2EOXA

Solution structure of the c2h2 type zinc finger (region 315-345) of human zinc finger protein 473
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
44
structure length
44
Chain Sequence
GSSGSSGTDSKSYNCNECGKAFTRIFHLTRHQKIHTRKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 315-345) of human Zinc finger protein 473
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 473
total genus 5
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eoxA01
1YSAC 2MKNA 2EM7A 1ZU1A 4R2EA 2EPUA 5KL5A 2YRKA 2EPPA 4F6MA 2RSIA 2YRHA 2YTQA 2EOHA 2LV2A 2EOQA 2LO3A 2EL5A 4X9JA 4WSGA 2EMIA 1A1KA 4R2RA 2YTNA 4IJDA 2HGHA 2EP3A 2EMLA 2EN7A 1DGCA 2ELYA 2YSPA 1G2DC 2RPCA 2EQ1A 2YU8A 2CSHA 3EPKA 2EJ4A 1A1GA 1F2IG 5KL2A 2EN2A 2VRDA 3EPJA 1X5WA 2EM6A 2EL6A 1X6HA 2EQ3A 1JK2A 1UBDC 2EE8A 2LT7A 1A1LA 2YTPA 2ADRA 2EM9A 5KL3A 2ENAA 5KL7A 2EM5A 2PRTA 2NABA 1KJKA 4FK5C 2EPAA 2EOOA 2LCEA 2WBTA 2GHFA 2ENCA 4R2PA 3MHHC 5KL4A 2EMKA 1ZR9A 2EN6A 2EPXA 2EOFA 2EM4A 2WCC3 2ELZA 2DRPA 1A1FA 2EOEA 4GZNC 2EMGA 3EPLA 2WBSA 2YTEA 2ENHA 2GLIA 2BB8A 1TF6A 2JPAA 4M9VC 2EN8A 2E72A 2EOSA 3MHSC 2YTDA 2EOYA 2EL4A 2EMBA 2MKDA 1X6FA 2YTOA 2EMFA 1X6EA 4F6NA 1B69A 2EM3A 1UN6B 2EOMA 1AAYA 2EPRA 2CT1A 2DLKA 1JK1A 2DMIA 2EN1A 2J7JA 1LLMC 2YSOA 1NCSA 2EM2A 1YUIA 1TN9A 2R1FA 1A1IA 1G2FC 1TF3A 1Z1BA 2EOZA 2EM8A 2YTFA 3M99B 2EOXA 2YTJA 4R2DA 2CTDA 4R2CA 4F2JC 2EOJA 3EPHA 1MEYC 4R2SA 3UK3C 1BBOA 2JP9A 1A1HA 4R2AA 2WBUA 2I13A 2M9AA 2DLQA 2EMXA 2EMHA 1WJPA 2EN3A 1ZAAC 2EMCA 2A25A 2EPZA 2YTIA 2EOIA 1P47A 2EMZA 2YRMA 5KL6A 1A1JA 2EMAA 2EMYA 3VHTB 1YUJA 2DGCA 1RMDA 2D9HA 2EN4A 2YU5A 2EPCA 2YTGA 2MDGA 2EM0A 2EORA 2LVHA 4IS1C 2EMWA 4R2QA 1X3CA 1BB8A 2EQ0A
chains in the Genus database with same CATH superfamily
