA 1SD6A 4Y13A 3DBLB 2EMYA 3AG2H 3SZTA 2JOXA 4XLNF 4BDZA 4LFCE 1GZ6A 2LFBA 4RGSA 4DW6A 3JSOA 3QAHA 4KNYA 1DUXC 4BXXJ 1V5GA 4UV8A 1HW1A 3H3UA 2H1KA 3RKYA 3THOB 4PCQA 3OS2A 5AC5A 1XNRE 1UELB 4XIDA 4EJWA 2V1UA 5F3WA 2O8XA 4L5NC 1QVUA 2DAOA 5FKOA 1S72I 2M3AA 2IA2A 2KDOA 1P4WA 1QQIA 2VN2A 1BW5A 2LYCA 1B59A 1I6XA 2Y0SN 4DR3E 2K9MA 4DQ2A 2LF8A 3BJ6A 3SEZA 3WGGA 2EL6A 5TGTA 3KP4A 1CF7A 4LF6E 4ENJA 3CJQB 4U88A 2IS6A 1HR0E 2OTJI 3S93A 4BL0B 4X62E 4JI0E 5GAGJ 3PNTA 1XX5A 2VC0A 2F4VE 1HKSA 4IJAA 3HKZA 4YFXF 4IOAF 2EM3A 3FMRA 3EUKL 2B3TB 4EJOA 4CYCA 3OIPA 1ZARA 2HOSA 2E1NA 4XMYA 4A5MA 1FP1D 2EINH 3BOQA 2P6SA 5ICEA 4FE7A 2F5EA 4RB1A 1PUFB 1MNMC 3HOUJ 2CQNA 3EUHA 3TO6A 1YS6A 4RH8A 1FIPA 3FK6A 1T38A 3M1EA 4X65E 2EPOA 2NXNB 2Q8KA 5CFFE 4P1WA 2V9KA 2LDUA 2VT2A 3A4CA 3LFKA 2DTZA 2M8EA 3H3VK 3HZJA 1R49A 2RPCA 3UR3C 5HNFA 3HOSA 4DV6E 2FMYA 3KFWX 1ZR9A 2IW5A 5IWAE 4HX7A 1YITI 2A61A 3DJWA 4ZC3A 1E3HA 1AAYA 1Z67A 4IHWA 4JV5E 2FU4A 3A0HC 3R0AA 5KVRA 1F36A 2MLGA 5ICGA 2PJRA 3J81Z 2ZSHB 3ULQB 3DLLF 3FM3A 3RJPA 2R4GA 9ANTA 1D5YA 2XSDC 1KYWA 1HOMA 2L2MA 4ON0A 3F22A 4AIKA 1Z05A 1R1UA 3A03A 3BY6A 5E3LA 3WTUC 1G3WA 3L2RA 3R6SA 2EOXA 1X1PA 2DFIA 3T1BA 5LEJA 3X2QH 2EQ1A 3BLYA 4OIRF 1SD4A 2OCEA 2G7HA 2E7WA 1Y39A 4M9VC 2NVTJ 3JRIA 4DBQA 3QWLA 3MKLA 4RM3A 3QU6A 4Z2YA 2FEZA 5D5VB 3VYXA 2R7RA 3W6JB 2XAQA 3T8RA 3ZMUA 2X6XA 2BXZA 2JPCA 4IO9F 3FISA 4DIQA 2WC2A 4M9ZA 2E34A 4I02A 2MABA 3AFHA 2Z5UA 3MZYA 1BIBA 3CJNA 1QNTA 5AE2A 4RGRA 3G1OA 2LH9A 1JKQC 1OR7A 2J7JA 2B0LA 4KICA 1LE8B 3W2WA 3CZ6A 1KJKA 2PX9A 3D0SA 3QP5A 1P47A 1WQ2A 2KFDA 2HOEA 5J4YA 5M5YJ 2WBUA 2IGOA 3CJTB 2E71A 4UVCA 4JQFA 4JX6A 4V2GA 2DA5A 3NARA 3GTGJ 3P1XA 1UMQA 4LB5A 1SVLA 4LLLA 4WFTA 1T8IA 3BG9A 3E6CC 1S9HA 3I56I 1FEXA 1D0XA 2OBPA 2DK8A 4B48A 2AXLA 2P4WA 3WTYC 3W6VA 4HBLA 2ECCA 1X5WA 2EOSA 2LCEA 3M8EA 1T4NA 3PO2J 2RKHA 1SVOA 2LY1A 2WV0A 3K4BA 4UY8I 4M2ZA 1Q1HA 2ME6A 2E1OA 2HGCA 2LY2A 5TRDA 3CCJI 2DO7A 3E5UA 1JUSA 2QQ8A 3TL4X 2PG4A 3CMMA 1JGSA 4B4CA 5E8GA 3S2DJ 5HOOA 4IQ4A 2JUGA 4KMFA 2EM9A 1RNLA 2LT7A 3MD2A 4ZZLA 2HYFA 1XSVA 1TT0A 1UHWA 2LBFA 3PIPF 2HC5A 1Z3XA 5F64A 5KAFC 2LV2A 1D8KA 1TC3C 3CC4I 2ENHA 4NHRA 1MW7A 3RPQA 1S5LC 2KIFA 1YIJI 3EUAA 4IOCF 1MKMA 5F0CA 2K85A 2DMQA 3CMYA 2NUFA 4BHBA 3A2KA 2EM2A 3RKWA 2KZVA 2DQLA 1I5ZA 4WXHA 4KDPA 1MIJA 4XM3A 5EDNA 3R61A 4I99C 4K2EA 3ADGA 3AV0A 1TF3A 2QCOA 5F6FA 1X6HA 3SFIA 3DTEA 2DA4A 5FLXZ 4QTRA 5FRMA 2ZMEA 4CYDA 2BHZA 2QQAA 2NS0A 2FQ4A 3GFJA 4P5OA 2PMHA 2BBGA 1A6IA 1MJAA 4RA2A 2L2NA 2YX4A 3S15J 4GCVA 2EIKH 1D1AA 3ZQHA 4XICA 2A6HF 3F6OA 2KJBA 5CJ9A 2JQ7A 2X4HA 3GLXA 1LFUP 1LEBA 1X6FA 4N9IA 2JRMA 3M07A 4AYBA 2VE7C 3L2UA 2COMA 2LVSA 1ZN2A 4E70A 5DV5A 3N4MA 2MLKA 2WZOA 3ECHA 3ZMZA 2B63J 2GA2A 1IRXA 4IZZA 2GXAA 1RKWA 5HS7A 1H9TA 4BNCA 5AASA 2VQCA 3QPLA 4OOIA 4LLGF 1A36A 4GO1A 2A07F 2YS9A 4HA8A 1WH5A 2F4IA 3L00A 4PFPA 5ERIA 2R0QC 2V9VA 1P4AA 1YIOA 2D1VA 3IAM2 4BEHA 5D4RA 4D1QA 4D5FA 1BR2A 1QU3A 1UHMA 3HL2A 2YSOA 2BEOA 2DOEA 2QUFA 4BUPA 2VODA 3HGGA 2WY7Q 2JOBA 2YPRA 2IGMA 2HPIA 2EN3A 2JUCA 1ZG5A 1VQ5I 4A93J 1J5EE 2FOKA 3D5LA 2TRTA 5HLTA 2QSFX 1MBEA 1MNDA 3WTXC 3HOVJ 2YTJA 4EJUA 2IPQX 4HSTA 4BE0A 2JA6J 1IN8A 4X66E 2DJIA 3GZ6A 3CCQI 2VI6A 2CUEA 1I39A 2HFHA 2JWTA 5AC4A 3QPSA 5CKTA 3PQKA 4WF2A 1IF1A 5D8LB 2Z33A 2VLAA 5J40A 1B6AA 1DU0A 3CCUI 4LIUA 2BV6A 2V85A 3U1DA 1X3ZB 2LK2A 3E5QA 5FKMA 1IN6A 4XSXF 3VSLA 2VB6A 4XRFA 1USSA 2B7EA 3QOEA 1JK2A 3J81C 4LF5E 4JX5A 1K83J 1X58A 1MSEC 5KNLA 1JUMA 2DU9A 2VQLA 1AKHA 3FXRA 2EM6A 4Q47A 3G6EI 3MZHA 1LLMC 4KT5C 1RC7A 1IJWC 1ZR2A 3HTSB 