2EOXA

Solution structure of the c2h2 type zinc finger (region 315-345) of human zinc finger protein 473
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
44
structure length
44
Chain Sequence
GSSGSSGTDSKSYNCNECGKAFTRIFHLTRHQKIHTRKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 473
publication title Solution structure of the C2H2 type zinc finger (region 315-345) of human Zinc finger protein 473
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eoxA01
4IJDA 1P47A 2EOSA 2DLKA 2EM7A 5KL5A 2YSPA 4R2SA 2DMIA 2EN6A 1KJKA 2EMKA 2YTNA 2HGHA 2EPZA 2M9AA 2EMHA 2A25A 2ELYA 2CSHA 2WBUA 2EN1A 1DGCA 2EMXA 2WCC3 2J7JA 2EPCA 5KL4A 1A1KA 2EJ4A 2EMIA 5KL3A 4R2RA 4M9VC 1BB8A 4X9JA 2EOJA 2EMCA 1MEYC 1Z1BA 2YTPA 2EMFA 2EM8A 2YTFA 2RPCA 1A1FA 2EM0A 2EE8A 2ADRA 2DLQA 1BBOA 2WBSA 2EM9A 2GLIA 2YRHA 4R2DA 2LVHA 2LO3A 2ENAA 4R2QA 1ZU1A 2EOIA 2EPPA 2YRMA 2JPAA 2VRDA 2LV2A 4F6MA 2EMWA 1YUIA 2EOEA 1JK1A 2DGCA 2BB8A 2EL6A 2JP9A 3EPHA 1A1JA 2EM5A 2EPAA 2EOQA 2YU5A 2YTJA 1ZR9A 1JK2A 1X6HA 2EMAA 2YTGA 2YU8A 2MKNA 2EPRA 5KL6A 1TN9A 2ELZA 1B69A 2DRPA 2EPUA 2EM4A 2EM6A 1A1HA 1YUJA 2EL5A 1NCSA 1A1LA 2EOFA 3EPKA 5KL2A 1TF6A 2D9HA 2EOZA 1YSAC 2YSOA 4R2AA 1WJPA 2EPXA 2YRKA 1TF3A 2YTIA 1A1IA 2EMBA 1UN6B 3MHSC 1LLMC 2EMYA 2EOXA 2EQ1A 3EPLA 4R2CA 2MKDA 1UBDC 2EORA 2EP3A 2ENCA 1ZAAC 2PRTA 4GZNC 1G2FC 4WSGA 2EMZA 2YTOA 1RMDA 1X3CA 5KL7A 1F2IG 2EMGA 2EMLA 2YTQA 2CTDA 1G2DC 2I13A 2YTEA 1X5WA 2EM2A 2E72A 4F6NA 2EOMA 3M99B 2EL4A 2EM3A 2EQ3A 2LCEA 2R1FA 2EOHA 1AAYA 3MHHC 2CT1A 2YTDA 4FK5C 2ENHA 2RSIA 4IS1C 3EPJA 2EN3A 1X6FA 2LT7A 3UK3C 2EN4A 4R2PA 2MDGA 2EN8A 2EOYA 2EN7A 2NABA 2WBTA 4F2JC 2EN2A 2EQ0A 4R2EA 1X6EA 2GHFA 2EOOA 1A1GA 3VHTB
chains in the Genus database with same CATH superfamily
