2EOXA

Solution structure of the c2h2 type zinc finger (region 315-345) of human zinc finger protein 473
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
44
structure length
44
Chain Sequence
GSSGSSGTDSKSYNCNECGKAFTRIFHLTRHQKIHTRKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 473
publication title Solution structure of the C2H2 type zinc finger (region 315-345) of human Zinc finger protein 473
rcsb
source organism Homo sapiens
total genus 5
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eoxA01
1ZU1A 2CSHA 5KL3A 1G2FC 2EN1A 2EPXA 2YU5A 1TN9A 2CTDA 4R2RA 2YSOA 2YTQA 1A1JA 2YTIA 1F2IG 1X6EA 2MDGA 1YSAC 2JPAA 2EM0A 4FK5C 2HGHA 2ADRA 2EMGA 2EPCA 2PRTA 3UK3C 2YRMA 2GLIA 2DMIA 2EMHA 2I13A 4IJDA 2EOQA 2A25A 1X5WA 3VHTB 3EPKA 4R2SA 4R2QA 2EMCA 1MEYC 2LVHA 2BB8A 4F6NA 2EMYA 2EOEA 1YUIA 2EL6A 2YRHA 2YRKA 2DGCA 2EOYA 1ZAAC 1JK1A 2EORA 2EL5A 2DLKA 2R1FA 2WBUA 2RSIA 2VRDA 5KL2A 4GZNC 2YTPA 2EPZA 2YU8A 1G2DC 1UN6B 2EQ3A 2YTNA 1JK2A 2ENHA 2EPAA 3EPHA 1BB8A 5KL4A 1BBOA 2EM8A 2EMAA 2EL4A 2LT7A 5KL5A 2YTOA 4R2AA 2EOMA 2EOHA 2EQ0A 1X3CA 2EP3A 2NABA 4WSGA 2EMIA 2ELZA 3M99B 2EMXA 5KL6A 2EE8A 1A1KA 1YUJA 2EPRA 2EN7A 2EN3A 4F2JC 2YTJA 2EQ1A 1WJPA 1UBDC 2EJ4A 3EPLA 2ELYA 2EMZA 1TF6A 2YTDA 2EN4A 2GHFA 2EMFA 2MKNA 2EM7A 1KJKA 2M9AA 2D9HA 2CT1A 2YSPA 2EM2A 2EOIA 3MHHC 4R2EA 2WBSA 2J7JA 4IS1C 1NCSA 2EM9A 2EMWA 2ENAA 2EM5A 4R2CA 1AAYA 1A1IA 1LLMC 2ENCA 2EMBA 1RMDA 2EOXA 1X6HA 2EN8A 2EOZA 2EM4A 2EOFA 2LV2A 2EN6A 1A1GA 1DGCA 1TF3A 4R2PA 1A1LA 2DLQA 2DRPA 2JP9A 2YTEA 2MKDA 2EOSA 2EM6A 2EMLA 2EMKA 2EN2A 1A1FA 2EPPA 3MHSC 1A1HA 2LO3A 2E72A 2YTFA 1ZR9A 2EPUA 2YTGA 2EOOA 2RPCA 1P47A 5KL7A 4X9JA 1B69A 4F6MA 2WCC3 2LCEA 4R2DA 1Z1BA 3EPJA 2EOJA 2EM3A 4M9VC 1X6FA 2WBTA
chains in the Genus database with same CATH superfamily