4CH7A 1MSFC 3OWTA 2LNBA 1FPQA 1VQKI 1YW8A 4G6TB 4DYCA 3L2WA 2GHFA 2I8DA 3IHUA 3QQAA 2L5QA 4EEFG 4EM2A 3NWTA 2IS1A 1E17A 1OJLA 1R5ID 4NBQA 4DYRA 5J3LA 2V79A 3OYGA 4A3JJ 1X49A 4GZNC 4TUGA 1O7FA 2ZM6E 1B9NA 2L4MA 1ZG1A 2CGPA 5H6QA 4OIPF 3FHNA 5GPAA 2ZC2A 2E2JJ 1QRYA 4BE1A 2PRTA 3FXMA 2E5ZA 3E6MA 4HTGA 3CESA 2B7TA 2VPRA 5ILSA 3OYDA 1WI3A 2JZYA 4A3FJ 1Z7UA 2EPNA 2W4SA 4AIJA 5LHGA 1FOXA 5CPRB 2EQ0A 2ZCWA 4BJ6C 1IN5A 3V8JA 5HDNA 1XD7A 2IA1A 1YYKA 4E7JA 1ON1A 2JA5J 2V87A 2AQFA 3BBGA 4LTYA 5A6BA 4BKXA 1T6SA 3JAMZ 3F8BA 1KYQA 2JVAA 4F7ZA 3IV5A 1OCOH 1OPCA 3Q5FA 5IPAA 3S2HJ 2V83A 5FROA 1I94E 1YX3A 3BPVA 3CDHA 4XLAA 4A0ZA 5IT3A 3HRMA 1D3YA 1IN7A 1WKMA 4HV6A 4MLOA 2P7VB 3EPLA 1IRZA 1A1JA 1TWCJ 2VJJA 4WSGA 2E1MA 4PZJA 1LUJB 4BH9A 3O3KA 3JRCA 2ZBKA 2DT7B 2XDVA 5FD5A 3ZCOA 2D1HA 1UCRA 3ZQQA 4LFUA 3CCEI 5JLXA 1VI0A 2ZXWH 1TNSA 3OL3A 2M1SA 1BR1A 3JRBA 4DJAA 3IRQA 2GXBA 2XPVA 2JR1A 2OZ6A 2CFXA 2L3JA 2M8GX 2KLOA 4Y33A 5BMZA 4F9CB 2QENA 3FF5A 1PP7U 2KOUA 1IDYA 4WSPA 1NG6A 1F4KA 1PVEA 5LLQA 3CUQB 3RZOJ 1A1IA 3A0BC 2CWEA 4CCOA 1PJSA 3FKIJ 3BQZA 3SZGA 3T1HE 3ASOH 4HPQA 5A6KA 3IH2A 1LFBA 3JW4A 4L9TA 3NAUA 2YTOA 2L7MP 1R1VA 1HNXE 2PMZA 2CUJA 2DLKA 3BR2A 4I6ZA 4XQFA 1BB8A 1Z1DA 1BIAA 5M5WJ 2E60A 1B4AA 1OMIA 3HOWJ 4FE4A 3DP7A 2ELZA 1XNQE 4XLCA 2DPUA 3K4JA 3FKJA 2ICWG 4G12A 3K4CA 3RPUA 4W1UA 3R4KA 4QLCU 2A6EF 4WXDA 3S2WA 3G71I 2KHXA 5CQGA 2BBYA 4IXAA 4L9NA 1N77A 3H5NA 2CUFA 2XSJC 1W5SA 5C44J 4P78A 1D0YA 1T56A 2H6BA 4LOCA 2QM3A 4ESBA 2YSRA 3F8CA 3J80K 3IAS2 4JOMA 4P9FA 3C2HA 3ZMDA 5K5QA 1LNWA 2M5WA 1LB2A 2L02A 3C6KA 4CZZA 2M45A 4IQJA 3H9QA 1P2FA 3C1DA 2K3FA 4HV5A 3UKGA 1FYLA 4DGWB 2PLYA 2EZIA 4WCGA 2UUBE 1K7AA 3OMYA 1GXPA 1SMYF 3OMLA 3L1PA 2E7XA 1X2NA 3VODA 2R7DA 2ADUA 2EMWA 1S8NA 1T33A 4FHTA 4XRSG 4OAZA 3CTAA 1DQ3A 1ZYRF 3M9AA 1Z77A 2PFBA 5EEGA 3K4MA 3OYLA 3FXLA 4M72A 2HYGD 2RTXA 4KYWA 4FETA 2XGEA 2HNHA 4R2PA 4O5GA 1STUA 1SANA 3GTPJ 4BY7J 1BBYA 3MZ8A 3BZ6A 4YY3E 3OSGA 1KA8A 2R92J 3I4MJ 1X2MA 3BQYA 4BXUA 3LLHA 3WGHA 1YRNB 2EMHA 4XRSA 1MZBA 3KP2A 1A5JA 4WXCA 1SMTA 2HQRA 3I59A 1DGWY 2X1CA 2IS2A 2LRDA 4D7MA 4F2JC 5BR8E 4NXME 2XROA 3ONQA 5CVVA 3GX4X 1Z7LA 3JCUC 5FRNA 4UHTA 5JI6A 5IT9Z 3DEWA 4BEHB 3HPHA 3KCCA 4A6EA 2QQBA 5E3MA 1WHQA 1O57A 1MMAA 1K79A 1HQCA 3GXOA 3JSPA 4IS1C 1XS9A 4RGUA 3AG4H 3COAC 1ZLKA 3CDIA 5ED4A 2M1BA 4BYYA 1NCSA 1NG7A 2VUMJ 3OL4A 4B43A 4F3QA 1BI1A 5DD8A 2ZXJA 3K69A 3HKZN 4BHCA 4C2TA 4RDUA 2ELYA 2QVOA 2WAFA 4DR4E 2IHR1 2NA2A 3MCZA 1WVRA 3E7LA 1N78A 1ITYA 1BL0A 4F93B 2MBFA 3FK7A 1HNWE 3ABKH 2M7AA 3BJOA 1Y8RB 2ME0A 3E5XA 1RC9A 3E97A 2KIMA 5EEAA 2LBSB 1HKTA 3H5AA 2R7ZJ 2ZSIB 3KYDB 2EPUA 3BR1A 1HW5A 1LFPA 2VF1A 2LVHA 2ID6A 2CV1A 4ZZDA 1FOYA 4II2A 3KP5A 3ZQ7A 2MC6A 1IV8A 1RZ4A 3LSHA 3PNYA 2WBSA 4HQMA 2ECBA 5AIQA 4QPOA 3OYKA 4XOPA 4B8XA 5K5RA 3OYCA 3TBIA 1APLC 1YJNI 4M6XA 4RAZA 1I27A 2Q2EA 1MMSA 1SAUA 2LTSA 2YRMA 3HSRA 3F9KA 1VNDA 4N4OB 2JPAA 4ENNA 1ETWA 3CCSI 2V4JC 2L92A 4BAYA 2EPLX 4PSWA 1YG2A 2K5CA 2OPTA 1B8IA 1SR9A 3IWBA 1MH3A 1YJWI 1HNZE 3PFIA 2FD5A 4NQWB 2CTDA 3P9CA 3F72A 5D5WB 2DA1A 1R22A 4KWYA 3JRGA 1S3JA 4R8HA 4BS9A 1WJ5A 4Y3OA 2VKDA 2XKPA 1XB4A 4IHSA 3F0CA 1T0FC 3GTOJ 5LRSA 4ETSA 1LJ9A 2EIMH 1LVAA 2OJED 2EN4A 1FTZA 4V19K 3B73A 2HZTA 2DMIA 2E1MC 5DDGA 3BT9A 2IS4A 2HI3A 5F0FA 4R2CA 2KDZA 2RV8A 3IWZA 3HRTA 5CVRA 4AVZA 3CD6I 4E6KG 2OF7A 2EA4A 3M1CA 4LITA 3C18A 3RIRA 1XDUA 3W2VA 3C2BA 4A6DA 2HVSA 3GF2A 2HOAA 3OYNA 1GT0C 1IAWA 5BQTA 2EM0A 2YT4A 2DGCA 5HODA 4IHVA 4B47A 2LF7A 4MQ9F 2MGQA 4OWRB 2V1XA 5EF6A 2G9WA 4NC8A 4F91B 3WTTC 3GLLA 2K4VA 