1MGTA

Crystal structure of o6-methylguanine-dna methyltransferase from hyperthermophilic archaeon pyrococcus kodakaraensis strain kod1
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
169
structure length
169
Chain Sequence
MLSVEKFRVGERVVWIGVIFSGRVQGIAFAFDRGTLMKRIHDLAEHLGKRGVSISLDVQPSDYPEKVFKVLIGELDNASFLRELSFEGVTPFEKKVYEWLTKNVKRGSVITYGDLAKALNTSPRAVGGAMKRNPYPIVVPCHRVVAHDGIGYYSSGIEEKKFLLEIEGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (O6-METHYLGUANINE-DNA METHYLTRANSFERASE)
publication title Hyperthermostable protein structure maintained by intra and inter-helix ion-pairs in archaeal O6-methylguanine-DNA methyltransferase.
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Transferase
total genus 57
structure length 169
sequence length 169
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 1999-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF09153 DUF1938 Domain of unknown function (DUF1938)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mgtA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1mgtA01
1F4KA 2HTJA 4Q4ZF 1ZLKA 1WQ2A 3QU6A 2W85A 4EM1A 3CO6C 4U7BA 4B8XA 4KN4X 1BI2A 4YIIA 3VEPA 4YFNF 4M9XA 3IKVA 3J80Z 4Q48A 2PI0A 5K5QA 1DPUA 3WTSC 4UXNA 3E6BA 1BC8C 2Q0OA 1DP7P 1OYIA 5CVIA 3I58A 2DTRA 2H94A 5DD8A 4IRIA 1A04A 4I0AA 1ULYA 3TO7A 3F6VA 5K5RA 2OAZA 3MEXA 4O3MA 4IJAA 1LB2A 5HVQC 4NHJA 4WXDA 3ELKA 4HX8A 4A6EA 5J8FA 3FM3A 4U0YA 3OV8A 3FX3A 5F64A 2V79A 4AIKA 2BE5F 2W24A 4R1HA 2WTEA 4HQMA 4IHTA 2IA2A 1F5TA 2Z33A 2ZXJA 2QVOA 1HKSA 1FBQA 2O3FA 1LDDA 2L54A 2DW4A 4MQVA 4A0XA 1IW7F 2XAJA 2ZFWA 3WTWC 3EDPA 1U5TA 4LLGF 2IJLA 2VOPA 1K79A 2EV6A 3T0YA 1J7KA 2HQRA 3GO5A 4ZYEA 3DPTA 1F9NA 2ISYA 2HZTA 3CUOA 4A5NA 4CYDA 1SD4A 2W25A 3GF2A 3Q9SA 2GXBA 2Z5UA 2BV6A 2FA5A 3KP6A 4FT8A 3LSTA 3ZQ7A 2JSCA 3H3UA 5E8IA 4LB6B 4ETSA 5A2QZ 2V9VA 4EGYA 4ZYDA 2WV0A 4XSXF 5D5VB 4LFUA 2TDXA 3F72A 4DNCA 5TJJA 5LRRA 5ED4A 4HAMA 3F6OA 1O3QA 1L0OC 3TKYA 2HEOA 3HOTA 4AD9A 4ASNA 5TRDA 1TW3A 4OMZA 1UFMA 4ZH4F 4P5OA 4JQFA 4QWQA 1EH7A 2PQ8A 5BPDA 1KQ9A 2ISZA 1LQ1A 1XDUA 3WTTC 3GUDA 1ZGJA 4PGGA 4ZYHA 1OMIA 3VFZA 2BBYA 3R0JA 5E1XA 3WTXC 2XAHA 2A3SA 4IPAA 3OOPA 2O61A 1YFHA 4ZYGA 1TLHB 4ENKA 3R61A 3DQVC 3JTGA 4F7ZA 2OQGA 2JTVA 3RKYA 5LHIA 1G3TA 1HW5A 3PFIA 5F1RA 1Y0UA 1YW7A 4M6YA 4ZZLA 4ENJA 4AVPA 3LA2A 4GXOA 4HF1A 2X4HA 1BOAA 2CQKA 4LK1F 3M7GA 3F8MA 5J8CA 3I0TA 5LRSA 2XKOA 3B73A 3HIFA 3N4MA 3E97A 3FXRA 3E6CC 3FWEA 4YFXF 3GFLA 4M9SA 1T38A 1O3SA 1CF7B 4P9UA 2Y75A 2RVCA 2VN2A 4CO8A 1MKMA 2JPBA 2JRTA 2ZCWA 5L3EA 1PP8F 2LF8A 1E17A 2YPRA 3SZTA 4BHCA 4UVBA 2QUFA 2HR3A 4EV0A 3J80K 4EQQA 3G73A 4RGSA 1ZH5A 5E1WA 2DPUA 4OOIA 3WTZA 3WTYC 1WWXA 4I0BA 1MDMB 2XAFA 3WE2A 2E7XA 1QZYA 2ACJA 3COAC 1IN7A 3GFMA 1HW2A 1W7PB 3N97A 3FM5A 1FY7A 3GEZA 3SXYA 1Z9CA 2M1BA 2P6TA 2ESNA 5CYVA 5K5OA 2YX4A 2DK8A 4LG0B 4IVNA 2EFOA 4OIOF 2FU4A 4KNYA 3GX4X 5ILSA 4WX9A 2A69F 2DFIA 4EJUA 1PUEE 1YTYA 2FRHA 2NNYA 2UXNA 3NEUA 3FXUA 2VONA 5EEGA 5ICCA 2LNBA 4IRHA 1IXCA 1RUNA 1Z6RA 1MGTA 3DFGA 3HTUA 4I01A 3RTRA 3DXJF 1STZA 4P96A 3RYRA 4M73A 2EK5A 3BJ6A 1FWZA 3HRMA 2XGXA 3KP3A 4CDGA 3MZYA 4OIPF 1ZRCA 2OD5A 2VBZA 2HWVA 4IXAA 2P5KA 2RGVA 5LHGA 2FBIA 4G8XA 3TO9A 3FMQA 5A2QK 1IAWA 1U2WA 1FBSA 2QQ9A 3KEQA 4KN7X 1DDNA 2CG4A 1I6XA 1J0RA 3TDZC 3P9IA 3RYPA 1HBXG 2M45A 1ZRFA 5FFXA 2PMHA 2ZO4A 1P6RA 5ILUA 5K1YA 3R0AA 2BGCA 1I27A 2W84A 2VOOA 2NS0A 4LB5A 3DP7A 1YW9A 4HW0A 2IPQX 3FXQA 3H3ZA 3ERED 1HKQA 5BMZA 1XGSA 1HW1A 3M8FA 4L5IA 2RQPA 3FMRA 1XCBA 2H27A 5LGUA 1EH6A 2UWMA 4LJZF 3NRVA 1MJAA 2P8TA 2XHKA 1EH8A 3IRQA 3I59A 2DLLA 4LG0A 1YW8A 4LK0F 4EVIA 3C3WA 3MFKA 3GZ5A 4S05A 3BJOA 3HRTA 3T8TA 2DQLA 1W7PD 1S7OA 3TO6A 3RDIA 2E7WA 3L00A 3GFJA 2NNNA 3GLXA 1XMKA 4U88A 3U2RA 4G7OF 4MNUA 4DQ2A 3ZP5A 2PLYA 3P9CA 3HHHA 3LAPA 2IW5A 1LDJA 1TQPA 1FLIA 1J75A 1SMYF 1ZLJA 2YU3A 1Z91A 5JHUA 3U9GA 1FT9A 3V8LA 4CGZA 2OQRA 4KMFA 2PEXA 1UHWA 4HBLA 1LEAA 5D4RA 4HYEA 6PAXA 4BAYA 2L02A 3I64A 1G6NA 3T8RA 4KMUX 3WGIA 2VXZA 2BYVE 2Q2EA 2DQRA 2MD5A 5D8KB 5BPIA 4A0ZA 5KK1A 4BYYA 5CLSA 2MA3A 3RKWA 2KRFA 3VODA 3BJAA 1REPC 3MQ0A 3FMSA 1BIBA 2EV5A 1SAXA 1R00A 5IT3A 2CGPA 1YS7A 4G7HF 1T98A 2ZNZA 1B59A 3FZVA 4HDUA 2ZMEA 1WRJA 4RB3C 5JVTA 4A0YA 3M8EA 1G3YA 3E5UA 4GYIA 4OINF 3I71A 4ENNA 2PBIA 2PFBA 3BROA 2QWWA 4HV6A 1SMTA 1V4RA 2EB7A 5DDGA 2HKXA 2JT1A 1G4DA 3T5XA 3IKTA 2HTSA 3O2PE 3E5QA 3TQNA 1F1ZA 1FPQA 2DK5A 1B9MA 1FSEA 3P9KA 4UVAA 5JR3A 1ZG1A 2M5WA 4KIFA 2HFHA 4XRFA 2R3SA 1R58A 3ECOA 2MH2A 3QU3A 4JBAA 5EEHA 1QNTA 3W6JB 4A2UA 1XCVA 4FHTA 1K78A 2GAUA 2Y0MA 2K27A 2DO7A 1U78A 3WU1B 1FYMA 1T0FA 3Q5FA 1XSXA 5CVJA 2K86A 2LDUA 1J59A 3F22A 4CXFA 1R1VA 1RI7A 1TQIA 4E70A 4IRGA 4I2OA 2OZ6A 3MCZA 3QPHA 1B6AA 2KIMA 1O57A 2LF7A 5FD5A 3KCCA 1I1GA 2KKOA 3CDHA 1FP2A 3L9FA 3HSEA 4CZZA 1HSJA 2D1HA 3F8BA 3KETA 3EUHA 3QAHA 2F5CA 3GZ6A 2WC2A 2WWYA 3DPLC 3SQNA 3ZMSA 1D5VA 5HS9A 3J7AO 2ZBKA 2GQQA 2OBPA 3TDUC 3ZMUA 3KLOA 2F5EA 1P4WA 3WGHA 1FP1D 4UV8A 4IHSA 3WTVC 3BZ6A 5HDNA 1SD7A 5D5UB 1Z7UA 4M72A 3J81Z 4N0BA 2HGCA 2A5YB 1XB4A 5E1ZB 3GWZA 4L18B 1BBYA 4ZZDA 1IN5A 2IA1A 2EA2A 1S3JA 1P92A 3HOSA 2P4WA 1QO0D 3V4GA 1XSDA 5FB2A 