2EM7A 2DMIA 2EN6A 5A6JA 1KJKA 5IV8B 2HGHA 2M9AA 3JAMC 2A25A 2WBUA 4LF4E 5BR8E 4DMIA 2WCC3 1RC7A 3KZZA 2EPCA 5KL4A 2LJHA 4DUYE 5DNYA 2V85A 3VYYA 5IXMB 4LU9A 4DV2E 4BHBA 1X47A 2EMCA 2YPNA 4M30A 1MEYC 3DJWA 2EMFA 2RPCA 3RMPA 2JOBA 2ADRA 1BBOA 3T1YE 2L92A 2LO3A 2ENAA 2EOIA 2WZOA 4JI2E 2FGGA 4F6MA 4DR4E 2EZ6A 2EMWA 1KYQA 1YZ9A 3C6MA 1T4NA 3P1XA 3AUZA 2KHXA 2EPKX 4WPYA 3THOB 2NUFA 1IBLE 1EH6A 4WXCA 1ZR9A 1X6HA 1MGTA 2YU8A 2ELZA 2K7IA 2EM4A 4RH8A 1NCSA 3J81C 1TF6A 2UUBE 1YPNA 2D9HA 2L2NA 2LJUA 1YSAC 5TSEA 4J8ZA 2YWQA 4R2AA 3TQMA 2B7TA 4LF5E 1WHNA 1WJPA 2VQEE 3MSWA 5AE2A 2B7VA 4R2CA 1T39A 3H09A 4MLQA 2YTOA 4LF8E 3C4BA 4JI7E 5A6KA 2EPNA 1F2IG 5LL6R 4DV3E 1G2DC 3HPZA 4DR1E 1FJGE 4F6NA 2EOMA 5FLXC 2EM3A 2LCEA 1X49A 1AAYA 4X8WA 2RTXA 2YTDA 5A2QC 2LTRA 3BGHA 2EPMX 4BC7A 2EN3A 4B3RE 4BBYA 4JI6E 1DI2A 1IBKE 2F4VE 2EOYA 1IQSA 4GKJE 2EN2A 2EQ0A 2GHFA 2JY9A 4JI3E 2LTSA 4KWYA 1RQ0A 4B3ME 1P47A 2DB2A 4R2SA 2YTNA 5IWAE 1YYWA 2EPZA 5LLQA 4JI5E 2EN1A 2VQFE 2EMXA 4JI8E 2JYAA 4ZYHA 4TUGA 1HNZE 2J7JA 1HNXE 4BHCA 2EJ4A 1ZBQA 2DIXA 1YFHA 3KWRA 2V87A 4P78A 2L33A 4WFTA 2EPLX 4LF7E 2EM8A 2H36X 2B3TB 2JVAA 2HJJA 2L6MA 2GLIA 4R2DA 2LVHA 1SFEA 2V8QB 1ZU1A 1N36E 2JPAA 5AASA 3BF2A 4ZYDA 2N8XA 4DR3E 2DMYA 2BB8A 2JP9A 4F9AB 3OTOE 1A1JA 5AE1A 1N3GA 2JR1A 2EOQA 2YU5A 1WXRA 4KZSA 2YTJA 2YTGA 4LTYA 5KL6A 2FTXB 4NHRA 1B69A 1TN9A 2DRPA 2CPNA 1X48A 2EM6A 1YUJA 2EL5A 3J80C 1SR9A 5KL2A 2EPOA 1EH8A 3L00A 2EWLA 2M4IA 2MDRA 2YSOA 4R8OA 1N32E 3ECRA 2M7QA 1TF3A 1UN6B 2EOXA 4ZYEA 2V83A 1NEIA 2EORA 1PDAA 1ZAAC 4WSGA 2EMZA 1T4LB 2I9IA 1RMDA 1HR0E 1X3CA 4O4KA 5F3WA 2EMGA 4L5NC 2EMLA 3ADIA 2CTDA 4X66E 2I13A 1PJSA 1X5WA 4X62E 2E72A 4NXME 4DKKA 3M99B 2EL4A 2FV4B 1UHZA 2EQ3A 2VF1A 2EOHA 2L3JA 2ENHA 3BBGA 2LMZA 1QNTA 3EPJA 1IBME 4O24A 1X6FA 2LT7A 3C4TA 2HHHE 2EN8A 4OX9E 4F2JC 3LMLA 4Q35B 4R2EA 3T1HE 3FIGA 3ADLA 2EOOA 3VHTB 4DUZE 2EOSA 5KL5A 5A6AA 4MLVA 2CSHA 2DSYA 4R03A 2MC5A 4GEQB 2JXPA 5KL3A 4R2RA 4F9BB 4M9VC 1BB8A 5ADZA 2YTPA 4DV1E 2DLQA 1J26A 1BBGA 1J5EE 2EM9A 2YRHA 4DV0E 4DV5E 4JI4E 4R2QA 1HNWE 4GKKE 5AC4A 3THNA 2RS6A 1N34E 2EOEA 3DF6A 2LUQA 3QG5C 1XNQE 2N3HA 4M2ZA 1YYKA 2EM5A 1EH7A 4LFCE 2EPAA 2NUEA 3ADJA 4BCAA 1JK2A 2EMAA 1PKPA 2MKNA 2EPRA 2G7HA 4WXDA 