4KIBA 3DLAA 4KISA 3BP8A 3RQ4A 1YYWA 4ESJA 2LTRA 2CQ7A 4QWQA 1MBFA 4BJ5C 2L2OA 1DDNA 5J1YA 4X6AJ 4NQWA 2YTEA 1I1GA 2K3PA 4XONA 2NUGA 2ZFUA 1I3AA 3I58A 5EGOB 2H09A 1F1ZA 2EIJH 4LMYA 2YR2A 1S6LA 4CYCB 2O8KA 2RVCA 1MBJA 3ZMVA 2EJRA 1IUFA 1Z1BA 2P5LC 1T39A 3BWGA 2NAZA 2ESNA 1F5TA 2EOFA 2DODA 2VASA 5JR3A 1AWCA 2QSHX 3HEFA 3AL0B 3PSFA 4HNVA 1FOWA 2ELHA 4HEA2 5IYDJ 4KFCA 2W84A 2EPAA 4F92B 5KL3A 1U9NA 1R6RA 2DTRA 2YU3A 1ONVA 2GWRA 1T4OA 1IGNA 4MTDA 2BZTA 3BTIA 2EWLA 3PUFA 1H89C 1JGGA 3C2GA 3OR2C 2E36A 4YIFA 3LFUA 4S05A 3BTLA 1I6HJ 3LMLA 4KZSA 1ETXA 3WTWC 1U3EM 4RB2C 5D6FA 2IRFG 3TGNA 1STZA 4IF4A 5E79C 3MN2A 1SFXA 3DEUA 4XL9A 5EG0B 2I10A 2KONA 1TQPA 3I64A 3MMYB 3RKQA 2NVUB 3TP3A 2ADRA 4U0VA 2STTA 1A1LA 2LC2A 3CCVI 1KQ8A 1D1CA 4AU7A 2E1MB 3DBHB 3ZP5A 3G1MA 2NOGA 3PUBA 1Z3YA 3JTZA 1JK1A 3CO7C 4GRIA 5IOZA 3PJRA 2CMPA 1BI2A 1ZRFA 2B7VA 1DPUA 4G6QA 1FOKA 3DTIA 1X19A 4UNOA 2W25A 2XGXA 4GXOA 4PJ0C 3WHCA 1USTA 5LEKA 4A3DJ 1BA5A 3VK6A 2HGHA 3GEZA 3LMMA 4CSWA 2HQNA 1EV7A 4QIWN 3KP7A 4PGHA 2EFOA 1BBOA 1ZKGA 4NHJA 1QU6A 5B66C 1ZTRA 4ZYEA 3DWLE 1S29A 2NNYA 1X3CA 2F8BA 3IP4B 3ROUA 2EPCA 3HM5A 5BS6A 4I0AA 4M6VA 2WB1A 4XLEA 2N8XA 3HQ1A 5A6BD 4EJVA 3U9GA 1YRNA 4DV3E 4CCLA 5L3FA 4LFBE 1FBSA 1VZ0A 2MA3A 2YX7A 1YYVA 5FKKA 2CYYA 3KETA 4MFDA 2XAHA 1BR4A 3G3ZA 1A1FA 5HVQC 4JYKA 2MC4A 4UXNA 5D8KB 2DMYA 2CH0A 2F5FA 5JVGF 3WGIA 1U5TC 4RAGA 4CDGA 4GGGA 5EZGA 2OD5A 4PSXA 3CCLI 2LMZA 2F6CA 4I98B 3R0JA 1Z91A 1JKRC 1IG7A 1A31A 5IV8B 1UJ8A 5L3DA 2LD5A 1NK2P 3K70D 3I53A 2R7WA 1WFXA 3HDDA 1UB9A 5K7FA 2ELJA 3BPXA 3RDIA 1A04A 1RUOA 3SEQA 5D5XB 3GZ5A 1ZU1A 1GLNA 5LBQA 1WJEA 3TOBA 2Y0MA 1TWHJ 2E5NA 2FBIA 4AWXB 1U2WA 2EPZA 4BACA 2JK3A 1PDNC 3SYTA 1N3GA 1QPIA 2KMUA 5TISC 2XC7A 2RDPA 3OYHA 2JYAA 4MNUA 2HDWA 3HRUA 1U8BA 5EEHA 2RNGA 4YG2F 2BY2A 2FMLA 3U21A 1G2FC 4TUIA 2O7OA 1G3SA 3ERED 2K86A 3QYEA 1YFHA 4M6YA 1B1BA 4DV5E 4JI3E 5DCFA 1J26A 4JX4A 2VE9A 2CFOA 1TZLA 4EV0A 5LRRA 3MAJA 1G4DA 1ZGJA 2EILH 2EK5A 3JRHA 3C6MA 2EN7A 3DKXA 2EPMX 1NHAA 2FE3A 3Q3SA 1FSHA 4B3SE 4XKBA 1J5YA 2L9SA 3U2RA 2PJRB 4G6DA 5FB2A 2QBYB 4J8ZA 4DV7E 3HIFA 2WADA 4MLQA 2AO9A 4RB0A 1OCCH 2W00A 3A01A 2NABA 3ZRGA 3P9KA 5H20A 2VT3A 5DM7F 5BNGA 3JRDA 2XB0X 4J19A 4F9BB 1XN7A 3SXYA 2WBMA 3GBGA 4XN0A 5DS9A 3RMPA 4G94A 3ECOA 1LKXA 2O5RA 3LWFA 3O8HA 3J7Yp 1YSAC 4HX4A 2GLOA 2HU9A 4FCYA 2HR3A 1YUIA 1I3QJ 3N97A 4CCMA 2LY9A 3BG3A 2EZLA 4NNJA 5ILVA 1GTKA 5F1JA 2M34A 1YE9A 2O3FA 3J7AG 2XAFA 1YZ9A 1L3LA 5IP9J 3TW7A 2YU8A 2A5WA 4ZYAA 5DEQA 3GVAA 1XMAA 5DCMA 2DSYA 2Y31A 3KLOA 4HZFA 4CCKA 3HG9A 5AIPA 4Y4RA 4LK1F 3RQIA 2W1OA 4YIRX 4R8OA 3ABLH 4PJJA 5A2QC 1GV5A 3IC7A 2EORA 2EPFA 4CGZA 2KISA 1EF4A 3DTKA 1W0UA 1IN4A 1BJAA 2KJCA 2XB5A 3B02A 3VYTB 2OC6A 2EMXA 2V7FA 3KEOA 3P7NA 2JA8J 2L9RA 2EP3A 2WAQN 3S17J 1X1BA 1JKOC 3CQZJ 2H1LA 4RHBB 1NK3P 4F6NA 3GFLA 1VQ8I 1RI7A 4RLFA 5EGOA 2DXIA 2BE5F 3L7WA 4D9JA 5FLVA 2R7TA 5TSEA 4DV4E 5EYRA 4II3A 3ZGKA 1DP7P 2DYSH 4A69C 2CJJA 1DPRA 3T8TA 3OS1A 4R2SA 2DCEA 3G1LA 3VYYA 1YUJA 3BTCA 1HA8A 2X0LA 1NTCA 3BTJA 1AH5A 1WPKA 2CUZA 2GLIA 2EN6A 1XSXA 4L5EA 2RSMA 2RREA 1DP3A 4BBYA 2WTEA 1ZAAC 2CQQA 4F9AB 4GFBA 1X3UA 2GOMA 3MQ0A 3WE3A 4DNCA 4O43A 1GVDA 4C3HJ 1N32E 2HOTA 1FSEA 1O7LA 3UK3C 3PQJA 2LOOA 3VYSB 2HXIA 2GQQA 2VIXA 1A1KA 4ZTJA 1V3FA 3CMAI 4K0KE 1ETYA 2DA2A 4XRMA 3OSFA 1UZCA 3P5JA 3L2CA 2VQHA 5A6JA 1OISA 4R2EA 1KGSA 2CRGA 2BGCA 3DKYA 1XC5A 1J09A 3MKZA 3L2QA 3DF8A 2PMZN 2WA0A 3K7AJ 2ZKZA 4ZH4F 2Y75A 4C3JJ 3BJAA 2JMWA 4L18B 4FX4A 2L7FP 2NUEA 1YO5C 1REPC 2TCTA 2DB2A 3F23A 2HDCA 4IHXA 3KPHA 4RB3C 1P6RA 2EV0A 