5E20A 1YG2A 3SHFA 4HV5A 1PP7U 3WU0A 2HYFA 2PMUA 2VT2A 3PQKA 1ZN2A 4XLNF 1O7LA 3HUGA 3ML6A 3E3VA 5LEKA 1OYWA 1J5YA 3V7SA 1MZBA 2DT5A 4L0YB 1QPMA 5ICEA 4EJVA 4L0ZB 3EQLF 4YG2F 4OU0A 3F21A 1ZG3A 2XVCA 1IN8A 1BI0A 3NQOA 2XIGA 2QM3A 5HS7A 2K4JA 2P6SA 2H6CA 2MH9A 5H6RA 1O7FA 1E2XA 3ABTA 4TV7A 5DCMB 1BI1A 5FD6A 1ODDA 3CJNA 4ENMA 1AWCA 5CVRA 4U0VA 1HSTA 2QQAA 5BQTA 5E18F 1W5SA 4EJOA 4EJTA 4HX4A 4M74A 3KFWX 5LBQA 4NB5A 2MC3A 4GO1A 4A5MA 5BS6A 1HKTA 3C18A 2J5PA 5AONA 3WODF 4XLPF 1GXPA 4GCVA 4AIHA 5BOXA 1J2XA 3O6BB 2EFWA 4MQ9F 5CJ9A 2KJBA 2PG4A 4LMYA 1R1UA 1FC3A 1LJ9A 1XDSA 1IRFA 2Y48A 2DAOA 1ON1A 3TOAA 3KLNA 2A6HF 1Z1DA 1YLFA 1T39A 1LVAA 3M9AA 4XSZF 3K9TA 1KA8A 1KU2A 5LHHA 3HRSA 2P5LC 3E6DA 2M30A 4S04A 2QZ8A 4N9HA 1ZAOA 2KIUA 1IZ1A 4KICA 4MGRA 1RUOA 3M1EA 4G94A 2PJPA 3K1MA 2EA4A 3ZMDA 4WF2A 3I59B 4MEXF 3TGNA 5HDKA 1T6SA 3LQRA 4KDPA 1P2FA 1KQ0A 3ABUA 5DCMA 3SFZA 4HLYA 4HF2A 4BNCA 3KE2A 1R22A 3E5XA 5FO5A 4ESJA 1UHMA 1K7AA 2EFPA 3K1NA 2HQNA 1FZPB 5ICGA 3QP5A 3ZPLA 4RAZA 1FOKA 4L9TA 2VBXA 2V1UA 3BWGA 1XGMA 4A6DA 3WE3A 3CUQA 5L3CA 5E17F 4I02A 2Q8KA 2MLGA 1ZRDA 3ZMZA 2LKPA 1WI9A 3ECHA 2AS5F 1IN4A 4UHTA 5F6FA 2E1NA 4QLCU 3BDDA 1O3RA 3ISPA 2RDPA 2RNJA 1XGNA 1XGOA 2ZJ2A 2OU2A 2COMA 3LWFA 2J5OA 3I4PA 2D1VA 1B9NA 4I98B 3W6KB 4WXHA 3DEUA 3J81K 2JPCA 2KIFA 3D0SA 1H9TA 5DD4A 4IF4A 2B0LA 1G3WA 4YFKF 3V7CA 2VODA 1XN7A 1VTNC 4BQAA 2ZMEB 4CICA 2W57A 3QRFF 1UCRA 3JAMZ 1OPCA 2OA4A 5HS8A 3S2WA 2FNAA 5ERIA 1U8RA 1OKRA 2CWEA 1S8NA 2FBKA 4G6DA 3IHUA 3E6MA 2D2WA 4NQWA 2QBYA 2MBFA 2ZKZA 1P4AA 1QQIA 4FX0A 5DYMA 1G3SA 2GA1A 4YIFA 4RGXA 2ZNYA 2Z99A 5ICFA 1XD7A 4KIGA 3P7NA 5FLXZ 2NRAC 2L4MA 2VBYA 3BY6A 4HX7A 1K78B 2G7HA 2V6CA 4AWXB 4KIBA 2UZKA 2FF4A 3KZYA 4G9YA 3HRUA 3CUQC 4OIQF 2YR2A 2P7CB 4KYWA 1K6OA 1KU9A 4P9FA 3KP5A 1TBXA 4L5JA 4M9ZA 3O3KA 1BJAA 1MJ9A 1L3LA 2CYYA 2X0LA 3IWZA 4HA8A 5DUIA 2FE3A 4RB2C 4R8HA 2EJRA 3V8JA 3WTUC 5KVRA 2MLKA 3V8KA 2FOKA 2VT3A 5J6XA 1O3TA 1IXRC 3KEOA 4EM2A 3GVAA 2FMLA 4ESBA 1TNSA 4K2EA 3ZMVA 3EETA 4AIJA 4WWCA 1IRGA 2YSRA 4I09A 4HDVA 3FF5A 2EFQA 5L3FA 3RIRA 1CGPA 2EFNA 1YO5C 1R23A 4CHUA 1D8KA 4U0WA 2GXGA 4PZJA 1YS6A 2EWNA 2K02A 2P5VA 2UXXA 2DPDA 4HLXA 2VE9A 5HLGA 3PQJA 1FBUA 3GW2A 3GFIA 4MHGA 3I5UA 2DBBA 3LQQA 3QPTA 1BIAA 1W5TA 4N9IA 2O6GE 2IP2A 3RKXA 3WG9A 4KUMA 1IF1A 3K0LA 2NAZA 4WXCA 2LSOA 3LA7A 4M71A 3T1BA 4KA4A 2FQ3A 2IA0A 4O5VA 3RI4A 4FX4A 3LA3A 2K4BA 1R5HA 1B1BA 3Q9VA 1JHFA 2HKOA 4RGRA 1FNNA 4Y13A 2VE8A 4UVCA 2HDCA 4HQEA 2O8XA 1C0WA 4Z2YA 4LD5A 3BOQA 5HLIA 2Z3YA 2FXAA 1ONVA 4PGHA 4G6QA 2VC1A 1RIOH 3LFKA 2IT0A 1LEBA 3EYIA 5DV5A 5CVUA 4HF0A 5DUKA 4UNOA 3VOEA 5IT9Z 1R5GA 5LLQA 1KU3A 4ESFA 4Q5SF 1GXQA 1D3YA 2Z9OA 2CW0F 1LNWA 4BXUA 3BPXA 1YIOA 1S29A 4KFCA 1ON2A 3I54A 4XBFA 4OIRF 2ETHA 3R6SA 1BI3A 4LLLA 3QP6A 2RKHA 1TTYA 1USTA 1BM9A 2FBHA 4EJWA 1ZGAA 2E1CA 1FYLA 1X3UA 2FSWA 3JAMK 1USSA 1HXDA 2A68F 1OR7A 3IWFA 3JSPA 4MTEA 3D5LA 3ULQB 2G7UA 5JI6A 4HZFA 5DCFA 3F3XA 3RPQA 1SFXA 3REOA 1IUYA 1J9IA 5CVVA 1D8JA 3K1PA 4PCQA 1ZHFA 4H0EA 1R1TA 5H20A 2L01A 1KYWA 1LDKB 2ESHA 4R79A 5FLXK 1IN6A 4Y17A 4O6JA 2FMYA 4RGUA 2R7DA 3C1DA 3RJPA 1U5TC 4I7HA 2XAQA 5HOOA 2L4AA 3HSRA 3JW4A 1UB9A 3BPVA 5LGTA 2EV0A 4HOBA 1KGSA 3SZPA 4L9JA 1NHAA 1ZG5A 5L3BA 2ADUA 3CUQB 3VB2A 4M6XA 2XV4S 4RAYA 2M8EA 1JXSA 3L7WA 5D6EA 2L3DA 4Y15A 4OMYA 2F5DA 1KYZA 3IRRA 2OZUA 5D4SA 1R7JA 4UUVA 5D5XB 3L09A 2RC4A 2CSOA 3ROUA 2XAGA 1RZ4A 2A07F 5H6QA 4P55A 5AIQA 2RV8A 4BH9A 1XSVA 3C7JA 1DUXC 2FNPA 4Q47A 2GIVA 3HYIA 2XUBA 3AAFA 5LEJA 2XROA 3LAJA 1GVJA 2BEOA 2H09A 3EYYA 5DEQA 3KP4A 3BP8A 1I1SA 1JGSA 4WK8F 2XASA 2KJCA 3ZMTA 3F8CA 4G7ZF 2VBWA 2HS5A 5ILVA 2QLZA 2GZWA 3QOPA 2R7FA 1WKMA 5D8LB 1I5ZA 1OYYA 2GA2A 1ZARA 2A6EF 3DV8A 1YQAA 3K69A 2HOEA 2QBYB 2CO5A 4GYGA 2QQBA 2ELHA 1Q1HA 3JTHA 3CLOA 1U6GA 2H6BA 1H0MA 3GXOA 2PN6A 4UV9A 3B02A 3R60A 1V3FA 3HSFA 2DU9A 1AOYA 2XRNA 4RB0A 5HDGA 2YX7A 4BHPA 3TOBA 4EGZA 4RB1A 2O0YA 3G3ZA 5JFRA 3MZHA 1CF7A 2STWA 4EMSA 2P7VB 1DPRA 2QENA 2XKPA 3F8FA 1ZREA 1SD5A 4KT5C 1BC7C 2HYGD 5L3DA 4MTDA 2F5FA 1FX7A 5D6FA 3HTSB 1FYKA 5D5WB 1KU7A 2NYXA 5FFZA 1S6LA 3GYHX 3F23A 4B09A 5IT9K 3V7RA 2STTA 2IRFG 1WSUA 3IC7A 5E8GA 3CTAA 3JSOA 5HLHA 1T2KA 3I53A 1Z6TA 1QGPA 1B4AA 1KQ8A 1IXSB 2AXLA 2F2EA 5AIPA 1BN5A 2O03A 4D0PA 3ZN1A 1SD6A 2DI3A 1MDMA 1RNLA 2GWRA 3ZN0A 1W4MA 1MJBA 2QYOA 2RN7A 1W7PA 3KP2A 1TQMA 3F8NA 3K2ZA 3MWMA 5FGMA 2V1XA 3KP7A 3R4KA 4L9VA 3DF8A 1GHCA 3FHZA 2K7LA 2C6YA 1JE8A 1P4XA 4GGGA 2IVMA 3MAJA 1PDNC 2VC0A 5L3GA 4EM0B 1JHHA 2JZYA 4L9NA 4WCGA 1TNTA 4U7DA 2V1DA 1U3EM 1MD0A 1YYVA 1QBJA 4LLNA 4MEYF 3U1DA 1H9GA 4RS8A 3HHGA 3DKWA 1HQCA 1EV7A 3IL2A 1FSHA 2FEZA 4BHBA 4ON0A 4JK1X 1QZZA 2A61A 3WGGA 1Z05A 1S7AA 3RPUA 1XMAA 3KZZA 1SFUA 4PDKA 3L2CA 1ZYRF 1U5TB 2CFXA 4A12A 2M87A 3H92A 2D45A 1TW2A 2G9WA 3CO7C 4LGWA 5LGNA 1R36A 1SFEA
chains in the Genus database with same CATH superfamily