2EPOA 4DR1E 1T4NA 3LLHA 2L6MA 1J26A 5IWAE 4WXDA 3J81C 4WSGA 1IMUA 5A6KA 4YY3E 4M2ZA 2EP3A 1DGCA 1YYWA 2ELYA 2DMYA 1G2DC 5AE3A 5A6AA 2EQ1A 2YU8A 2KHXA 2LUQA 4BC9A 2JWOA 2EJ4A 4X62E 1IBME 2LMZA 1X6HA 3C6MA 1WRJA 1T39A 2LUPB 1L4SA 2B7TA 1PJTA 3F6GA 3HPZA 5A6JA 5KL7A 1KJKA 4FK5C 4JI4E 4NZVA 1ZBQA 4LFCE 3JU0A 4R2PA 3MHHC 1XMQE 5AE1A 1ZR9A 3JAMC 2WCC3 2JY9A 2DRPA 2HHHE 2WBSA 1HNXE 2YTEA 2DSYA 2FV4B 2E72A 3ECRA 4WYQB 2YTDA 2UXDE 2EZ6A 2EMBA 4JI8E 1SR9A 5AC5A 2YZTA 1AAYA 2EPRA 2CT1A 1JK1A 1YYOA 2L33A 4MLVA 2UXCE 4DR7E 2EN1A 2J7JA 2H36X 5CFFE 1LLMC 2BBGA 4WX9A 3DF6A 1G2FC 2B9DA 2EOXA 2GPIA 2DIXA 3LMLA 4BCAA 1IQOA 5IT9C 3EPHA 1ZBTA 4DUZE 4O5GA 4R2AA 5A2QC 2M9AA 3EQ1A 4DV6E 2UUBE 1WJPA 2JYAA 4DV3E 1ZAAC 2ODRD 2YRMA 1SFEA 5AC4A 1A1JA 1WHNA 3P1XA 1N33E 4BHBA 2EMAA 1YUJA 2D9HA 3KZYA 4X66E 2WZOA 2EMWA 3BF2A 1X3CA 2GLIA 1BB8A 2RTXA 4Q35B 4DV2E 1QU6A 1ZU1A 3BGHA 4R2EA 1N3GA 5LLQA 1IQSA 2DB2A 2RSIA 2LV2A 2LO3A 4LF6E 4X9JA 3HPSA 1A1KA 1EH6A 2V89A 1DQ3A 4IJDA 1RQ0A 1T4LB 2YSPA 5AASA 4NXME 4P78A 2M7QA 2CSHA 2KONA 3AV0A 4N4RB 4M30A 4LF4E 2G7HA 2E1MA 2EM6A 4DV5E 2EE8A 1A1LA 4AQYE 1N32E 5KL3A 4DUYE 4B3TE 2ENAA 1BBGA 4JI3E 3HXLA 3IWBA 2EPAA 2EOOA 2GHFA 2YT4A 2VQFE 4JI0E 3DJWA 5KL4A 4KHPE 2L2MA 4JV5E 2ELZA 2UXBE 2EOEA 4GZNC 4B3RE 3EPLA 1QNTA 4GEQB 3ADIA 2ENHA 1YFHA 3MHSC 5A6BD 4ZYEA 2EL4A 4BC7A 2E5LE 1B69A 4DR6E 2EOMA 4X8WA 3H09A 4WPYA 1N34E 4LFBE 2L92A 1NCSA 1YUIA 2VF1A 3JTZA 1Z1BA 4NHRA 2EM8A 3M99B 2F4VE 1J5EE 4R2CA 4ZYDA 4F2JC 2N3HA 1YYKA 2JP9A 1FKAE 2V88A 1X49A 4R03A 2LTRA 4BHCA 2LBSB 1STUA 2EMHA 1WXRA 4GKKE 4DR5E 2YTIA 2K4VA 3C4BA 4WFTA 4JI5E 2JXPA 5LL6R 5KL6A 2EMYA 1PJSA 3VHTB 3K6QA 2YTGA 4X64E 3BBGA 4DMIA 2MC5A 4B3ME 4L5NC 5IXMB 2HJJA 4R2QA 2EQ0A 1O0WA 2MKNA 1EKZA 1UHZA 1HNZE 3VYXA 1XNQE 1UILA 2K7IA 4LU9A 2YRHA 3IWCA 2EOHA 2EL5A 3AUZA 1GQEA 4M0VA 2LJUA 2EPMX 5BR8E 2HGHA 2EMLA 4ZYGA 2L2KB 2Q8UA 4DKKA 3MSWA 3OTOE 2EL6A 2EQ3A 4TUGA 4KZSA 2LT7A 2KOUA 2L2NA 2YTPA 2EM5A 4WXCA 2NABA 1N36E 2MDRA 2FGGA 2MC6A 4O24A 2EPXA 4WSPA 2EOFA 2CPNA 4X65E 2HC5A 1HNWE 2V83A 2JVAA 1T4OA 1EH7A 2JPAA 4JI1E 2BB8A 1TF6A 4BBYA 2EN8A 1PJQA 4DV1E 2VE7C 2EPNA 4I8OA 1GTKA 3ADGA 2YTOA 2N3GA 2EM3A 1FJGE 2DLKA 1I94E 1NEIA 1YPNA 3L00A 3TQMA 2I9IA 5IV8B 1X47A 