3E0JB 1KU3A 1R1TA 3BCAA 4Z6YA 2LRSA 2X85A 2QBYA 2OCCH 3BG7A 1IXRC 2F5DA 1E2XA 4HEIA 4HQEA 3CC7I 3O2PE 2DJNA 4IRHA 3ZMTA 5KL4A 1HSTA 1MBHA 3H5RA 1QBJA 3SJMA 1PUEE 4PJLA 2NRAC 4E7SA 3I3LA 4A2UA 4DV2E 5GTHC 5T6JA 1OR7C 1X4OA 5JHFA 1XDSA 2QKLB 4R2DA 2UUAE 2XASA 2AHQA 4XNFA 5M3MJ 2LJHA 1ETKA 3BG5A 2ZO4A 2F4OB 1U5TA 3DKWA 2UV1A 3ABUA 4EMSA 4A3EJ 2JSCA 2BB8A 2ZJPF 2VBWA 5LMNE 4O24A 2CW8A 2VOOA 1W36D 4N4RB 4E7IA 5E1ZB 2P7CB 2EE8A 2Z16A 3KP3A 1K4TA 3RYPA 1UN6B 5LGNA 2EJ4A 2KZGA 2DQRA 2I9IA 2V26A 3LSGA 1E3OC 2V88A 4OINF 5D4SA 2YZTA 3QPTA 2PN6A 3LSTA 2D2WA 2XAJA 2R7FA 1KYZA 4ZYGA 1HKQA 3BCBA 3IL2A 2LKSA 4PDKA 4U7DA 2R7SA 1ENHA 2DA7A 3R60A 2LUPB 2Y48A 1Z6TA 2R7OA 4Q28A 5A2QK 1MDMA 4XR6A 2UUZA 5JHUA 2I13A 3NWSA 4PK4A 4UUSB 4AM3A 4TV7A 4I0BA 4UVBA 1ZAOA 2IVMA 3K70C 4DKKA 2Y2ZA 3TW6A 2EH3A 5BPDA 1XGSA 3F6VA 5FLMJ 2YRKA 1KZHA 3T5XA 1BM9A 2R76A 4JI2E 4YIIA 1B8IB 4MEXF 1ON2A 2ZMEB 1J0RA 1IQSA 1HLVA 1Z6RA 3I59B 5A2QZ 2H8RA 2EN2A 1WH7A 5IY5H 3H0GJ 4M74A 3EYIA 5C3EJ 2MSYA 2Q0OA 3BR0A 3Q0VA 2XV4S 2EOZA 3F6GA 3Q9VA 3ZMSA 5C4JJ 5LHHA 2ENCA 2OAZA 2L6MA 2FJ1A 2JRTA 3HOXJ 1FJGE 1P4XA 2VJ4A 2O03A 2QSGX 3GMEA 1W7PA 5DTDA 3H92A 3PL8A 4E7HA 4F54A 4P96A 2BOLA 3GFMA 2LP0A 4BHPA 4LG0B 2DMTA 2VXDA 1C0WA 3GYHX 3SDBA 3F8NA 1AU7A 4HF1A 2KP6A 2L4AA 3SQNA 4BXFA 1YI2I 4XSZF 2FOWA 1RIOH 1F2IG 2DT5A 1FBQA 5A69A 2IJLA 1LE8A 1H8AC 2VXZA 2R7XA 2MKNA 2EWNA 2W48A 3VWBA 4KUMA 4KN4X 2RQLA 2DRPA 4IL6C 3GTMJ 2QEXI 5A6AA 2EFNA 4DV0E 3GUDA 1VQ7I 4WPYA 2IA0A 1BC8C 3DU5A 4B44A 3HHHA 2L3DA 3TMOA 2EQ3A 2EV5A 2K40A 2OZUA 4Y17A 3RSNA 3S1MJ 2JSPA 2N3GA 2QGUA 1XTAA 4BQQA 3OY9A 4HF0A 3FX3A 2PJPA 3C7JA 3A01B 2ZB9A 5F1RA 3K10A 3Q0WA 1PUFA 4YFNF 1BI3A 2CS3A 2EZ6A 2XGDA 2XUBA 2HVQA 4OU0A 1O0WA 3S8PA 4A3GJ 1Y1WJ 3IWDA 3TO7A 4FQGA 4L9JA 1VQMI 2CQXA 4CCJA 1TBXA 3RI4A 2K27A 2H36X 4KHPE 1JUPA 1V5FA 1U78A 2NS7A 2L01A 2M7BA 1W5CC 3VHTB 3LOCA 1IQOA 3E6DA 2EV6A 3AUZA 1FP2A 3ABMH 1OYYA 3AAFA 1RKTA 1UHSA 3ESWB 2V6EA 2NOJB 3KZZA 4P9UA 2E2HJ 4BGDA 4I01A 2EZKA 4DYQA 3DCFA 4X1EA 4UV9A 1OCPA 1GDTA 1V55H 2PBIA 2RNJA 4HLXA 1XGNA 2L9VA 2EOOA 2IEKA 1XMKA 1R00A 2HKXA 1CQTA 3IKVA 2HXOA 3LQQA 4X0GA 2RS6A 4M73A 3LSRA 3S3OA 2FBHA 3KP6A 2EM4A 2LG4A 2WY8Q 4JI6E 2EOHA 1FBUA 2ESHA 3REOA 1LEAA 2ZNZA 4H4KC 1WJAA 5IOYA 2A69F 2EQRA 3ZQIA 4AVPA 2DDBA 2ZNYA 4KMUX 1ZBTA 2JP9A 4BY1J 3KEQA 1VQ9I 2IGNA 4DUZE 4B09A 2JWOA 3OYAA 5FLXC 3K6QA 3ADIA 4L5JA 1IXCA 3RYRA 2EPRA 2Z1DA 3B6AA 2EMAA 2EPKX 3QPHA 2CSHA 1ZLJA 3GWZA 1VFCA 2VKEA 1HC8A 4L0ZB 4I76A 3HOYJ 3OOPA 2CQKA 3LAJA 3VSKA 3CCRI 1G8XA 1RPWA 2D5VA 3H9GA 1MJ9A 1YS7A 1T4LB 1YLFA 2R3SA 2R7UA 3FMSA 5CYVA 2LJUA 2MDGA 4GDFA 1J59A 1BOAA 1QZYA 1MBGA 4LD5A 2MD5A 3L2VA 4YEJA 3RTRA 1CGPA 4IJDA 1RR7A 4C30A 3HOZJ 5BPIA 3SDGA 1P9QC 3H9JA 1K61A 3RZDJ 2ENAA 2FSWA 3CUQA 2VKVA 3LSKA 4NC7A 4RAFA 4XLPF 3EUHC 1IC8A 3BZCA 4HAMA 1SVMA 3CDLA 2LSOA 2ZXHA 2CV2A 1ZBQA 1SFEA 1TTYA 5HNHA 2EMCA 3ZQLA 4N9HA 2XAGA 4EQQA 2YPNA 2B9DA 1TNTA 3IKTA 3H0DA 4UUVA 2KL4A 3F8FA 1A35A 2WAQA 2YWQA 4OAYA 1GV2A 3KYLA 1ETOA 1SFUA 2BY0A 1LDJA 1R5HA 2IP2A 2XPWA 1S7AA 3OTOE 3NRVA 3CUOA 4BE2A 5KL6A 3G73A 4HLYA 2DFFA 2MC5A 5EJCA 3CP2A 4CCNA 2X1EA 5KL7A 2N3HA 3IH4A 3GTKJ 3W3CA 3KZYA 5ICFA 2VOPA 4HOBA 2KPMA 1U5TB 4NDLA 2XIGA 1D0ZA 1YJ9I 1ZGAA 4NC6A 3W2AA 2ZXIA 1UG2A 2CPNA 2NNNA 3T1YE 1RRJA 2EOIA 4Y52J 3MHSC 1IBKE 1I1SA 2EPXA 4MTEA 4PJNA 1FMVA 1UBDC 4DOZA 2F48A 2NVXJ 1JT0A 2HYJA 4LIVA 1N33E 3S14J 1JHFA 2VC1A 2AS5F 2O0YA 1P92A 2DMUA 4W97A 3UNGC 3LSIA 2RQQA 2V8QB 1FMWA 3D1NI 1QHHD 2RAEA 1TT5B 1XG1A 4M71A 2PI0A 3VPRA 2HQAA 3ELKA 4I8OA 