1DQ3A 2CSHA 2NUFA 2EN1A 2JY9A 1SFEA 2YT4A 1AH5A 4ZYDA 2EPMX 2YSOA 2YTQA 1EH7A 3THOB 2HGHA 4BS9A 1ZBQA 4LF5E 2EOQA 1X5WA 1X48A 2FGGA 5A2QC 2L2KB 1MEYC 2LVHA 1STUA 2EOEA 2EPLX 2YRHA 2EWLA 2LTSA 2H36X 1IQSA 4X66E 2DLKA 4JI2E 2EPKX 2BBGA 5A6JA 5BR8E 2VRDA 4LTYA 1T4OA 5KL2A 3HQ1A 2LJHA 4GZNC 4BHCA 3T1HE 2M4IA 1G2DC 1JK2A 4KWYA 2EPAA 2VF1A 2VQFE 5KL4A 2EMAA 5T6JA 3J7AG 1WHQA 2YTOA 2JXPA 2JOXA 4R2AA 2NUEA 2WZOA 2EOMA 3ZOQB 4JI1E 4MLQA 2NABA 5AASA 5KL6A 4L5NC 4JV5E 4O24A 1J5EE 4WXDA 1O0WA 1TF6A 1FKAE 4DUZE 2MKNA 2CT1A 2YSPA 2EM2A 1QNTA 2G7HA 4GEQB 3C4TA 4R2EA 2EM9A 4R03A 2EM5A 2M7QA 1LLMC 3C6MA 3ADIA 2V89A 3J7Yp 2EOFA 2LV2A 4F9AB 1TF3A 1WXRA 4R2PA 5IT9C 4JI5E 4X65E 1IBME 2LMZA 2I9IA 2ZM6E 5AE3A 2UUAE 2L3JA 4DV0E 4Q35B 2EOSA 3P1XA 2EMLA 2EMKA 2EN2A 3KWRA 3VYYA 2EPPA 4DV5E 3MHSC 2ODRC 3ADLA 2KONA 2RPCA 4X9JA 4O4KA 2FV4B 1PJSA 2WCC3 4DV6E 2EOJA 1A1JA 1XNQE 4ZYHA 3KZYA 4DUYE 2JYAA 2HJJA 1TN9A 4JI8E 2CTDA 4ZYEA 4R2RA 1T4LB 1XNRE 5LMNE 1F2IG 2MDGA 4DR2E 4B3TE 2EPCA 3L00A 2PRTA 2YRMA 4NXME 2RS7A 3THNA 2E5LE 3ADJA 2R76A 2N8XA 2A25A 1WHNA 4LF4E 2EZ6A 4X62E 4R2QA 2KHXA 2LTRA 2EMYA 2UUCE 2V87A 1MGTA 5A6BD 4DV4E 2B7TA 4BC9A 1T38A 2L92A 4LF8E 2R1FA 2RSIA 4GKKE 2DMYA 3OTOE 2EPZA 3HPSA 2YU8A 2FTXB 3BF2A 3BBGA 4LF6E 1BB8A 1UHZA 4HTGA 2EM8A 2LT7A 2MDRA 1DI2A 4LU9A 5KL5A 3BIDA 4WX9A 2EOHA 1X3CA 3F6HA 4WSGA 4WXCA 1YYKA 3ADGA 3M99B 1A1KA 2EE8A 1YUJA 1IBLE 1YYOA 4DV7E 4F2JC 2EQ1A 1EH6A 2EJ4A 3EPLA 3JAMC 2JOBA 3KZZA 1YPNA 2EN4A 1NCSA 2EMWA 2CPNA 3VYXA 2EMBA 1RMDA 2EOXA 3AUZA 1A1GA 1DGCA 2EN6A 2B9DA 5F3WA 4YHHE 4YY3E 2YTEA 3FIGA 4KHPE 1HR0E 2EPNA 1IMUA 1GTKA 1A1FA 1EKZA 4M30A 1A1HA 2LO3A 4O43A 2EPUA 1RC7A 2EOOA 1X49A 5KL7A 3LLHA 5TSEA 3T1YE 1X6FA 1ZU1A 4DKKA 5A6AA 2LUPB 2EPXA 4JI0E 2YU5A 1ZBTA 4DR5E 4O5GA 3C6KA 1N32E 4NZVA 3QG5C 2YTIA 2VQEE 4BHBA 2L3CA 1YSAC 2EM0A 1L4SA 2V8QB 2UU9E 2YZTA 2I13A 2LRSA 4IJDA 4JYAE 5CFFE 1XMQE 1WRJA 4AQYE 3EPKA 2YPNA 1EH8A 2EMCA 2IHR1 4F6NA 5AC5A 5IWAE 4JI7E 2N3GA 2YRKA 2EOYA 4DV3E 5LLQA 1HNZE 4DR3E 1ZAAC 1YZ9A 2JVAA 3IWCA 2EL5A 2WBUA 4B3RE 4NHRA 4NXNE 2YTPA 1N34E 4BMJA 2F4VE 1GZ6A 4DMIA 4L8NA 2EQ3A 2B7VA 3EPHA 3HTXA 2K7IA 2UXBE 2LBSB 4M0VA 1IQOA 1GQEA 2EQ0A 3J80C 