2KOUA 4HEIA 4X65E 2EPUA 2ODRC 4DR2E 1A1HA 1A1LA 3EPKA 4YY3E 4F54A 1DQ3A 4DR5E 2E5LE 1GQEA 2UU9E 4NZVA 2YRKA 1O0WA 2EMBA 1A1IA 4I8OA 2EMYA 2EQ1A 2RQLA 5A6BA 3IWDA 2YT4A 2UUAE 1UBDC 3K6QA 2M1SA 2EP3A 3EQ1A 2PRTA 2UXDE 3IWCA 4GZNC 1G2FC 1T4OA 4LF9E 3F6HA 2IHR1 4LFBE 4L8NA 4BC9A 2RSMA 4NXNE 1FKAE 5CFFE 2EM2A 3KZYA 5A6BD 1T38A 2HC5A 4OOGC 4JV5E 3MHHC 2LRSA 3AV0A 4K0KE 2KONA 4FK5C 2LBSB 3F6GA 2L3CA 4LF6E 1WHQA 2UUCE 2K4VA 2EN4A 4R2PA 1PJQA 3HTXA 1QU6A 2EN7A 3ADGA 2NABA 3HPSA 2E1MA 1A1GA 4IJDA 2DLKA 2YSPA 2BBGA 1XMQE 2EMKA 4WSPA 2EMHA 2ELYA 1DGCA 3BIDA 2UXCE 4YHHE 1IMUA 5IT9C 2L2KB 4LFAE 2LUPB 1A1KA 2EMIA 2V88A 1AH5A 1UILA 2NA2A 2UXBE 4RHBB 4X9JA 2EOJA 2F8BA 1Z1BA 3HXLA 3VK6A 2YTFA 1A1FA 2EE8A 2EM0A 2N3GA 4DV6E 2WBSA 2MC6A 4WX9A 2EPPA 2YRMA 4AQYE 2VRDA 3OMLA 2JOXA 2LV2A 4B3TE 1YUIA 1JK1A 2DGCA 2RS7A 2EL6A 1EKZA 3LLHA 3EPHA 1WRJA 2L2MA 2ODRD 4X64E 3IWBA 5LMUE 2R76A 2V86A 1XMOE 4O5GA 4BS9A 3J7Yp 1GTKA 5AC5A 2Q8UA 4M0VA 4HTGA 2EOFA 1YYOA 3ZOQB 1XNRE 4DV7E 3JTZA 2EOZA 1N33E 4Q28A 1STUA 2VE7C 2V89A 1GZ6A 2EPXA 5AE3A 2YTIA 2ZM6E 3J7AG 3MHSC 1LLMC 2NUGA 3EPLA 2MKDA 4O43A 2ENCA 4N4RB 1I94E 2GPIA 4F9CB 5KL7A 5LMNE 2YTQA 1IQOA 5T6JA 4DR6E 2YTEA 4JI1E 4B3SE 3JU0A 4KHPE 2LE2A 4BMJA 5A69A 3HQ1A 2R1FA 1PJTA 3C6KA 1ZBTA 2B9DA 2CT1A 3VYXA 4P7DA 4DV4E 2RSIA 4IS1C 1L4SA 2L8TA 4JI0E 3UK3C 4JYAE 2MDGA 4DR7E 4ZYGA 2WBTA 4WYQB 4TUIA 2JWOA 1X6EA 2YZTA
chains in the Genus database with same CATH topology
4IJDA 1P47A 2EOSA 2DLKA 2EM7A 5KL5A 2YSPA 4R2SA 2DMIA 2EN6A 1KJKA 2EMKA 2YTNA 2HGHA 2EPZA 2M9AA 2EMHA 2A25A 2ELYA 2CSHA 2WBUA 2EN1A 1DGCA 2EMXA 2WCC3 2J7JA 2EPCA 5KL4A 1A1KA 2EJ4A 2EMIA 5KL3A 4R2RA 4M9VC 1BB8A 4X9JA 2EOJA 2EMCA 1MEYC 1Z1BA 2YTPA 2EMFA 2EM8A 2YTFA 2RPCA 1A1FA 2EM0A 2EE8A 2ADRA 2DLQA 1BBOA 2WBSA 2EM9A 2GLIA 2YRHA 4R2DA 2LVHA 2LO3A 2ENAA 4R2QA 1ZU1A 2EOIA 2EPPA 2YRMA 2JPAA 2VRDA 2LV2A 4F6MA 2EMWA 1YUIA 2EOEA 1JK1A 2DGCA 2BB8A 2EL6A 2JP9A 3EPHA 1A1JA 2EM5A 2EPAA 2EOQA 2YU5A 2YTJA 1ZR9A 1JK2A 1X6HA 