1E0EA 2UUCE 4IHYA 1R36A 3PM1A 5CLSA 4RAYA 4NXNE 4EGYA 2DLQA 1UILA 3ASNH 2EMBA 4YFKF 6PAXA 1RQ0A 5IP7J 2O61A 4DV1E 1IO2A 3CP8A 5L3GA 2VQFE 2DLLA 2XPUA 1JJ8C 2X6YA 3QOPA 5L3BA 3JR9A 2KKOA 5AE3A 2LKXA 4BDYA 2GZWA 1UAAA 2G0EA 4R79A 1UG0A 1E3PA 4IRGA 3I55I 4HF2A 2OTLI 1SC7A 2G7UA 4GEQB 4M30A 4P55A 1KU9A 5B3SH 2P0WA 2EL5A 5HS9A 1WJCA 5F0HA 1N75A 1U9OA 2MC3A 3ADLA 5E8IA 3J7YJ 2NVYJ 4L9VA 2RSIA 3IUOA 1QZZA 1SEUA 1HXDA 2P8TA 1OKRA 3LSMA 2HZDA 3BGHA 3HC7A 4R2QA 2X9DA 4R2AA 2ISYA 1XCVA 4M3FA 1UFMA 2DA3A 2D45A 3VFZA 4AYBN 5B1AH 2E19A 5LFAA 2L8TA 2DDAA 3LAPA 4A0XA 3K1NA 1Z9CA 1WJFA 4DBRA 4FASD 3ZQCA 1A1HA 2A05A 2EM7A 4C9YA 1IBME 1EKEA 4HX8A 2Z3YA 3JU0A 5J1RA 5F27A 3DPTA 3HB9A 3BR6A 2ZJRF 1TQMA 3K1PA 2EOMA 1G2HA 3G2BA 3MEXA 4ZDOA 3IWFA 4JK1X 3DU6A 3GTJJ 5LMUE 5ICCA 2HDDA 2KRFA 4B3ME 4HG2A 1X3WB 1U6GA 2O9LA 3EPZA 4OIOF 2DOAA 3KWRA 2R5ZA 1Y0NA 4R03A 1HDPA 1L0OC 1XGOA 5B5EC 2DW4A 1EH6A 1QZEA 2EM5A 3V8KA 1WI9A 3WG7H 2VBYA 1QPMA 3IRRA 2R7VA 3KLNA 4ZYHA 4JYAE 2DFHA 4LFAE 1FJLA 1ZH5A 3DF6A 2YU5A 2HTJA 4GKJE 1R4MB 1ACIA 1WJDA 3BR3A 1KU7A 3NQOA 5D5UB 3TDZC 5IT9C 1TL8A 4G7ZF 3M3YJ 1LDKB 1IV6A 3M99B 2DMNA 4DZPA 3VEPA 1D1BA 4S04A 5HLIA 2UXXA 4IVNA 2X48A 3FBNB 2RS7A 1X48A 2V6CA 2EMKA 4OMZA 2KIUA 4JBAA 1PJRA 2LE2A 2WBTA 4Y15A 2HS5A 3FBIB 2P6TA 4L5IA 2CG4A 4RS8A 2UXBE 2TDXA 4WX9A 4HSRA 4D0PA 2VJ5A 1BJZA 3AG1H 3ERMA 5K7ZA 1VQNI 1BI0A 4H0EA 4CA0A 1X1AA 3E1SA 1X1DA 2FRHA 2JTVA 4LF4E 4ASNA 4NUBA 4DUYE 2EMZA 3PFYA 3OYBA 3VYRB 3JRFA 3FIWA 4G7OF 4J01A 3FIGA 4GKKE 1D5VA 3QP6A 4XKWA 1OQYA 5AE1A 3CF5F 3WTSC 3I4PA 4PGGA 3C4TA 1G6NA 4M3BA 1W7PD 3FXKA 2W82A 2IT0A 5J8CA 4A3KJ 3S32A 3OIOA 3OV8A 5F04A 5HS8A 3MFKA 4BMJA 4MGRA 2YSPA 1Y56A 4YHHE 5IXMB 2IBDA 2QKMB 2B9SA 2F4MB 1WHUA 2UZKA 1W36C 2F2EA 4G8XA 1AHDP 4DZJA 1B69A 3L09A 1IBLE 2L2KB 1FYMA 3JRAA 5DYMA 3SHFA 4RM2A 3KE2A 2LUQA 1MEYC 5GAHJ 1X6EA 3M8FA 2M9HA 4UUSA 5E17F 1GQEA 2MH2A 2F5VA 3HSFA 3MVPA 3PO3J 2V89A 2EOQA 4ANJA 1R9TJ 1GXQA 1FYKA 2WWYA 1FLIA 2FA5A 3FXOA 3WTVC 4CZCA 3ZQFA 3Q0UA 1JKPC 1LVKA 3ZQGA 2YTNA 3OIQA 1ZRDA 2ODRC 2L3CA 3SFZA 5CVUA 1WXRA 2F5CA 2EFQA 5KHDA 1ZGWA 1FIAA 5EG0A 2WCC3 3C4BA 2QZ8A 1MJBA 3GO5A 1RETA 4EM0B 1HCRA 2EMFA 2OV7A 3WTZA 2YTIA 2V86A 1S7OA 1PDAA 3CF2A 2LMDA 2DI3A 2ZJQF 4ITVA 5CVJA 1SFOJ 2GIZA 5E18F 1HBXG 1VQLI 2D9HA 3H36A 3HUGA 3HBLA 4MFEA 4PUSA 1X4PA 5IYCJ 4CO8A 2YU9J 5LL6R 3TEDA 1IW7F 3GZNB 2XAUA 4FTHA 2XF6A 4BC9A 5IYBJ 2O6GE 1JT6A 4LU9A 4E7ZA 2EOYA 4ZDLA 2UXCE 3I71A 2LTPA 1QO0D 2OU2A 2KQRA 2M87A 4Y7NJ 1O4XA 3CC2I 3HTXA 3I5UA 1MBKA 3BDDA 2E72A 1LPQA 4DR1E 1P7IA 3V8LA 2LBFB 4B3TE 3BZKA 3LSJA 4EATA 3TQNA 2VE8A 2BVLA 3FXQA 3HPZA 1TQIA 1EA3A 1O3RA 1XPXA 1OCRH 3WG9A 1BC7C 1GHCA 2Y0SA 4P7DA 1TWAJ 2KHMA 3V7SA 1YHQI 2ISZA 1Y0UA 5LGTA 1R58A 2JA7J 3ML6A 2A3SA 3KEYA 2R7QA 1OYIA 4QSHA 3MKYB 5FLXK 2ETHA 1AA7A 4M9XA 2R5YB 2M9AA 2GOXB 1N34E 1FC3A 3JAMC 1MD0A 4D7NA 4LF9E 2EFPA 4EJTA 2V1DA 3CCMI 4UVAA 1U8RA 1DI2A 2DBBA 5FFXA 1TWGJ 2M2EA 3H3ZA 4MHGA 3JREA 1PJTA 3WU0A 2ID3A 2WAEA 2V1NA 1T08B 3B6CA 4RGXA 1HW2A 3G4SI 4IKFA 4E4HA 1VQPI 5IT9K 1V5EA 2HTSA 5L3CA 4E7KA 1DGRM 1FZPB 5KL2A 5GPCA 2BY3A 1NEIA 2A5YB 4X64E 1ZREA 1DU6A 4LG3A 3PNVA 4B3RE 1O3TA 5FKNA 1FT9A 1MDMB 1Q1VA 5JLWA 4XLHA 1TW3A 1RESA 2R93J 5M5XJ 2BW3A 1JJ6C 5FKLA 1SAXA 2JA2A 2P81A 3E6BA 1NH3A 3A02A 3HTUA 3RPUD 4A12A 2E5LE 4CUGA 1T98A 1ETQA 2VONA 2LLKA 2FF4A 3AKZA 4JI8E 1VF9A 3K4NA 2H6CA 2W24A 3CJRB 4A3LJ 3BG6A 2DFEA 2OUMA 5KAIC 4GYIA 1M1EB 2E2IJ 5DNYA 3DPUA 5JVTA 2ELKA 2BYVE 3KX2A 3CCYA 3FMQA 3FXUA 1F43A 3ZPLA 3K1MA 1OFCX 3TDUC 2FBKA 3VDXA 4G7HF 2V9PA 