3IWDA 5AC4A 4J8ZA 2EMIA 4ZYGA 4LF9E 2EMXA 2EN7A 5ADZA 3HXLA 5IV8B 4I8OA 1N36E 2ELYA 2V88A 2L2MA 3ECRA 2M9AA 2D9HA 2GLIA 2EOIA 4IS1C 2ENAA 4R2CA 4WSPA 1A1IA 2UXCE 2ENCA 1HNWE 1KYQA 2EN8A 3MSWA 2EOZA 2EM4A 4WYQB 4Q28A 1A1LA 4BC7A 2JWOA 4HEIA 2LJUA 2DRPA 2JP9A 2MKDA 2EM6A 2VE7C 4JI6E 1PDAA 4RHBB 5A69A 4P78A 2YTFA 4WFTA 2L2NA 3F6GA 2E1MA 2YWQA 1SR9A 1UILA 5A6KA 1P47A 4M2ZA 1B69A 1T4NA 3HPZA 4R2DA 1Z1BA 3EPJA 2EPOA 4DR6E 2EM3A 5KL3A 1G2FC 2N3HA 4LFBE 3K6QA 2M1SA 4TUIA 3IWBA 5LMUE 2LUQA 5AE2A 2LE2A 4BBYA 1X6EA 2RQLA 2JPAA 4B3ME 2JR1A 4FK5C 2ADRA 2EMGA 3UK3C 4GKJE 2DMIA 1XMOE 2NA2A 4K0KE 2EMHA 5DNYA 4WPYA 4MLVA 2DSYA 1YYWA 3VHTB 1HNXE 4R2SA 2BB8A 3JTZA 1YUIA 1BBGA 2RTXA 2EL6A 4KZSA 2DGCA 1J26A 2DB2A 2L8TA 1I94E 1JK1A 2EORA 2HC5A 4X64E 1PKPA 4DR7E 2F8BA 4TUGA 2RSMA 1N3GA 2V86A 3J81C 4RH8A 4B3SE 4OX9E 1IBKE 1UN6B 4DV1E 1NEIA 2YTNA 2ENHA 1QU6A 2MC5A 4F54A 1BBOA 4F9BB 2EL4A 3LMLA 3RMPA 1FJGE 2UUBE 1T39A 4DV2E 3C4BA 2ODRD 4OOGC 2EP3A 3OMLA 4DR1E 1PJQA 1PJTA 2L6MA 2HHHE 2ELZA 2NUGA 2EPRA 2Q8UA 2B3TB 2EN3A 3H09A 2YTJA 1WJPA 1UBDC 2EMZA 2MC6A 2YTDA 2GHFA 2EMFA 1RQ0A 2EM7A 1KJKA 3TQMA 5LL6R 3MHHC 2WBSA 2J7JA 4DR4E 2KOUA 1AAYA 5A6BA 2UXDE 3AV0A 3EQ1A 1X6HA 4JI3E 2DIXA 5IXMB 4F9CB 1YFHA 3DF6A 4R8OA 1X47A 2K4VA 2RS6A 1N33E 5AE1A 4JI4E 2DLQA 4N4RB 4LFCE 3JU0A 4LF7E 2GPIA 2E72A 2YTGA 1ZR9A 2V85A 4P7DA 3VK6A 5FLXC 3DJWA 2V83A 3BGHA 4F6MA 4LFAE 2LCEA 2L33A 4X8WA 4M9VC 4BCAA 2WBTA
chains in the Genus database with same CATH topology
1ZU1A 2CSHA 5KL3A 1G2FC 2EN1A 2EPXA 2YU5A 1TN9A 2CTDA 4R2RA 2YSOA 2YTQA 1A1JA 2YTIA 1F2IG 1X6EA 2MDGA 1YSAC 2JPAA 2EM0A 4FK5C 2HGHA 2ADRA 2EMGA 2EPCA 2PRTA 3UK3C 2YRMA 2GLIA 2DMIA 2EMHA 2I13A 4IJDA 2EOQA 2A25A 1X5WA 3VHTB 3EPKA 4R2SA 4R2QA 2EMCA 1MEYC 2LVHA 2BB8A 4F6NA 2EMYA 2EOEA 1YUIA 2EL6A 2YRHA 2YRKA 2DGCA 2EOYA 1ZAAC 1JK1A 2EORA 2EL5A 2DLKA 2R1FA 2WBUA 2RSIA 2VRDA 5KL2A 4GZNC 2YTPA 2EPZA 2YU8A 1G2DC 1UN6B 2EQ3A 2YTNA 1JK2A 2ENHA 2EPAA 3EPHA 1BB8A 5KL4A 1BBOA 2EM8A 2EMAA 