2EMAA 2YTGA 2YU8A 2MKNA 2EPRA 5KL6A 1TN9A 2ELZA 1B69A 2DRPA 2EPUA 2EM4A 2EM6A 1A1HA 1YUJA 2EL5A 1NCSA 1A1LA 2EOFA 3EPKA 5KL2A 1TF6A 2D9HA 2EOZA 1YSAC 2YSOA 4R2AA 1WJPA 2EPXA 2YRKA 1TF3A 2YTIA 1A1IA 2EMBA 1UN6B 3MHSC 1LLMC 2EMYA 2EOXA 2EQ1A 3EPLA 4R2CA 2MKDA 1UBDC 2EORA 2EP3A 2ENCA 1ZAAC 2PRTA 4GZNC 1G2FC 4WSGA 2EMZA 2YTOA 1RMDA 1X3CA 5KL7A 1F2IG 2EMGA 2EMLA 2YTQA 2CTDA 1G2DC 2I13A 2YTEA 1X5WA 2EM2A 2E72A 4F6NA 2EOMA 3M99B 2EL4A 2EM3A 2EQ3A 2LCEA 2R1FA 2EOHA 1AAYA 3MHHC 2CT1A 2YTDA 4FK5C 2ENHA 2RSIA 4IS1C 3EPJA 2EN3A 1X6FA 2LT7A 3UK3C 2EN4A 4R2PA 2MDGA 2EN8A 2EOYA 2EN7A 2NABA 2WBTA 4F2JC 2EN2A 2EQ0A 4R2EA 1X6EA 2GHFA 2EOOA 1A1GA 3VHTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJD A;  1P47 A;  2EOS A;  2DLK A;  2EM7 A;  5KL5 A;  2YSP A;  4R2S A;  2DMI A;  2EN6 A;  1KJK A;  2EMK A;  2YTN A;  2HGH A;  2EPZ A;  2M9A A;  2EMH A;  2A25 A;  2ELY A;  2CSH A;  2WBU A;  2EN1 A;  1DGC A;  2EMX A;  2WCC 3;  2J7J A;  2EPC A;  5KL4 A;  1A1K A;  2EJ4 A;  2EMI A;  5KL3 A;  4R2R A;  4M9V C;  1BB8 A;  4X9J A;  2EOJ A;  2EMC A;  1MEY C;  1Z1B A;  2YTP A;  2EMF A;  2EM8 A;  2YTF A;  2RPC A;  1A1F A;  2EM0 A;  2EE8 A;  2ADR A;  2DLQ A;  1BBO A;  2WBS A;  2EM9 A;  2GLI A;  2YRH A;  4R2D A;  2LVH A;  2LO3 A;  2ENA A;  4R2Q A;  1ZU1 A;  2EOI A;  2EPP A;  2YRM A;  2JPA A;  2VRD A;  2LV2 A;  4F6M A;  2EMW A;  1YUI A;  2EOE A;  1JK1 A;  2DGC A;  2BB8 A;  2EL6 A;  2JP9 A;  3EPH A;  1A1J A;  2EM5 A;  2EPA A;  2EOQ A;  2YU5 A;  2YTJ A;  1ZR9 A;  1JK2 A;  1X6H A;  2EMA A;  2YTG A;  2YU8 A;  2MKN A;  2EPR A;  5KL6 A;  1TN9 A;  2ELZ A;  1B69 A;  2DRP A;  2EPU A;  2EM4 A;  2EM6 A;  1A1H A;  1YUJ A;  2EL5 A;  1NCS A;  1A1L A;  2EOF A;  3EPK A;  5KL2 A;  1TF6 A;  2D9H A;  2EOZ A;  1YSA C;  2YSO A;  4R2A A;  1WJP A;  2EPX A;  2YRK A;  1TF3 A;  2YTI A;  1A1I A;  2EMB A;  1UN6 B;  3MHS C;  1LLM C;  2EMY A;  2EOX A;  2EQ1 A;  3EPL A;  4R2C A;  2MKD A;  1UBD C;  2EOR A;  2EP3 A;  2ENC A;  1ZAA C;  2PRT A;  