1MGTA

Crystal structure of o6-methylguanine-dna methyltransferase from hyperthermophilic archaeon pyrococcus kodakaraensis strain kod1
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
169
structure length
169
Chain Sequence
MLSVEKFRVGERVVWIGVIFSGRVQGIAFAFDRGTLMKRIHDLAEHLGKRGVSISLDVQPSDYPEKVFKVLIGELDNASFLRELSFEGVTPFEKKVYEWLTKNVKRGSVITYGDLAKALNTSPRAVGGAMKRNPYPIVVPCHRVVAHDGIGYYSSGIEEKKFLLEIEGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN (O6-METHYLGUANINE-DNA METHYLTRANSFERASE)
publication title Hyperthermostable protein structure maintained by intra and inter-helix ion-pairs in archaeal O6-methylguanine-DNA methyltransferase.
pubmed doi rcsb
source organism Thermococcus kodakarensis
total genus 57
structure length 169
sequence length 169
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 1999-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF09153 DUF1938 Domain of unknown function (DUF1938)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mgtA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1mgtA01
2QWWA 1U5TA 1JXSA 4HX8A 1O3RA 1FP2A 2IRFG 1LQ1A 4MQ9F 1ZLKA 2VC1A 1SD5A 1UCRA 5E20A 2YPRA 1FNNA 1IF1A 1BI0A 1G3WA 4HV6A 5CJ9A 3LA7A 3QU3A 2A07F 3CTAA 4HQMA 1OKRA 2D2WA 2V79A 1U3EM 2W85A 5H6QA 5L3GA 1IN6A 2D45A 2CWEA 2P6SA 5J8FA 2PI0A 1I1SA 2EFOA 1TNTA 2V1XA 5HLGA 4OOIA 3IL2A 5KVRA 4XRFA 5LGNA 2YSRA 1P6RA 1FP1D 2FSWA 4WF2A 4Z2YA 5LEJA 4O3MA 1ZG3A 3HOSA 1X3UA 2QM3A 3V7CA 4B8XA 1C0WA 2VN2A 4N0BA 4XBFA 2GXBA 3LAPA 3BPXA 1ZLJA 3ZP5A 1T38A 5BMZA 1MJBA 3I5UA 2BE5F 1CF7A 2FBIA 1O3SA 2HR3A 2CFXA 2M87A 2O0YA 1QZYA 3IWFA 4G94A 2XKOA 2QENA 3GW2A 1Y0UA 3RKXA 3I64A 2FNAA 3E5XA 3ML6A 1K78B 1PP8F 2G9WA 4OMYA 5ERIA 1WWXA 3E3VA 4IVNA 2OZ6A 3KP5A 4GGGA 3K1MA 3G73A 3LAJA 3I53A 1Z9CA 5DCMB 5HS8A 2HKXA 1REPC 1U6GA 5L3EA 4YG2F 4LLLA 4Q47A 2H94A 2HKOA 3FF5A 2GXGA 2DW4A 1TW2A 3M1EA 3H3ZA 1O7FA 2X4HA 4G6QA 4CO8A 4JK1X 2GA2A 3FXQA 2OAZA 4G9YA 1G3TA 2NAZA 5LHIA 1DDNA 3F8FA 4OIQF 3KFWX 1T6SA 5DD8A 4L9NA 1RI7A 4EGZA 1JGSA 2L3DA 2ZXJA 2XROA 3H3UA 3QOPA 4L0YB 4PGGA 5FD6A 5D4SA 1XSXA 3QRFF 2DAOA 4KFCA 3NRVA 3K0LA 3FM3A 3ECOA 2BYVE 2YX7A 4RGRA 3GO5A 2F2EA 2DTRA 2P5VA 2PLYA 1OR7A 2XAJA 1A04A 4MTDA 2O3FA 2XVCA 1XGMA 3Q9VA 1PP7U 4CGZA 3R0JA 4I0AA 1FOKA 4I2OA 3D5LA 3ZPLA 1ZAOA 4LG0B 3V8LA 4KIGA 2CG4A 1U78A 5D6EA 2BV6A 5BOXA 4WCGA 2RKHA 3S2WA 2ZCWA 3PQJA 1HW1A 3ZQ7A 1J7KA 3TQNA 5J6XA 2DQLA 1LJ9A 2UZKA 1YS6A 1V4RA 4G8XA 3C1DA 4U0YA 2WV0A 2PG4A 1XSDA 1IRFA 5FB2A 3ERED 4YIFA 4KIBA 4A2UA 3CLOA 4I0BA 2M30A 3C3WA 1USTA 2ADUA 1G4DA 2H6BA 1USSA 1F5TA 1TQIA 5AIQA 5JVTA 1IN5A 4S04A 1UHWA 1I1GA 1H9TA 1Z91A 2FU4A 1YW9A 2UXNA 3I71A 1BOAA 2ZJ2A 4HF1A 3L7WA 3VODA 3J80Z 4BQAA 2GQQA 1MKMA 1HSTA 3JAMK 3TOBA 1W4MA 1J5YA 4RAZA 1ZRCA 5D8LB 3KZZA 1K7AA 3GFIA 3I0TA 3T1BA 1BI1A 1XMKA 2PQ8A 1EH7A 4XLNF 4EM0B 1SD7A 2ELHA 1BI3A 4I7HA 2L02A 2O61A 2MH2A 2LKPA 4IRIA 1D8JA 1LEAA 4AIKA 4CZZA 2EV0A 4FHTA 4N9HA 1KQ0A 3GVAA 2RQPA 3HYIA 1FYMA 1MGTA 1FLIA 1R5HA 3HIFA 1FBSA 3GEZA 4OINF 2ETHA 3WTSC 1HW5A 4FX4A 5K5QA 3MAJA 1B6AA 5JHUA 2EB7A 4ASNA 2JT1A 3F6OA 3P9IA 4RB0A 2GA1A 5L3CA 2DK8A 4MQVA 1YFHA 1FZPB 5HOOA 1I6XA 2MLKA 3JSPA 4EGYA 3MEXA 2ISYA 2ESHA 5ICEA 1P4AA 2G7UA 3V4GA 2VBXA 5ICFA 2XKPA 4RB1A 3FM5A 1WQ2A 3CJNA 2VOOA 4EMSA 4HV5A 2XAGA 4LK0F 4LG0A 3HHGA 1R36A 4P96A 1B1BA 2P7VB 1ZGAA 2XIGA 1MZBA 2UXXA 2RGVA 3BZ6A 4CXFA 3ABTA 3FMRA 5D5VB 3DV8A 2NS0A 4IXAA 3F8BA 2A3SA 2Q0OA 4HX7A 4LLNA 2P4WA 1WSUA 1KU9A 1KQ8A 4EJWA 1RUNA 4HYEA 1ONVA 1XGNA 5K1YA 1GHCA 5LLQA 1T39A 4KMUX 1G3SA 3MWMA 2XAQA 1ZGJA 4ON0A 3ZN1A 2DT5A 1Z6RA 3QU6A 5F1RA 3ABUA 3QPHA 2LNBA 4WXCA 3CO6C 3F22A 4FX0A 1HKQA 3E6MA 3F21A 2OQGA 4ENJA 2HS5A 3E5UA 3K69A 3ISPA 2RC4A 1K79A 2A69F 1YW8A 4YFKF 1H9GA 4M6XA 2FEZA 4UVCA 4IPAA 4BH9A 4U0VA 4BNCA 4PCQA 3SFZA 1ZG5A 4O6JA 2RNJA 2YR2A 2QLZA 2LSOA 2J5OA 4KA4A 1O57A 2EV6A 1ZYRF 5D6FA 2XGXA 4Q5SF 2W25A 3FMSA 4L9TA 1P92A 3QAHA 4UXNA 3WTTC 3K9TA 2DPUA 3R0AA 2NRAC 2VT2A 4TV7A 2XAFA 2BBYA 2KRFA 3KETA 2NNYA 1LVAA 2A61A 2VE9A 3SQNA 4A6EA 4A5MA 1VTNC 1Q1HA 3KLNA 1MD0A 1R1VA 1T0FA 1XDSA 1SD4A 3BJ6A 4LGWA 2MBFA 2KIFA 4DNCA 1DP7P 3B73A 4M72A 1ZHFA 1U8RA 4CHUA 5JR3A 2O8XA 2NNNA 4M71A 1XN7A 2JTVA 3DPTA 1UB9A 5L3BA 5LBQA 4U7BA 2FA5A 2FXAA 4L0ZB 3TO7A 2H09A 4H0EA 1JHHA 2Z33A 4KIFA 2W84A 2Z99A 4HDVA 1XCBA 5FD5A 5KK1A 2ZNYA 3IKTA 2PN6A 1IUYA 2DPDA 2Z3YA 4OMZA 3MFKA 3GF2A 1LDKB 2HDCA 5FLXZ 3HTUA 4JBAA 4CYDA 1F9NA 3ZMZA 4IRHA 2FE3A 3ELKA 4EQQA 1BC7C 1DPUA 4ESFA 1XSVA 1P4XA 2M8EA 2XAHA 2OZUA 3MCZA 1L3LA 5D5XB 4NB5A 1EH6A 2DO7A 1YO5C 4Y17A 4L9JA 4G6DA 3HRSA 3QPTA 3U2RA 2V1UA 3ZMTA 3LFKA 5LRSA 1R00A 3I4PA 1I27A 3CUOA 2YU3A 1W5SA 2VONA 1BIAA 4M9XA 1XB4A 1D8KA 2FBHA 4MNUA 4NQWA 3HOTA 1ZRFA 3BOQA 4OIRF 2TDXA 1ON2A 2OQRA 4MEXF 3FMQA 3DXJF 1J75A 2MA3A 3E6BA 3N97A 2P5KA 5E8IA 1XD7A 1S7AA 3BPVA 4Y13A 2HGCA 2P8TA 3WTYC 5IT9Z 1XGOA 2OU2A 4EJOA 2AXLA 4UUVA 3PQKA 2KIUA 1L0OC 1YS7A 4PGHA 3FHZA 3G3ZA 3CUQC 2EFPA 3Q9SA 3DF8A 3KP3A 5D5UB 3WTZA 3LQQA 2EA2A 3GFJA 1TNSA 2KJBA 5A2QZ 5LGTA 3J81Z 1YTYA 3LQRA 3WGIA 4LMYA 2UWMA 3F6VA 1G3YA 3NQOA 2O6GE 1HW2A 4ZYEA 1S3JA 4ESBA 5CVJA 3SXYA 2K7LA 