3O6BB 3V7CA 3J7ZI 5DM6F 1ZELA 2RN7A 1ODDA 4JI4E 4DMIA 1R23A 2ZFWA 2RC4A 4Q48A 3ZN0A 2EOEA 1CF7B 4WWCA 1FKAE 1Z21A 4IX7A 1MMNA 2HKOA 4J00A 1B72B 2K4BA 1RUNA 2FNAA 1FWZA 4M3DA 5FO5A 2L9NA 1H9GA 2FUG2 4MIMA 3I54A 2DMPA 3I9V2 5FD6A 3J80Z 4XKCA 1KONA 1JI8A 1UHZA 1WCMJ 1FX7A 4I09A 4M0VA 2MKDA 1ZR4A 3K4KA 1MH4A 1Y8QB 2HPMA 3EDPA 1JE8A 4B3AA 4FT8A 2VRDA 3DV8A 4LLNA 2QYOA 4AIDA 5DUKA 4L0YB 1VQ6I 3J7AO 1T2KA 4A3MJ 1I50J 4CICA 2BW3B 1EH7A 5HLGA 2COBA 5F08A 1Y6IA 5K5OA 4ABZA 1TP4A 2XKOA 2VJIA 4BJTA 1WRJA 3H35A 4PFOA 2LR8A 1TW2A 5E1XA 3S3NA 4BCAA 1IUYA 5E1WA 1KQ0A 3BR5A 5H2FC 1ZQ3P 4XORA 5KCMA 1HF0A 2Y69H 3QODA 4O5VA 1MNEA 3H09A 4KJZA 3GW2A 5LHIA 2CU7A 3S3MA 3JTHA 3K9TA 2LO3A 1YW7A 2K02A 2YTPA 4KA4A 2OQRA 4I7HA 2K9QA 3M8JA 3HPGA 3DFGA 2K9SA 1XCBA 2Q2EB 2R5YA 2DA6A 1EKZA 1W7PB 4A3BJ 2M4GA 3EETA 1WJPA 2X51A 3BROA 2PQ8A 1OLTA 3WODF 2KT0A 1ZG3A 5LD2C 2VBZA 4NB5A 4OIQF 2XHKA 5E3OA 1YX5A 2A25A 2X1DA 3EQLF 4RLQA 1K78B 4ZTFA 5DCMB 1F9NA 5BOXA 1W0TA 3HGYA 4CXFA 1FNNA 2EN8A 2HQ5A 3HXLA 3CMEI 2IAIA 3D5RC 4UUTA 1LQ1A 1J9IA 1G59A 4A0YA 2W57A 4GYGA 2JN6A 4X9JA 4HRIA 4BBSJ 3KIOA 3TOAA 3K4LA 3JAMK 2YTFA 1PJQA 1IRGA 2EPPA 2FQ3A 2XRLA 4DR6E 4LF8E 1YOVB 1G2DC 1B9MA 1BBGA 1KQ9A 1K6OA 3ZOQB 4KITB 4KIGA 2XRNA 4FK5C 4LGWA 3LQRA 2GM4A 5K1YA 3S16J 3H1CA 1O3QA 3DBRB 2DK5A 3LA2A 3DQVC 3D5SC 4HDUA 3S1NJ 2NVQJ 1H88C 1OCTC 4ENKA 1ZHFA 2STWA 3LNQA 1X1CA 2EMIA 3TKYA 2K7IA 3DXJF 2BXYA 3ZXSA 2LKPA 3FWEA 5GP9A 1XMXA 4HDVA 3DPLC 5D6EA 4G9YA 4U87A 4E7LA 4EM1A 5B1BH 1J75A 4B1RA 1Z0XA 2M4IA 4IPAA 1YTYA 3WE2A 5CVIA 5J6XA 1B72A 3F3XA 4CHUA 2W85A 2H8WA 5ILUA 1X47A 4MQVA 1LDDA 1TLHB 2GPIA 2CSOA 2ODRD 2VL8A 1BW6A 2MD0A 3HSEA 4BQOA 1EJ9A 2C6YA 4N4NB 4YRVA 4XLFA 3HUGB 2L7KA 4MEYF 4EVIA 3N05A 2CT1A 3OYIA 5IP6A 4BC7A 2EBIA 1WWXA 2XF5A 3HHGA 4YELA 4S0HB 2DPDA 4AC0A 4HW0A 5E3NA 1QGPA 2YUSA 3F8MA 4JP0A 3C3WA 3EYYA 2JY9A 2JVHA 2XF7A 4B3XA 1P7JA 3KYCB 5K7HA 5AONA 1PKPA 3LL7A 2P5VA 3V7RA 3L9FA 2MFZA 2OA4A 1SD5A 2GIVA 2DYRH 1IXSB 2X6OA 4JI1E 4M9SA 3AG3H 5C4XJ 4KT6A 3GFIA 2E35A 4U0YA 1T0FA 2CO5A 4ENMA 5HLHA
chains in the Genus database with same CATH topology
3JTGA 2GA1A 3QRFF 1W5TA 3HRSA 1VTNC 3CO6C 2QWWA 1ZRCA 2E1CA 5DUIA 1K78A 1JXSA 3FHZA 3K2ZA 2MH9A 3P9IA 2ACJA 3VB2A 1AOYA 3I0TA 3QU3A 5TJJA 2RGVA 3ABTA 5LGUA 1ULYA 2XVCA 1YQAA 3V4GA 2J5OA 1IRFA 2QQ9A 1J7KA 1R5GA 2FNPA 2GXGA 2PEXA 3WU1B 1SD7A 3K0LA 3HYIA 4AD9A 2NYXA 1KU2A 3CLOA 4N0BA 3ISPA 5L3EA 2OQGA 2Z9OA 5H6RA 1G3YA 3F21A 2M30A 2PMUA 1JHHA 2H94A 3RKXA 2ZJ2A 2Z99A 1GVJA 1XGMA 5FGMA 4I2OA 2JPBA 5HDGA 4FX0A 4XBFA 4HYEA 4Q5SF 1XSDA 3LA7A 3W6KB 2H27A 5E20A 4Q4ZF 1HSJA 2RQPA 2HWVA 3VOEA 4KIFA 4WK8F 5JFRA 1O3SA 1G3TA 4O3MA 2GAUA 2EFWA 3LA3A 1D8JA 3CUQC 1BN5A 3M7GA 1OYWA 5KK1A 5DD4A 4EGZA 1R7JA 4BQAA 4KN7X 4IRIA 2FXAA 1FY7A 1IZ1A 2K4JA 3FZVA 3MWMA 2K7LA 2EA2A 3J81K 3E3VA 2HEOA 4IHTA 2CW0F 4U0WA 1J2XA 2A68F 2UXNA 4R1HA 4A5NA 2QLZA 4O6JA 4LG0A 1V4RA 2J5PA 3FM5A 4ESFA 3SZPA 4LB6B 1W4MA 2VBXA 2EB7A 3HOTA 1WSUA 4LJZF 3T0YA 3Q9SA 1EH8A 2L54A 3TO9A 1MGTA 4AIHA 4U7BA 4OMYA 3ZN1A 2P5KA 2JT1A 5FFZA 5J8FA 3NEUA 1YW9A 4ZYDA 2UWMA 5HDKA 1PP8F 1H0MA 4LK0F 1SD6A 4Y13A 3SZTA 4XLNF 4RGSA 3JSOA 3QAHA 4KNYA 1DUXC 4UV8A 1HW1A 3H3UA 3RKYA 4PCQA 4EJWA 2V1UA 2O8XA 2DAOA 2IA2A 1P4WA 1QQIA 2VN2A 1B59A 1I6XA 4DQ2A 2LF8A 3BJ6A 3WGGA 3KP4A 1CF7A 4ENJA 4U88A 2VC0A 1HKSA 4IJAA 4YFXF 3FMRA 4EJOA 1ZARA 2E1NA 4A5MA 1FP1D 3BOQA 5ICEA 2P6SA 2F5EA 4RB1A 3EUHA 3TO6A 1YS6A 1T38A 3M1EA 2Q8KA 2LDUA 2VT2A 3LFKA 2M8EA 3HOSA 2FMYA 3KFWX 2IW5A 4HX7A 2A61A 2FU4A 5KVRA 3R0AA 2MLGA 5ICGA 