4GZN C;  1G2F C;  4WSG A;  2EMZ A;  2YTO A;  1RMD A;  1X3C A;  5KL7 A;  1F2I G;  2EMG A;  2EML A;  2YTQ A;  2CTD A;  1G2D C;  2I13 A;  2YTE A;  1X5W A;  2EM2 A;  2E72 A;  4F6N A;  2EOM A;  3M99 B;  2EL4 A;  2EM3 A;  2EQ3 A;  2LCE A;  2R1F A;  2EOH A;  1AAY A;  3MHH C;  2CT1 A;  2YTD A;  4FK5 C;  2ENH A;  2RSI A;  4IS1 C;  3EPJ A;  2EN3 A;  1X6F A;  2LT7 A;  3UK3 C;  2EN4 A;  4R2P A;  2MDG A;  2EN8 A;  2EOY A;  2EN7 A;  2NAB A;  2WBT A;  4F2J C;  2EN2 A;  2EQ0 A;  4R2E A;  1X6E A;  2GHF A;  2EOO A;  1A1G A;  3VHT B; 
#chains in the Genus database with same CATH topology
 2EM7 A;  2DMI A;  2EN6 A;  5A6J A;  1KJK A;  5IV8 B;  2HGH A;  2M9A A;  3JAM C;  2A25 A;  2WBU A;  4LF4 E;  5BR8 E;  4DMI A;  2WCC 3;  1RC7 A;  3KZZ A;  2EPC A;  5KL4 A;  2LJH A;  4DUY E;  5DNY A;  2V85 A;  3VYY A;  5IXM B;  4LU9 A;  4DV2 E;  4BHB A;  1X47 A;  2EMC A;  2YPN A;  4M30 A;  1MEY C;  3DJW A;  2EMF A;  2RPC A;  3RMP A;  2JOB A;  2ADR A;  1BBO A;  3T1Y E;  2L92 A;  2LO3 A;  2ENA A;  2EOI A;  2WZO A;  4JI2 E;  2FGG A;  4F6M A;  4DR4 E;  2EZ6 A;  2EMW A;  1KYQ A;  1YZ9 A;  3C6M A;  1T4N A;  3P1X A;  3AUZ A;  2KHX A;  2EPK X;  4WPY A;  3THO B;  2NUF A;  1IBL E;  1EH6 A;  4WXC A;  1ZR9 A;  1X6H A;  1MGT A;  2YU8 A;  2ELZ A;  2K7I A;  2EM4 A;  4RH8 A;  1NCS A;  3J81 C;  1TF6 A;  2UUB E;  1YPN A;  2D9H A;  2L2N A;  2LJU A;  1YSA C;  5TSE A;  4J8Z A;  2YWQ A;  4R2A A;  3TQM A;  2B7T A;  4LF5 E;  1WHN A;  1WJP A;  2VQE E;  3MSW A;  5AE2 A;  2B7V A;  4R2C A;  1T39 A;  3H09 A;  4MLQ A;  2YTO A;  4LF8 E;  3C4B A;  4JI7 E;  5A6K A;  2EPN A;  1F2I G;  5LL6 R;  4DV3 E;  1G2D C;  3HPZ A;  4DR1 E;  1FJG E;  4F6N A;  2EOM A;  5FLX C;  2EM3 A;  2LCE A;  1X49 A;  1AAY A;  4X8W A;  2RTX A;  2YTD A;  5A2Q C;  2LTR A;  3BGH A;  2EPM X;  4BC7 A;  2EN3 A;  4B3R E;  4BBY A;  4JI6 E;  1DI2 A;  1IBK E;  2F4V E;  2EOY A;  1IQS A;  4GKJ E;  2EN2 A;  2EQ0 A;  2GHF A;  2JY9 A;  4JI3 E;  2LTS A;  4KWY A;  1RQ0 A;  4B3M E;  1P47 A;  