2W57A 5E18F 3P9KA 3WGHA 2LDUA 4EJUA 4R79A 1EV7A 1IAWA 5FLXK 3COAC 4L9VA 2MH9A 4ESJA 1BJAA 2Z5UA 4A5NA 1T98A 3BJOA 4WWCA 3TO6A 4ZZDA 1WRJA 3D0SA 3RTRA 2A68F 4KYWA 3HSEA 3V8KA 2WTEA 3CUQA 2M5WA 4KUMA 4BHBA 3GLXA 3LA3A 4K2EA 3IRQA 2XUBA 5HDNA 3IRRA 5HS9A 4Q48A 1ZG1A 2DU9A 2KJCA 4UV8A 1LB2A 3GWZA 3ZN0A 3ZMVA 4G7OF 4RB3C 2EV5A 2K4BA 1NHAA 2OD5A 1R1UA 2PFBA 3SZPA 2QBYA 3C18A 4E70A 1B9NA 4HLXA 1P2FA 4I98B 4BHPA 3B02A 1HQCA 1MJ9A 1TW3A 1QBJA 1QPMA 2PEXA 2Q8KA 1R23A 3ZMSA 3K1NA 4HQEA 1O3QA 5HDKA 3Q5FA 5DCFA 5DUKA 3O2PE 5CVUA 5L3FA 2A5YB 1TBXA 2L01A 3TDZC 3E6DA 3F3XA 2E7WA 4ZYDA 1QO0D 3WTVC 3HRUA 1EH8A 1G6NA 3TKYA 1ZARA 1OYYA 4XSZF 5D5WB 1V3FA 3JTHA 3ZMUA 2J5PA 2Y48A 5ILVA 4HF0A 2GIVA 3J81K 3GZ5A 3HSFA 5BPDA 1J9IA 1IW7F 5LHHA 2DI3A 3M7GA 4M74A 3ECHA 1QNTA 1MDMA 3ULQB 5JFRA 1S8NA 2KKOA 3T8RA 3ROUA 1XDUA 2FMLA 4WXDA 3WU1B 3V7RA 3DEUA 2EWNA 2EK5A 5AIPA 1DPRA 3FWEA 1IN7A 1ULYA 2A6EF 2WWYA 3WODF 2ACJA 1E17A 4MGRA 4HLYA 2ESNA 5JI6A 1TQPA 3T0YA 3ZMDA 2KIMA 5D4RA 4BHCA 4OIPF 1B59A 5DEQA 3WTXC 4HW0A 2FOKA 4LD5A 2HFHA 2ZFWA 2HYFA 3RYRA 5EEGA 1FY7A 2QVOA 5BPIA 2RDPA 1BN5A 3FZVA 1HSJA 4RGSA 4DQ2A 4GCVA 1YQAA 3BY6A 2E7XA 3F8NA 3F72A 3KZYA 1BBYA 3DQVC 3J80K 3WTWC 1YYVA 1YLFA 5F6FA 5BQTA 5LEKA 1PDNC 2ISZA 3W6JB 2FF4A 2DQRA 3J7AO 4EVIA 4M6YA 3P7NA 3F23A 2COMA 2STTA 4QLCU 2ZO4A 1BM9A 2IVMA 2IA1A 4P9FA 3VFZA 3W6KB 4A0XA 4YFNF 2JPCA 3FXUA 2QQBA 1STZA 2K4JA 4AIJA 4KICA 1O7LA 4RS8A 1RZ4A 1OYWA 3KE2A 3WG9A 1TQMA 2AS5F 1KU2A 3VB2A 3REOA 3EUHA 4WK8F 3AAFA 3QP5A 3TOAA 2CGPA 4GYGA 2DBBA 1OMIA 1O3TA 2F5EA 2HEOA 1FBQA 3GUDA 2MD5A 4Q4ZF 1SD6A 5E8GA 4UV9A 3PFIA 2ZBKA 3F8MA 3EETA 4RGXA 3KEOA 5E17F 4AVPA 3RI4A 3MQ0A 4EM1A 1Z7UA 2P5LC 4FT8A 4UVBA 2QYOA 2MC3A 3BP8A 4NHJA 2IP2A 1B4AA 1ZN2A 2VXZA 3HHHA 3HRTA 3VEPA 3IHUA 3E5QA 1S7OA 1UHMA 2H6CA 5HDGA 1FYKA 4U0WA 5CYVA 2O03A 1YG2A 4EV0A 1FSHA 3KP2A 5E1XA 4YFXF 2CQKA 4UVAA 3RIRA 2JZYA 1WI9A 4BAYA 2V9VA 3T5XA 3DP7A 3QP6A 1FC3A 5TRDA 1FWZA 5J8CA 3E97A 4RB2C 2L54A 2K02A 4HA8A 2NYXA 3EQLF 2IW5A 2XRNA 5D8KB 1AOYA 3O6BB 4HF2A 1XMAA 5ILSA 2E1CA 2VC0A 1WKMA 3CO7C 4L5JA 4EM2A 1U2WA 4KN7X 2GAUA 3DKWA 3IWZA 3EYIA 3TGNA 4I09A 2GWRA 2M1BA 4QWQA 1OPCA 4BXUA 4HAMA 2RV8A 3KCCA 3N4MA 2OBPA 4IHTA 2HZTA 3R4KA 2IJLA 1IXSB 4KDPA 2FNPA 2G7HA 2JSCA 2JPBA 4ENNA 1Z6TA 1KYZA 3DPLC 3C7JA 4A0ZA 1BC8C 4ZYGA 1IXRC 2VT3A 3CUQB 5HLHA 2ZKZA 2H27A 2ZNZA 4LK1F 1P4WA 1XCVA 3BJAA 4LB6B 3GFLA 3LA2A 3V8JA 4ENMA 1CGPA 6PAXA 3M8FA 1FYLA 1QGPA 1JHFA 4JQFA 2QBYB 3H92A 4UNOA 1YW7A 3JSOA 3BWGA 5L3DA 4GXOA 1R58A 3K1PA 2VBYA 5BS6A 1IN8A 1LNWA 3GXOA 3WTUC 2XASA 3NEUA 1W5TA 5DD4A 4IF4A 5DUIA 3WE2A 2IPQX 3HRMA 3JW4A 4HX4A 3EYYA 4M73A 3KP4A 3JAMZ 5CLSA 4R8HA 1IXCA 3U1DA 3I54A 1RIOH 4KN4X 4P9UA 5FFZA 5HLIA 1IRGA 4M9SA 1R22A 2VBZA 2E1NA 2FQ3A 3I59B 1KQ9A 2FRHA 4CICA 3CDHA 1QZZA 2PMHA 1LDJA 3RDIA 5F64A 1BIBA 3WE3A 1MDMB 1JE8A 3M9AA 2BEOA 3BROA 1J59A 2CW0F 2Y0MA 2DFIA 2RN7A 4L18B 2HQNA 2HWVA 3RKYA 1TTYA 2X0LA 3KEQA 5FO5A 4ENKA 1SFXA 1W7PB 2L4AA 4I02A 5LRRA 3E6CC 4U88A 3K2ZA 1S6LA 3HTSB 3I58A 2HOEA 2QZ8A 1FSEA 4GO1A 4XSXF 2R7FA 1AWCA 2R3SA 2K27A 2DLLA 2EFWA 4OIOF 1TLHB 2RVCA 1SMTA 1FBUA 4EJTA 2JRTA 3VOEA 1D5VA 4LB5A 1SAXA 2P6TA 1HBXG 2HYGD 3U9GA 5ICGA 2LF7A 4R1HA 3GX4X 5K5RA 2IA0A 2FBKA 4PDKA 3R60A 4N9IA 1QQIA 3GYHX 2Q2EA 3O3KA 2QUFA 5E1ZB 2D1VA 4HZFA 2EFNA 2WC2A 4I01A 1H0MA 4P5OA 2CYYA 5ED4A 1HKSA 2VE8A 3RJPA 5H6RA 2QQAA 4ZYHA 1K78A 1D3YA 4AIHA 1FPQA 2IA2A 2A6HF 4XLPF 5IT3A 4A6DA 1SFEA 4B09A 3MZHA 2HQRA 2M45A 3SZTA 4ZH4F 3IC7A 5HS7A 2ZMEB 4D0PA 5DCMA 5IT9K 5CVIA 4AWXB 2F5FA 2LF8A 1W7PD 2VODA 4YIIA 2OA4A 3RPUA 1KU7A 3RPQA 3FX3A 2DK5A 2C6YA 4F7ZA 5DDGA 4S05A 3GZ6A 3WU0A 1BI2A 3HSRA 1SFUA 3OOPA 2HTSA 4KNYA 3T8TA 5A2QK 3LWFA 3EDPA 4LFUA 3I59A 4RGUA 3KLOA 2STWA 1Z1DA 2W24A 1S29A 4UHTA 4PZJA 2F5DA 1SMYF 4HBLA 2EJRA 5CVRA 2YX4A 1Z05A 2VOPA 1YIOA 3M8EA 5EEHA 1U5TB 3R6SA 5LGUA 4MTEA 2P7CB 2B0LA 3F8CA 4LLGF 1R5GA 1W7PA 1PUEE 2F5CA 1RNLA 4HOBA 4IHSA 1RUOA 5E1WA 3GFMA 1FX7A 3TO9A 1IZ1A 3MZYA 4L5IA 4WX9A 2Z9OA 4GYIA 4OU0A 4WXHA 4RAYA 1K6OA 4U7DA 2V1DA 3BDDA 4O5VA 2PMUA 2GZWA 1ZRDA 3KP6A 3L00A 3DFGA 1T2KA 1I5ZA 4G7HF 2FMYA 4Y15A 1HXDA 2VBWA 1F4KA 2V6CA 5H20A 5TJJA 1HKTA 1UFMA 5ILUA 1GXPA 4MEYF 3L2CA 1KYWA 1J2XA 1KGSA 2EFQA 5CVVA 4ETSA 3FXRA 2XV4S 3L9FA 1GXQA 2PBIA 4M9ZA 1OYIA 2Y75A 2L4MA 4G7ZF 4A12A 5DV5A 3HUGA 4KT5C 3P9CA 5HVQC 2EA4A 1CF7B 1DUXC 3V7SA 1U5TC 5FGMA 1ON1A 5ICCA 4BYYA 1ZH5A 4MHGA 4LJZF 5LHGA 3R61A 3OV8A 2XHKA 1KU3A 1LDDA 2HTJA 4IRGA 1E2XA 3SHFA 2ZMEA 2PJPA 5FFXA 4ZZLA 4A0YA 1FT9A 4CDGA 1MJAA 3WGGA 1LEBA 1ZREA 1J0RA 5AONA 1B9MA 5K5OA 1R7JA 1XGSA 5DYMA 2K86A 3RKWA 1GVJA 2CO5A 4EJVA 4KMFA 4IJAA 1KA8A 3RYPA 3LSTA 1R1TA 2D1HA 2BGCA 3KP7A 1ODDA 2R7DA 4HDUA 3JTGA 2CSOA 3IKVA 3TDUC 4AD9A 1IN4A 1F1ZA 3L09A 2QQ9A 2IT0A 4P55A 2MLGA
chains in the Genus database with same CATH superfamily