2EL4A 2LT7A 5KL5A 2YTOA 4R2AA 2EOMA 2EOHA 2EQ0A 1X3CA 2EP3A 2NABA 4WSGA 2EMIA 2ELZA 3M99B 2EMXA 5KL6A 2EE8A 1A1KA 1YUJA 2EPRA 2EN7A 2EN3A 4F2JC 2YTJA 2EQ1A 1WJPA 1UBDC 2EJ4A 3EPLA 2ELYA 2EMZA 1TF6A 2YTDA 2EN4A 2GHFA 2EMFA 2MKNA 2EM7A 1KJKA 2M9AA 2D9HA 2CT1A 2YSPA 2EM2A 2EOIA 3MHHC 4R2EA 2WBSA 2J7JA 4IS1C 1NCSA 2EM9A 2EMWA 2ENAA 2EM5A 4R2CA 1AAYA 1A1IA 1LLMC 2ENCA 2EMBA 1RMDA 2EOXA 1X6HA 2EN8A 2EOZA 2EM4A 2EOFA 2LV2A 2EN6A 1A1GA 1DGCA 1TF3A 4R2PA 1A1LA 2DLQA 2DRPA 2JP9A 2YTEA 2MKDA 2EOSA 2EM6A 2EMLA 2EMKA 2EN2A 1A1FA 2EPPA 3MHSC 1A1HA 2LO3A 2E72A 2YTFA 1ZR9A 2EPUA 2YTGA 2EOOA 2RPCA 1P47A 5KL7A 4X9JA 1B69A 4F6MA 2WCC3 2LCEA 4R2DA 1Z1BA 3EPJA 2EOJA 2EM3A 4M9VC 1X6FA 2WBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZU1 A;  2CSH A;  5KL3 A;  1G2F C;  2EN1 A;  2EPX A;  2YU5 A;  1TN9 A;  2CTD A;  4R2R A;  2YSO A;  2YTQ A;  1A1J A;  2YTI A;  1F2I G;  1X6E A;  2MDG A;  1YSA C;  2JPA A;  2EM0 A;  4FK5 C;  2HGH A;  2ADR A;  2EMG A;  2EPC A;  2PRT A;  3UK3 C;  2YRM A;  2GLI A;  2DMI A;  2EMH A;  2I13 A;  4IJD A;  2EOQ A;  2A25 A;  1X5W A;  3VHT B;  3EPK A;  4R2S A;  4R2Q A;  2EMC A;  1MEY C;  2LVH A;  2BB8 A;  4F6N A;  2EMY A;  2EOE A;  1YUI A;  2EL6 A;  2YRH A;  2YRK A;  2DGC A;  2EOY A;  1ZAA C;  1JK1 A;  2EOR A;  2EL5 A;  2DLK A;  2R1F A;  2WBU A;  2RSI A;  2VRD A;  5KL2 A;  4GZN C;  2YTP A;  2EPZ A;  2YU8 A;  1G2D C;  1UN6 B;  2EQ3 A;  2YTN A;  1JK2 A;  2ENH A;  2EPA A;  3EPH A;  1BB8 A;  5KL4 A;  1BBO A;  2EM8 A;  2EMA A;  2EL4 A;  2LT7 A;  5KL5 A;  2YTO A;  4R2A A;  2EOM A;  2EOH A;  2EQ0 A;  1X3C A;  2EP3 A;  2NAB A;  4WSG A;  2EMI A;  2ELZ A;  3M99 B;  2EMX A;  5KL6 A;  2EE8 A;  1A1K A;  1YUJ A;  2EPR A;  2EN7 A;  2EN3 A;  4F2J C;  2YTJ A;  2EQ1 A;  1WJP A;  1UBD C;  2EJ4 A;  3EPL A;  2ELY A;  2EMZ A;  1TF6 A;  2YTD A;  2EN4 A;  2GHF A;  2EMF A;  2MKN A;  2EM7 A;  1KJK A;  2M9A A;  2D9H A;  2CT1 A;  2YSP A;  2EM2 A;  2EOI A;  3MHH C;  4R2E A;  2WBS A;  2J7J A;  4IS1 C;  1NCS A;  2EM9 