3CC2I 2M7QA 3OYHA 2ZC2A 2V7FA 3WG7H 1F43A 1F4KA 3C2HA 2HTJA 4NHRA 2CH0A 1MBGA 1X49A 4R2QA 1V5GA 4Q4ZF 1ZLKA 2GXAA 2BY2A 2DCEA 1WQ2A 5EDNA 2GOXB 3QU6A 2W85A 4EM1A 3CO6C 4U7BA 3OYFA 2ZSIB 4B8XA 5JLWA 4KN4X 1BI2A 4YIIA 3VEPA 2Q8UA 4YFNF 2L92A 4M9XA 2YTDA 2DMPA 1G8XA 2FD5A 2CJJA 3IKVA 1W0TA 5KAIC 4R2RA 3J80Z 4Q48A 4R2CA 1FTTA 2PI0A 5K5QA 2N3HA 1DPUA 3EQ1A 3WTSC 4UXNA 4PFOA 2WADA 3E6BA 2DYSH 1BC8C 2Q0OA 3QYFA 4CCJA 4FASD 1DP7P 1OYIA 1EJ9A 2X1DA 3I58A 5CVIA 3ZR8X 2DTRA 2LBFA 2K40A 2H94A 5DD8A 1RKWA 3SJMA 2E5NA 4IRIA 1A04A 4I0AA 1ULYA 4XKBA 3F0CA 3TO7A 3W3CA 3OYKA 1FOXA 3F6VA 2OTLI 5K5RA 2OAZA 3MEXA 4O3MA 2EPLX 4IJAA 1LB2A 2LG4A 4M9VC 5HVQC 1TL8A 3IAS2 4NHJA 2EPRA 4WXDA 3ELKA 2MC6A 4R8OA 4HX8A 2WB1N 3ZQGA 3GCMA 3HPHA 1PJQA 4A6EA 5J8FA 3K6QA 2RQLA 2NUFA 3FM3A 4Y52J 2DMQA 3MD2A 4U0YA 2IAIA 3CCRI 2M3AA 2VUMJ 3OR2C 1X58A 2EIKH 3HEFA 4HTGA 3THOB 4LF4E 3OV8A 3OS2A 4LFAE 3FX3A 5F64A 5TGTA 1A1GA 4BGDA 3CCMI 4E7LA 1BJZA 2V79A 1B72B 4AIKA 1LE8A 5HNFA 2BE5F 2IXSA 2HNHA 2W24A 2WTEA 3BR5A 4R1HA 3OSFA 2Z1DA 4HQMA 4IHTA 2IA2A 2GBYA 4HNVA 2KQRA 4NUBA 2QSGX 1F5TA 2Z33A 2ZXJA 2W00A 4X6AJ 3Q3SA 3MN2A 2QVOA 1I94E 2DFHA 1SVLA 3D5RC 1HKSA 4BE2A 5A2QC 4LFBE 1FBQA 3KYLA 2O3FA 2WA0A 2ME6A 1LDDA 3OYIA 5F27A 2L54A 2DW4A 3QPLA 4MQVA 1FMWA 4DYRA 4Y4RA 4A0XA 1IW7F 1A1KA 2YTGA 3BTCA 1LUJB 4EEFG 2XAJA 4PJMA 4FE7A 2ZFWA 3WTWC 3JCUC 1MBEA 2IBDA 2K9LA 3TBIA 5F0CA 2DSYA 3EDPA 1T4OA 1YUIA 1ORKA 2R0QC 1SEUA 1U5TA 4LLGF 1XC5A 1AU7A 3ZQHA 3QOEA 2R7XA 2MFZA 2IJLA 2LR8A 2MDGA 2VOPA 3CCQI 3HPGA 2MKNA 1YOVB 3JR9A 2VKHA 1JJ6C 3SEZA 4KISA 1K79A 2EV6A 3T0YA 4BXFA 1J7KA 4NBQA 3M1CA 2XPVA 2HQRA 3GO5A 2Y0SN 4ZYEA 3DPTA 4JI1E 3ZOQB 4NNJA 4BJTA 2F6CA 1IBLE 2E1OA 1F9NA 4NXNE 5GTHC 1S72I 2ISYA 2HZTA 5M3MJ 3CUOA 3QODA 4A5NA 4CYDA 1A36A 2EMCA 1SD4A 2W25A 1SVMA 3GF2A 2HQAA 2MSYA 3Q9SA 1OFCX 1NH3A 4A69C 2HPMA 2GXBA 3ZGKA 2Z5UA 2BV6A 3CCUI 2EOMA 4UUTA 3SDBA 2EBIA 2FA5A 2W1OA 3KP6A 4FT8A 3LSTA 2FTXB 2ODRC 3AUZA 3K4BA 4UB8C 3ZQ7A 4O43A 2JSCA 3H3UA 5E8IA 4LB6B 4ETSA 4FQGA 2GIZA 5A2QZ 2V9VA 4EGYA 3GTQJ 1M1EB 4ZYDA 2YTFA 1YJWI 3OWTA 1JTYA 2WV0A 3OYGA 4E7JA 4IHWA 4XSXF 5M5YJ 5D5VB 3MKLA 4YHHE 1WJEA 1T4NA 3B6CA 4IHVA 1IRXA 4LFUA 4XN3A 2UXDE 2CMPA 2TDXA 1R6RA 3F72A 2EM7A 4DNCA 5TJJA 5LRRA 4ZJZA 5ED4A 4HAMA 4PJJA 3F6OA 1JKQC 1O3QA 1L0OC 3S2HJ 1YJNI 1YZ9A 1GLNA 1ZR4A 3TKYA 2HEOA 3KEYA 4XRSA 3X2QH 3HOTA 5B1BH 3TW6A 2HOSA 4B3XA 3FXLA 4LF6E 4AD9A 4ASNA 5TRDA 2E60A 1BW5A 1VQ6I 1OQYA 3HM5A 1TW3A 3OYAA 3H9QA 4ZTJA 4OMZA 2LO3A 2V89A 1UFMA 2YSPA 4X64E 1BW6A 4ZH4F 1YX3A 4XONA 2Y9YA 4P5OA 4JQFA 2DLKA 4QWQA 1EH7A 3ADIA 1XMOE 3V42A 2PQ8A 5BPDA 2VQEE 3S32A 4IO9F 3OYEA 4A3BJ 4CA0A 1KQ9A 2ISZA 3GTKJ 4RH8A 2LTPA 1LQ1A 1XDUA 3WTTC 3L2QA 4JV5E 2JA5J 3GUDA 2DLQA 2ZJRF 1ZGJA 3BBGA 1WXRA 3JRCA 4PGGA 4ZYHA 2VQCA 2BOLA 3U21A 2EL6A 1OMIA 2XGEA 3VFZA 3ECRA 2BBYA 3R0JA 2YZTA 3BCBA 4EATA 4IJDA 5E3NA 3JRIA 1JJ8C 5CQGA 5E1XA 1S5LC 3WTXC 1YHQI 2EZKA 2XAHA 2JP9A 2A3SA 4IPAA 3OOPA 3HL2A 2E2HJ 2O61A 1YFHA 4ZYGA 3H0DA 1TLHB 4ENKA 3R61A 3DQVC 4H4KC 3JTGA 2BXZA 3PJRA 4O24A 1T0FC 3T1YE 1X6EA 2H36X 2GM4A 2E34A 2KISA 4B3AA 4RAFA 1YIJI 4F7ZA 2OQGA 2JTVA 2N3GA 4YY3E 5KL3A 2EPOA 3RKYA 5LHIA 1G3TA 1HW5A 3PFIA 1JUMA 2KL4A 3VYRB 2LKXA 4M0VA 1ERDA 2WAEA 5FKNA 5F1RA 1Y0UA 2QGUA 1YW7A 4M6YA 1NG7A 4C2MJ 4ZZLA 1BBOA 4ENJA 4AVPA 2H1LA 3HKZN 4LIUA 2EOEA 2EIJH 3LA2A 1JT6A 4GXOA 4HF1A 2X4HA 3AKZA 3H9GA 3QQAA 1G2DC 2CQQA 1BOAA 2MKDA 3S3NA 2BW3A 1WJAA 3IV5A 4E4HA 1NK2P 2CQKA 1VQ5I 3IP4B 4LK1F 4XMYA 2E1MB 3M7GA 3F8MA 5J8CA 4JI4E 3ZQQA 3I0TA 5LRSA 2NXNB 4M3FA 2XKOA 2ZM6E 1MSEC 1BB8A 2OUMA 3PNVA 5GAGJ 2LH9A 3B73A 4JX6A 2R7TA 3DJWA 3HIFA 3N4MA 3J7AG 3E97A 2EN7A 3FXRA 2ZFUA 3E6CC 5B3SH 3OL4A 1OLTA 1IBKE 1Y1WJ 3FWEA 4YFXF 3A01A 3JTZA 3GFLA 1J5EE 4M9SA 2ENAA 3C2BA 1T38A 1O3SA 1CF7B 2IS6A 1SANA 4P9UA 2YWQA 2DOAA 4XKVA 2Y75A 1QZEA 2RVCA 2XB0X 2VLAA 2VN2A 4CO8A 3LSMA 4DV5E 2F4IA 3W2WA 2B9DA 1MKMA 3HGGA 2R1FA 2JPBA 2JRTA 2ZCWA 4AVZA 1TN9A 4CCMA 5L3EA 2B9SA 3BQYA 1PP8F 2LF8A 1ETWA 3Q0WA 1E17A 2YPRA 1FIAA 2X6YA 3FXOA 3SZTA 4BHCA 1N77A 1LFUP 2EN4A 5EYRA 3G2BA 1R9TJ 2YUSA 2WAQA 4UVBA 5GAEJ 2VPLA 2QUFA 3CF5F 4TUGA 2HR3A 1LFBA 4EV0A 3FDYA 2E72A 3J80K 5F3WA 3HTXA 4EQQA 3G73A 2EN2A 4RGSA 1ZH5A 2RTXA 2AQFA 1RMDA 1NCSA 5E1WA 2DPUA 3K4NA 1PVEA 2CRGA 1I50J 4A3CJ 3IUOA 3PO3J 4IOAF 1AKHA 4OOIA 2BZTA 3WTZA 4C9YA 2YTIA 2YU5A 2XPWA 3WTYC 1WWXA 4BQNA 3PSIA 4I0BA 4PJ0C 1MBKA 1MDMB 4E7IA 2XAFA 3WE2A 3S93A 2ECBA 2EM3A 4GKJE 2E7XA 4AYBN 2VPRA 3L2RA 2LV2A 1QZYA 2LVSA 4Y7NJ 2ACJA 3COAC 4DR2E 4LF9E 3HJEA 4RBOA 1IN7A 1E0EA 2BHYA 4XLCA 3GFMA 1HW2A 3OIOA 1W7PB 3N97A 3FM5A 1FY7A 3GEZA 3SXYA 2ZXWH 2DRPA 1MW7A 2COBA 1GUUA 2R5ZB 1Z9CA 1T4LB 3S3MA 2OTJI 2M1BA 4OWRB 2P6TA 3CD6I 4KZSA 2ESNA 2BVMA 1MMSA 2JOXA 4XLAA 5CYVA 5K5OA 2YX4A 1YPNA 2DK8A 4F92B 2EZHA 3CCSI 4LG0B 4B3SE 2KDOA 4IVNA 2EFOA 4A3FJ 5EGOA 2L5QA 4OIOF 2WB1A 2FU4A 4KNYA 3GX4X 3K70D 5A6KA 2L3CA 2HVSA 4E7SA 3I56I 4BDZA 4R2AA 5ILSA 4WX9A 3VHTB 2A69F 2DFIA 2I8DA 1OISA 4EJUA 2KRHA 1PUEE 1V5EA 3ZQCA 1YTYA 4R2SA 2FRHA 2NNYA 2UXNA 3NEUA 3FXUA 2W4SA 5JLXA 2VONA 5EEGA 3HPSA 2QCOA 4BXXJ 5ICCA 2LNBA 3H5RA 2DOFA 1IXCA 4IRHA 2EQ1A 1RUNA 1Z6RA 2ZXHA 3GTPJ 1MGTA 5E79C 3PNYA 4PUSA 3DFGA 3HTUA 4I01A 2MGQA 3RTRA 3S8PA 3DXJF 1ZAAC 2VQHA 1XPXA 3EPLA 2CPNA 1STZA 4P96A 3RYRA 4M73A 4X62E 3G1OA 2H8RA 2JXPA 4X1EA 4ZC3A 4LU9A 2EK5A 3CMAI 2M1SA 3BJ6A 3SEQA 1FWZA 5J1RA 5CFFE 3NAUA 3HRMA 2XGXA 