1VQNI 4GFBA 2QWWA 1U5TA 1JXSA 4HX8A 4F6MA 1O3RA 1FP2A 2IRFG 1LQ1A 4BMJA 1DI2A 3DWLE 3DKXA 4MQ9F 1WGXA 2CQ7A 3LSPA 1ZK8A 1ZLKA 4FETA 4DV0E 2VC1A 3UR3C 1SD5A 3QWLA 3BBGA 4UB8C 3EQ1A 1UCRA 5E20A 4PUSA 4LF8E 4F6NA 2V9KA 3CMAI 2E72A 5IYCJ 2YPRA 3VK6A 1FNNA 4Z6YA 2ME0A 1IF1A 2XF6A 1BI0A 4NUBA 1G3WA 3KZIC 4PJJA 3OMYA 4HV6A 5EG0B 5CJ9A 1UILA 3FDYA 3JR9A 1A1KA 3LA7A 3QU3A 2A07F 3CTAA 2EMYA 1RKWA 4HQMA 1OKRA 2D2WA 2JN6A 2V79A 1U3EM 4HTGA 2M0MA 1Z67A 1MBFA 2W85A 5H6QA 5L3GA 2ENCA 1IN6A 3IUOA 1VQ8I 2F48A 2YU8A 1VQMI 4LTYA 1K4SA 2Y30A 2D45A 3EPKA 1FMVA 5LMUE 1MNMC 2CWEA 2P6SA 2HOAA 3HOZJ 3CF2A 2B63J 5J8FA 3H1CA 2EOHA 2PI0A 2WB1N 1ZR2A 3S8PA 1I1SA 1RKTA 1UBDC 2E5NA 2JA7J 1VQLI 3LL7A 2W7NA 4R2DA 5JLWA 1QA6A 1QRYA 2EFOA 4NZVA 1TNTA 2V1XA 4BEHB 3KYDB 3QOEA 3GTLJ 1Z7LA 5HLGA 4OOIA 2EN7A 2DLQA 3IL2A 5KVRA 3K2AA 4XRFA 5LGNA 2XAUA 3Q0UA 2YSRA 1P6RA 1FP1D 2K4VA 4M30A 1I94E 2FSWA 3K4LA 2PMZA 4WF2A 1JI8A 4Z2YA 1U8BA 5LEJA 4O3MA 1ZG3A 1X3UA 2QM3A 1GV5A 3V7CA 4B8XA 3HOSA 5AC5A 4A3MJ 1C0WA 2VN2A 3A0HC 4Q35B 3K4JA 2NS8A 4N0BA 4XBFA 4DOZA 2GXBA 2X51A 2EN1A 1VQ5I 3LAPA 3DKYA 1HF0A 1S7EA 1ZLJA 3BPXA 3ZP5A 1T38A 2EN3A 5BMZA 5IOZA 1WJPA 1WZ2A 1MJBA 2Q2EB 3I5UA 3MMYB 5KL2A 4XKBA 2BE5F 2EOXA 1CF7A 4AVZA 1IBLE 2FBIA 1OJLA 2HR3A 1AA7A 1O3SA 2CFXA 2M87A 2O0YA 3K6QA 1I3AA 1QZYA 3IWFA 1V5EA 2IXSA 4G94A 2XKOA 1NK2P 2QENA 3LMLA 3GW2A 1OCCH 2VQLA 3CCRI 1Y0UA 2DT7B 3RKXA 1BJZA 2EIKH 3I64A 1WPKA 2FNAA 1SANA 3RQIA 4LOCA 2L3JA 4H4KC 1X48A 3E5XA 4I8OA 1GUUA 3ZRGA 5F1JA 2EL6A 1VF9A 3ML6A 1K78B 4HG2A 3CDLA 1PP8F 3QQAA 2G9WA 2DA1A 2UV1A 1WJDA 4LITA 4OMYA 5ERIA 1IV6A 1WWXA 3E3VA 4BBYA 4IVNA 2OZ6A 2QGUA 1T08B 1OR7C 4DR1E 3KP5A 3QYFA 4DV1E 4GGGA 2LMDA 3K1MA 3G73A 3FK6A 3LAJA 1UJ8A 5CFFE 3I53A 2VKEA 3ASNH 2E60A 1Z9CA 3FBNB 5E3NA 5DCMB 5HS8A 2HKXA 4CCLA 1REPC 4M3DA 4JI4E 1IV8A 5EEAA 3THNA 1POGA 1U6GA 5E3LA 5L3EA 5AASA 2F4IA 4JX6A 4YG2F 4LLLA 4Q47A 3BG3A 2H94A 2V7FA 3SEZA 2HKOA 3FF5A 3VWBA 3T1HE 2XB0X 1XX5A 2GXGA 2L2NA 2DW4A 3OYJA 1TW2A 1AHDP 4AYBN 3M1EA 1W0TA 2V1NA 4XLCA 2XGCA 1O7FA 3H3ZA 2X4HA 4R2QA 1PJRA 1AKHA 4G6QA 4F93B 2RS6A 4CO8A 3JRBA 1DU6A 4JK1X 2GA2A 3FXQA 2OAZA 4G9YA 1EKZA 2GLIA 1G3TA 1IDYA 2NAZA 5LHIA 1DDNA 3F8FA 1IQOA 4OIQF 3K4KA 3A4CA 3KFWX 3TP0A 3LSKA 2EOIA 1YYOA 3JRAA 1LUJB 1T6SA 5DD8A 1MIJA 3FK7A 2VF1A 4R2SA 2EOOA 2ELYA 3BZCA 4L9NA 1RI7A 4QTRA 2XC7A 4EGZA 3WG7H 1JGSA 2Z16A 3HG9A 2L3DA 2ZXJA 3OWTA 2CUZA 2XROA 2DCEA 1WHQA 1XMQE 3H3UA 2LJHA 2W48A 3QOPA 3EUAA 5E3MA 5H2FC 4L0YB 4PGGA 3VYSB 3ZQQA 5FD6A 5D4SA 5C4JJ 1XSXA 3QRFF 3TP3A 2DAOA 3BCAA 1JUPA 5K7FA 4KFCA 5IOYA 4A3KJ 1X3ZB 4F9BB 3NRVA 3BTCA 2OV7A 1I39A 3K0LA 1PUFB 3FM3A 3MKYB 1WHUA 3IP4B 1KONA 3ECOA 2BYVE 2YX7A 4RGRA 3H5AA 1X3WB 4A3BJ 4R03A 3GO5A 5EGOB 4IKFA 2F2EA 3ERMA 2DTRA 2P5VA 1XPXA 3RZOJ 5F04A 4C3IJ 2PLYA 1OR7A 1E3OC 2DFHA 2XAJA 3OR2C 1A04A 4MTDA 3FXLA 1BBOA 3GTMJ 2O3FA 2XVCA 1XGMA 2ZFUA 3S32A 2DXIA 2X85A 3C2HA 2DMYA 3Q9VA 1EJ9A 1J09A 4BDZA 1PP7U 2CQXA 1YJNI 4CGZA 2I9IA 2CRGA 3R0JA 4I0AA 3L2RA 1FOKA 4I2OA 3D5LA 4D9JA 3ZPLA 2KRCA 2KRHA 1ZAOA 2VKHA 4M3FA 3V8LA 4KIGA 4LG0B 3JRDA 3KX2A 1Y8QB 2CG4A 1YYKA 4XIDA 3F6GA 1U78A 1IO2A 5D6EA 2P0WA 2BV6A 4V2GA 5BOXA 4WCGA 1JUMA 2RKHA 3S2WA 4ZJZA 4BEHA 2ZCWA 3AG3H 3PQJA 1HW1A 5KCMA 1X2NA 3ZQ7A 1J7KA 1T95A 3T1YE 2YTEA 3TQNA 5J6XA 2DQLA 1LJ9A 3CC7I 2UZKA 1YS6A 1V4RA 4G8XA 2P81A 2DB2A 3C1DA 4U0YA 2WV0A 2MYSA 2KMUA 2DN0A 2PG4A 3H9JA 2EILH 2JUGA 3K6GA 3HL2A 4A3EJ 1IRFA 3OYMA 1XSDA 4R8OA 5FB2A 2YS9A 4KIBA 4YIFA 4XICA 3J7YJ 3ERED 4A2UA 3CLOA 2KPMA 4I0BA 1JKRC 2M30A 3L1PA 3C3WA 3S2HJ 2L8TA 2MKDA 1USTA 2ADUA 2F5VA 1G4DA 2H6BA 1USSA 4PJLA 3PSFA 4DR3E 1F5TA 1TQIA 5AIQA 1SC7A 5JVTA 3E7LA 2XF7A 3TW6A 4RH8A 3HJEA 2ENAA 1IN5A 4S04A 1UHWA 2X48A 2V83A 1I1GA 1H9TA 3HUGB 4HSTA 2VJIA 1YIJI 2DT6A 1Z91A 2FU4A 3IH4A 1JT6A 1YW9A 2UXNA 3I71A 4IJDA 1BOAA 1Z3YA 4MLQA 1X49A 2K40A 2ZJ2A 4HF1A 3L7WA 3VODA 2OJED 4AUXA 2OCCH 3I56I 4A3IJ 2ELZA 3CCSI 2ICWG 1OCTC 3J80Z 1WI3A 1UAAA 4BQAA 1GVDA 2EM0A 2GQQA 1R9TJ 2IGOA 1MKMA 1HSTA 2BXYA 3THOB 2E1MC 3JAMK 3GTPJ 3TOBA 1W4MA 4A3LJ 1J5YA 4RAZA 4XR6A 1ZRCA 5D8LB 3KZZA 1K7AA 4AQYE 3S15J 3GFIA 3I0TA 3DTIA 2RQQA 2L9NA 1OFCX 2PMZN 4PJMA 3T1BA 1FJLA 1VZ0A 4B48A 2HU9A 1BI1A 3B6CA 5HODA 1A6IA 1XMKA 2PQ8A 2VPLA 5CQGA 4BY7J 1XNQE 1RC9A 3Q0VA 1ETOA 1JTYA 2EPOA 2EMCA 1Y39A 1EH7A 3DTKA 5JVGF 4XLNF 4O5GA 2B7VA 5TISC 4EM0B 2M4IA 3IWBA 1SD7A 3RMPA 1TZLA 2YTGA 2ELHA 2WY8Q 2KZGA 3LSIA 4DR2E 4ITVA 1SVLA 1BI3A 4I7HA 2L02A 2N8GA 2O61A 3HKZA 1R6RA 1X4OA 2MH2A 2LKPA 1JKQC 2K9MA 4IRIA 1D8JA 2I5UA 4FCYA 3Q3SA 1LEAA 2YUSA 2YTJA 4AIKA 4D5CA 2H1LA 1K4TA 1DGCA 2MABA 2OPTA 4N4NB 4KT6A 4CZZA 1JKPC 3O8GA 2LH9A 1NEIA 2EV0A 4FHTA 2ZXWH 4BJTA 4IHVA 4N9HA 2YT4A 2I10A 4IHWA 1KQ0A 3GVAA 4L5EA 3PIOF 2RQPA 3HYIA 1FYMA 1MGTA 1FLIA 2BHYA 4BE2A 1R5HA 4FK5C 2JJ7A 3HIFA 3M8JA 2O9LA 1FBSA 4AIDA 2LTPA 3GEZA 4OINF 2NA2A 5BR8E 2ETHA 5F27A 1LVKA 3WTSC 1SVOA 5AC4A 3BQZA 1HW5A 4JYKA 4FX4A 3EPZA 3K4MA 5K5QA 3MAJA 1B6AA 3AG2H 3IAS2 2X6XA 4NDLA 5JHUA 5A6JA 2YU9J 2EB7A 4ASNA 4BS9A 4ZDOA 4M3GA 2WBUA 2JT1A 2IS4A 2OCEA 3F6OA 2R92J 3P9IA 4RB0A 1LPQA 2EOYA 2H1KA 2GA1A 3S16J 4C9YA 5L3CA 3KPHA 1V5GA 2DK8A 2EOQA 4MQVA 1YFHA 1FZPB 5HOOA 1I6XA 4DIQA 1FTZA 2MLKA 2K85A 2OF7A 3JSPA 4EGYA 3MEXA 2ISYA 2ESHA 5ICEA 2LR8A 3MD2A 4NNJA 2DRPA 1P4AA 5HNFA 2G7UA 3V4GA 2VBXA 4GZNC 3GTQJ 2L2MA 5ICFA 1ITYA 2XKPA 4RB1A 3LSMA 3MKZA 3FM5A 2FUG2 3VSKA 3J80C 1WQ2A 1Y0NA 2M3AA 