2YSOA 3HQ1A 2R1FA 2YPNA 1WHQA 1TF3A 2IHR1 2EOZA 2YTFA 5F3WA 4BMJA 4R2DA 2CTDA 4P7DA 2UUAE 4F54A 1GZ6A 1MEYC 4R2SA 3UK3C 1BBOA 2M4IA 4HTGA 2L8TA 4DR2E 2M1SA 1A1HA 2WBUA 2NUEA 2I13A 1XMOE 3C4TA 2DLQA 4DR4E 2RS6A 2EMCA 1P47A 2EOIA 3QG5C 2EMZA 2JOXA 3J80C 4ZYHA 3F6HA 1KYQA 4LTYA 4DV4E 1HR0E 1RMDA 2EN4A 4L8NA 4BS9A 3KWRA 4O4KA 4JI7E 2MDGA 2EM0A 2L3JA 2EORA 4HEIA 3J7AG 4IS1C 5T6JA 5LMNE 2JOBA 4TUIA 1YSAC 5ADZA 2EM7A 4LF5E 2EPUA 5KL5A 2YRKA 2EPPA 3ADJA 4NXNE 4F6MA 4OX9E 2YTQA 2EOQA 2ODRC 3OMLA 5LMUE 5AE2A 2YWQA 2EMIA 5TSEA 4R2RA 4Q28A 2YTNA 1DI2A 2EN7A 2UUCE 1AH5A 5A6BA 2RPCA 3EPKA 1A1GA 2LTSA 2RQLA 1F2IG 4GKJE 5KL2A 2EN2A 2VRDA 3EPJA 1X5WA 1EH8A 1UBDC 1JK2A 2FTXB 2NUFA 4JI2E 2ADRA 2EM9A 4JYAE 2PRTA 1PDAA 4KWYA 4YHHE 2LCEA 4F9BB 1YZ9A 2NUGA 2WBTA 3IWDA 3HTXA 1T38A 2ENCA 1X48A 4LF8E 2EMKA 2EN6A 2EM4A 3THOB 1A1FA 2EMGA 4JI6E 2NA2A 4B3SE 2N8XA 5FLXC 4RH8A 2ZM6E 3VYYA 4K0KE 4M9VC 1RC7A 2EOSA 2EOYA 2EPLX 2MKDA 2V8QB 1X6FA 5A69A 2RSMA 2EMFA 1X6EA 4F6NA 1UN6B 3ZOQB 4O43A 3C6KA 2DMIA 1IBLE 4OOGC 1XNRE 2EM2A 1TN9A 4RHBB 1A1IA 1PKPA 2V86A 2B3TB 2YTJA 5DNYA 3BIDA 2EWLA 2EOJA 2R76A 3ADLA 2V85A 2UU9E 4DR3E 3J7Yp 4DV0E 2L3CA 3KZZA 2EMXA 2EPKX 2EN3A 3FIGA 4LFAE 2A25A 2EPZA 1MGTA 2JR1A 4LF7E 4R8OA 2LJHA 3THNA 3T1HE 4LF9E 2RS7A 2VQEE 2B7VA 2LE2A 2LRSA 2DGCA 2YU5A 4F9AB 2EPCA 3VK6A 2V87A 4MLQA 4F9CB 2LVHA 3T1YE 1IBKE 4DV7E 4J8ZA 2F8BA 3RMPA
chains in the Genus database with same CATH topology
1YSAC 2MKNA 2EM7A 1ZU1A 4R2EA 2EPUA 5KL5A 2YRKA 2EPPA 4F6MA 2RSIA 2YRHA 2YTQA 2EOHA 2LV2A 2EOQA 2LO3A 2EL5A 4X9JA 4WSGA 2EMIA 1A1KA 4R2RA 2YTNA 4IJDA 2HGHA 2EP3A 2EMLA 2EN7A 1DGCA 2ELYA 2YSPA 1G2DC 2RPCA 2EQ1A 2YU8A 2CSHA 3EPKA 2EJ4A 1A1GA 1F2IG 5KL2A 2EN2A 2VRDA 3EPJA 1X5WA 2EM6A 2EL6A 1X6HA 2EQ3A 1JK2A 1UBDC 2EE8A 2LT7A 1A1LA 2YTPA 2ADRA 2EM9A 5KL3A 2ENAA 5KL7A 2EM5A 2PRTA 2NABA 1KJKA 4FK5C 2EPAA 2EOOA 2LCEA 2WBTA 2GHFA 2ENCA 4R2PA 3MHHC 5KL4A 2EMKA 1ZR9A 2EN6A 2EPXA 2EOFA 2EM4A 2WCC3 2ELZA 2DRPA 1A1FA 2EOEA 