3KP3A 1K83J 3QG5C 4C3IJ 2EMGA 1IO2A 4CDGA 5JVGF 3MZYA 4BJ6C 1N3GA 4NXME 4OIPF 1YE9A 4YEJA 1W36D 1ZRCA 2OD5A 2VBZA 1STUA 5DNYA 1HLVA 1JUSA 2HWVA 4WPYA 2LMDA 4IXAA 1WGXA 2P5KA 5EG0B 4XQFA 1X48A 5FKKA 1X1CA 2RGVA 2J7JA 3OR1C 5LHGA 5C3EJ 2N8XA 2FBIA 1A1JA 2YRHA 1MMNA 2JVGA 4G8XA 4IQ4A 2DA2A 3TO9A 1RC7A 3LSPA 2LY1A 3FMQA 5KL5A 1YYWA 3A1YA 5A2QK 4Z6YA 2DJIA 1IAWA 1U2WA 2Y0SA 3DCFA 1FBSA 2QQ9A 3BTJA 2W82A 4E7HA 1IG7A 4M3DA 4F3QA 3KEQA 4M30A 4KN7X 1DDNA 2CG4A 1I6XA 1J0RA 3TDZC 1RPWA 2FUG2 3P9IA 4JP0A 3RYPA 1I6HJ 2EPAA 5LL6R 2QKMB 1HBXG 3S16J 4P1WA 2M45A 2M7BA 1POGA 1X3ZB 3FHNA 5FFXA 1ZRFA 2PMHA 1HNXE 2ZO4A 2Y2ZA 1K4TA 1P6RA 4DJAA 3CC4I 5ILUA 1Y56A 4LITA 1E3HA 2RREA 3R0AA 5K1YA 2NVXJ 2UUBE 2BGCA 1I27A 2VIXA 5AASA 2V1NA 3OTOE 2W84A 2VOOA 2NS0A 1N78A 4FTHA 1VZ0A 2L7KA 3CCYA 4A3KJ 4LB5A 3DP7A 4F54A 3I3LA 4F9BB 4DR4E 1YW9A 3CLQA 4HW0A 2IPQX 3FXQA 3H3ZA 5GTIC 3K4KA 1U0JA 4AIDA 3ERED 1HKQA 2V87A 2LRSA 1RRJA 5BMZA 1XGSA 3O8HA 1HW1A 3M8FA 5M3FJ 4L5IA 2LBFB 2KHXA 2BY1A 1X4OA 2RQPA 2OC6A 3FMRA 1XCBA 2CS3A 4XL9A 2H27A 5LGUA 1EH6A 2BVLA 2UWMA 4LJZF 2VJ5A 2F4MB 3NRVA 1MJAA 2P8TA 2XHKA 5J47A 1EH8A 4DOZA 2FOWA 3IRQA 3I59A 3JRFA 2DLLA 4LG0A 1FMVA 2CSHA 2L2MA 3C6KA 3VYTB 4DMIA 1YW8A 2EOQA 4LK0F 4EVIA 3C3WA 2R7QA 4IHXA 3MFKA 4A3IJ 1N36E 3GZ5A 3S1RJ 1WVRA 2KIQA 2DB2A 4S05A 3BJOA 4M2ZA 2XAUA 3HRTA 3T8TA 2DQLA 1W7PD 1ZQ3P 1S7OA 3TO6A 2QA4I 2EOZA 1MBHA 3RDIA 2E7WA 3L00A 4XLFA 3GFJA 4HSRA 1LE8B 2NNNA 3GLXA 1XMKA 3LSIA 4U88A 3U2RA 4G7OF 4MNUA 4DQ2A 2HPIA 4B3ME 3ZP5A 3M3YJ 2PLYA 1WJCA 3P9CA 1MSFC 2Y9ZA 2QF7A 3HHHA 3LAPA 1QU6A 2IW5A 3S2DJ 4QIWN 2L33A 2JRMA 4I76A 1LDJA 2QSFX 3CP2A 1TQPA 1FLIA 4O4KA 1J75A 4B44A 3JRAA 1SMYF 2LBSB 1LKXA 1HOMA 1ZLJA 3LSGA 4IOCF 2YU3A 1Z91A 4HNTA 5FROA 4PSXA 3U9GA 5JHUA 1FT9A 2WBUA 3OYJA 3V8LA 4PFPA 2EMBA 2JN6A 4CGZA 3RQIA 1A1IA 3AFHA 3FXMA 4II2A 1WH7A 2L6MA 1JKRC 2KZVA 1J09A 2OQRA 4KMFA 5EG0A 2PEXA 3VYSB 1UHWA 2H8WA 4HBLA 1NEIA 1LEAA 2QSHX 2DMUA 5D4RA 2F5VA 4HYEA 6PAXA 2KPMA 4BAYA 3LFUA 3OL3A 2OCEA 2L02A 3I64A 3ZQFA 4BL0B 1IMUA 5IYDJ 4JI5E 1G6NA 3T8RA 4KMUX 4C3HJ 3WGIA 2VXZA 1KJKA 2BYVE 1LFPA 2Q2EA 2V4JC 2DQRA 3BQZA 2MD5A 5A6JA 1A6IA 2HVRA 1I3QJ 3M07A 5D8KB 5BPIA 2DT6A 2UUZA 5KK1A 3DKXA 3CQZJ 5CLSA 4A0ZA 1QHGA 3BCAA 4BYYA 4IEJA 4O5GA 4BBYA 3RKQA 4BE0A 3DLAA 2MA3A 1R4MB 5CPRB 3RKWA 3KWRA 3OIQA 1LVKA 2KRFA 2KFDA 3VODA 4OX9E 4IL6C 1BA5A 3BJAA 1REPC 3MQ0A 3FMSA 4BC7A 4B48A 3J7Yp 1BIBA 2EV5A 1VQOI 1SAXA 1R00A 5IT3A 2CGPA 1UHZA 3VK6A 1WZ2A 4LTYA 1YS7A 1SR9A 2R7VA 1VI0A 1T98A 4G7HF 5C4JJ 2ZNZA 1GZ6A 2JVHA 1B59A 3FZVA 4OAYA 2XB5A 4RMNA 4HDUA 3BR2A 1OCTC 1ZBTA 1E3PA 2ZMEA 2EM5A 1WRJA 4RB3C 2EMHA 3MKYB 5JVTA 2LE2A 4A0YA 2ODRD 3M8EA 1G3YA 3E5UA 2PMZN 1WHNA 4GYIA 4RLFA 4OINF 3BG3A 3WHBA 3I71A 2L9SA 2N8GA 2KOUA 1W1WE 5TSEA 2W7NA 4ENNA 2PBIA 2PFBA 3BROA 4ZDPA 3TW7A 1N75A 3LSRA 1MBFA 1XMXA 2QWWA 4HV6A 1SMTA 1V4RA 2EB7A 4RA2A 5DDGA 2VE7C 2NOJB 4W1UA 2HKXA 2JT1A 3GLLA 3BTLA 3C6MA 1G4DA 3T5XA 3IKTA 4F6NA 2EZ6A 3ZXSA 2HTSA 3O2PE 1Z7LA 4A3EJ 3E5QA 1D1BA 3TQNA 3QYEA 1D5YA 2E2IJ 2EPPA 1F1ZA 2KONA 1FPQA 1WHUA 3E7LA 2DK5A 4QPOA 2IGNA 1B9MA 2B3TB 1FSEA 3P9KA 4UVAA 4RM2A 5JR3A 1ZG1A 1S9HA 2M5WA 4DR7E 4KIFA 3H1CA 2HFHA 3IH4A 4CSWA 4XRFA 2KT0A 2R3SA 2Y30A 1JUPA 1R58A 1RQ0A 3ECOA 1P7JA 2MH2A 3I9V2 4LOCA 4XK4A 4QPQA 4A3JJ 3QU3A 4JBAA 5EEHA 1QNTA 2M9HA 3I4MJ 3W6JB 2EORA 4A2UA 1XCVA 4FHTA 1K78A 2GAUA 2Y0MA 2K27A 4AYBA 2DO7A 3HUGB 1U78A 3WU1B 1FYMA 2CV0A 1OCRH 1T0FA 1ITYA 2LRDA 3Q5FA 1XSXA 4FISA 1VFCA 4U87A 3MHSC 2EN1A 1IDZA 1Z21A 5CVJA 4WFTA 2EH3A 5IT9C 2K86A 2WZOA 1T56A 2BHZA 3ADGA 2LDUA 1J59A 3J81C 2RSMA 1RKTA 1E3OC 2ELJA 3HOZJ 2GPIA 3F22A 4CXFA 1R1VA 1RI7A 1TQIA 2RAEA 3VSKA 2DMYA 4E70A 2LUPB 2YSOA 4IRGA 5B1AH 2B7EA 4I2OA 2IHR1 3L2VA 2EM4A 2OZ6A 3MCZA 4Q35B 4GZNC 2EZLA 3QPHA 1B6AA 2KHMA 2KIMA 1O57A 2LF7A 5FD5A 3KCCA 1I1GA 2KKOA 1A6QA 3CDHA 1FP2A 2R7SA 1YYOA 2IGOA 3L9FA 3HSEA 5T6JA 4CZZA 2BW3B 1HSJA 2D1HA 3F8BA 4Y33A 3KETA 1MH3A 2RS7A 2AHQA 1X1PA 2F4OB 3DTIA 2NUGA 3EUHA 3RMPA 3QAHA 2F5CA 3GZ6A 2V9KA 2WC2A 2WY7Q 2WWYA 1GDTA 4M3EA 4I99C 1YI2I 3F6GA 3DPLC 3AL0C 3SQNA 1X19A 3FXJA 3ZMSA 1D5VA 5HS9A 1Q1VA 3J7AO 4DZJA 4X0GA 2ZBKA 2F48A 5HLTA 2GQQA 4UUSB 3BC8A 2A6TA 3JU0A 2OBPA 3TDUC 2R7OA 1G2FC 3A01B 3ZMUA 1J26A 1O0WA 4XKCA 2A5WA 3KLOA 2F5EA 1P4WA 3WGHA 1RR7A 3IWDA 1TT5B 1FP1D 1D1CA 4UV8A 4IHSA 4LF7E 5J3LA 3WTVC 2YRKA 2FJ1A 3BZ6A 5HDNA 2EMAA 3QPSA 3OS1A 1SD7A 5D5UB 1Z7UA 1XX5A 4M72A 4AU7A 3J81Z 4N0BA 1KYQA 4XRSG 2HGCA 2ZMEC 2EILH 3TMOA 3HOVJ 1IV8A 2A5YB 1Y8RB 2VKVA 1XB4A 5E1ZB 3GWZA 2K9NA 4L18B 1BBYA 4DR1E 1X1BA 4DGWB 4ZZDA 2HXIA 3RZDJ 1H8AC 1IN5A 2IA1A 3TEDA 2EA2A 1JT0A 3J7YJ 4V2GA 1S3JA 2EOFA 1P92A 4XM3A 3BG7A 3KYCB 3HOSA 5LMNE 2KZGA 2P4WA 1BL0A 3CC7I 1QO0D 3ZCOA 3V4GA 4B47A 1XSDA 5FB2A 5E20A 1YG2A 2L7ZA 3NWTA 1PYVA 3SHFA 2EMFA 2LTRA 3WHCA 2M8GX 4HV5A 2BBGA 4RM3A 1AKHB 1PP7U 3OMLA 3G1LA 3WU0A 3K4LA 2HYFA 4C30A 2FX0A 2PMUA 2EIMH 5KL2A 2JWTA 1NTCA 3S1NJ 2P0WA 3CDIA 3SZGA 2PJRA 1A5JA 1R5ID 2VT2A 1FEXA 3PQKA 2ELZA 3HQ1A 1ZN2A 4XLNF 2DA3A 1O7LA 4F55A 2DTZA 3HUGA 3ML6A 3E3VA 3OYDA 2LUQA 5LEKA 4ZDOA 2DMTA 1T08B 1OYWA 3PM1A 1XTAA 3OYMA 