4EATA 3CJNA 2Y9ZA 2VOOA 3DBHB 4EMSA 4HV5A 2M8GX 2XAGA 4HSRA 1ZU1A 2DDAA 2EPKX 1X1BA 4LK0F 4LG0A 2DA4A 4PSWA 5FROA 3HHGA 3CCEI 1R36A 2EBIA 3G1LA 2W4SA 1D1BA 4C2TA 1B1BA 2P7VB 3BC8A 3BG6A 1ZGAA 4P96A 2XIGA 1MZBA 4EEFG 2JP9A 3HXLA 2UXXA 2CS3A 2RGVA 3BZ6A 4CXFA 4FE4A 3MVPA 2EH3A 1A1LA 3ABTA 3UNGC 4RDUA 4FQGA 2DMPA 5E3OA 3BZKA 3FMRA 3DV8A 5D5VB 4KWYA 2H8RA 2NS0A 1BR2A 4IXAA 3F8BA 4HRIA 2EPPA 2A3SA 2Q0OA 1BL0A 4HX7A 3SZGA 4LLNA 2P4WA 1MH3A 1WSUA 2L7ZA 1KU9A 2M34A 1KQ8A 5C4XJ 4EJWA 4X0GA 5K7HA 1RUNA 3PSIA 2V6EA 4KJZA 3D5SC 4HYEA 2Y2ZA 3A03A 1ONVA 3QG5C 1XGNA 5K1YA 3SDGA 5FRNA 1IBKE 3TMOA 2RQLA 3I55I 3MHHC 4YHHE 5KL4A 4R2CA 2TCTA 1GHCA 3OYHA 1U9NA 5LLQA 4ZTFA 1T39A 2DFFA 4KMUX 2COBA 4LU9A 1ZBTA 1G3SA 3MWMA 1XMOE 4YY3E 2XAQA 1B69A 1ZGJA 3C4TA 3RZDJ 4ON0A 2QCOA 3ZN1A 3HC7A 3SFIA 1JKOC 2DT5A 2MC4A 1Z6RA 2QQ8A 3ZQHA 3QU6A 5F1RA 2V8QB 2L7FP 4DMIA 3ABUA 3QPHA 2LNBA 1L4SA 4WXCA 3CO6C 1X2MA 2BBGA 1T0FC 3F22A 4FX0A 1HKQA 2VKDA 4WPYA 4E7LA 2PRTA 3E6MA 5IYBJ 3F21A 3VYYA 2OQGA 2DFEA 2EM5A 4ENJA 2EPRA 1P7IA 2HS5A 2HNHA 3E5UA 3K69A 3ZXSA 4J00A 1R71A 2EPCA 3FISA 3ISPA 1UN6B 2RC4A 5DNYA 1K79A 2TRTA 2XSDC 2MC6A 2A69F 4PFPA 1YW8A 4YFKF 2EZ6A 3C6MA 4CCMA 4A93J 2DOFA 3EUKL 2VJJA 4Y3OA 3G1OA 3AFHA 4NQWB 3HOYJ 1H9GA 2GOXB 2BZTA 4M6XA 1IJWC 1J26A 1MW7A 2DOEA 2A5WA 1S9HA 2FEZA 2B9SA 9ANTA 4UVCA 4IPAA 3HOWJ 2QKLB 2DIXA 2KISA 4BH9A 4IZZA 4U0VA 4BNCA 3AG4H 4PCQA 3SFZA 1ZG5A 4DR7E 3K4NA 2BW3B 4O6JA 3DCFA 2RNJA 2R1FA 1FKAE 2YR2A 1VFCA 2QLZA 4MFEA 1RC7A 2I8DA 2M4GA 3M4OJ 2UUCE 4BCAA 2LSOA 4BQOA 2J5OA 1O4XA 1G8XA 4BXFA 2EPAA 4KA4A 1O57A 2EV6A 1PVEA 1ZYRF 3P5JA 5D6FA 1ACIA 2XGXA 2L9VA 3G4SI 4Q5SF 1TWFJ 2W25A 3OIPA 1GDTA 3FMSA 4L9TA 1P92A 2XPVA 2K5CA 2GBYA 3BR3A 4JOMA 2ZJRF 2O8KA 4F92B 1WJAA 2NOGA 3QAHA 4UXNA 3WTTC 2CV2A 3K9TA 2DPUA 3R0AA 1HNWE 3S1QJ 4GRIA 2NRAC 3ADGA 2VQFE 2VT2A 4TV7A 2L2KB 3DPUA 2XAFA 2ZJPF 4X66E 2BBYA 2KRFA 3KETA 2NNYA 3RQ4A 3HKZN 4RHBB 1N25A 1LVAA 1WVRA 2A61A 4XONA 2R7SA 4M3EA 2V85A 2GOMA 1E3HA 2VE9A 3SQNA 4LFBE 2HXIA 4FISA 4A6EA 4R2RA 3P1XA 4A5MA 1VTNC 2EORA 1Q1HA 4YELA 4OAYA 5J40A 3DJWA 1IRXA 3SEQA 4UY8I 4RM3A 3H5NA 2IAIA 3KLNA 2F4OB 1MD0A 1R1VA 2YZTA 1T0FA 1MBJA 3KWRA 1XDSA 1OCPA 1SD4A 2HC5A 1XNRE 1MMAA 2CQQA 3BJ6A 4LGWA 1I3QJ 3BR2A 1P47A 3OOUA 2MBFA 2KIFA 2YRHA 4DNCA 1DP7P 3A02A 3B73A 4M72A 4E7HA 3S3MA 4BU2A 1ZHFA 2HQ5A 1U8RA 2EQ1A 5LFAA 1K61A 3JTZA 4CHUA 4LF7E 5JR3A 2O8XA 2EL5A 2VKVA 3N05A 2NNNA 4M71A 3FXOA 1XN7A 1QVUA 2JTVA 2VASA 3QYBA 4ZDPA 2JY9A 2YTOA 3DPTA 1ZAAC 1GLNA 5J1UA 4HEA2 1MMSA 3F6HA 5T6JA 1UB9A 5L3BA 5HNHA 4LIUA 1TWCJ 5LBQA 4U7BA 2ELKA 4G6TB 2LBSB 2CUFA 2FA5A 2BVMA 5B3SH 1X6EA 5KL7A 2FXAA 4BXXJ 2MGQA 2EE8A 3F0CA 4L0ZB 1Y6IA 5IP9J 3TO7A 3S1RJ 2H09A 3CMMA 2Z2SB 4H0EA 1JHHA 2IGKA 4C2UA 2Z33A 4KIFA 2W84A 2LVHA 2Z99A 2EM4A 2EPFA 4HDVA 3H9QA 2JVHA 3S2DJ 1XCBA 4DYQA 4J01A 2DMQA 1UHZA 5FD5A 5KK1A 4HNUA 4CYCA 1IRZA 1BBGA 2ZNYA 3IKTA 2PN6A 1IUYA 2DPDA 3W2AA 4IS1C 2Z3YA 1VNDA 3HPZA 1F2IG 4IHYA 4OMZA 3MFKA 3GF2A 1VQ4I 3LSGA 1A36A 1LDKB 1SVMA 2HDCA 1X1DA 3VYXA 4PSXA 5FLXZ 2EN6A 3HTUA 1A1FA 4IO9F 4JBAA 2ZM6E 4CYDA 1F9NA 3ZMZA 2M1SA 4IRHA 1NK3P 1T4LB 2EZIA 2FE3A 3SYTA 2HVRA 2KHXA 2YTFA 4JYAE 2LYCA 1MMGA 2LOOA 3ELKA 4EQQA 1BC7C 5GPCA 4LF5E 2WAQA 1DPUA 1G2HA 5C44J 2NUFA 2LG4A 4ESFA 2R7QA 3K4BA 2VUMJ 1XSVA 1P4XA 3FBIB 4XLEA 4C2MJ 3A2KA 2M8EA 2XAHA 2OZUA 3MCZA 4M6VA 4DV3E 1L3LA 5D5XB 4NB5A 1EH6A 1X1AA 3FHNA 4B3ME 4JI7E 2DO7A 1VQKI 1YO5C 4Y17A 3HZJA 4L9JA 2CW7A 2RS7A 4G6DA 3HRSA 4FASD 3J7Yp 3QPTA 1UELB 3U2RA 2V1UA 2EL4A 3ZMTA 4HNVA 4ZC3A 3LFKA 1U0JA 5LRSA 3AL0C 1R00A 3I4PA 1I27A 3CUOA 1GTKA 2YU3A 4F9AB 3CDIA 1W5SA 2VONA 1BIAA 4M9XA 1XB4A 4MLVA 1D8KA 2FBHA 3HGYA 2GHFA 4MNUA 2GIZA 4NQWA 4Y33A 2VLAA 3HOTA 2EZKA 1ZRFA 3BOQA 1E3PA 3LOCA 4DBQA 4OIRF 2TDXA 3VPRA 1HLVA 1DP3A 4NBQA 1FOYA 4BE0A 3OYAA 3PM1A 3LSJA 1ON2A 2CUJA 4XRMA 4CCJA 1YITI 2BW3A 2BY2A 1N34E 1Z77A 1T56A 2OQRA 3CC4I 3KYCB 4E7IA 1WJBA 4MEXF 1M1EB 3PUFA 4A3CJ 1YX3A 3EPLA 1N3GA 1B72B 3FMQA 3DXJF 1J75A 2JMWA 2MA3A 4FE7A 1VQOI 3E6BA 3N97A 3CLQA 4QPQA 4C3JJ 2P5KA 5E8IA 1BA5A 5FKKA 1XD7A 1BR1A 1S7AA 3BPVA 4Y13A 1FOXA 2HGCA 5FKLA 2P8TA 1RRJA 3WTYC 5IT9Z 1XGOA 2LKSA 2OU2A 4EJOA 2AXLA 1KZHA 3PUBA 3C2BA 4UUVA 2EOEA 3PQKA 2KIUA 1JTXA 2EM3A 4CH7A 4BJ6C 1L0OC 4BL0B 5J1YA 1YS7A 3AKZA 1WXRA 2FOWA 1OCRH 1FOWA 4PGHA 3FHZA 3G3ZA 2M9HA 1ZTRA 2EMBA 3CUQC 2EFPA 4JI8E 3Q9SA 1G2FC 3DF8A 4DR6E 2HQAA 2B7TA 4R2AA 1VQPI 3KP3A 5DS9A 5FLXC 4RM2A 5D5UB 3WTZA 5M3FJ 3LQQA 3BTLA 1OCZH 3M3YJ 2EA2A 3GFJA 1NTCA 1TNSA 2KJBA 1TF3A 2E1MB 5A2QZ 1MNDA 4J19A 3KYLA 4RAFA 1KJKA 2VQGA 4R2PA 3LFUA 5LGTA 4ZYAA 3J81Z 1YTYA 3HPSA 4PJ0C 3PNTA 5KNLA 3LQRA 3WGIA 2KLOA 4LMYA 2R7WA 2UWMA 5F0HA 1LLMC 3F6VA 1G3YA 1MBEA 1I50J 3HOUJ 3NQOA 2O6GE 1HW2A 4ZYEA 1S3JA 4CCKA 2YU5A 2X9DA 3DF6A 4GKJE 4ESBA 1ETXA 3M1CA 2GM4A 5CVJA 3SXYA 1B8IB 3S1MJ 2EZHA 3OL4A 4J8ZA 2K7LA 2F8BA 2W57A 5E18F 4XNFA 4DYCA 2DODA 2IEKA 3P9KA 3CCLI 3WGHA 2LDUA 2QSGX 1T4NA 2O5RA 3OIQA 1W0UA 4EJUA 4R79A 4WSGA 1EV7A 1IAWA 4JI5E 2XPUA 5FLXK 4GDFA 1F43A 3COAC 4L9VA 2MH9A 4L5NC 2DA5A 4ESJA 4YIRX 1BJAA 4ZDLA 3VYUB 2Z5UA 3J7ZI 3OS2A 3M99B 2VJ4A 4A5NA 3CP2A 