A;  2EMW A;  2ENA A;  2EM5 A;  4R2C A;  1AAY A;  1A1I A;  1LLM C;  2ENC A;  2EMB A;  1RMD A;  2EOX A;  1X6H A;  2EN8 A;  2EOZ A;  2EM4 A;  2EOF A;  2LV2 A;  2EN6 A;  1A1G A;  1DGC A;  1TF3 A;  4R2P A;  1A1L A;  2DLQ A;  2DRP A;  2JP9 A;  2YTE A;  2MKD A;  2EOS A;  2EM6 A;  2EML A;  2EMK A;  2EN2 A;  1A1F A;  2EPP A;  3MHS C;  1A1H A;  2LO3 A;  2E72 A;  2YTF A;  1ZR9 A;  2EPU A;  2YTG A;  2EOO A;  2RPC A;  1P47 A;  5KL7 A;  4X9J A;  1B69 A;  4F6M A;  2WCC 3;  2LCE A;  4R2D A;  1Z1B A;  3EPJ A;  2EOJ A;  2EM3 A;  4M9V C;  1X6F A;  2WBT A; 
#chains in the Genus database with same CATH topology
 1DQ3 A;  2CSH A;  2NUF A;  2EN1 A;  2JY9 A;  1SFE A;  2YT4 A;  1AH5 A;  4ZYD A;  2EPM X;  2YSO A;  2YTQ A;  1EH7 A;  3THO B;  2HGH A;  4BS9 A;  1ZBQ A;  4LF5 E;  2EOQ A;  1X5W A;  1X48 A;  2FGG A;  5A2Q C;  2L2K B;  1MEY C;  2LVH A;  1STU A;  2EOE A;  2EPL X;  2YRH A;  2EWL A;  2LTS A;  2H36 X;  1IQS A;  4X66 E;  2DLK A;  4JI2 E;  2EPK X;  2BBG A;  5A6J A;  5BR8 E;  2VRD A;  4LTY A;  1T4O A;  5KL2 A;  3HQ1 A;  2LJH A;  4GZN C;  4BHC A;  3T1H E;  2M4I A;  1G2D C;  1JK2 A;  4KWY A;  2EPA A;  2VF1 A;  2VQF E;  5KL4 A;  2EMA A;  5T6J A;  3J7A G;  1WHQ A;  2YTO A;  2JXP A;  2JOX A;  4R2A A;  2NUE A;  2WZO A;  2EOM A;  3ZOQ B;  4JI1 E;  4MLQ A;  2NAB A;  5AAS A;  5KL6 A;  4L5N C;  4JV5 E;  4O24 A;  1J5E E;  4WXD A;  1O0W A;  1TF6 A;  1FKA E;  4DUZ E;  2MKN A;  2CT1 A;  2YSP A;  2EM2 A;  1QNT A;  2G7H A;  4GEQ B;  3C4T A;  4R2E A;  2EM9 A;  4R03 A;  2EM5 A;  2M7Q A;  1LLM C;  3C6M A;  3ADI A;  2V89 A;  3J7Y p;  2EOF A;  2LV2 A;  4F9A B;  1TF3 A;  1WXR A;  4R2P A;  5IT9 C;  4JI5 E;  4X65 E;  1IBM E;  2LMZ A;  2I9I A;  2ZM6 E;  5AE3 A;  2UUA E;  2L3J A;  4DV0 E;  4Q35 B;  2EOS A;  3P1X A;  2EML A;  2EMK A;  2EN2 A;  3KWR A;  3VYY A;  2EPP A;  4DV5 E;  3MHS C;  2ODR C;  3ADL A;  2KON A;  2RPC A;  4X9J A;  4O4K A;  2FV4 B;  1PJS A;  2WCC 3;  4DV6 E;  2EOJ A;  1A1J A;  1XNQ E;  4ZYH A;  3KZY A;  4DUY E;  