3J81Z 3ULQB 3FM3A 3RJPA 1KYWA 4ON0A 3F22A 4AIKA 1Z05A 1R1UA 3BY6A 3WTUC 1G3WA 3R6SA 2DFIA 3T1BA 5LEJA 4OIRF 1SD4A 2G7HA 2E7WA 3QU6A 4Z2YA 2FEZA 5D5VB 3W6JB 2XAQA 3T8RA 3ZMUA 2JPCA 2WC2A 4M9ZA 4I02A 2Z5UA 3MZYA 1BIBA 3CJNA 1QNTA 4RGRA 1OR7A 2B0LA 4KICA 3D0SA 3QP5A 1WQ2A 2HOEA 4UVCA 4JQFA 4LB5A 4LLLA 3E6CC 2OBPA 2DK8A 2AXLA 2P4WA 3WTYC 4HBLA 3M8EA 2RKHA 2WV0A 1Q1HA 2HGCA 5TRDA 2DO7A 3E5UA 2PG4A 1JGSA 5E8GA 5HOOA 4KMFA 1RNLA 4ZZLA 2HYFA 1XSVA 1UHWA 5F64A 1D8KA 3RPQA 2KIFA 1MKMA 4BHBA 3RKWA 4KDPA 2DQLA 1I5ZA 4WXHA 3R61A 4K2EA 5F6FA 5FLXZ 2ZMEA 4CYDA 2QQAA 2NS0A 4P5OA 3GFJA 2PMHA 1MJAA 2YX4A 4GCVA 2A6HF 3F6OA 2KJBA 5CJ9A 2X4HA 3GLXA 1LEBA 4N9IA 2COMA 1ZN2A 4E70A 5DV5A 3N4MA 2MLKA 3ECHA 3ZMZA 2GA2A 5HS7A 1H9TA 4BNCA 4OOIA 4LLGF 4GO1A 2A07F 4HA8A 3L00A 5ERIA 2V9VA 1P4AA 1YIOA 2D1VA 5D4RA 1UHMA 2BEOA 2QUFA 2VODA 2YPRA 1ZG5A 2FOKA 3D5LA 3WTXC 4EJUA 2IPQX 1IN8A 3GZ6A 2HFHA 1IF1A 3PQKA 4WF2A 5D8LB 2Z33A 1B6AA 2BV6A 3U1DA 3E5QA 1IN6A 4XSXF 4XRFA 1USSA 2DU9A 3FXRA 4Q47A 3MZHA 4KT5C 3HTSB 2LNBA 1FPQA 1YW8A 3IHUA 4EM2A 1E17A 2V79A 1O7FA 1B9NA 2L4MA 1ZG1A 2CGPA 5H6QA 4OIPF 3E6MA 5ILSA 2JZYA 1Z7UA 4AIJA 5LHGA 2ZCWA 1IN5A 3V8JA 5HDNA 1XD7A 2IA1A 1ON1A 1T6SA 3JAMZ 3F8BA 4F7ZA 1OPCA 3Q5FA 3BPVA 3CDHA 4A0ZA 5IT3A 3HRMA 1D3YA 1IN7A 1WKMA 4HV6A 2P7VB 4PZJA 4BH9A 3O3KA 2ZBKA 5FD5A 2D1HA 1UCRA 4LFUA 1TNSA 3IRQA 2GXBA 2OZ6A 2CFXA 5BMZA 2QENA 3FF5A 1PP7U 1F4KA 5LLQA 3CUQB 2CWEA 3JW4A 4L9TA 1R1VA 1Z1DA 1BIAA 1B4AA 1OMIA 3DP7A 2DPUA 3RPUA 4QLCU 3R4KA 2A6EF 4WXDA 3S2WA 2BBYA 4IXAA 4L9NA 1W5SA 2H6BA 2QM3A 4ESBA 2YSRA 3F8CA 3J80K 4P9FA 3ZMDA 5K5QA 1LNWA 2M5WA 1LB2A 2L02A 4CZZA 2M45A 1P2FA 3C1DA 4HV5A 1FYLA 2PLYA 4WCGA 1K7AA 1GXPA 1SMYF 2E7XA 3VODA 2R7DA 2ADUA 1S8NA 4FHTA 3CTAA 1ZYRF 3M9AA 2PFBA 5EEGA 4M72A 2HYGD 4KYWA 1BBYA 3BZ6A 1KA8A 4BXUA 3WGHA 1MZBA 3KP2A 4WXCA 1SMTA 2HQRA 3I59A 2XROA 5CVVA 3GX4X 4UHTA 5JI6A 5IT9Z 4A6EA 3KCCA 2QQBA 1O57A 1K79A 1HQCA 3JSPA 3GXOA 4RGUA 3COAC 1ZLKA 5ED4A 2M1BA 4BYYA 1BI1A 4BHCA 5DD8A 2ZXJA 3K69A 2QVOA 3MCZA 2MBFA 3BJOA 3E5XA 3E97A 2KIMA 1HKTA 1HW5A 4ZZDA 3KP5A 3ZQ7A 1RZ4A 4HQMA 5AIQA 4B8XA 5K5RA 4M6XA 4RAZA 1I27A 2Q2EA 3HSRA 4ENNA 4BAYA 1YG2A 3PFIA 3P9CA 3F72A 5D5WB 1R22A 1S3JA 4R8HA 2XKPA 1XB4A 4IHSA 5LRSA 4ETSA 1LJ9A 1LVAA 3B73A 2HZTA 5DDGA 2RV8A 3IWZA 3HRTA 5CVRA 2EA4A 3C18A 3RIRA 1XDUA 4A6DA 3GF2A 1IAWA 5BQTA 2LF7A 4MQ9F 2V1XA 2G9WA 3WTTC 4KIBA 3BP8A 4ESJA 4QWQA 1DDNA 4NQWA 1I1GA 3I58A 2H09A 1F1ZA 4LMYA 2YR2A 1S6LA 2RVCA 3ZMVA 2EJRA 2P5LC 1T39A 3BWGA 2NAZA 2ESNA 1F5TA 5JR3A 1AWCA 2ELHA 4KFCA 2W84A 2DTRA 2YU3A 1ONVA 2GWRA 4MTDA 4YIFA 4S05A 3WTWC 1U3EM 4RB2C 5D6FA 2IRFG 3TGNA 1STZA 4IF4A 1SFXA 3DEUA 1TQPA 3I64A 4U0VA 2STTA 1KQ8A 3ZP5A 3CO7C 1BI2A 1ZRFA 1DPUA 4G6QA 1FOKA 4UNOA 2W25A 2XGXA 4GXOA 1USTA 5LEKA 3GEZA 2HQNA 1EV7A 3KP7A 4PGHA 2EFOA 4NHJA 4ZYEA 2NNYA 1S29A 3ROUA 5BS6A 4I0AA 4EJVA 3U9GA 5L3FA 1FBSA 2MA3A 2YX7A 1YYVA 2CYYA 3KETA 2XAHA 3G3ZA 5HVQC 4UXNA 5D8KB 2F5FA 3WGIA 1U5TC 4CDGA 4GGGA 2OD5A 4I98B 3R0JA 1Z91A 5L3DA 3I53A 1UB9A 3BPXA 3RDIA 1A04A 1RUOA 5D5XB 3GZ5A 5LBQA 3TOBA 2Y0MA 2FBIA 4AWXB 1U2WA 1PDNC 2RDPA 4MNUA 3HRUA 5EEHA 4YG2F 2FMLA 1G3SA 3ERED 2K86A 1YFHA 4M6YA 1B1BA 5DCFA 2VE9A 4EV0A 1G4DA 5LRRA 3MAJA 1ZGJA 2EK5A 1NHAA 2FE3A 1FSHA 1J5YA 3U2RA 4G6DA 5FB2A 2QBYB 3HIFA 4RB0A 3P9KA 5H20A 2VT3A 1XN7A 3SXYA 4G94A 3ECOA 3LWFA 4HX4A 2HR3A 3N97A 5ILVA 2O3FA 2XAFA 1L3LA 5DEQA 3GVAA 1XMAA 5DCMA 3KLOA 4HZFA 5AIPA 4LK1F 3IC7A 4CGZA 1IN4A 1BJAA 2KJCA 3B02A 3KEOA 3P7NA 3GFLA 1RI7A 2BE5F 3L7WA 1DP7P 1DPRA 3T8TA 2X0LA 