2VQHA 4G12A 4LF6E 1ZR9A 3H35A 2JUCA 2M4KA 5F0CA 1X6FA 4JI6E 1T98A 1YX5A 1FEXA 3BJOA 4WWCA 3LLHA 2EM9A 4MFDA 5E79C 2LJUA 3TO6A 4ZZDA 1WRJA 3D0SA 2EINH 5B5EC 1V5FA 3RTRA 2A68F 3WHBA 4KYWA 4DR5E 3HSEA 3V8KA 4ANJA 2EQ0A 3FIGA 5C3EJ 3CUQA 2WTEA 2BVLA 2M5WA 4KUMA 3H3VK 5IT9C 4BHBA 3GLXA 4MO7A 5EDNA 1PJTA 3LA3A 2HDWA 1OISA 3OYCA 4M0VA 1PKPA 4K2EA 3IRQA 2XUBA 5HDNA 3IRRA 5HS9A 4Q48A 1ZG1A 2E34A 1N36E 2DU9A 2KJCA 1OLTA 2MFZA 3H5RA 4UV8A 5AE2A 1I6HJ 1YSAC 1LB2A 3GWZA 3ZN0A 4QIWN 1R4MB 2EPUA 3ZMVA 4WYQB 4G7OF 4RB3C 2R93J 2E36A 2EV5A 2V88A 2Y9YA 3AG1H 2K4BA 1IGNA 2Q1ZB 4AM3A 1NHAA 2OD5A 2DMNA 1R1UA 2PFBA 3SZPA 2QBYA 1IUFA 3C18A 4E70A 4A3JJ 1B9NA 4HLXA 2EMZA 2WADA 5DM6F 1P2FA 4I98B 4BHPA 3B6AA 1JGGA 4I99C 5A2QC 1D0ZA 3B02A 1HQCA 1ORKA 1MJ9A 1TW3A 3CC2I 2YTIA 1P7JA 2VIXA 1QBJA 2MC5A 3J81C 4NXNE 1QPMA 2PEXA 2Q8KA 1Z1BA 3DTEA 1R23A 4DGWB 1D0XA 1MMDA 3ZMSA 2D5VA 2RTXA 2RSIA 1A31A 4CCNA 2RNGA 3TEDA 4DV2E 1RR7A 3K1NA 1Y8RB 4HQEA 4U87A 1O3QA 5HDKA 4XQFA 4DZPA 3Q5FA 3X2QH 5F08A 1T33A 5DCFA 5DUKA 3CD6I 3O2PE 1YOVB 5CVUA 5L3FA 3RKQA 2A5YB 2YPNA 2H36X 1B72A 3BR5A 1TBXA 4DV4E 2L01A 1HDDC 3PO2J 1LFPA 3TDZC 3E6DA 3F3XA 2E7WA 4ZYDA 2HDDA 4Y52J 1TT0A 1QO0D 5EJCA 3WTVC 4F91B 3HRUA 2ECBA 1EH8A 2CTDA 1Q1VA 1FMWA 3OIOA 2MKNA 5EZGA 3BLYA 4D5FA 1H88C 5JHFA 2R5YB 5KAIC 1G6NA 4PFOA 3TKYA 1ZARA 1OYYA 4XSZF 4F54A 2L9RA 2EPXA 5D5WB 5GAGJ 2L7MP 1V3FA 2BOLA 2E35A 1WFXA 3JTHA 3ZMUA 1QVTA 2J5PA 2DSYA 1GQEA 2Y48A 3TL4X 3UK3C 2WBMA 5ILVA 2UUZA 4HF0A 5IXMB 3DEEA 2R7RA 2GIVA 3C6KA 4P7DA 5CPRB 3J81K 3GZ5A 3HSFA 4DJAA 4W1UA 5BNGA 5BPDA 1J9IA 1IW7F 5LHHA 2JSPA 3HGGA 3J7AY 1JUSA 2DI3A 4E6KG 2PX9A 5GTIC 3M7GA 4M74A 2R7XA 2HVSA 1EA3A 3ECHA 1XG1A 4F2JC 1QNTA 2K9QA 3BG5A 1MDMA 3ULQB 2EMIA 5JFRA 1X3CA 2EQRA 1WH5A 1S8NA 2KKOA 2X1DA 1D0YA 4Y4RA 3T8RA 3ROUA 2LO3A 1XDUA 2FMLA 4WXDA 3WU1B 3BG9A 1DQ3A 3V7RA 1GZ6A 3DEUA 1NG6A 4BQQA 5FJ8J 2EWNA 2E1MA 2EK5A 5GP9A 1BW5A 3S93A 3FXMA 3OSFA 2XSJC 5AIPA 3OYFA 2WB1A 2X1CA 3G2BA 1DPRA 3FWEA 3HOVJ 4M9VC 1UG0A 2N8XA 2FJ1A 1APLC 3ABKH 1IN7A 1ULYA 2A6EF 2WWYA 3ZGKA 3NWTA 5IV8B 2DLKA 3WODF 2ACJA 5GADJ 3GBGA 1E17A 4MGRA 2H8WA 3OYNA 2UU9E 4HLYA 2ESNA 3OL3A 4BC9A 5JI6A 1TQPA 3FKJA 3T0YA 3ZMDA 2KIMA 5D4RA 4BHCA 4BBSJ 5CKTA 4OIPF 1B8IA 1EKEA 1B59A 5DEQA 3WTXC 4HW0A 5IWAE 2FOKA 4LD5A 3I4NJ 2FTXB 3D1NI 2HFHA 2ZFWA 5B1AH 3ZCOA 2HYFA 1BW6A 1TWHJ 3RYRA 2RSMA 5EEGA 4MIMA 5A6KA 3EUHC 1A1JA 2E71A 1FTTA 1FY7A 1S5LC 5A6AA 2QVOA 2K9NA 5BPIA 2RDPA 1BN5A 3FZVA 2V86A 4ZTJA 3JRHA 3MKWB 2QEXI 1HSJA 4RGSA 2HOTA 1UZCA 4DQ2A 2DA7A 3D5RC 4UUTA 4GCVA 1T8IA 4B3TE 3BR0A 2HHHE 1YQAA 4NC8A 2ADRA 3BY6A 5FLVA 4L8NA 3CQZJ 3NARA 2E7XA 3RCOA 2UXBE 3F8NA 3F72A 3KZYA 4OAZA 5IPAA 3S3OA 1BBYA 3DQVC 4V19K 3DU5A 3PO3J 4XOPA 1WHNA 5TSEA 3J80K 3WTWC 2ECCA 1YE9A 1HNXE 4IOCF 1YYVA 3I3LA 5AE1A 4XN0A 1YLFA 5F6FA 5BQTA 1FJGE 5LEKA 4CYCB 2R4GA 3OR1C 2BY0A 1PDNC 4X64E 2ISZA 2E5ZA 3W6JB 2CH0A 2FF4A 2N3HA 2DQRA 3W3CA 3J7AO 4RAGA 4EVIA 2VB6A 1VQ7I 4CSWA 2O7OA 1HOMA 3ZOQB 4M6YA 3P7NA 2EZLA 3EPHA 1HR0E 3ZR8X 3F23A 2COMA 2STTA 2EMAA 4QLCU 2ZO4A 2ZXIA 1BM9A 4QPOA 2IS6A 2XRLA 2CJJA 2HOSA 4NXME 1HC8A 3IH2A 2X6YA 2IVMA 2IA1A 4P9FA 3VFZA 4E4HA 3W6KB 2I13A 2LUPB 4A3FJ 4A0XA 3HM5A 2ME6A 1HDPA 2KL4A 2JPCA 4YFNF 3OYBA 3L2UA 3FXUA 1Y56A 4LG3A 4DKKA 2VPRA 4KITB 2V9PA 3L2QA 1NG7A 2QQBA 3MHSC 4DW6A 3H9GA 1STZA 2K4JA 5JLXA 3GTKJ 3CCJI 4B3XA 4AIJA 4M3BA 3K10A 3FXKA 4KICA 1O7LA 2EOSA 4RS8A 3GMEA 1QPIA 3K4CA 1K83J 5FKNA 1RZ4A 1OYWA 3KE2A 1MBGA 2UUBE 5M5XJ 4NC7A 3PIPF 5DTDA 2LVSA 3ESWB 1YHQI 5GAHJ 3ABMH 3WG9A 1TQMA 2Q8UA 3L2WA 2KDZA 2AS5F 1KU2A 2JA8J 4YEJA 3VB2A 3OYEA 1SFOJ 3REOA 3OYLA 4F3QA 2JYAA 4A69C 3EUHA 4WK8F 3AAFA 3QP5A 3TOAA 2CV1A 2VRDA 2NVYJ 3CCQI 2DYSH 2CGPA 1ETVA 3C2GA 3H36A 3C4BA 4GYGA 2DBBA 1OMIA 2LE2A 1O3TA 2R7TA 1TWAJ 2F5EA 2HEOA 1FBQA 3GUDA 2MD5A 4DR4E 5EZHA 4Q4ZF 1S72I 2DMTA 4B1RA 1SD6A 5E8GA 4UV9A 3PFIA 2ZBKA 3F8MA 2NVQJ 3EETA 3DBLB 4RGXA 2EOZA 3KEOA 5E17F 2NVUB 4AVPA 3RI4A 3VHTB 2BHZA 2QA4I 3BR1A 3MQ0A 2R5YA 4Q28A 2HJJA 3QODA 3WU2C 1Z7UA 4EM1A 2P5LC 2BXZA 2JVGA 4FT8A 2QYOA 4UVBA 2MC3A 2X1EA 4KZSA 3CMEI 3BP8A 4NHJA 2ENHA 2EPZA 2IP2A 1B4AA 1A1HA 2IS2A 1ZN2A 1ETYA 2VXZA 2L0KA 4DUYE 3GCMA 3HHHA 3HRTA 4UB6C 3LNQA 4XKWA 3JU0A 2N3GA 3MN2A 3KEYA 3VEPA 1EF4A 3IHUA 4JV5E 3E5QA 1S7OA 2EOFA 4D7MA 2DDBA 3F9KA 1UHMA 5DM7F 3HB9A 2H6CA 1JK1A 5HDGA 1JJ6C 5LL6R 2ZJQF 1FYKA 1LE8B 2EOJA 4HEIA 5A6BD 4U0WA 1X1CA 5CYVA 2O03A 3BGHA 4B4CA 1YG2A 5J3LA 4EV0A 1FSHA 3KP2A 2XB5A 1X6HA 2LT7A 1IBME 5E1XA 4F52A 3CCVI 3ADLA 4YFXF 4M2ZA 2CQKA 4UVAA 1V54H 1E0EA 3IH3A 5EYRA 1XS9A 3RIRA 2JZYA 3GTJJ 2J7JA 1WI9A 4I6ZA 2CFOA 4BAYA 2HPMA 2HZDA 2V9VA 2XF5A 3CESA 3T5XA 1MSEC 4LF9E 3JCUC 2NXNB 3CCUI 3DP7A 2KP6A 3QP6A 3FIWA 2LTSA 1FC3A 2CMPA 5TRDA 1FWZA 1FIAA 2LMZA 5J8CA 2CT1A 3ONQA 3AL0B 3BQYA 3E97A 4RB2C 2B7EA 2L54A 4A3GJ 2K02A 4HA8A 3UKGA 2NYXA 3EQLF 2IW5A 2XRNA 4XRSA 3OYDA 2NUGA 2M7AA 5D8KB 1AOYA 4E7ZA 3MKLA 1VQ6I 3CZ6A 2LCEA 3DLLF 2YRMA 2R7ZJ 3O6BB 2YSPA 4HF2A 1XMAA 4JX5A 1UG2A 4XN3A 5ILSA 4XKCA 4FTHA 3JRFA 2E1CA 2EMFA 1TF6A 2VC0A 2CSHA 1WKMA 2VJ5A 2EWLA 2LBFB 3BF2A 3CO7C 4L5JA 2L6MA 4EM2A 3AUZA 1U2WA 4KN7X 