2JYA A;  2HJJ A;  1TN9 A;  4JI8 E;  2CTD A;  4ZYE A;  4R2R A;  1T4L B;  1XNR E;  5LMN E;  1F2I G;  2MDG A;  4DR2 E;  4B3T E;  2EPC A;  3L00 A;  2PRT A;  2YRM A;  4NXM E;  2RS7 A;  3THN A;  2E5L E;  3ADJ A;  2R76 A;  2N8X A;  2A25 A;  1WHN A;  4LF4 E;  2EZ6 A;  4X62 E;  4R2Q A;  2KHX A;  2LTR A;  2EMY A;  2UUC E;  2V87 A;  1MGT A;  5A6B D;  4DV4 E;  2B7T A;  4BC9 A;  1T38 A;  2L92 A;  4LF8 E;  2R1F A;  2RSI A;  4GKK E;  2DMY A;  3OTO E;  2EPZ A;  3HPS A;  2YU8 A;  2FTX B;  3BF2 A;  3BBG A;  4LF6 E;  1BB8 A;  1UHZ A;  4HTG A;  2EM8 A;  2LT7 A;  2MDR A;  1DI2 A;  4LU9 A;  5KL5 A;  3BID A;  4WX9 A;  2EOH A;  1X3C A;  3F6H A;  4WSG A;  4WXC A;  1YYK A;  3ADG A;  3M99 B;  1A1K A;  2EE8 A;  1YUJ A;  1IBL E;  1YYO A;  4DV7 E;  4F2J C;  2EQ1 A;  1EH6 A;  2EJ4 A;  3EPL A;  3JAM C;  2JOB A;  3KZZ A;  1YPN A;  2EN4 A;  1NCS A;  2EMW A;  2CPN A;  3VYX A;  2EMB A;  1RMD A;  2EOX A;  3AUZ A;  1A1G A;  1DGC A;  2EN6 A;  2B9D A;  5F3W A;  4YHH E;  4YY3 E;  2YTE A;  3FIG A;  4KHP E;  1HR0 E;  2EPN A;  1IMU A;  1GTK A;  1A1F A;  1EKZ A;  4M30 A;  1A1H A;  2LO3 A;  4O43 A;  2EPU A;  1RC7 A;  2EOO A;  1X49 A;  5KL7 A;  3LLH A;  5TSE A;  3T1Y E;  1X6F A;  1ZU1 A;  4DKK A;  5A6A A;  2LUP B;  2EPX A;  4JI0 E;  2YU5 A;  1ZBT A;  4DR5 E;  4O5G A;  3C6K A;  1N32 E;  4NZV A;  3QG5 C;  2YTI A;  2VQE E;  4BHB A;  2L3C A;  1YSA C;  2EM0 A;  1L4S A;  2V8Q B;  2UU9 E;  2YZT A;  2I13 A;  2LRS A;  4IJD A;  4JYA E;  5CFF E;  1XMQ E;  1WRJ A;  4AQY E;  3EPK A;  2YPN A;  1EH8 A;  2EMC A;  2IHR 1;  4F6N A;  5AC5 A;  5IWA E;  4JI7 E;  2N3G A;  2YRK A;  2EOY A;  4DV3 E;  5LLQ A;  1HNZ E;  4DR3 E;  1ZAA C;  1YZ9 A;  2JVA A;  3IWC A;  2EL5 A;  2WBU A;  4B3R E;  4NHR A;  4NXN E;  2YTP A;  1N34 E;  4BMJ A;  2F4V E;  1GZ6 A;  4DMI A;  4L8N A;  2EQ3 A;  2B7V A;  3EPH A;  3HTX A;  2K7I A;  2UXB E;  2LBS B;  4M0V A;  1IQO A;  1GQE A;  2EQ0 A;  3J80 C;  3IWD A;  5AC4 A;  4J8Z A;  2EMI A;  4ZYG A;  4LF9 E;  2EMX A;  2EN7 A;  5ADZ A;  