4GZNC 2EMGA 3EPLA 2WBSA 2YTEA 2ENHA 2GLIA 2BB8A 1TF6A 2JPAA 4M9VC 2EN8A 2E72A 2EOSA 3MHSC 2YTDA 2EOYA 2EL4A 2EMBA 2MKDA 1X6FA 2YTOA 2EMFA 1X6EA 4F6NA 1B69A 2EM3A 1UN6B 2EOMA 1AAYA 2EPRA 2CT1A 2DLKA 1JK1A 2DMIA 2EN1A 2J7JA 1LLMC 2YSOA 1NCSA 2EM2A 1YUIA 1TN9A 2R1FA 1A1IA 1G2FC 1TF3A 1Z1BA 2EOZA 2EM8A 2YTFA 3M99B 2EOXA 2YTJA 4R2DA 2CTDA 4R2CA 4F2JC 2EOJA 3EPHA 1MEYC 4R2SA 3UK3C 1BBOA 2JP9A 1A1HA 4R2AA 2WBUA 2I13A 2M9AA 2DLQA 2EMXA 2EMHA 1WJPA 2EN3A 1ZAAC 2EMCA 2A25A 2EPZA 2YTIA 2EOIA 1P47A 2EMZA 2YRMA 5KL6A 1A1JA 2EMAA 2EMYA 3VHTB 1YUJA 2DGCA 1RMDA 2D9HA 2EN4A 2YU5A 2EPCA 2YTGA 2MDGA 2EM0A 2EORA 2LVHA 4IS1C 2EMWA 4R2QA 1X3CA 1BB8A 2EQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YSA C;  2MKN A;  2EM7 A;  1ZU1 A;  4R2E A;  2EPU A;  5KL5 A;  2YRK A;  2EPP A;  4F6M A;  2RSI A;  2YRH A;  2YTQ A;  2EOH A;  2LV2 A;  2EOQ A;  2LO3 A;  2EL5 A;  4X9J A;  4WSG A;  2EMI A;  1A1K A;  4R2R A;  2YTN A;  4IJD A;  2HGH A;  2EP3 A;  2EML A;  2EN7 A;  1DGC A;  2ELY A;  2YSP A;  1G2D C;  2RPC A;  2EQ1 A;  2YU8 A;  2CSH A;  3EPK A;  2EJ4 A;  1A1G A;  1F2I G;  5KL2 A;  2EN2 A;  2VRD A;  3EPJ A;  1X5W A;  2EM6 A;  2EL6 A;  1X6H A;  2EQ3 A;  1JK2 A;  1UBD C;  2EE8 A;  2LT7 A;  1A1L A;  2YTP A;  2ADR A;  2EM9 A;  5KL3 A;  2ENA A;  5KL7 A;  2EM5 A;  2PRT A;  2NAB A;  1KJK A;  4FK5 C;  2EPA A;  2EOO A;  2LCE A;  2WBT A;  2GHF A;  2ENC A;  4R2P A;  3MHH C;  5KL4 A;  2EMK A;  1ZR9 A;  2EN6 A;  2EPX A;  2EOF A;  2EM4 A;  2WCC 3;  2ELZ A;  2DRP A;  1A1F A;  2EOE A;  4GZN C;  2EMG A;  3EPL A;  2WBS A;  2YTE A;  2ENH A;  2GLI A;  2BB8 A;  1TF6 A;  2JPA A;  4M9V C;  2EN8 A;  2E72 A;  2EOS A;  3MHS C;  2YTD A;  2EOY A;  2EL4 A;  2EMB A;  2MKD A;  1X6F A;  2YTO A;  2EMF A;  1X6E A;  4F6N A;  1B69 A;  2EM3 A;  1UN6 B;  2EOM A;  1AAY A;  2EPR A;  2CT1 A;  2DLK A;  1JK1 A;  2DMI A;  2EN1 A;  2J7J A;  1LLM C;  2YSO A;  1NCS A;  2EM2 A;  1YUI A;  1TN9 A;  2R1F A;  1A1I A;  1G2F C;  1TF3 A;  1Z1B A;  2EOZ A;  2EM8 