2MC4A 4DZPA 2DODA 3KYDB 1XG1A 1GV2A 1J5YA 4HPQA 3UKGA 3V7SA 4A3LJ 1MZBA 2DT5A 4L0YB 1QPMA 1G59A 1WJPA 1AAYA 3ERMA 5ICEA 4EJVA 3VDXA 1HCRA 3BZCA 3OSGA 4L0ZB 3EQLF 4YG2F 1U9OA 4OU0A 3F21A 1ZG3A 2XVCA 3MSWA 1IN8A 1BI0A 3NQOA 4NDLA 5EGOB 2XIGA 2QM3A 5HS7A 2K4JA 3FBNB 2P6SA 2H6CA 2MH9A 4A3DJ 4GFBA 1X5WA 5H6RA 4CCKA 2YTJA 1X3CA 1O7FA 3K4MA 1E2XA 3ABTA 4TV7A 2E5LE 2M2EA 1SVOA 4L5EA 5DCMB 2EMZA 3LNQA 1BI1A 4V19K 5FD6A 4YRVA 2M7AA 1ODDA 3CJNA 1QA6A 3EUHC 4ENMA 1AWCA 5CVRA 2D5VA 1D0ZA 4U0VA 1QVUA 1HSTA 2QQAA 1GV5A 5BQTA 2CV2A 4DYCA 1ZKGA 5E18F 2O7OA 2EMYA 4UUSA 1JKOC 1W5SA 5F0FA 4EJOA 1UHSA 4HX4A 4EJTA 3EPHA 2F4VE 4XOTA 1ZR9A 2I10A 4M74A 4ANJA 3P5JA 3KFWX 5LBQA 3OIPA 4JYAE 2HC5A 2R92J 3GZNB 2JA7J 4NB5A 2MC3A 2DDBA 2NOGA 4GO1A 1Z3YA 1A1HA 1Y0NA 4A5MA 5K7ZA 3L1PA 5BS6A 1HKTA 4DIQA 2EMWA 3C18A 2CFOA 2J5PA 5IV8B 5AONA 3UR3C 3WODF 4XLPF 3H5NA 2CUFA 1GXPA 4DV7E 4GCVA 3TP0A 4AIHA 1WJBA 5BOXA 3HOXJ 1BOBA 2UUAE 1J2XA 1JK2A 3O6BB 2EOIA 5A6BA 3DTKA 4J19A 2VF1A 2EFWA 2CTDA 4DKKA 4MQ9F 5CJ9A 2KJBA 1VQLI 3PNTA 2PG4A 3HB9A 3PUBA 4DV3E 4LMYA 5IPAA 1R1UA 1WPKA 1Y6IA 2CUJA 4ITVA 4BY1J 1FC3A 2EQ0A 1LJ9A 1XDSA 1IRFA 2Y48A 3H35A 4C3JJ 1TC3C 2DAOA 2JA6J 1ON1A 3TOAA 3KLNA 2E35A 3GTMJ 2EPUA 2L2KB 2A6HF 2RSIA 1X6HA 1Z1DA 1YLFA 1XNRE 1SFOJ 3H09A 2R5YA 1T39A 2MYSA 2JSPA 2TCTA 2FGGA 1Y39A 4M3GA 2CT1A 1EA3A 1LVAA 2V26A 3M9AA 2LOOA 2EM6A 2KLOA 4MFEA 4XSZF 3K9TA 4LG3A 1KA8A 1VQ7I 1KU2A 5LHHA 3HRSA 2P5LC 1GQEA 1OCPA 3E6DA 1TWCJ 2GLOA 2M30A 5GPCA 4S04A 5F08A 2QZ8A 4N9HA 1ZAOA 2YTEA 2KIUA 2LTSA 1IZ1A 1UMQA 4F93B 4KICA 4MGRA 2VQGA 1IRZA 1RUOA 1Z1BA 3M1EA 5DM6F 4G94A 2PMZA 2PJPA 3K1MA 1MMGA 2EA4A 2YTNA 3ZMDA 4WF2A 3I59B 1P7IA 5KHDA 4MEXF 4PSWA 2DA4A 1K4SA 3TGNA 5HDKA 1T6SA 2EQ3A 1OCZH 3LQRA 2RQQA 4KDPA 3ABKH 2IGKA 1P2FA 2X6XA 1KQ0A 1DU0A 5BR8E 2UV1A 5C4XJ 3ABUA 4F2JC 5DCMA 2X1EA 3C2GA 3OYLA 1V5FA 3SFZA 4PJNA 4HLYA 1HDDC 4HF2A 4BNCA 1UELB 2KMUA 3KE2A 2ECCA 5M5WJ 3ABLH 4BMJA 2MG4A 4B3RE 5DS9A 1R22A 3E5XA 1A31A 5K7FA 5FO5A 1JI8A 3ZQLA 2PX9A 3D5SC 1P47A 4ESJA 4TUIA 3AV0A 1UHMA 1K7AA 2EFPA 3K1NA 4J8ZA 3JRBA 1X2MA 2HQNA 2JWOA 1FZPB 5ICGA 4ABZA 3C4BA 3QP5A 4IQJA 3UNGC 3ZPLA 4RAZA 1FOKA 2X85A 2ZSHB 4L9TA 2VBXA 2M4KA 5M5XJ 5AE2A 4HSTA 2JA2A 3DU6A 2V1UA 3OYNA 3BWGA 1ZGWA 1XGMA 1FJLA 2R93J 4I8OA 1D0XA 3KZIC 4A6DA 3WE3A 4DR6E 3CUQA 4R2PA 1DQUA 5BNGA 3ZQIA 2IGMA 5L3CA 2MDRA 4OOGC 2EOJA 4CCLA 2KRCA 3OS0A 2G0EA 1YRNA 2L8TA 5E17F 3DF6A 4G12A 3JAMC 2LY9A 4I02A 2Q8KA 3W2VA 2MLGA 1ZRDA 3ZMZA 2LKPA 1WI9A 1Z77A 3E0JB 3ECHA 2AS5F 2EP3A 1IN4A 1RETA 3J7ZI 4UHTA 2F8BA 5F6FA 2DGCA 2VL8A 2E1NA 4QLCU 2EQRA 3BG9A 1ZBQA 2B7VA 2KDZA 2CQNA 2ME0A 1QU3A 3BDDA 2H1KA 2R4GA 3D1NI 1UZCA 1YITI 2Z16A 3EPZA 2K85A 1O3RA 3ISPA 1HNWE 2RDPA 2RNJA 2B7TA 2Q2EB 3OOUA 2V6EA 1XGNA 3CJRB 1XGOA 2ZJ2A 2OU2A 3DKYA 1ZELA 4M6VA 2COMA 4XIDA 3AL0B 2EMLA 5IWAE 3LWFA 2J5OA 4B4CA 3I4PA 4A3MJ 2D1VA 1B9NA 4I98B 4F91B 3W6KB 2K4VA 4WXHA 1F2IG 3DEUA 3J81K 2EOSA 2JPCA 2K9SA 2KIFA 3D0SA 1H9TA 2I5UA 4F6MA 5DD4A 4DYQA 4IF4A 2HHHE 2EN6A 4BEHB 1RESA 4AUXA 2B0LA 2OV7A 1H89C 1G3WA 9ANTA 2VRDA 4YFKF 5FLXC 3GTLJ 3V7CA 1AA7A 3ZOBA 2VODA 1XN7A 2EOOA 3DU5A 1IUFA 1VTNC 2DYRH 3H9JA 4RAGA 2DXIA 4BQAA 4IKFA 3GTGJ 2ZMEB 4CICA 2W57A 3QRFF 1BR2A 5IP9J 3LL7A 3LLHA 4JI6E 1UCRA 3JAMZ 2Y69H 3ABMH 4IHYA 2XF6A 1OPCA 2OA4A 4D5CA 5HS8A 2O9LA 3S2WA 4G6TB 4PK4A 2OJED 3MZ8A 2IEKA 3HC7A 1TWFJ 4BQOA 2FNAA 5ERIA 3PIPF 3OYBA 1OKRA 1U8RA 5GP9A 4UB6C 2V85A 1B8IB 1EKZA 3S14J 2CWEA 2HXOA 1IDYA 1S8NA 3GBGA 2LC2A 5FRNA 2EOXA 5DM7F 2FBKA 4G6DA 1YX5A 3IHUA 2CW8A 3E6MA 2D2WA 4MO7A 4NQWA 2L9NA 4HEIA 2EPNA 4BBSJ 2VQFE 2QBYA 2MBFA 1WI3A 2M34A 4FK5C 2ZKZA 1P4AA 3SYTA 1K6YA 3GTOJ 3S1MJ 1QQIA 2I9IA 2RS6A 2R76A 2ZB9A 4FX0A 5DYMA 3DPUA 1IGNA 5IP6A 1G3SA 4GEQB 4JI3E 2EINH 1H88C 2GA1A 1GTKA 4GKKE 1HC8A 4YIFA 4RGXA 2BY0A 2ZNYA 1MNMC 3MMYB 1PJSA 2Z99A 5ICFA 1XD7A 4KIGA 1HF0A 2X9DA 4R03A 3GTJJ 3BF2A 3P7NA 3F9KA 5FLXZ 2W48A 2NRAC 1IQOA 2BB8A 2L4MA 2VBYA 2JA8J 2EM2A 4DV1E 3BY6A 3FISA 2ADRA 2DA7A 3BGHA 4C2UA 4HX7A 3CDLA 4J00A 1K78B 4JI8E 4B1RA 2G7HA 3A4CA 4BBRJ 2V6CA 5KNLA 2VB6A 1QVTA 4AWXB 4KIBA 1T95A 2GLIA 2UZKA 2VJ4A 4P7DA 2Z2SB 2FF4A 3KZYA 4G9YA 4WYQB 3HRUA 3CUQC 4OIQF 3LMLA 2YR2A 3CCLI 2P7CB 4KYWA 3TL4X 2XGDA 2WBTA 3FK6A 2DDAA 1K6OA 2PRTA 2I13A 3IH3A 4KITB 1KU9A 4PJLA 4Q28A 2JOBA 4P9FA 3KP5A 1TBXA 3BR0A 4L5JA 4JX5A 4M9ZA 1PJRA 3O3KA 3H0GJ 3RZOJ 3M8JA 4IZZA 3AG1H 3G71I 2HZDA 4XICA 1BJAA 1MJ9A 1RR8C 2NABA 1L3LA 2CYYA 2V88A 2X0LA 1PUFA 3ONQA 2ID3A 2TRTA 1XS9A 1BR4A 1FJGE 3IWZA 2E5ZA 4HA8A 2XF5A 5DUIA 1ETQA 1U9NA 2FE3A 4RB2C 2EN8A 2D9HA 5FJ8J 2CV1A 4R8HA 4BEHA 2EJRA 3V8JA 2X51A 5DTDA 3WTUC 2HOAA 5KVRA 2MLKA 1F36A 3V8KA 5IYBJ 4W97A 2FOKA 1QPIA 2VT3A 2EPCA 5J6XA 2WAFA 1VQ9I 3CESA 1O3TA 1IXRC 3KEOA 4EM2A 3B6AA 5B5EC 4JOMA 1KONA 3MKZA 1CQTA 3GVAA 5LD2C 1ACIA 3VPRA 1PDAA 1IBME 2FMLA 4ESBA 1TNSA 4K2EA 3ZMVA 3EETA 2HDDA 4AIJA 1GVDA 2JMWA 3CF2A 4MLOA 4WWCA 2ZJPF 1IRGA 2YSRA 5H2FC 1JK1A 4I09A 4HDVA 2M4IA 3VYYA 2YS9A 3JREA 1B8IA 3FF5A 2EFQA 5L3FA 3RIRA 3CMYA 4FCYA 1I3AA 1CGPA 3FXKA 2EFNA 4BJ5C 1YO5C 2Q1ZB 1R23A 4BQQA 1D8KA 4CHUA 3ADLA 4U0WA 4X8WA 2GXGA 3BR6A 3FBIB 1YS6A 