2DB2 A;  4R2S A;  2YTN A;  5IWA E;  1YYW A;  2EPZ A;  5LLQ A;  4JI5 E;  2EN1 A;  2VQF E;  2EMX A;  4JI8 E;  2JYA A;  4ZYH A;  4TUG A;  1HNZ E;  2J7J A;  1HNX E;  4BHC A;  2EJ4 A;  1ZBQ A;  2DIX A;  1YFH A;  3KWR A;  2V87 A;  4P78 A;  2L33 A;  4WFT A;  2EPL X;  4LF7 E;  2EM8 A;  2H36 X;  2B3T B;  2JVA A;  2HJJ A;  2L6M A;  2GLI A;  4R2D A;  2LVH A;  1SFE A;  2V8Q B;  1ZU1 A;  1N36 E;  2JPA A;  5AAS A;  3BF2 A;  4ZYD A;  2N8X A;  4DR3 E;  2DMY A;  2BB8 A;  2JP9 A;  4F9A B;  3OTO E;  1A1J A;  5AE1 A;  1N3G A;  2JR1 A;  2EOQ A;  2YU5 A;  1WXR A;  4KZS A;  2YTJ A;  2YTG A;  4LTY A;  5KL6 A;  2FTX B;  4NHR A;  1B69 A;  1TN9 A;  2DRP A;  2CPN A;  1X48 A;  2EM6 A;  1YUJ A;  2EL5 A;  3J80 C;  1SR9 A;  5KL2 A;  2EPO A;  1EH8 A;  3L00 A;  2EWL A;  2M4I A;  2MDR A;  2YSO A;  4R8O A;  1N32 E;  3ECR A;  2M7Q A;  1TF3 A;  1UN6 B;  2EOX A;  4ZYE A;  2V83 A;  1NEI A;  2EOR A;  1PDA A;  1ZAA C;  4WSG A;  2EMZ A;  1T4L B;  2I9I A;  1RMD A;  1HR0 E;  1X3C A;  4O4K A;  5F3W A;  2EMG A;  4L5N C;  2EML A;  3ADI A;  2CTD A;  4X66 E;  2I13 A;  1PJS A;  1X5W A;  4X62 E;  2E72 A;  4NXM E;  4DKK A;  3M99 B;  2EL4 A;  2FV4 B;  1UHZ A;  2EQ3 A;  2VF1 A;  2EOH A;  2L3J A;  2ENH A;  3BBG A;  2LMZ A;  1QNT A;  3EPJ A;  1IBM E;  4O24 A;  1X6F A;  2LT7 A;  3C4T A;  2HHH E;  2EN8 A;  4OX9 E;  4F2J C;  3LML A;  4Q35 B;  4R2E A;  3T1H E;  3FIG A;  3ADL A;  2EOO A;  3VHT B;  4DUZ E;  2EOS A;  5KL5 A;  5A6A A;  4MLV A;  2CSH A;  2DSY A;  4R03 A;  2MC5 A;  4GEQ B;  2JXP A;  5KL3 A;  4R2R A;  4F9B B;  4M9V C;  1BB8 A;  5ADZ A;  2YTP A;  4DV1 E;  2DLQ A;  1J26 A;  1BBG A;  1J5E E;  2EM9 A;  2YRH A;  4DV0 E;  4DV5 E;  4JI4 E;  4R2Q A;  1HNW E;  4GKK E;  5AC4 A;  3THN A;  2RS6 A;  1N34 E;  2EOE A;  3DF6 A;  2LUQ A;  3QG5 C;  1XNQ E;  2N3H A;  4M2Z A;  1YYK A;  2EM5 A;  1EH7 A;  4LFC E;  2EPA A;  2NUE A;  3ADJ A;  4BCA A;  1JK2 A;  2EMA A;  1PKP A;  2MKN A;  2EPR A;  2G7H A;  4WXD A;  2KOU A;  4HEI A;  4X65 E;  2EPU A;  2ODR