A;  2YTF A;  3M99 B;  2EOX A;  2YTJ A;  4R2D A;  2CTD A;  4R2C A;  4F2J C;  2EOJ A;  3EPH A;  1MEY C;  4R2S A;  3UK3 C;  1BBO A;  2JP9 A;  1A1H A;  4R2A A;  2WBU A;  2I13 A;  2M9A A;  2DLQ A;  2EMX A;  2EMH A;  1WJP A;  2EN3 A;  1ZAA C;  2EMC A;  2A25 A;  2EPZ A;  2YTI A;  2EOI A;  1P47 A;  2EMZ A;  2YRM A;  5KL6 A;  1A1J A;  2EMA A;  2EMY A;  3VHT B;  1YUJ A;  2DGC A;  1RMD A;  2D9H A;  2EN4 A;  2YU5 A;  2EPC A;  2YTG A;  2MDG A;  2EM0 A;  2EOR A;  2LVH A;  4IS1 C;  2EMW A;  4R2Q A;  1X3C A;  1BB8 A;  2EQ0 A; 
#chains in the Genus database with same CATH topology
 2EPO A;  4DR1 E;  1T4N A;  3LLH A;  2L6M A;  1J26 A;  5IWA E;  4WXD A;  3J81 C;  4WSG A;  1IMU A;  5A6K A;  4YY3 E;  4M2Z A;  2EP3 A;  1DGC A;  1YYW A;  2ELY A;  2DMY A;  1G2D C;  5AE3 A;  5A6A A;  2EQ1 A;  2YU8 A;  2KHX A;  2LUQ A;  4BC9 A;  2JWO A;  2EJ4 A;  4X62 E;  1IBM E;  2LMZ A;  1X6H A;  3C6M A;  1WRJ A;  1T39 A;  2LUP B;  1L4S A;  2B7T A;  1PJT A;  3F6G A;  3HPZ A;  5A6J A;  5KL7 A;  1KJK A;  4FK5 C;  4JI4 E;  4NZV A;  1ZBQ A;  4LFC E;  3JU0 A;  4R2P A;  3MHH C;  1XMQ E;  5AE1 A;  1ZR9 A;  3JAM C;  2WCC 3;  2JY9 A;  2DRP A;  2HHH E;  2WBS A;  1HNX E;  2YTE A;  2DSY A;  2FV4 B;  2E72 A;  3ECR A;  4WYQ B;  2YTD A;  2UXD E;  2EZ6 A;  2EMB A;  4JI8 E;  1SR9 A;  5AC5 A;  2YZT A;  1AAY A;  2EPR A;  2CT1 A;  1JK1 A;  1YYO A;  2L33 A;  4MLV A;  2UXC E;  4DR7 E;  2EN1 A;  2J7J A;  2H36 X;  5CFF E;  1LLM C;  2BBG A;  4WX9 A;  3DF6 A;  1G2F C;  2B9D A;  2EOX A;  2GPI A;  2DIX A;  3LML A;  4BCA A;  1IQO A;  5IT9 C;  3EPH A;  1ZBT A;  4DUZ E;  4O5G A;  4R2A A;  5A2Q C;  2M9A A;  3EQ1 A;  4DV6 E;  2UUB E;  1WJP A;  2JYA A;  4DV3 E;  1ZAA C;  2ODR D;  2YRM A;  1SFE A;  5AC4 A;  1A1J A;  1WHN A;  3P1X A;  1N33 E;  4BHB A;  2EMA A;  1YUJ A;  2D9H A;  3KZY A;  4X66 E;  2WZO A;  2EMW A;  3BF2 A;  1X3C A;  2GLI A;  1BB8 A;  2RTX A;  4Q35 B;  4DV2 E;  1QU6 A;  1ZU1 A;  3BGH A;  4R2E A;  1N3G A;  5LLQ A;  1IQS A;  2DB2 A;  2RSI