2EWNA 2K02A 4PZJA 3IWBA 3IWCA 2P5VA 2CQ7A 2UXXA 2DPDA 4V2FA 1RC9A 4HLXA 2WV1A 4RLQA 2VE9A 3VYUB 5HLGA 4ZTFA 3MVPA 4P78A 3PQJA 1FBUA 3GW2A 1R4NB 3GFIA 1AH5A 4XORA 1UN6B 2WBMA 4MHGA 3I5UA 2DBBA 3HZJA 3LQQA 4JX4A 1ETYA 2O5RA 2LMZA 3E1SA 4DUZE 1BR1A 2XGCA 1QRYA 3QPTA 1V54H 2PJRB 1BIAA 1W5TA 4N9IA 2MABA 2O6GE 3TQMA 1ZTRA 2ENHA 2IP2A 2CQXA 3RKXA 3WG9A 3EPJA 2CW7A 1N32E 4KUMA 3BZKA 1IF1A 3K0LA 2NAZA 3QWLA 4WXCA 4XN0A 4YELA 2LSOA 3LA7A 2NVTJ 3S17J 1LPQA 1ETXA 5IOYA 4FE4A 5IXMB 4M71A 1IJWC 1X6FA 4D5FA 2L0KA 2EM0A 3C4TA 3G4SI 1T8IA 1Y8QB 3K10A 3T1BA 4XR6A 4KA4A 1OJLA 3BR1A 2FQ3A 2IA0A 3U1KA 4O5VA 3RI4A 4FX4A 1EF4A 1WCMJ 2YU8A 3LA3A 5IYCJ 3CMEI 4KWYA 2DT7B 2LJHA 2LT7A 2K4BA 1PKPA 2LREA 2R7UA 2YT4A 1R5HA 2LY2A 1MNDA 2AXTC 5J4YA 5JHFA 4DV6E 4HG2A 4CCNA 1B1BA 1S7EA 3Q9VA 1JHFA 1DGWY 2HKOA 4RGRA 1FNNA 2LLKA 1UBDC 4OAZA 4Y13A 2EZIA 1VQNI 2VE8A 2Y31A 1A1FA 4UVCA 1IQSA 2HDCA 4BC9A 4HQEA 1FOYA 2O8XA 3PFYA 4Z2YA 1C0WA 2X1CA 4LD5A 3BOQA 1YJ9I 4QTRA 5HLIA 2Z3YA 2FXAA 1ONVA 2GOMA 4PGHA 4G6QA 2VC1A 1RIOH 3LFKA 3KPHA 2IT0A 1LEBA 2LVHA 5AE1A 3EYIA 2OCCH 5AC4A 5DV5A 5CVUA 4HF0A 3HBLA 1QHHD 1FTZA 4DBQA 5DUKA 4UNOA 3VOEA 1B69A 4F9CB 5IT9Z 1R5GA 4UY8I 3L2UA 5LLQA 2EMKA 1KU3A 5E3OA 4ESFA 4Q5SF 1GXQA 1D3YA 2Z9OA 2VKEA 2NA2A 2EMIA 1ENHA 5E3MA 4XLEA 4BU2A 2V86A 2DJNA 2CW0F 2L7FP 1DI2A 1LNWA 4BXUA 3BPXA 1YIOA 1S29A 5J40A 4KFCA 1ON2A 3I54A 4II3A 2A25A 2UXBE 4XBFA 4OIRF 2P81A 4E7KA 3H36A 2ETHA 5E3LA 3R6SA 1VQ8I 2XRLA 3BLYA 1Z67A 3A0BC 1BI3A 4LLLA 3QP6A 4BDYA 2RKHA 4XOPA 4DR3E 3PL8A 5F0HA 5C44J 2HI3A 3A02A 1TTYA 1BBGA 1WJFA 1USTA 4AQYE 1BM9A 2FBHA 4EJWA 1ZGAA 2DN0A 2E1CA 1FYLA 3FKIJ 1X3UA 2DFEA 1N25A 1TWAJ 2FSWA 3DEEA 4IS1C 3JAMK 2R5YB 3HPZA 1VQKI 1USSA 1D1AA 2L2OA 1HXDA 2QEXI 1IV6A 3HOWJ 2A68F 4S0HB 1OR7A 3IWFA 3CCVI 3AG3H 3KIOA 5J1UA 1B72A 2LKSA 3JSPA 4MTEA 2L9VA 3M4OJ 4DW6A 5A69A 2EPFA 1X1AA 3D5LA 3ULQB 1R71A 4N4OB 2G7UA 5JI6A 4HZFA 3S1QJ 5DCFA 2ELKA 4WSPA 3F3XA 3RPQA 3ASOH 1KZHA 1SFXA 3REOA 5IP7J 4R2DA 4DV4E 4NC7A 5CQEA 4GDFA 1ZU1A 1IUYA 4FETA 3PSFA 1J9IA 3Q0UA 1UG2A 2GHFA 4K0KE 5CVVA 1D8JA 2AO9A 4D7MA 2X6WA 3JRHA 2NS8A 4WSGA 5ADZA 3K1PA 4PCQA 1ZHFA 4H0EA 2EPXA 1R1TA 1MMAA 2NVYJ 5H20A 2FQ4A 2L01A 1KYWA 1TF3A 3BT9A 1TWGJ 1ZK8A 3DLLF 1LDKB 2E19A 5EF6A 2ESHA 4R79A 5FLXK 1IN6A 3WU2C 4Y17A 1MBJA 4O6JA 1NK3P 3K7AJ 2FMYA 4RGUA 2R7DA 1A35A 4JI7E 1U8BA 2R7ZJ 3C1DA 3RJPA 5FLVA 1U5TC 4I7HA 2XAQA 3RQ4A 3JRGA 2WY8Q 3EUAA 1ETOA 2LFBA 2EWLA 5HOOA 1EKEA 2L4AA 3HSRA 2JUGA 4MFDA 2LJUA 4BKXA 2L9RA 1UB9A 2OPTA 3JW4A 3BPVA 2JUCA 5LGTA 2EV0A 3ASNH 3TP3A 2YTPA 1GT0C 1L4SA 2ZJQF 2K9QA 1IC8A 4HOBA 1KGSA 3SZPA 2JK3A 3L2WA 4L9JA 3HXLA 3CJQB 1HNZE 1NHAA 1OCOH 3FIWA 3G1MA 4D7NA 1Y1VJ 1ZG5A 4JYKA 1JKPC 1UAAA 5L3BA 5EEAA 2ADUA 3CUQB 3P1XA 1JTXA 1DU6A 3S15J 3VB2A 4M6XA 5HODA 2XV4S 5GADJ 4RAYA 1YRNB 2M8EA 1FIPA 1UG0A 1HR0E 2NVQJ 3DBRB 4F52A 1R49A 5IOZA 3L7WA 3I4NJ 1Z3XA 5D6EA 3FKJA 4HNUA 1DP3A 1JXSA 2L3DA 2EL5A 1XNQE 2R7RA 1YYKA 1X4PA 1TT0A 4Y15A 4OMYA 3KX2A 2UUCE 3LSKA 1N33E 1WHQA 2YTQA 2HJJA 3GMEA 2F5DA 4GRIA 1KYZA 2XSDC 2HDWA 2OZUA 1MNEA 5D4SA 4D1QA 3IRRA 3S3OA 1R7JA 2XSJC 5D5XB 4UUVA 1MIJA 3L09A 2RC4A 2CSOA 3ROUA 2XAGA 1RZ4A 2A07F 2EJ4A 4HEA2 4X66E 5H6QA 1DQ3A 2BXYA 4P55A 4NC8A 2RV8A 5AIQA 4BH9A 4D9JA 2ENCA 1XSVA 2DMNA 3C7JA 3O8GA 4BE1A 1DUXC 2FNPA 1WJDA 4Q47A 2GIVA 3HYIA 5A6AA 4BACA 4J01A 2XUBA 3AAFA 5LEJA 2XROA 2NVUB 1P9QC 1WJ5A 5A6BD 1MMDA 3LAJA 2V83A 2E71A 5K7HA 3QYBA 1GVJA 2BEOA 2H09A 4XNFA 1N34E 3CP8A 2YU9J 3EYYA 2QQ8A 1OCCH 5DEQA 3KP4A 1LLMC 3BP8A 3PUFA 2EM9A 1I1SA 2LCEA 4E7ZA 3G6EI 1JGSA 3OY9A 1OR7C 4WK8F 2XASA 2HYJA 3PO2J 1X2NA 2KJCA 3ZMTA 3F8CA 2HOTA 4G7ZF 2VBWA 2X48A 2HS5A 5ILVA 4CCOA 2QLZA 4ZDLA 2GZWA 3QOPA 4LIVA 3SDGA 4MLVA 2R7FA 2YPNA 4MIMA 1WKMA 5D8LB 2WBSA 2VJIA 2IS1A 1I5ZA 3F6HA 4M3BA 3ADJA 3MKWB 3IH2A 2M9AA 1OYYA 5J4VA 3H3VK 2GA2A 1ZARA 2A6EF 2BY3A 2VKDA 4KT6A 4C2TA 3DV8A 1YQAA 3K69A 1SC7A 4DV0E 2RNGA 4X65E 3FK7A 4NQWB 3RCOA 2ZXIA 3BTIA 4XKWA 1AHDP 2DMIA 2HOEA 2QBYB 5KCMA 4R2EA 2CO5A 2K3PA 2X6OA 4GYGA 2UU9E 2M0CA 2QQBA 4IX7A 2ELHA 1Q1HA 3JTHA 3CLOA 1U6GA 5J1YA 5CKTA 2JQ7A 1PJTA 2EE8A 1A1LA 2H6BA 3AG4H 4BUPA 1H0MA 3GXOA 2PN6A 3MHHC 1VQPI 1TP4A 2O8KA 3DTEA 4UV9A 2EPKX 3B02A 5FKOA 3R60A 1FKAE 3NARA 3NWSA 1V3FA 2E1MA 4Y3OA 2K7IA 3HSFA 2DU9A 3Q0VA 4XRMA 2XRNA 4RB0A 5HDGA 1AOYA 4JI0E 2YX7A 2HU9A 3ESWB 4BHPA 2R7WA 3OYCA 3TOBA 2MW8A 1WFXA 4EGZA 3K4CA 2E2JJ 4RB1A 2O0YA 1JGGA 4KHPE 3IAM2 1WH5A 1X1DA 4B43A 3G3ZA 4CYCB 5JFRA 3HOYJ 2RPCA 3MZHA 3JRDA 1UJ8A 4QSHA 4ZYAA 2IS4A 1CF7A 2STWA 5TISC 4EMSA 2P7VB 1DPRA 2QENA 2XKPA 3F8FA 1ZREA 2EOYA 3DEWA 1SD5A 4B3TE 4DBRA 2JR1A 3EPKA 1HDPA 4KT5C 2V8QB 4LFCE 1BC7C 2HYGD 1VQ4I 3DWLE 1SAUA 5L3DA 2F5FA 4MTDA 4E6KG 3THNA 1FX7A 5D6FA 4N4RB 5FLMJ 1MEYC 3HTSB 1FYKA 5D5WB 1FOWA 4CZCA 1KU7A 2JJ7A 1VF9A 2VI6A 2NYXA 5FFZA 2DA6A 2DOEA 1S6LA 2UXCE 2LK2A 2B63J 3GYHX 2L7MP 3F23A 3HGYA 4B09A 1PUFB 3BIDA 1X47A 4BS9A 3ZRGA 5IT9K 2MD0A 3V7RA 2K9MA 1G2HA 1D0YA 2STTA 2QKLB 2VQLA 1ETVA 2IRFG 3H5AA 1WSUA 3IC7A 4L5NC 4DV2E 5E8GA 3FIGA 3CTAA 3JSOA 1YSAC 1MH4A 2OF7A 5HLHA 1TZLA 2XF7A 3I53A 4KJZA 1T2KA 1UILA 4XLHA 2EL4A 2EPMX 4JI2E 1Z6TA 