C;  4DR2 E;  1A1H A;  1A1L A;  3EPK A;  4YY3 E;  4F54 A;  1DQ3 A;  4DR5 E;  2E5L E;  1GQE A;  2UU9 E;  4NZV A;  2YRK A;  1O0W A;  2EMB A;  1A1I A;  4I8O A;  2EMY A;  2EQ1 A;  2RQL A;  5A6B A;  3IWD A;  2YT4 A;  2UUA E;  1UBD C;  3K6Q A;  2M1S A;  2EP3 A;  3EQ1 A;  2PRT A;  2UXD E;  3IWC A;  4GZN C;  1G2F C;  1T4O A;  4LF9 E;  3F6H A;  2IHR 1;  4LFB E;  4L8N A;  4BC9 A;  2RSM A;  4NXN E;  1FKA E;  5CFF E;  2EM2 A;  3KZY A;  5A6B D;  1T38 A;  2HC5 A;  4OOG C;  4JV5 E;  3MHH C;  2LRS A;  3AV0 A;  4K0K E;  2KON A;  4FK5 C;  2LBS B;  3F6G A;  2L3C A;  4LF6 E;  1WHQ A;  2UUC E;  2K4V A;  2EN4 A;  4R2P A;  1PJQ A;  3HTX A;  1QU6 A;  2EN7 A;  3ADG A;  2NAB A;  3HPS A;  2E1M A;  1A1G A;  4IJD A;  2DLK A;  2YSP A;  2BBG A;  1XMQ E;  2EMK A;  4WSP A;  2EMH A;  2ELY A;  1DGC A;  3BID A;  2UXC E;  4YHH E;  1IMU A;  5IT9 C;  2L2K B;  4LFA E;  2LUP B;  1A1K A;  2EMI A;  2V88 A;  1AH5 A;  1UIL A;  2NA2 A;  2UXB E;  4RHB B;  4X9J A;  2EOJ A;  2F8B A;  1Z1B A;  3HXL A;  3VK6 A;  2YTF A;  1A1F A;  2EE8 A;  2EM0 A;  2N3G A;  4DV6 E;  2WBS A;  2MC6 A;  4WX9 A;  2EPP A;  2YRM A;  4AQY E;  2VRD A;  3OML A;  2JOX A;  2LV2 A;  4B3T E;  1YUI A;  1JK1 A;  2DGC A;  2RS7 A;  2EL6 A;  1EKZ A;  3LLH A;  3EPH A;  1WRJ A;  2L2M A;  2ODR D;  4X64 E;  3IWB A;  5LMU E;  2R76 A;  2V86 A;  1XMO E;  4O5G A;  4BS9 A;  3J7Y p;  1GTK A;  5AC5 A;  2Q8U A;  4M0V A;  4HTG A;  2EOF A;  1YYO A;  3ZOQ B;  1XNR E;  4DV7 E;  3JTZ A;  2EOZ A;  1N33 E;  4Q28 A;  1STU A;  2VE7 C;  2V89 A;  1GZ6 A;  2EPX A;  5AE3 A;  2YTI A;  2ZM6 E;  3J7A G;  3MHS C;  1LLM C;  2NUG A;  3EPL A;  2MKD A;  4O43 A;  2ENC A;  4N4R B;  1I94 E;  2GPI A;  4F9C B;  5KL7 A;  5LMN E;  2YTQ A;  1IQO A;  5T6J A;  4DR6 E;  2YTE A;  4JI1 E;  4B3S E;  3JU0 A;  4KHP E;  2LE2 A;  4BMJ A;  5A69 A;  3HQ1 A;  2R1F A;  1PJT A;  3C6K A;  1ZBT A;  2B9D A;  2CT1 A;  3VYX A;  4P7D A;  4DV4 E;  2RSI A;  4IS1 C;  1L4S A;  2L8T A;  4JI0 E;  3UK3 C;  4JYA E;  2MDG A;  4DR7 E;  4ZYG A;  2WBT A;  4WYQ B;  4TUI A;  2JWO A;  1X6E A;  2YZT A; 