A;  2LV2 A;  2LO3 A;  4LF6 E;  4X9J A;  3HPS A;  1A1K A;  1EH6 A;  2V89 A;  1DQ3 A;  4IJD A;  1RQ0 A;  1T4L B;  2YSP A;  5AAS A;  4NXM E;  4P78 A;  2M7Q A;  2CSH A;  2KON A;  3AV0 A;  4N4R B;  4M30 A;  4LF4 E;  2G7H A;  2E1M A;  2EM6 A;  4DV5 E;  2EE8 A;  1A1L A;  4AQY E;  1N32 E;  5KL3 A;  4DUY E;  4B3T E;  2ENA A;  1BBG A;  4JI3 E;  3HXL A;  3IWB A;  2EPA A;  2EOO A;  2GHF A;  2YT4 A;  2VQF E;  4JI0 E;  3DJW A;  5KL4 A;  4KHP E;  2L2M A;  4JV5 E;  2ELZ A;  2UXB E;  2EOE A;  4GZN C;  4B3R E;  3EPL A;  1QNT A;  4GEQ B;  3ADI A;  2ENH A;  1YFH A;  3MHS C;  5A6B D;  4ZYE A;  2EL4 A;  4BC7 A;  2E5L E;  1B69 A;  4DR6 E;  2EOM A;  4X8W A;  3H09 A;  4WPY A;  1N34 E;  4LFB E;  2L92 A;  1NCS A;  1YUI A;  2VF1 A;  3JTZ A;  1Z1B A;  4NHR A;  2EM8 A;  3M99 B;  2F4V E;  1J5E E;  4R2C A;  4ZYD A;  4F2J C;  2N3H A;  1YYK A;  2JP9 A;  1FKA E;  2V88 A;  1X49 A;  4R03 A;  2LTR A;  4BHC A;  2LBS B;  1STU A;  2EMH A;  1WXR A;  4GKK E;  4DR5 E;  2YTI A;  2K4V A;  3C4B A;  4WFT A;  4JI5 E;  2JXP A;  5LL6 R;  5KL6 A;  2EMY A;  1PJS A;  3VHT B;  3K6Q A;  2YTG A;  4X64 E;  3BBG A;  4DMI A;  2MC5 A;  4B3M E;  4L5N C;  5IXM B;  2HJJ A;  4R2Q A;  2EQ0 A;  1O0W A;  2MKN A;  1EKZ A;  1UHZ A;  1HNZ E;  3VYX A;  1XNQ E;  1UIL A;  2K7I A;  4LU9 A;  2YRH A;  3IWC A;  2EOH A;  2EL5 A;  3AUZ A;  1GQE A;  4M0V A;  2LJU A;  2EPM X;  5BR8 E;  2HGH A;  2EML A;  4ZYG A;  2L2K B;  2Q8U A;  4DKK A;  3MSW A;  3OTO E;  2EL6 A;  2EQ3 A;  4TUG A;  4KZS A;  2LT7 A;  2KOU A;  2L2N A;  2YTP A;  2EM5 A;  4WXC A;  2NAB A;  1N36 E;  2MDR A;  2FGG A;  2MC6 A;  4O24 A;  2EPX A;  4WSP A;  2EOF A;  2CPN A;  4X65 E;  2HC5 A;  1HNW E;  2V83 A;  2JVA A;  1T4O A;  1EH7 A;  2JPA A;  4JI1 E;  2BB8 A;  1TF6 A;  4BBY A;  2EN8 A;  1PJQ A;  4DV1 E;  2VE7 C;  2EPN A;  4I8O A;  1GTK A;  3ADG A;  2YTO A;  2N3G A;  2EM3 A;  1FJG E;  2DLK A;  1I94 E;  1NEI A;  1YPN A;  3L00 A;  3TQM A;  2I9I A;  5IV8 B;  1X47 A;  2YSO A;  3HQ1 A;  2R1F A;  2YPN