1XSXA 2WTEA 1X3UA 3MQ0A 3WE3A 4DNCA 1FSEA 1O7LA 3PQJA 2GQQA 1V3FA 3L2CA 1KGSA 2BGCA 3DF8A 2ZKZA 4ZH4F 2Y75A 3BJAA 4L18B 4FX4A 1YO5C 1REPC 3F23A 2HDCA 4RB3C 2EV0A 1P6RA 1KU3A 1R1TA 2QBYA 2F5DA 1IXRC 1E2XA 4HQEA 3O2PE 4IRHA 3ZMTA 1HSTA 1QBJA 1PUEE 2NRAC 4A2UA 1XDSA 2XASA 2ZO4A 1U5TA 3ABUA 3DKWA 4EMSA 2JSCA 2VBWA 2VOOA 5E1ZB 2P7CB 3KP3A 3RYPA 5LGNA 2DQRA 4OINF 5D4SA 3QPTA 2PN6A 3LSTA 2D2WA 2XAJA 2R7FA 1KYZA 4ZYGA 1HKQA 3IL2A 4PDKA 4U7DA 3R60A 2Y48A 1Z6TA 5A2QK 1MDMA 5JHUA 4TV7A 4I0BA 4UVBA 1ZAOA 2IVMA 5BPDA 1XGSA 3F6VA 3T5XA 1BM9A 4YIIA 4MEXF 1ON2A 2ZMEB 1J0RA 1Z6RA 3I59B 5A2QZ 4M74A 3EYIA 2Q0OA 2XV4S 3Q9VA 3ZMSA 5LHHA 2OAZA 2JRTA 1P4XA 2O03A 1W7PA 3H92A 4P96A 3GFMA 4BHPA 4LG0B 1C0WA 3GYHX 3F8NA 4HF1A 2L4AA 3SQNA 4XSZF 1RIOH 2DT5A 1FBQA 2IJLA 2VXZA 2EWNA 4KUMA 4KN4X 2EFNA 3GUDA 2IA0A 1BC8C 3HHHA 2L3DA 2EV5A 2OZUA 4Y17A 4HF0A 3FX3A 2PJPA 3C7JA 5F1RA 4YFNF 1BI3A 2XUBA 4OU0A 3TO7A 4L9JA 1TBXA 3RI4A 2K27A 1U78A 2L01A 3E6DA 2EV6A 1FP2A 1OYYA 3AAFA 3KZZA 4P9UA 4I01A 4UV9A 2RNJA 2PBIA 4HLXA 1XGNA 1XMKA 1R00A 2HKXA 3IKVA 3LQQA 4M73A 2FBHA 3KP6A 1FBUA 2ESHA 3REOA 1LEAA 2ZNZA 2A69F 4AVPA 2ZNYA 4KMUX 3KEQA 4B09A 4L5JA 1IXCA 3RYRA 3QPHA 1ZLJA 3GWZA 4L0ZB 3OOPA 2CQKA 3LAJA 1MJ9A 1YS7A 1YLFA 2R3SA 3FMSA 5CYVA 1J59A 1BOAA 1QZYA 4LD5A 2MD5A 1CGPA 3RTRA 5BPIA 2FSWA 3CUQA 4XLPF 4HAMA 2LSOA 1SFEA 1TTYA 4N9HA 2XAGA 4EQQA 1TNTA 3IKTA 4UUVA 3F8FA 1SFUA 1LDJA 1R5HA 2IP2A 1S7AA 3NRVA 3CUOA 3G73A 4HLYA 3KZYA 5ICFA 2VOPA 4HOBA 1U5TB 2XIGA 1ZGAA 2NNNA 1I1SA 4MTEA 1JHFA 2VC1A 2AS5F 2O0YA 1P92A 4M71A 2PI0A 3ELKA 1R36A 5CLSA 4RAYA 4EGYA 4YFKF 6PAXA 2O61A 5L3GA 2DLLA 3QOPA 5L3BA 2KKOA 2GZWA 4R79A 4IRGA 4HF2A 2G7UA 4P55A 1KU9A 5HS9A 2MC3A 5E8IA 4L9VA 1QZZA 1HXDA 2P8TA 1OKRA 2ISYA 1XCVA 2D45A 1UFMA 3VFZA 3LAPA 4A0XA 3K1NA 1Z9CA 4HX8A 2Z3YA 3DPTA 1TQMA 3K1PA 3MEXA 3IWFA 4JK1X 5ICCA 2KRFA 1U6GA 4OIOF 1L0OC 1XGOA 2DW4A 1EH6A 3V8KA 1WI9A 2VBYA 1QPMA 3IRRA 3KLNA 4ZYHA 1ZH5A 2HTJA 1KU7A 3NQOA 5D5UB 3TDZC 4G7ZF 1LDKB 3VEPA 4S04A 5HLIA 2UXXA 4IVNA 2V6CA 4OMZA 2KIUA 4JBAA 4Y15A 2HS5A 2P6TA 4L5IA 2CG4A 4RS8A 2TDXA 4WX9A 4D0PA 1BI0A 4H0EA 2FRHA 2JTVA 4ASNA 4G7OF 1D5VA 3QP6A 3WTSC 3I4PA 4PGGA 1G6NA 1W7PD 2IT0A 5J8CA 3MFKA 3OV8A 5HS8A 4MGRA 2UZKA 2F2EA 4G8XA 3L09A 1FYMA 5DYMA 3SHFA 3KE2A 3M8FA 5E17F 2MH2A 3HSFA 1GXQA 1FYKA 2WWYA 1FLIA 2FA5A 3WTVC 1ZRDA 3SFZA 5CVUA 2F5CA 2EFQA 2QZ8A 1MJBA 3GO5A 4EM0B 3WTZA 1S7OA 2DI3A 5CVJA 5E18F 1HBXG 3HUGA 4CO8A 1IW7F 2O6GE 3I71A 1QO0D 2OU2A 2M87A 3I5UA 3BDDA 3V8LA 3TQNA 2VE8A 3FXQA 1TQIA 1O3RA 1GHCA 3WG9A 1BC7C 3V7SA 2ISZA 1Y0UA 5LGTA 1R58A 3ML6A 2A3SA 1OYIA 5FLXK 2ETHA 4M9XA 1FC3A 1MD0A 2EFPA 4EJTA 2V1DA 1U8RA 4UVAA 2DBBA 5FFXA 3H3ZA 4MHGA 3WU0A 4RGXA 5IT9K 1HW2A 2HTSA 5L3CA 1FZPB 2A5YB 1ZREA 1O3TA 1FT9A 1MDMB 1TW3A 1SAXA 3E6BA 3HTUA 4A12A 1T98A 2VONA 2FF4A 2H6CA 2W24A 4GYIA 5JVTA 2BYVE 3FMQA 3FXUA 3ZPLA 3K1MA 3TDUC 4G7HF 2FBKA 3O6BB 3V7CA 2RN7A 1ODDA 1R23A 2ZFWA 2RC4A 4Q48A 3ZN0A 1CF7B 4WWCA 2HKOA 2K4BA 1RUNA 2FNAA 1FWZA 5FO5A 1H9GA 3I54A 5FD6A 3J80Z 1FX7A 4I09A 3EDPA 1JE8A 4FT8A 3DV8A 4LLNA 2QYOA 5DUKA 4L0YB 3J7AO 1T2KA 4CICA 1EH7A 5HLGA 5K5OA 2XKOA 1WRJA 5E1XA 1TW2A 1IUYA 5E1WA 1KQ0A 4O5VA 5LHIA 3GW2A 3JTHA 3K9TA 1YW7A 2K02A 4KA4A 2OQRA 4I7HA 3DFGA 1XCBA 1W7PB 3EETA 3BROA 2PQ8A 3WODF 1ZG3A 2VBZA 4NB5A 4OIQF 2XHKA 3EQLF 1K78B 5DCMB 1F9NA 5BOXA 4CXFA 1FNNA 1LQ1A 1J9IA 4A0YA 2W57A 4GYGA 3TOAA 3JAMK 1IRGA 2FQ3A 1B9MA 1KQ9A 1K6OA 4KIGA 2XRNA 4LGWA 3LQRA 5K1YA 1O3QA 2DK5A 3LA2A 3DQVC 4HDUA 4ENKA 1ZHFA 2STWA 3TKYA 3DXJF 2LKPA 3FWEA 4HDVA 3DPLC