3HXL A;  5IV8 B;  4I8O A;  1N36 E;  2ELY A;  2V88 A;  2L2M A;  3ECR A;  2M9A A;  2D9H A;  2GLI A;  2EOI A;  4IS1 C;  2ENA A;  4R2C A;  4WSP A;  1A1I A;  2UXC E;  2ENC A;  1HNW E;  1KYQ A;  2EN8 A;  3MSW A;  2EOZ A;  2EM4 A;  4WYQ B;  4Q28 A;  1A1L A;  4BC7 A;  2JWO A;  4HEI A;  2LJU A;  2DRP A;  2JP9 A;  2MKD A;  2EM6 A;  2VE7 C;  4JI6 E;  1PDA A;  4RHB B;  5A69 A;  4P78 A;  2YTF A;  4WFT A;  2L2N A;  3F6G A;  2E1M A;  2YWQ A;  1SR9 A;  1UIL A;  5A6K A;  1P47 A;  4M2Z A;  1B69 A;  1T4N A;  3HPZ A;  4R2D A;  1Z1B A;  3EPJ A;  2EPO A;  4DR6 E;  2EM3 A;  5KL3 A;  1G2F C;  2N3H A;  4LFB E;  3K6Q A;  2M1S A;  4TUI A;  3IWB A;  5LMU E;  2LUQ A;  5AE2 A;  2LE2 A;  4BBY A;  1X6E A;  2RQL A;  2JPA A;  4B3M E;  2JR1 A;  4FK5 C;  2ADR A;  2EMG A;  3UK3 C;  4GKJ E;  2DMI A;  1XMO E;  2NA2 A;  4K0K E;  2EMH A;  5DNY A;  4WPY A;  4MLV A;  2DSY A;  1YYW A;  3VHT B;  1HNX E;  4R2S A;  2BB8 A;  3JTZ A;  1YUI A;  1BBG A;  2RTX A;  2EL6 A;  4KZS A;  2DGC A;  1J26 A;  2DB2 A;  2L8T A;  1I94 E;  1JK1 A;  2EOR A;  2HC5 A;  4X64 E;  1PKP A;  4DR7 E;  2F8B A;  4TUG A;  2RSM A;  1N3G A;  2V86 A;  3J81 C;  4RH8 A;  4B3S E;  4OX9 E;  1IBK E;  1UN6 B;  4DV1 E;  1NEI A;  2YTN A;  2ENH A;  1QU6 A;  2MC5 A;  4F54 A;  1BBO A;  4F9B B;  2EL4 A;  3LML A;  3RMP A;  1FJG E;  2UUB E;  1T39 A;  4DV2 E;  3C4B A;  2ODR D;  4OOG C;  2EP3 A;  3OML A;  4DR1 E;  1PJQ A;  1PJT A;  2L6M A;  2HHH E;  2ELZ A;  2NUG A;  2EPR A;  2Q8U A;  2B3T B;  2EN3 A;  3H09 A;  2YTJ A;  1WJP A;  1UBD C;  2EMZ A;  2MC6 A;  2YTD A;  2GHF A;  2EMF A;  1RQ0 A;  2EM7 A;  1KJK A;  3TQM A;  5LL6 R;  3MHH C;  2WBS A;  2J7J A;  4DR4 E;  2KOU A;  1AAY A;  5A6B A;  2UXD E;  3AV0 A;  3EQ1 A;  1X6H A;  4JI3 E;  2DIX A;  5IXM B;  4F9C B;  1YFH A;  3DF6 A;  4R8O A;  1X47 A;  2K4V A;  2RS6 A;  1N33 E;  5AE1 A;  4JI4 E;  2DLQ A;  4N4R B;  4LFC E;  3JU0 A;  4LF7 E;  2GPI A;  2E72 A;  2YTG A;  1ZR9 A;  2V85 A;  4P7D A;  3VK6 A;  5FLX C;  3DJW A;  2V83 A;  3BGH A;  4F6M A;  4LFA E;  2LCE A;  2L33 A;  4X8W A;  4M9V C;  4BCA A;  2WBT A; 