2GAUA 3DKWA 2CUEA 3IWZA 3EYIA 2EMGA 2ZSHB 4OWRB 4I09A 3TGNA 4AC0A 4WFTA 2GWRA 2M1BA 1A1GA 3FXJA 4QWQA 1OPCA 3PFYA 3OYKA 1DU0A 3QYEA 4BXUA 2DTZA 4HAMA 2EPNA 1YRNA 3GZNB 3JRGA 2RV8A 3KCCA 4B44A 3GLLA 3N4MA 2OBPA 4IHTA 1MNEA 2VQCA 2LFBA 2HZTA 5A6BA 1JK2A 3EPJA 3R4KA 2IJLA 4DV5E 2CU7A 1IXSB 1MSFC 4B3RE 3V42A 2IGNA 4KDPA 5A69A 2FNPA 4IQ4A 3ZQGA 2EM7A 4LF4E 4AU7A 2G7HA 4C30A 4DZJA 3CMYA 2JSCA 1BR4A 2JPBA 4ENNA 1Z6TA 1KYZA 3DPLC 3C7JA 4A0ZA 1BC8C 2KDOA 1ZGWA 4IHXA 4ZYGA 1IXRC 2VT3A 5KHDA 3CUQB 1CQTA 5HLHA 2ZKZA 2H27A 3ZOBA 5AE3A 4XOTA 5FRMA 2EM8A 3O8HA 2ZNZA 4LK1F 4DBRA 2DA2A 2NUEA 3MSWA 1P4WA 1PYVA 1XCVA 3BJAA 3ECRA 2D9HA 4LB6B 3GFLA 2L7KA 3LA2A 4XM3A 3V8JA 5J4YA 4ENMA 4PJNA 1CGPA 5M5WJ 1QU3A 6PAXA 2L9SA 3M8FA 1FYLA 1QGPA 1PDAA 4X62E 1TN9A 2HGHA 2LY2A 5KL5A 1DGRM 1JHFA 4JQFA 4IX7A 1LFUP 2QBYB 2IHR1 2L92A 3H92A 4UNOA 1YW7A 1ZQ3P 3JSOA 3PJRA 3BWGA 5L3DA 2JK3A 4GXOA 1R58A 3I4MJ 5B66C 5KL3A 4II2A 2VL8A 1WJCA 3K1PA 1MEYC 2VBYA 4R2EA 5BS6A 2DGCA 2NVXJ 1IN8A 1LNWA 2G0EA 1MBHA 3GXOA 4ABZA 3PNYA 3WTUC 2XASA 3NEUA 1W5TA 2WV1A 3A01A 5DD4A 4X6AJ 4YRVA 4IF4A 1HA8A 3BTIA 4E7JA 4A3DJ 2A6TA 3G71I 5DUIA 2DA3A 3WE2A 2IPQX 3HRMA 1IMUA 3JW4A 1W36C 4HX4A 4KHPE 2L33A 3EYYA 4M73A 3KP4A 4PK4A 5B1BH 2X6WA 1TT5B 3JAMZ 2FV4B 1WJFA 1H8AC 2JVAA 1A1IA 5CLSA 2EIMH 4R8HA 2L3CA 1ETKA 4XKVA 1IXCA 1OCOH 4Y7NJ 2VXDA 3U1DA 3I54A 2EMLA 1RIOH 2MG4A 1X58A 4KN4X 2M9AA 4P9UA 5FFZA 2YRKA 2E2IJ 5HLIA 1QHGA 1W36D 1IRGA 4M9SA 3JRCA 1R22A 2VBZA 3ADJA 2A05A 5F3WA 2E1NA 2FQ3A 2HVQA 3I59B 1KQ9A 4LIVA 1Z0XA 2FRHA 2LY9A 2DJNA 4CICA 3CDHA 1QZZA 2PMHA 4QSHA 1LDJA 1LE8A 4LFCE 3PL8A 1ETWA 2QKMB 4BBRJ 3RDIA 2JA6J 1QU6A 5F64A 1BIBA 3WE3A 1MDMB 3HTXA 1JE8A 4TUGA 3M9AA 2BEOA 3BROA 1J59A 4F55A 1PJSA 2JOBA 1IDZA 2E19A 2CW0F 2EP3A 1X1PA 3BCBA 3OYIA 3E0JB 2Y0MA 2DFIA 2RN7A 5IP7J 2JR1A 4L18B 2NABA 2HQNA 4JX4A 1TC3C 1RETA 2HWVA 3RKYA 3BT9A 1STUA 3DEWA 2KONA 1TTYA 2X0LA 3QPSA 3KEQA 4IL6C 5FO5A 4UUSB 3S3NA 2E2HJ 4KISA 2LK2A 4ENKA 4JP0A 1SFXA 3S17J 3A1YA 2DMUA 1W7PB 2L4AA 4I02A 1KYQA 2F4MB 5LRRA 2LP0A 5EG0A 4GEQB 2Z1DA 3E6CC 2R76A 1XTAA 4U88A 3K2ZA 5CQEA 1D1CA 1S6LA 2AO9A 2FGGA 3HDDA 4OOGC 2ZC2A 2ID6A 1TL8A 3HTSB 5TGTA 2VQEE 2HPIA 3I58A 5F0FA 4JI0E 2HOEA 2QZ8A 1FSEA 2RAEA 2ZSIB 4XRSG 1Y1VJ 4GO1A 4XSXF 2EMWA 5KL6A 1P9QC 2V89A 2R7FA 5J1RA 4TUIA 2LBFA 1AWCA 4P1WA 4B3SE 5HLTA 2K3FA 1SR9A 1MMNA 2R3SA 2WA0A 4RBOA 3H0GJ 2R7VA 2K27A 2DLLA 2WZOA 3JREA 2KZVA 3OYGA 2EFWA 2HXOA 1GT0C 4OIOF 3G6EI 1TLHB 2RVCA 1V55H 1SMTA 3W2VA 1LKXA 1FBUA 4EJTA 3CJRB 1XC5A 2Y69H 2Y0SA 1A5JA 4N4RB 2JRTA 3VOEA 1D5VA 1SEUA 2X6OA 2MDGA 4LB5A 4XLFA 3LSRA 3JAMC 1SAXA 2P6TA 1HBXG 1IQSA 3RPUD 2HYGD 2IS1A 2LKXA 4E7KA 4BGDA 2LRSA 2CW8A 3U9GA 3BG7A 5ICGA 2LF7A 4R1HA 3GX4X 5K5RA 4CZCA 2IA0A 2YSOA 5IY5H 2LD5A 2FBKA 4S0HB 1N32E 4PDKA 3R60A 4N9IA 1QQIA 4LFAE 3GYHX 4IEJA 1IC8A 4RMNA 4IOAF 2Q2EA 1RQ0A 2KHMA 3O3KA 4JI2E 2IGMA 2QUFA 5E1ZB 2QSHX 2XDVA 2D1VA 2RPCA 4WSPA 2M0CA 4HZFA 2EFNA 2OUMA 4O4KA 4DV7E 3QPLA 2AQEA 2MSYA 2WC2A 4I01A 4XLAA 1H0MA 1X19A 2JWTA 4P5OA 2UXDE 2CYYA 5ED4A 1HKSA 1Z21A 4BJ5C 2VE8A 3RJPA 1Y1WJ 5H6RA 2FD5A 2QQAA 2YWQA 2LC2A 2CQNA 4ZYHA 3ZQLA 1K78A 1G59A 4BDYA 1GV2A 4HPQA 3J7AG 1D3YA 4AIHA 4XLHA 1FPQA 2IA2A 2A6HF 4RLQA 2FQ4A 3OS0A 4XLPF 5IT3A 4NHRA 4DUZE 4A6DA 5KAFC 1SFEA 4B09A 1YJ9I 3MZHA 2R7UA 2CPNA 2LTRA 1U9OA 1VI0A 2HQRA 2OC6A 3U21A 3WHCA 2M45A 1R4NB 3SZTA 4CUGA 3IC7A 5HS7A 4ZH4F 1HNZE 2V87A 2ZMEB 4D0PA 4NC6A 5DCMA 2ID3A 3HQ1A 2LRDA 3CF5F 5CVIA 4AWXB 5IT9K 4JI3E 2F5FA 2LF8A 1UMQA 1W7PD 2VODA 1X4PA 5M3MJ 4X8WA 4YIIA 2KIQA 2OA4A 1D5YA 2UXCE 2WAQN 2EIJH 5GPAA 1SFKA 2KFDA 3RPUA 3CP8A 4W97A 1KU7A 4F9CB 2GPIA 3TBIA 2XPWA 3OTOE 4GKKE 2DA6A 1N77A 3RPQA 5FKMA 3FX3A 4BC7A 2DK5A 2C6YA 4O24A 4F7ZA 1AAYA 3I9V2 2NS7A 5DDGA 2M7QA 4S05A 3KIOA 2LV2A 3GZ6A 4OX9E 3WU0A 2L2OA 3IWDA 1BI2A 3HSRA 1SFUA 3OOPA 2HTSA 2XGDA 1X47A 1YJWI 4KNYA 1MH4A 2W1OA 2JXPA 2A25A 3T8TA 2KOUA 5A2QK 4X1EA 3LWFA 3EDPA 4LFUA 3I59A 4D7NA 4RGUA 3KLOA 2STWA 1RPWA 1Z1DA 2EMKA 2EN8A 1WH7A 2E2JJ 2W24A 2MD0A 1TWGJ 1ZR4A 3GTGJ 1FIPA 1S29A 4UHTA 2R5ZB 2BB8A 3K7AJ 2EM2A 2YTNA 2RREA 4PZJA 2F5DA 4XK4A 1SMYF 4HBLA 4XL9A 5GAEJ 2NOJB 1TP4A 2EJRA 1F36A 5CVRA 2YX4A 1Z05A 1IG7A 2PJRB 2VOPA 1YUJA 4E7SA 2LY1A 1N75A 1YIOA 3NAUA 3ZQCA 2K3PA 3OSGA 4CCOA 5J47A 3M8EA 2JA2A 5FLMJ 1W5CC 5EEHA 1U5TB 3R6SA 5LGUA 2JRMA 4MTEA 2VI6A 2P7CB 3IWCA 1ENHA 2B0LA 3F8CA 1PUFA 1AU7A 4LLGF 5IYDJ 2EN4A 3PNVA 4UUSA 2GXAA 1UHSA 3TW7A 1R5GA 4D1QA 1ZELA 2BY3A 1NCSA 3W2WA 2WCC3 1W7PA 3SDBA 5EGOA 1PUEE 2F5CA 2W00A 1BOBA 1RNLA 5EF6A 3G1MA 4BE1A 4HOBA 4IQJA 4IHSA 1RUOA 4X9JA 5E1WA 1N33E 3GFMA 1FX7A 3TO9A 2VE7C 1IZ1A 3MZYA 2ODRC 3L2VA 4MLOA 4L5IA 4WX9A 2LUQA 2DMIA 1Z3XA 2EPLX 2ZMEC 3BTJA 1LFBA 2Z9OA 2JWOA 4GYIA 3M07A 4OU0A 1ETQA 4BKXA 4WXHA 4RAYA 1WJEA 3ZQFA 1K6OA 4U7DA 2V1DA 3BDDA 2V26A 4O5VA 2PMUA 2GZWA 1ZRDA 3KP6A 3GTOJ 3L00A 3DFGA 2ZB9A 4HNTA 3OY9A 4BY1J 2EJ4A 2UUAE 2ODRD 1PJQA 3IV5A 3H09A 3DU6A 1WJ5A 4V2FA 1G2DC 4B3AA 3JRIA 1A6QA 1T2KA 2JPAA 2LLKA 1I5ZA 4BUPA 4G7HF 2FMYA 5GTHC 4K0KE 4Y15A 2B3TB 1HXDA 2R0QC 3TQMA 2VBWA 1F4KA 2V6CA 2OTLI 1T4OA 3MZ8A 2AQFA 5H20A 5FKOA 5TJJA 1UFMA 1HKTA 