2VJJA 2HQ5A 3CZ6A 1QGPA 1B4AA 3A2KA 1IXSB 1KQ8A 2AXLA 2CUEA 3HG9A 2F2EA 5AIPA 2VXDA 5B66C 1BN5A 2O03A 2FV4B 4D0PA 5LFAA 3DBHB 5KAFC 3ZN1A 1SD6A 2DI3A 3VSLA 2NS7A 4AM3A 2YRMA 3BR3A 5LMUE 1XMQE 2DA5A 5EJCA 5F1JA 1MDMA 1RNLA 2A05A 3EUKL 5KL6A 2JPAA 1DGRM 2AQEA 2GWRA 3CCEI 1HA8A 4DUYE 2XDVA 3LSJA 4RDUA 3M99B 3LSHA 3K2AA 3ZN0A 4YIRX 3OMYA 2EN3A 3W6VA 1W4MA 2EMXA 1MJBA 2QYOA 2K5CA 1V55H 1I39A 2RN7A 2V9PA 3BG5A 2CUZA 2HGHA 1W7PA 3K70C 1VQMI 3KP2A 1TQMA 3PIOF 5GPAA 5FKMA 2NUEA 2JVAA 3F8NA 3K2ZA 3MWMA 5FGMA 2ELYA 2V1XA 5AE3A 3KP7A 4DR5E 2R5ZA 1W5CC 3R4KA 4CUGA 3A03A 4AC0A 4I6ZA 5AC5A 4L9VA 4CH7A 2ICWG 3DF8A 1K61A 1GHCA 3FHZA 2EPZA 3RSNA 2K7LA 2C6YA 1JE8A 1P4XA 4GGGA 2IVMA 3MAJA 5GAHJ 1PDNC 2VC0A 5L3GA 2L2NA 4NZVA 3AG2H 1JHHA 4EM0B 1TWHJ 2DA1A 2JZYA 2KP6A 4L9NA 4WCGA 2IS2A 1SFKA 1TNTA 3VWBA 3LMMA 1DGCA 3LOCA 4U7DA 5EZGA 4HRIA 2V1DA 1U3EM 4LF5E 4RHBB 4LF8E 1W0UA 2EOHA 1TF6A 4BCAA 4NC6A 3W2AA 1MD0A 3I55I 3A0HC 2E1MC 1APLC 1YYVA 5FRMA 3HOUJ 3SFIA 2LP0A 3K4JA 1QBJA 4LLNA 4MEYF 2MC5A 3U1DA 1H9GA 4RS8A 2EM8A 1W36C 3HHGA 2WCC3 3DKWA 1HQCA 3CJTB 4CYCA 1EV7A 1O4XA 4A93J 3IL2A 4N4NB 1FSHA 1X3WB 2FEZA 4BHBA 4ON0A 4JK1X 5F04A 4F9AB 3UK3C 3J80C 1QZZA 2A61A 3WGGA 5HNHA 3T1HE 2CU7A 1ETKA 1Z05A 2YTOA 2DIXA 2E36A 1S7AA 3RPUA 1Z0XA 5KL4A 2LYCA 1NG6A 1XMAA 3KZZA 2L3JA 1SFUA 2LD5A 5FKLA 2M0MA 4PDKA 3L2CA 2XPUA 2VASA 3K6GA 2DFFA 5EZHA 1ZYRF 1U5TB 2CFXA 4X9JA 3BG6A 4A12A 3N05A 1T33A 2M87A 4BY7J 2K3FA 3HDDA 2ID6A 3H92A 2XC7A 4L8NA 3VYXA 2JY9A 3DBLB 2HVQA 2D45A 1VNDA 1ZR2A 2WAQN 1TW2A 5IY5H 2G9WA 3J7AY 3CO7C 2M4GA 4LGWA 2JYAA 3HKZA 4A3GJ 4MLQA 3CCJI 5KL7A 3RPUD 1YUJA 3CMMA 5LGNA 1R36A 1SFEA
chains in the Genus database with same CATH topology
1F4KA 2HTJA 4Q4ZF 1ZLKA 1WQ2A 3QU6A 2W85A 4EM1A 3CO6C 4U7BA 4B8XA 4KN4X 1BI2A 4YIIA 3VEPA 4YFNF 4M9XA 3IKVA 3J80Z 4Q48A 2PI0A 5K5QA 1DPUA 3WTSC 4UXNA 3E6BA 1BC8C 2Q0OA 1DP7P 1OYIA 5CVIA 3I58A 2DTRA 2H94A 5DD8A 4IRIA 1A04A 4I0AA 1ULYA 3TO7A 3F6VA 5K5RA 2OAZA 3MEXA 4O3MA 4IJAA 1LB2A 5HVQC 4NHJA 4WXDA 3ELKA 4HX8A 4A6EA 5J8FA 3FM3A 4U0YA 3OV8A 3FX3A 5F64A 2V79A 4AIKA 2BE5F 2W24A 4R1HA 2WTEA 4HQMA 4IHTA 2IA2A 1F5TA 2Z33A 2ZXJA 2QVOA 1HKSA 1FBQA 2O3FA 1LDDA 2L54A 2DW4A 4MQVA 4A0XA 1IW7F 2XAJA 2ZFWA 3WTWC 3EDPA 1U5TA 4LLGF 2IJLA 2VOPA 1K79A 2EV6A 3T0YA 1J7KA 2HQRA 3GO5A 4ZYEA 3DPTA 1F9NA 2ISYA 2HZTA 3CUOA 4A5NA 4CYDA 1SD4A 2W25A 3GF2A 3Q9SA 2GXBA 2Z5UA 2BV6A 2FA5A 3KP6A 4FT8A 3LSTA 3ZQ7A 2JSCA 3H3UA 5E8IA 4LB6B 4ETSA 5A2QZ 2V9VA 4EGYA 4ZYDA 2WV0A 4XSXF 5D5VB 4LFUA 2TDXA 3F72A 4DNCA 5TJJA 5LRRA 5ED4A 4HAMA 3F6OA 1O3QA 1L0OC 3TKYA 2HEOA 3HOTA 4AD9A 4ASNA 5TRDA 1TW3A 4OMZA 1UFMA 4ZH4F 4P5OA 4JQFA 4QWQA 1EH7A 2PQ8A 5BPDA 1KQ9A 2ISZA 1LQ1A 1XDUA 3WTTC 3GUDA 1ZGJA 4PGGA 4ZYHA 1OMIA 3VFZA 2BBYA 3R0JA 5E1XA 3WTXC 2XAHA 2A3SA 4IPAA 3OOPA 2O61A 1YFHA 4ZYGA 1TLHB 4ENKA 3R61A 3DQVC 3JTGA 4F7ZA 2OQGA 2JTVA 3RKYA 5LHIA 1G3TA 1HW5A 3PFIA 5F1RA 1Y0UA 1YW7A 4M6YA 4ZZLA 4ENJA 4AVPA 3LA2A 4GXOA 4HF1A 2X4HA 1BOAA 2CQKA 4LK1F 3M7GA 3F8MA 5J8CA 3I0TA 5LRSA 2XKOA 3B73A 3HIFA 3N4MA 3E97A 3FXRA 3E6CC 3FWEA 4YFXF 3GFLA 4M9SA 1T38A 1O3SA 1CF7B 4P9UA 2Y75A 2RVCA 2VN2A 4CO8A 1MKMA 2JPBA 2JRTA 2ZCWA 5L3EA 1PP8F 2LF8A 1E17A 2YPRA 3SZTA 4BHCA 4UVBA 2QUFA 2HR3A 4EV0A 3J80K 4EQQA 3G73A 4RGSA 1ZH5A 5E1WA 2DPUA 4OOIA 3WTZA 3WTYC 1WWXA 4I0BA 1MDMB 2XAFA 3WE2A 2E7XA 1QZYA 2ACJA 3COAC 1IN7A 3GFMA 1HW2A 1W7PB 3N97A 3FM5A 1FY7A 3GEZA 3SXYA 1Z9CA 2M1BA 2P6TA 2ESNA 5CYVA 5K5OA 2YX4A 2DK8A 4LG0B 4IVNA 2EFOA 4OIOF 2FU4A 4KNYA 3GX4X 5ILSA 4WX9A 2A69F 2DFIA 4EJUA 1PUEE 1YTYA 2FRHA 2NNYA 2UXNA 3NEUA 3FXUA 2VONA 5EEGA 5ICCA 2LNBA 4IRHA 1IXCA 1RUNA 1Z6RA 1MGTA 3DFGA 3HTUA 4I01A 3RTRA 3DXJF 1STZA 4P96A 3RYRA 4M73A 2EK5A 3BJ6A 1FWZA 3HRMA 2XGXA 3KP3A 4CDGA 3MZYA 4OIPF 1ZRCA 2OD5A 2VBZA 2HWVA 4IXAA 2P5KA 2RGVA 5LHGA 2FBIA 4G8XA 3TO9A 3FMQA 5A2QK 1IAWA 1U2WA 1FBSA 2QQ9A 3KEQA 4KN7X 1DDNA 2CG4A 1I6XA 1J0RA 3TDZC 3P9IA 3RYPA 1HBXG 2M45A 1ZRFA 5FFXA 2PMHA 2ZO4A 1P6RA 5ILUA 5K1YA 3R0AA 2BGCA 1I27A 2W84A 2VOOA 2NS0A 4LB5A 3DP7A 1YW9A 4HW0A 2IPQX 3FXQA 3H3ZA 3ERED 1HKQA 5BMZA 1XGSA 1HW1A 3M8FA 4L5IA 2RQPA 3FMRA 1XCBA 2H27A 5LGUA 1EH6A 2UWMA 4LJZF 3NRVA 1MJAA 2P8TA 2XHKA 1EH8A 3IRQA 3I59A 2DLLA 4LG0A 1YW8A 4LK0F 4EVIA 3C3WA 3MFKA 3GZ5A 4S05A 3BJOA 3HRTA 3T8TA 2DQLA 1W7PD 1S7OA 3TO6A 3RDIA 2E7WA 3L00A 3GFJA 2NNNA 3GLXA 1XMKA 4U88A 3U2RA 4G7OF 4MNUA 4DQ2A 3ZP5A 2PLYA 3P9CA 3HHHA 3LAPA 2IW5A 1LDJA 1TQPA 1FLIA 1J75A 1SMYF 1ZLJA 2YU3A 1Z91A 5JHUA 3U9GA 1FT9A 3V8LA 4CGZA 2OQRA 4KMFA 2PEXA 1UHWA 4HBLA 1LEAA 5D4RA 4HYEA 6PAXA 4BAYA 2L02A 3I64A 1G6NA 3T8RA 4KMUX 3WGIA 2VXZA 2BYVE 2Q2EA 2DQRA 2MD5A 5D8KB 5BPIA 4A0ZA 5KK1A 4BYYA 5CLSA 2MA3A 3RKWA 2KRFA 3VODA 3BJAA 1REPC 3MQ0A 3FMSA 1BIBA 2EV5A 1SAXA 1R00A 5IT3A 2CGPA 1YS7A 4G7HF 1T98A 2ZNZA 1B59A 3FZVA 4HDUA 2ZMEA 1WRJA 4RB3C 5JVTA 4A0YA 3M8EA 1G3YA 3E5UA 4GYIA 4OINF 3I71A 4ENNA 2PBIA 2PFBA 3BROA 2QWWA 4HV6A 1SMTA 1V4RA 2EB7A 5DDGA 2HKXA 2JT1A 1G4DA 3T5XA 3IKTA 2HTSA 3O2PE 3E5QA 3TQNA 1F1ZA 1FPQA 2DK5A 1B9MA 1FSEA 3P9KA 4UVAA 5JR3A 1ZG1A 2M5WA 4KIFA 2HFHA 4XRFA 2R3SA 1R58A 3ECOA 2MH2A 3QU3A 4JBAA 5EEHA 1QNTA 