A;  1WHQ A;  1TF3 A;  2IHR 1;  2EOZ A;  2YTF A;  5F3W A;  4BMJ A;  4R2D A;  2CTD A;  4P7D A;  2UUA E;  4F54 A;  1GZ6 A;  1MEY C;  4R2S A;  3UK3 C;  1BBO A;  2M4I A;  4HTG A;  2L8T A;  4DR2 E;  2M1S A;  1A1H A;  2WBU A;  2NUE A;  2I13 A;  1XMO E;  3C4T A;  2DLQ A;  4DR4 E;  2RS6 A;  2EMC A;  1P47 A;  2EOI A;  3QG5 C;  2EMZ A;  2JOX A;  3J80 C;  4ZYH A;  3F6H A;  1KYQ A;  4LTY A;  4DV4 E;  1HR0 E;  1RMD A;  2EN4 A;  4L8N A;  4BS9 A;  3KWR A;  4O4K A;  4JI7 E;  2MDG A;  2EM0 A;  2L3J A;  2EOR A;  4HEI A;  3J7A G;  4IS1 C;  5T6J A;  5LMN E;  2JOB A;  4TUI A;  1YSA C;  5ADZ A;  2EM7 A;  4LF5 E;  2EPU A;  5KL5 A;  2YRK A;  2EPP A;  3ADJ A;  4NXN E;  4F6M A;  4OX9 E;  2YTQ A;  2EOQ A;  2ODR C;  3OML A;  5LMU E;  5AE2 A;  2YWQ A;  2EMI A;  5TSE A;  4R2R A;  4Q28 A;  2YTN A;  1DI2 A;  2EN7 A;  2UUC E;  1AH5 A;  5A6B A;  2RPC A;  3EPK A;  1A1G A;  2LTS A;  2RQL A;  1F2I G;  4GKJ E;  5KL2 A;  2EN2 A;  2VRD A;  3EPJ A;  1X5W A;  1EH8 A;  1UBD C;  1JK2 A;  2FTX B;  2NUF A;  4JI2 E;  2ADR A;  2EM9 A;  4JYA E;  2PRT A;  1PDA A;  4KWY A;  4YHH E;  2LCE A;  4F9B B;  1YZ9 A;  2NUG A;  2WBT A;  3IWD A;  3HTX A;  1T38 A;  2ENC A;  1X48 A;  4LF8 E;  2EMK A;  2EN6 A;  2EM4 A;  3THO B;  1A1F A;  2EMG A;  4JI6 E;  2NA2 A;  4B3S E;  2N8X A;  5FLX C;  4RH8 A;  2ZM6 E;  3VYY A;  4K0K E;  4M9V C;  1RC7 A;  2EOS A;  2EOY A;  2EPL X;  2MKD A;  2V8Q B;  1X6F A;  5A69 A;  2RSM A;  2EMF A;  1X6E A;  4F6N A;  1UN6 B;  3ZOQ B;  4O43 A;  3C6K A;  2DMI A;  1IBL E;  4OOG C;  1XNR E;  2EM2 A;  1TN9 A;  4RHB B;  1A1I A;  1PKP A;  2V86 A;  2B3T B;  2YTJ A;  5DNY A;  3BID A;  2EWL A;  2EOJ A;  2R76 A;  3ADL A;  2V85 A;  2UU9 E;  4DR3 E;  3J7Y p;  4DV0 E;  2L3C A;  3KZZ A;  2EMX A;  2EPK X;  2EN3 A;  3FIG A;  4LFA E;  2A25 A;  2EPZ A;  1MGT A;  2JR1 A;  4LF7 E;  4R8O A;  2LJH A;  3THN A;  3T1H E;  4LF9 E;  2RS7 A;  2VQE E;  2B7V A;  2LE2 A;  2LRS A;  2DGC A;  2YU5 A;  4F9A B;  2EPC A;  3VK6 A;  2V87 A;  4MLQ A;  4F9C B;  2LVH A;  3T1Y E;  1IBK E;  4DV7 E;  4J8Z A;  2F8B A;  3RMP A; 