#chains in the Genus database with same CATH homology
 1ZU1 A;  2CSH A;  5KL3 A;  1G2F C;  2EN1 A;  2EPX A;  2YU5 A;  1TN9 A;  2CTD A;  4R2R A;  2YSO A;  2YTQ A;  1A1J A;  2YTI A;  1F2I G;  1X6E A;  2MDG A;  1YSA C;  2JPA A;  2EM0 A;  4FK5 C;  2HGH A;  2ADR A;  2EMG A;  2EPC A;  2PRT A;  3UK3 C;  2YRM A;  2GLI A;  2DMI A;  2EMH A;  2I13 A;  4IJD A;  2EOQ A;  2A25 A;  1X5W A;  3VHT B;  3EPK A;  4R2S A;  4R2Q A;  2EMC A;  1MEY C;  2LVH A;  2BB8 A;  4F6N A;  2EMY A;  2EOE A;  1YUI A;  2EL6 A;  2YRH A;  2YRK A;  2DGC A;  2EOY A;  1ZAA C;  1JK1 A;  2EOR A;  2EL5 A;  2DLK A;  2R1F A;  2WBU A;  2RSI A;  2VRD A;  5KL2 A;  4GZN C;  2YTP A;  2EPZ A;  2YU8 A;  1G2D C;  1UN6 B;  2EQ3 A;  2YTN A;  1JK2 A;  2ENH A;  2EPA A;  3EPH A;  1BB8 A;  5KL4 A;  1BBO A;  2EM8 A;  2EMA A;  2EL4 A;  2LT7 A;  5KL5 A;  2YTO A;  4R2A A;  2EOM A;  2EOH A;  2EQ0 A;  1X3C A;  2EP3 A;  2NAB A;  4WSG A;  2EMI A;  2ELZ A;  3M99 B;  2EMX A;  5KL6 A;  2EE8 A;  1A1K A;  1YUJ A;  2EPR A;  2EN7 A;  2EN3 A;  4F2J C;  2YTJ A;  2EQ1 A;  1WJP A;  1UBD C;  2EJ4 A;  3EPL A;  2ELY A;  2EMZ A;  1TF6 A;  2YTD A;  2EN4 A;  2GHF A;  2EMF A;  2MKN A;  2EM7 A;  1KJK A;  2M9A A;  2D9H A;  2CT1 A;  2YSP A;  2EM2 A;  2EOI A;  3MHH C;  4R2E A;  2WBS A;  2J7J A;  4IS1 C;  1NCS A;  2EM9 A;  2EMW A;  2ENA A;  2EM5 A;  4R2C A;  1AAY A;  1A1I A;  1LLM C;  2ENC A;  2EMB A;  1RMD A;  2EOX A;  1X6H A;  2EN8 A;  2EOZ A;  2EM4 A;  2EOF A;  2LV2 A;  2EN6 A;  1A1G A;  1DGC A;  1TF3 A;  4R2P A;  1A1L A;  2DLQ A;  2DRP A;  2JP9 A;  2YTE A;  2MKD A;  2EOS A;  2EM6 A;  2EML A;  2EMK A;  2EN2 A;  1A1F A;  2EPP A;  3MHS C;  1A1H A;  2LO3 A;  2E72 A;  2YTF A;  1ZR9 A;  2EPU A;  2YTG A;  2EOO A;  2RPC A;  1P47 A;  5KL7 A;  4X9J A;  1B69 A;  4F6M A;  2WCC 3;  2LCE A;  4R2D A;  1Z1B A;  3EPJ A;  2EOJ A;  2EM3 A;  4M9V C;  1X6F A;  2WBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...