5ILUA 2QSFX 3Q0WA 2K7IA 1GXPA 4MEYF 1YRNB 1K6YA 3L2CA 3CJQB 2L5QA 3LMMA 1KYWA 1ZKGA 2M2EA 3ZQIA 3HOXJ 1J2XA 3W6VA 1RESA 1KGSA 2EFQA 4RLFA 5CVVA 1O0WA 1RMDA 4ETSA 1MBKA 1QHHD 3HEFA 3FXRA 3H0DA 2EMHA 5LMNE 2XV4S 3VDXA 2YTPA 2QF7A 3ADIA 3CCYA 3L9FA 2XGEA 2HYJA 3OMLA 2AXTC 2DOAA 1GXQA 5LD2C 2PBIA 2K9LA 2WAFA 3DBRB 4M9ZA 3CJTB 1OYIA 2Y75A 4XORA 2L4MA 2DYRH 4G7ZF 4A12A 5DV5A 1YUIA 2KT0A 2E5LE 1J5EE 2AHQA 3HUGA 4KT5C 1N78A 3P9CA 5HVQC 2EA4A 1CF7B 3IAM2 5M5YJ 3V7SA 1DUXC 1U5TC 5FGMA 3NWSA 3E1SA 1ON1A 4BACA 4AYBA 5ICCA 3U1KA 2EN2A 3VYTB 2CV0A 4RA2A 4BYYA 1ZH5A 4MHGA 3CCMI 1H89C 1X5WA 3BIDA 1SAUA 4LJZF 1D1AA 5LHGA 2Y0SN 2YTQA 1YZ9A 1QZEA 2LREA 3R61A 3K70C 1JJ8C 2E1OA 2EM6A 3OV8A 2XHKA 3RSNA 1KU3A 1BB8A 2EQ3A 1WCMJ 1LDDA 4DYRA 2HTJA 2M7BA 4IRGA 2IBDA 1AH5A 1E2XA 2JQ7A 3SHFA 2ZMEA 4CA0A 2PJPA 4B47A 4C3HJ 5FFXA 2B9DA 2MDRA 4JI1E 2Y31A 4ZZLA 1YYWA 1W1WE 3HPGA 3ABLH 2YTDA 4A0YA 3A01B 2JOXA 1FT9A 4CDGA 2F6CA 1MJAA 4DV6E 1VQ9I 3WGGA 2EOMA 1R49A 3K70D 3LSHA 4BQNA 1LEBA 4X65E 1ZREA 2ZXHA 4I76A 5ADZA 2BY1A 1DGWY 4B43A 1J0RA 5K7ZA 5AONA 4II3A 1B9MA 5K5OA 1ZBQA 2OTJI 1R7JA 2GLOA 3ASOH 3VSLA 3FKIJ 2R7OA 1YI2I 2JA5J 1XGSA 3BR6A 5DYMA 2V4JC 2K9SA 1RR8C 1NH3A 2K86A 1JT0A 3RKWA 1GVJA 2CO5A 4EJVA 4KMFA 1ERDA 4IJAA 1AKHB 3AV0A 2WBTA 1DQUA 3S14J 5IP6A 1KA8A 2F4VE 3RYPA 2W82A 2MW8A 3LSTA 3DLAA 2DJIA 3SJMA 1R1TA 2WBSA 2R5ZA 2EMXA 1R5ID 4P78A 3A0BC 2KQRA 2EPMX 2ELJA 2WY7Q 2HI3A 3OS1A 5J4VA 3HBLA 4O43A 2D1HA 2BGCA 3KP7A 2FX0A 2NVTJ 1ODDA 3VYRB 1YPNA 2R7DA 4HDUA 2PJRA 3JTGA 1XMXA 2CSOA 3HPHA 3IKVA 1IN4A 4N4OB 1F1ZA 3TDUC 4AD9A 3L09A 2QQ9A 2WAEA 1A35A 4XMYA 1OQYA 1HCRA 2IT0A 4P55A 3S1NJ 2MLGA
chains in the Genus database with same CATH topology
2QWWA 1U5TA 1JXSA 4HX8A 1O3RA 1FP2A 2IRFG 1LQ1A 4MQ9F 1ZLKA 2VC1A 1SD5A 1UCRA 5E20A 2YPRA 1FNNA 1IF1A 1BI0A 1G3WA 4HV6A 5CJ9A 3LA7A 3QU3A 2A07F 3CTAA 4HQMA 1OKRA 2D2WA 2V79A 1U3EM 2W85A 5H6QA 5L3GA 1IN6A 2D45A 2CWEA 2P6SA 5J8FA 2PI0A 1I1SA 2EFOA 1TNTA 2V1XA 5HLGA 4OOIA 3IL2A 5KVRA 4XRFA 5LGNA 2YSRA 1P6RA 1FP1D 2FSWA 4WF2A 4Z2YA 5LEJA 4O3MA 1ZG3A 3HOSA 1X3UA 2QM3A 3V7CA 4B8XA 1C0WA 2VN2A 4N0BA 4XBFA 2GXBA 3LAPA 3BPXA 1ZLJA 3ZP5A 1T38A 5BMZA 1MJBA 3I5UA 2BE5F 1CF7A 2FBIA 1O3SA 2HR3A 2CFXA 2M87A 2O0YA 1QZYA 3IWFA 4G94A 2XKOA 2QENA 3GW2A 1Y0UA 3RKXA 3I64A 2FNAA 3E5XA 3ML6A 1K78B 1PP8F 2G9WA 4OMYA 5ERIA 1WWXA 3E3VA 4IVNA 2OZ6A 3KP5A 4GGGA 3K1MA 3G73A 3LAJA 3I53A 1Z9CA 5DCMB 5HS8A 2HKXA 1REPC 1U6GA 5L3EA 4YG2F 4LLLA 4Q47A 2H94A 2HKOA 3FF5A 2GXGA 2DW4A 1TW2A 3M1EA 3H3ZA 1O7FA 2X4HA 4G6QA 4CO8A 4JK1X 2GA2A 3FXQA 2OAZA 4G9YA 1G3TA 2NAZA 5LHIA 1DDNA 3F8FA 4OIQF 3KFWX 1T6SA 5DD8A 4L9NA 1RI7A 4EGZA 1JGSA 2L3DA 2ZXJA 2XROA 3H3UA 3QOPA 4L0YB 4PGGA 5FD6A 5D4SA 1XSXA 3QRFF 2DAOA 4KFCA 3NRVA 3K0LA 3FM3A 3ECOA 2BYVE 2YX7A 4RGRA 3GO5A 2F2EA 2DTRA 2P5VA 2PLYA 1OR7A 2XAJA 1A04A 4MTDA 2O3FA 2XVCA 1XGMA 3Q9VA 1PP7U 4CGZA 3R0JA 4I0AA 1FOKA 4I2OA 3D5LA 3ZPLA 1ZAOA 4LG0B 3V8LA 4KIGA 2CG4A 1U78A 5D6EA 2BV6A 5BOXA 4WCGA 2RKHA 3S2WA 2ZCWA 3PQJA 1HW1A 3ZQ7A 1J7KA 3TQNA 5J6XA 2DQLA 1LJ9A 2UZKA 1YS6A 1V4RA 4G8XA 3C1DA 4U0YA 2WV0A 2PG4A 1XSDA 1IRFA 5FB2A 3ERED 4YIFA 4KIBA 4A2UA 3CLOA 4I0BA 2M30A 3C3WA 1USTA 2ADUA 1G4DA 2H6BA 1USSA 1F5TA 1TQIA 5AIQA 5JVTA 1IN5A 4S04A 1UHWA 1I1GA 1H9TA 1Z91A 2FU4A 1YW9A 2UXNA 3I71A 1BOAA 2ZJ2A 4HF1A 3L7WA 3VODA 3J80Z 4BQAA 2GQQA 1MKMA 1HSTA 3JAMK 3TOBA 1W4MA 1J5YA 4RAZA 1ZRCA 5D8LB 3KZZA 1K7AA 3GFIA 3I0TA 3T1BA 1BI1A 1XMKA 2PQ8A 1EH7A 4XLNF 4EM0B 1SD7A 2ELHA 1BI3A 4I7HA 2L02A 2O61A 2MH2A 2LKPA 4IRIA 1D8JA 1LEAA 4AIKA 4CZZA 2EV0A 4FHTA 4N9HA 1KQ0A 3GVAA 2RQPA 3HYIA 1FYMA 1MGTA 1FLIA 1R5HA 3HIFA 1FBSA 3GEZA 4OINF 2ETHA 3WTSC 1HW5A 4FX4A 5K5QA 3MAJA 1B6AA 5JHUA 2EB7A 4ASNA 2JT1A 3F6OA 3P9IA 4RB0A 2GA1A 5L3CA 2DK8A 4MQVA 1YFHA 1FZPB 5HOOA 1I6XA 2MLKA 3JSPA 4EGYA 3MEXA 2ISYA 2ESHA 5ICEA 1P4AA 2G7UA 3V4GA 2VBXA 5ICFA 2XKPA 4RB1A 3FM5A 1WQ2A 3CJNA 2VOOA 4EMSA 4HV5A 2XAGA 4LK0F 4LG0A 3HHGA 1R36A 4P96A 1B1BA 2P7VB 1ZGAA 2XIGA 1MZBA 2UXXA 2RGVA 3BZ6A 4CXFA 3ABTA 3FMRA 5D5VB 3DV8A 2NS0A 4IXAA 3F8BA 2A3SA 2Q0OA 4HX7A 4LLNA 2P4WA 1WSUA 1KU9A 1KQ8A 4EJWA 1RUNA 4HYEA 1ONVA 1XGNA 5K1YA 1GHCA 5LLQA 1T39A 4KMUX 1G3SA 3MWMA 2XAQA 1ZGJA 4ON0A 3ZN1A 2DT5A 1Z6RA 3QU6A 5F1RA 3ABUA 3QPHA 2LNBA 4WXCA 3CO6C 3F22A 4FX0A 1HKQA 3E6MA 3F21A 2OQGA 4ENJA 2HS5A 3E5UA 3K69A 3ISPA 2RC4A 1K79A 2A69F 1YW8A 4YFKF 1H9GA 4M6XA 2FEZA 4UVCA 4IPAA 4BH9A 4U0VA 4BNCA 4PCQA 3SFZA 1ZG5A 4O6JA 2RNJA 2YR2A 2QLZA 2LSOA 2J5OA 4KA4A 1O57A 2EV6A 1ZYRF 5D6FA 2XGXA 4Q5SF 2W25A 3FMSA 4L9TA 1P92A 3QAHA 4UXNA 3WTTC 3K9TA 2DPUA 3R0AA 2NRAC 2VT2A 4TV7A 2XAFA 2BBYA 2KRFA 3KETA 2NNYA 1LVAA 2A61A 2VE9A 3SQNA 4A6EA 4A5MA 1VTNC 1Q1HA 3KLNA 1MD0A 1R1VA 1T0FA 1XDSA 1SD4A 3BJ6A 4LGWA 2MBFA 2KIFA 4DNCA 1DP7P 3B73A 4M72A 1ZHFA 1U8RA 4CHUA 5JR3A 2O8XA 2NNNA 4M71A 1XN7A 2JTVA 3DPTA 1UB9A 5L3BA 5LBQA 4U7BA 2FA5A 2FXAA 4L0ZB 3TO7A 2H09A 4H0EA 1JHHA 2Z33A 4KIFA 2W84A 2Z99A 4HDVA 1XCBA 5FD5A 5KK1A 2ZNYA 3IKTA 2PN6A 1IUYA 2DPDA 2Z3YA 4OMZA 3MFKA 3GF2A 1LDKB 2HDCA 5FLXZ 3HTUA 4JBAA 4CYDA 1F9NA 3ZMZA 4IRHA 2FE3A 3ELKA 4EQQA 1BC7C 1DPUA 4ESFA 1XSVA 1P4XA 2M8EA 