#chains in the Genus database with same CATH homology
 1YSA C;  2MKN A;  2EM7 A;  1ZU1 A;  4R2E A;  2EPU A;  5KL5 A;  2YRK A;  2EPP A;  4F6M A;  2RSI A;  2YRH A;  2YTQ A;  2EOH A;  2LV2 A;  2EOQ A;  2LO3 A;  2EL5 A;  4X9J A;  4WSG A;  2EMI A;  1A1K A;  4R2R A;  2YTN A;  4IJD A;  2HGH A;  2EP3 A;  2EML A;  2EN7 A;  1DGC A;  2ELY A;  2YSP A;  1G2D C;  2RPC A;  2EQ1 A;  2YU8 A;  2CSH A;  3EPK A;  2EJ4 A;  1A1G A;  1F2I G;  5KL2 A;  2EN2 A;  2VRD A;  3EPJ A;  1X5W A;  2EM6 A;  2EL6 A;  1X6H A;  2EQ3 A;  1JK2 A;  1UBD C;  2EE8 A;  2LT7 A;  1A1L A;  2YTP A;  2ADR A;  2EM9 A;  5KL3 A;  2ENA A;  5KL7 A;  2EM5 A;  2PRT A;  2NAB A;  1KJK A;  4FK5 C;  2EPA A;  2EOO A;  2LCE A;  2WBT A;  2GHF A;  2ENC A;  4R2P A;  3MHH C;  5KL4 A;  2EMK A;  1ZR9 A;  2EN6 A;  2EPX A;  2EOF A;  2EM4 A;  2WCC 3;  2ELZ A;  2DRP A;  1A1F A;  2EOE A;  4GZN C;  2EMG A;  3EPL A;  2WBS A;  2YTE A;  2ENH A;  2GLI A;  2BB8 A;  1TF6 A;  2JPA A;  4M9V C;  2EN8 A;  2E72 A;  2EOS A;  3MHS C;  2YTD A;  2EOY A;  2EL4 A;  2EMB A;  2MKD A;  1X6F A;  2YTO A;  2EMF A;  1X6E A;  4F6N A;  1B69 A;  2EM3 A;  1UN6 B;  2EOM A;  1AAY A;  2EPR A;  2CT1 A;  2DLK A;  1JK1 A;  2DMI A;  2EN1 A;  2J7J A;  1LLM C;  2YSO A;  1NCS A;  2EM2 A;  1YUI A;  1TN9 A;  2R1F A;  1A1I A;  1G2F C;  1TF3 A;  1Z1B A;  2EOZ A;  2EM8 A;  2YTF A;  3M99 B;  2EOX A;  2YTJ A;  4R2D A;  2CTD A;  4R2C A;  4F2J C;  2EOJ A;  3EPH A;  1MEY C;  4R2S A;  3UK3 C;  1BBO A;  2JP9 A;  1A1H A;  4R2A A;  2WBU A;  2I13 A;  2M9A A;  2DLQ A;  2EMX A;  2EMH A;  1WJP A;  2EN3 A;  1ZAA C;  2EMC A;  2A25 A;  2EPZ A;  2YTI A;  2EOI A;  1P47 A;  2EMZ A;  2YRM A;  5KL6 A;  1A1J A;  2EMA A;  2EMY A;  3VHT B;  1YUJ A;  2DGC A;  1RMD A;  2D9H A;  2EN4 A;  2YU5 A;  2EPC A;  2YTG A;  2MDG A;  2EM0 A;  2EOR A;  2LVH A;  4IS1 C;  2EMW A;  4R2Q A;  1X3C A;  1BB8 A;  2EQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...