3W6JB 4A2UA 1XCVA 4FHTA 1K78A 2GAUA 2Y0MA 2K27A 2DO7A 1U78A 3WU1B 1FYMA 1T0FA 3Q5FA 1XSXA 5CVJA 2K86A 2LDUA 1J59A 3F22A 4CXFA 1R1VA 1RI7A 1TQIA 4E70A 4IRGA 4I2OA 2OZ6A 3MCZA 3QPHA 1B6AA 2KIMA 1O57A 2LF7A 5FD5A 3KCCA 1I1GA 2KKOA 3CDHA 1FP2A 3L9FA 3HSEA 4CZZA 1HSJA 2D1HA 3F8BA 3KETA 3EUHA 3QAHA 2F5CA 3GZ6A 2WC2A 2WWYA 3DPLC 3SQNA 3ZMSA 1D5VA 5HS9A 3J7AO 2ZBKA 2GQQA 2OBPA 3TDUC 3ZMUA 3KLOA 2F5EA 1P4WA 3WGHA 1FP1D 4UV8A 4IHSA 3WTVC 3BZ6A 5HDNA 1SD7A 5D5UB 1Z7UA 4M72A 3J81Z 4N0BA 2HGCA 2A5YB 1XB4A 5E1ZB 3GWZA 4L18B 1BBYA 4ZZDA 1IN5A 2IA1A 2EA2A 1S3JA 1P92A 3HOSA 2P4WA 1QO0D 3V4GA 1XSDA 5FB2A 5E20A 1YG2A 3SHFA 4HV5A 1PP7U 3WU0A 2HYFA 2PMUA 2VT2A 3PQKA 1ZN2A 4XLNF 1O7LA 3HUGA 3ML6A 3E3VA 5LEKA 1OYWA 1J5YA 3V7SA 1MZBA 2DT5A 4L0YB 1QPMA 5ICEA 4EJVA 4L0ZB 3EQLF 4YG2F 4OU0A 3F21A 1ZG3A 2XVCA 1IN8A 1BI0A 3NQOA 2XIGA 2QM3A 5HS7A 2K4JA 2P6SA 2H6CA 2MH9A 5H6RA 1O7FA 1E2XA 3ABTA 4TV7A 5DCMB 1BI1A 5FD6A 1ODDA 3CJNA 4ENMA 1AWCA 5CVRA 4U0VA 1HSTA 2QQAA 5BQTA 5E18F 1W5SA 4EJOA 4EJTA 4HX4A 4M74A 3KFWX 5LBQA 4NB5A 2MC3A 4GO1A 4A5MA 5BS6A 1HKTA 3C18A 2J5PA 5AONA 3WODF 4XLPF 1GXPA 4GCVA 4AIHA 5BOXA 1J2XA 3O6BB 2EFWA 4MQ9F 5CJ9A 2KJBA 2PG4A 4LMYA 1R1UA 1FC3A 1LJ9A 1XDSA 1IRFA 2Y48A 2DAOA 1ON1A 3TOAA 3KLNA 2A6HF 1Z1DA 1YLFA 1T39A 1LVAA 3M9AA 4XSZF 3K9TA 1KA8A 1KU2A 5LHHA 3HRSA 2P5LC 3E6DA 2M30A 4S04A 2QZ8A 4N9HA 1ZAOA 2KIUA 1IZ1A 4KICA 4MGRA 1RUOA 3M1EA 4G94A 2PJPA 3K1MA 2EA4A 3ZMDA 4WF2A 3I59B 4MEXF 3TGNA 5HDKA 1T6SA 3LQRA 4KDPA 1P2FA 1KQ0A 3ABUA 5DCMA 3SFZA 4HLYA 4HF2A 4BNCA 3KE2A 1R22A 3E5XA 5FO5A 4ESJA 1UHMA 1K7AA 2EFPA 3K1NA 2HQNA 1FZPB 5ICGA 3QP5A 3ZPLA 4RAZA 1FOKA 4L9TA 2VBXA 2V1UA 3BWGA 1XGMA 4A6DA 3WE3A 3CUQA 5L3CA 5E17F 4I02A 2Q8KA 2MLGA 1ZRDA 3ZMZA 2LKPA 1WI9A 3ECHA 2AS5F 1IN4A 4UHTA 5F6FA 2E1NA 4QLCU 3BDDA 1O3RA 3ISPA 2RDPA 2RNJA 1XGNA 1XGOA 2ZJ2A 2OU2A 2COMA 3LWFA 2J5OA 3I4PA 2D1VA 1B9NA 4I98B 3W6KB 4WXHA 3DEUA 3J81K 2JPCA 2KIFA 3D0SA 1H9TA 5DD4A 4IF4A 2B0LA 1G3WA 4YFKF 3V7CA 2VODA 1XN7A 1VTNC 4BQAA 2ZMEB 4CICA 2W57A 3QRFF 1UCRA 3JAMZ 1OPCA 2OA4A 5HS8A 3S2WA 2FNAA 5ERIA 1U8RA 1OKRA 2CWEA 1S8NA 2FBKA 4G6DA 3IHUA 3E6MA 2D2WA 4NQWA 2QBYA 2MBFA 2ZKZA 1P4AA 1QQIA 4FX0A 5DYMA 1G3SA 2GA1A 4YIFA 4RGXA 2ZNYA 2Z99A 5ICFA 1XD7A 4KIGA 3P7NA 5FLXZ 2NRAC 2L4MA 2VBYA 3BY6A 4HX7A 1K78B 2G7HA 2V6CA 4AWXB 4KIBA 2UZKA 2FF4A 3KZYA 4G9YA 3HRUA 3CUQC 4OIQF 2YR2A 2P7CB 4KYWA 1K6OA 1KU9A 4P9FA 3KP5A 1TBXA 4L5JA 4M9ZA 3O3KA 1BJAA 1MJ9A 1L3LA 2CYYA 2X0LA 3IWZA 4HA8A 5DUIA 2FE3A 4RB2C 4R8HA 2EJRA 3V8JA 3WTUC 5KVRA 2MLKA 3V8KA 2FOKA 2VT3A 5J6XA 1O3TA 1IXRC 3KEOA 4EM2A 3GVAA 2FMLA 4ESBA 1TNSA 4K2EA 3ZMVA 3EETA 4AIJA 4WWCA 1IRGA 2YSRA 4I09A 4HDVA 3FF5A 2EFQA 5L3FA 3RIRA 1CGPA 2EFNA 1YO5C 1R23A 4CHUA 1D8KA 4U0WA 2GXGA 4PZJA 1YS6A 2EWNA 2K02A 2P5VA 2UXXA 2DPDA 4HLXA 2VE9A 5HLGA 3PQJA 1FBUA 3GW2A 3GFIA 4MHGA 3I5UA 2DBBA 3LQQA 3QPTA 1BIAA 1W5TA 4N9IA 2O6GE 2IP2A 3RKXA 3WG9A 4KUMA 1IF1A 3K0LA 2NAZA 4WXCA 2LSOA 3LA7A 4M71A 3T1BA 4KA4A 2FQ3A 2IA0A 4O5VA 3RI4A 4FX4A 3LA3A 2K4BA 1R5HA 1B1BA 3Q9VA 1JHFA 2HKOA 4RGRA 1FNNA 4Y13A 2VE8A 4UVCA 2HDCA 4HQEA 2O8XA 1C0WA 4Z2YA 4LD5A 3BOQA 5HLIA 2Z3YA 2FXAA 1ONVA 4PGHA 4G6QA 2VC1A 1RIOH 3LFKA 2IT0A 1LEBA 3EYIA 5DV5A 5CVUA 4HF0A 5DUKA 4UNOA 3VOEA 5IT9Z 1R5GA 5LLQA 1KU3A 4ESFA 4Q5SF 1GXQA 1D3YA 2Z9OA 2CW0F 1LNWA 4BXUA 3BPXA 1YIOA 1S29A 4KFCA 1ON2A 3I54A 4XBFA 4OIRF 2ETHA 3R6SA 1BI3A 4LLLA 3QP6A 2RKHA 1TTYA 1USTA 1BM9A 2FBHA 4EJWA 1ZGAA 2E1CA 1FYLA 1X3UA 2FSWA 3JAMK 1USSA 1HXDA 2A68F 1OR7A 3IWFA 3JSPA 4MTEA 3D5LA 3ULQB 2G7UA 5JI6A 4HZFA 5DCFA 3F3XA 3RPQA 1SFXA 3REOA 1IUYA 1J9IA 5CVVA 1D8JA 3K1PA 4PCQA 1ZHFA 4H0EA 1R1TA 5H20A 2L01A 1KYWA 1LDKB 2ESHA 4R79A 5FLXK 1IN6A 4Y17A 4O6JA 2FMYA 4RGUA 2R7DA 3C1DA 3RJPA 1U5TC 4I7HA 2XAQA 5HOOA 2L4AA 3HSRA 3JW4A 1UB9A 3BPVA 5LGTA 2EV0A 4HOBA 1KGSA 3SZPA 4L9JA 1NHAA 1ZG5A 5L3BA 2ADUA 3CUQB 3VB2A 4M6XA 2XV4S 4RAYA 2M8EA 1JXSA 3L7WA 5D6EA 2L3DA 4Y15A 4OMYA 2F5DA 1KYZA 3IRRA 2OZUA 5D4SA 1R7JA 4UUVA 5D5XB 3L09A 2RC4A 2CSOA 3ROUA 2XAGA 1RZ4A 2A07F 5H6QA 4P55A 5AIQA 2RV8A 4BH9A 1XSVA 3C7JA 1DUXC 2FNPA 4Q47A 2GIVA 3HYIA 2XUBA 3AAFA 5LEJA 2XROA 3LAJA 1GVJA 2BEOA 2H09A 3EYYA 5DEQA 3KP4A 3BP8A 1I1SA 1JGSA 4WK8F 2XASA 2KJCA 3ZMTA 3F8CA 4G7ZF 2VBWA 2HS5A 5ILVA 2QLZA 2GZWA 3QOPA 2R7FA 1WKMA 5D8LB 1I5ZA 1OYYA 2GA2A 1ZARA 2A6EF 3DV8A 1YQAA 3K69A 2HOEA 2QBYB 2CO5A 4GYGA 2QQBA 2ELHA 1Q1HA 3JTHA 3CLOA 1U6GA 2H6BA 1H0MA 3GXOA 2PN6A 4UV9A 3B02A 3R60A 1V3FA 3HSFA 2DU9A 1AOYA 2XRNA 4RB0A 5HDGA 2YX7A 4BHPA 3TOBA 4EGZA 4RB1A 2O0YA 3G3ZA 5JFRA 3MZHA 1CF7A 2STWA 4EMSA 2P7VB 1DPRA 2QENA 2XKPA 3F8FA 1ZREA 1SD5A 4KT5C 1BC7C 2HYGD 5L3DA 4MTDA 2F5FA 1FX7A 5D6FA 3HTSB 1FYKA 5D5WB 1KU7A 2NYXA 5FFZA 1S6LA 3GYHX 3F23A 4B09A 5IT9K 3V7RA 2STTA 2IRFG 1WSUA 3IC7A 5E8GA 3CTAA 3JSOA 5HLHA 1T2KA 3I53A 1Z6TA 1QGPA 1B4AA 1KQ8A 1IXSB 2AXLA 2F2EA 5AIPA 1BN5A 2O03A 4D0PA 3ZN1A 1SD6A 2DI3A 1MDMA 1RNLA 2GWRA 3ZN0A 1W4MA 1MJBA 2QYOA 2RN7A 1W7PA 3KP2A 1TQMA 3F8NA 3K2ZA 3MWMA 5FGMA 2V1XA 3KP7A 3R4KA 4L9VA 3DF8A 1GHCA 3FHZA 2K7LA 2C6YA 1JE8A 1P4XA 4GGGA 2IVMA 3MAJA 1PDNC 2VC0A 5L3GA 4EM0B 1JHHA 2JZYA 4L9NA 4WCGA 1TNTA 4U7DA