2XAHA 2OZUA 3MCZA 1L3LA 5D5XB 4NB5A 1EH6A 2DO7A 1YO5C 4Y17A 4L9JA 4G6DA 3HRSA 3QPTA 3U2RA 2V1UA 3ZMTA 3LFKA 5LRSA 1R00A 3I4PA 1I27A 3CUOA 2YU3A 1W5SA 2VONA 1BIAA 4M9XA 1XB4A 1D8KA 2FBHA 4MNUA 4NQWA 3HOTA 1ZRFA 3BOQA 4OIRF 2TDXA 1ON2A 2OQRA 4MEXF 3FMQA 3DXJF 1J75A 2MA3A 3E6BA 3N97A 2P5KA 5E8IA 1XD7A 1S7AA 3BPVA 4Y13A 2HGCA 2P8TA 3WTYC 5IT9Z 1XGOA 2OU2A 4EJOA 2AXLA 4UUVA 3PQKA 2KIUA 1L0OC 1YS7A 4PGHA 3FHZA 3G3ZA 3CUQC 2EFPA 3Q9SA 3DF8A 3KP3A 5D5UB 3WTZA 3LQQA 2EA2A 3GFJA 1TNSA 2KJBA 5A2QZ 5LGTA 3J81Z 1YTYA 3LQRA 3WGIA 4LMYA 2UWMA 3F6VA 1G3YA 3NQOA 2O6GE 1HW2A 4ZYEA 1S3JA 4ESBA 5CVJA 3SXYA 2K7LA 2W57A 5E18F 3P9KA 3WGHA 2LDUA 4EJUA 4R79A 1EV7A 1IAWA 5FLXK 3COAC 4L9VA 2MH9A 4ESJA 1BJAA 2Z5UA 4A5NA 1T98A 3BJOA 4WWCA 3TO6A 4ZZDA 1WRJA 3D0SA 3RTRA 2A68F 4KYWA 3HSEA 3V8KA 2WTEA 3CUQA 2M5WA 4KUMA 4BHBA 3GLXA 3LA3A 4K2EA 3IRQA 2XUBA 5HDNA 3IRRA 5HS9A 4Q48A 1ZG1A 2DU9A 2KJCA 4UV8A 1LB2A 3GWZA 3ZN0A 3ZMVA 4G7OF 4RB3C 2EV5A 2K4BA 1NHAA 2OD5A 1R1UA 2PFBA 3SZPA 2QBYA 3C18A 4E70A 1B9NA 4HLXA 1P2FA 4I98B 4BHPA 3B02A 1HQCA 1MJ9A 1TW3A 1QBJA 1QPMA 2PEXA 2Q8KA 1R23A 3ZMSA 3K1NA 4HQEA 1O3QA 5HDKA 3Q5FA 5DCFA 5DUKA 3O2PE 5CVUA 5L3FA 2A5YB 1TBXA 2L01A 3TDZC 3E6DA 3F3XA 2E7WA 4ZYDA 1QO0D 3WTVC 3HRUA 1EH8A 1G6NA 3TKYA 1ZARA 1OYYA 4XSZF 5D5WB 1V3FA 3JTHA 3ZMUA 2J5PA 2Y48A 5ILVA 4HF0A 2GIVA 3J81K 3GZ5A 3HSFA 5BPDA 1J9IA 1IW7F 5LHHA 2DI3A 3M7GA 4M74A 3ECHA 1QNTA 1MDMA 3ULQB 5JFRA 1S8NA 2KKOA 3T8RA 3ROUA 1XDUA 2FMLA 4WXDA 3WU1B 3V7RA 3DEUA 2EWNA 2EK5A 5AIPA 1DPRA 3FWEA 1IN7A 1ULYA 2A6EF 2WWYA 3WODF 2ACJA 1E17A 4MGRA 4HLYA 2ESNA 5JI6A 1TQPA 3T0YA 3ZMDA 2KIMA 5D4RA 4BHCA 4OIPF 1B59A 5DEQA 3WTXC 4HW0A 2FOKA 4LD5A 2HFHA 2ZFWA 2HYFA 3RYRA 5EEGA 1FY7A 2QVOA 5BPIA 2RDPA 1BN5A 3FZVA 1HSJA 4RGSA 4DQ2A 4GCVA 1YQAA 3BY6A 2E7XA 3F8NA 3F72A 3KZYA 1BBYA 3DQVC 3J80K 3WTWC 1YYVA 1YLFA 5F6FA 5BQTA 5LEKA 1PDNC 2ISZA 3W6JB 2FF4A 2DQRA 3J7AO 4EVIA 4M6YA 3P7NA 3F23A 2COMA 2STTA 4QLCU 2ZO4A 1BM9A 2IVMA 2IA1A 4P9FA 3VFZA 3W6KB 4A0XA 4YFNF 2JPCA 3FXUA 2QQBA 1STZA 2K4JA 4AIJA 4KICA 1O7LA 4RS8A 1RZ4A 1OYWA 3KE2A 3WG9A 1TQMA 2AS5F 1KU2A 3VB2A 3REOA 3EUHA 4WK8F 3AAFA 3QP5A 3TOAA 2CGPA 4GYGA 2DBBA 1OMIA 1O3TA 2F5EA 2HEOA 1FBQA 3GUDA 2MD5A 4Q4ZF 1SD6A 5E8GA 4UV9A 3PFIA 2ZBKA 3F8MA 3EETA 4RGXA 3KEOA 5E17F 4AVPA 3RI4A 3MQ0A 4EM1A 1Z7UA 2P5LC 4FT8A 4UVBA 2QYOA 2MC3A 3BP8A 4NHJA 2IP2A 1B4AA 1ZN2A 2VXZA 3HHHA 3HRTA 3VEPA 3IHUA 3E5QA 1S7OA 1UHMA 2H6CA 5HDGA 1FYKA 4U0WA 5CYVA 2O03A 1YG2A 4EV0A 1FSHA 3KP2A 5E1XA 4YFXF 2CQKA 4UVAA 3RIRA 2JZYA 1WI9A 4BAYA 2V9VA 3T5XA 3DP7A 3QP6A 1FC3A 5TRDA 1FWZA 5J8CA 3E97A 4RB2C 2L54A 2K02A 4HA8A 2NYXA 3EQLF 2IW5A 2XRNA 5D8KB 1AOYA 3O6BB 4HF2A 1XMAA 5ILSA 2E1CA 2VC0A 1WKMA 3CO7C 4L5JA 4EM2A 1U2WA 4KN7X 2GAUA 3DKWA 3IWZA 3EYIA 3TGNA 4I09A 2GWRA 2M1BA 4QWQA 1OPCA 4BXUA 4HAMA 2RV8A 3KCCA 3N4MA 2OBPA 4IHTA 2HZTA 3R4KA 2IJLA 1IXSB 4KDPA 2FNPA 2G7HA 2JSCA 2JPBA 4ENNA 1Z6TA 1KYZA 3DPLC 3C7JA 4A0ZA 1BC8C 4ZYGA 1IXRC 2VT3A 3CUQB 5HLHA 2ZKZA 2H27A 2ZNZA 4LK1F 1P4WA 1XCVA 3BJAA 4LB6B 3GFLA 3LA2A 3V8JA 4ENMA 1CGPA 6PAXA 3M8FA 1FYLA 1QGPA 1JHFA 4JQFA 2QBYB 3H92A 4UNOA 1YW7A 3JSOA 3BWGA 5L3DA 4GXOA 1R58A 3K1PA 2VBYA 5BS6A 1IN8A 1LNWA 3GXOA 3WTUC 2XASA 3NEUA 1W5TA 5DD4A 4IF4A 5DUIA 3WE2A 2IPQX 3HRMA 3JW4A 4HX4A 3EYYA 4M73A 3KP4A 3JAMZ 5CLSA 4R8HA 1IXCA 3U1DA 3I54A 1RIOH 4KN4X 4P9UA 5FFZA 5HLIA 1IRGA 4M9SA 1R22A 2VBZA 2E1NA 2FQ3A 3I59B 1KQ9A 2FRHA 4CICA 3CDHA 1QZZA 2PMHA 1LDJA 3RDIA 5F64A 1BIBA 3WE3A 1MDMB 1JE8A 3M9AA 2BEOA 3BROA 1J59A 2CW0F 2Y0MA 2DFIA 2RN7A 4L18B 2HQNA 2HWVA 3RKYA 1TTYA 2X0LA 3KEQA 5FO5A 4ENKA 1SFXA 1W7PB 2L4AA 4I02A 5LRRA 3E6CC 4U88A 3K2ZA 1S6LA 3HTSB 3I58A 2HOEA 2QZ8A 1FSEA 4GO1A 4XSXF 2R7FA 1AWCA 2R3SA 2K27A 2DLLA 2EFWA 4OIOF 1TLHB 2RVCA 1SMTA 1FBUA 4EJTA 2JRTA 3VOEA 1D5VA 4LB5A 1SAXA 2P6TA 1HBXG 2HYGD 3U9GA 5ICGA 2LF7A 4R1HA 3GX4X 5K5RA 2IA0A 2FBKA 4PDKA 3R60A 4N9IA 1QQIA 3GYHX 2Q2EA 3O3KA 2QUFA 5E1ZB 2D1VA 4HZFA 2EFNA 2WC2A 4I01A 1H0MA 4P5OA 2CYYA 5ED4A 1HKSA 2VE8A 3RJPA 5H6RA 2QQAA 4ZYHA 1K78A 1D3YA 4AIHA 1FPQA 2IA2A 2A6HF 4XLPF 5IT3A 4A6DA 1SFEA 4B09A 3MZHA 2HQRA 2M45A 3SZTA 4ZH4F 3IC7A 5HS7A 2ZMEB 4D0PA 5DCMA 5IT9K 5CVIA 4AWXB 2F5FA 2LF8A 1W7PD 2VODA 4YIIA 2OA4A 3RPUA 1KU7A 3RPQA 3FX3A 2DK5A 2C6YA 4F7ZA 5DDGA 4S05A 3GZ6A 3WU0A 1BI2A 3HSRA 1SFUA 3OOPA 2HTSA 4KNYA 3T8TA 5A2QK 3LWFA 3EDPA 4LFUA 3I59A 4RGUA 3KLOA 2STWA 1Z1DA 2W24A 1S29A 4UHTA 4PZJA 2F5DA 1SMYF 4HBLA 2EJRA 5CVRA 2YX4A 1Z05A 2VOPA 1YIOA 3M8EA 5EEHA 1U5TB 3R6SA 5LGUA 4MTEA 2P7CB 2B0LA 3F8CA 4LLGF 1R5GA 1W7PA 1PUEE 2F5CA 1RNLA 4HOBA 4IHSA 1RUOA 5E1WA 3GFMA 1FX7A 3TO9A 1IZ1A 3MZYA 4L5IA 4WX9A 2Z9OA 4GYIA 4OU0A 4WXHA 4RAYA 1K6OA 4U7DA 2V1DA 3BDDA 4O5VA 2PMUA 2GZWA 1ZRDA 3KP6A 3L00A 3DFGA 1T2KA 1I5ZA 4G7HF 2FMYA 4Y15A 1HXDA 2VBWA 1F4KA 2V6CA 5H20A 5TJJA 1HKTA 1UFMA 5ILUA 1GXPA 4MEYF 3L2CA 1KYWA 1J2XA 1KGSA 2EFQA 5CVVA 4ETSA 3FXRA 2XV4S 3L9FA 1GXQA 2PBIA 4M9ZA 1OYIA 2Y75A 2L4MA 4G7ZF 4A12A 5DV5A 3HUGA 4KT5C 3P9CA 5HVQC 2EA4A 1CF7B 1DUXC 3V7SA 1U5TC 5FGMA 1ON1A 5ICCA 4BYYA 1ZH5A 4MHGA 4LJZF 5LHGA 3R61A 3OV8A 2XHKA 1KU3A 1LDDA 2HTJA 4IRGA 1E2XA 3SHFA 2ZMEA 2PJPA