#chains in the Genus database with same CATH homology
 4IJD A;  1P47 A;  2EOS A;  2DLK A;  2EM7 A;  5KL5 A;  2YSP A;  4R2S A;  2DMI A;  2EN6 A;  1KJK A;  2EMK A;  2YTN A;  2HGH A;  2EPZ A;  2M9A A;  2EMH A;  2A25 A;  2ELY A;  2CSH A;  2WBU A;  2EN1 A;  1DGC A;  2EMX A;  2WCC 3;  2J7J A;  2EPC A;  5KL4 A;  1A1K A;  2EJ4 A;  2EMI A;  5KL3 A;  4R2R A;  4M9V C;  1BB8 A;  4X9J A;  2EOJ A;  2EMC A;  1MEY C;  1Z1B A;  2YTP A;  2EMF A;  2EM8 A;  2YTF A;  2RPC A;  1A1F A;  2EM0 A;  2EE8 A;  2ADR A;  2DLQ A;  1BBO A;  2WBS A;  2EM9 A;  2GLI A;  2YRH A;  4R2D A;  2LVH A;  2LO3 A;  2ENA A;  4R2Q A;  1ZU1 A;  2EOI A;  2EPP A;  2YRM A;  2JPA A;  2VRD A;  2LV2 A;  4F6M A;  2EMW A;  1YUI A;  2EOE A;  1JK1 A;  2DGC A;  2BB8 A;  2EL6 A;  2JP9 A;  3EPH A;  1A1J A;  2EM5 A;  2EPA A;  2EOQ A;  2YU5 A;  2YTJ A;  1ZR9 A;  1JK2 A;  1X6H A;  2EMA A;  2YTG A;  2YU8 A;  2MKN A;  2EPR A;  5KL6 A;  1TN9 A;  2ELZ A;  1B69 A;  2DRP A;  2EPU A;  2EM4 A;  2EM6 A;  1A1H A;  1YUJ A;  2EL5 A;  1NCS A;  1A1L A;  2EOF A;  3EPK A;  5KL2 A;  1TF6 A;  2D9H A;  2EOZ A;  1YSA C;  2YSO A;  4R2A A;  1WJP A;  2EPX A;  2YRK A;  1TF3 A;  2YTI A;  1A1I A;  2EMB A;  1UN6 B;  3MHS C;  1LLM C;  2EMY A;  2EOX A;  2EQ1 A;  3EPL A;  4R2C A;  2MKD A;  1UBD C;  2EOR A;  2EP3 A;  2ENC A;  1ZAA C;  2PRT A;  4GZN C;  1G2F C;  4WSG A;  2EMZ A;  2YTO A;  1RMD A;  1X3C A;  5KL7 A;  1F2I G;  2EMG A;  2EML A;  2YTQ A;  2CTD A;  1G2D C;  2I13 A;  2YTE A;  1X5W A;  2EM2 A;  2E72 A;  4F6N A;  2EOM A;  3M99 B;  2EL4 A;  2EM3 A;  2EQ3 A;  2LCE A;  2R1F A;  2EOH A;  1AAY A;  3MHH C;  2CT1 A;  2YTD A;  4FK5 C;  2ENH A;  2RSI A;  4IS1 C;  3EPJ A;  2EN3 A;  1X6F A;  2LT7 A;  3UK3 C;  2EN4 A;  4R2P A;  2MDG A;  2EN8 A;  2EOY A;  2EN7 A;  2NAB A;  2WBT A;  4F2J C;  2EN2 A;  2EQ0 A;  4R2E A;  1X6E A;  2GHF A;  2EOO A;  1A1G A;  3VHT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...