2EOXA

Solution structure of the c2h2 type zinc finger (region 315-345) of human zinc finger protein 473
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
44
structure length
44
Chain Sequence
GSSGSSGTDSKSYNCNECGKAFTRIFHLTRHQKIHTRKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 315-345) of human Zinc finger protein 473
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 473
total genus 5
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eoxA01
5KL3A 2EOMA 2EMCA 4R2QA 2LT7A 1X6EA 1TF6A 2ADRA 2NABA 3EPLA 2EMBA 2ENHA 2EOFA 4X9JA 1A1FA 2EM4A 2DMIA 2VRDA 2EMAA 1A1IA 2EOJA 2YU5A 3M99B 2MKDA 2DRPA 2EOZA 2EN6A 1MEYC 5KL2A 2JP9A 2EOHA 2ELYA 2EPAA 2EM3A 3UK3C 1G2DC 1TF3A 1YUIA 1A1HA 2YRMA 1A1GA 4R2RA 1ZR9A 2EMGA 2EM7A 2YRKA 3MHHC 2GHFA 2EQ3A 2J7JA 2CTDA 2WBTA 2LVHA 2RPCA 2YTIA 2EQ1A 4IS1C 2EMIA 2EL6A 2EM9A 2DLKA 2EMZA 2EN7A 2YTFA 2GLIA 1ZU1A 3VHTB 2YSPA 2HGHA 1JK2A 4WSGA 2EPPA 2EMFA 4IJDA 4F6NA 2ENCA 2EN1A 2A25A 1JK1A 4M9VC 1ZAAC 4R2AA 1G2FC 4R2SA 2EM0A 2EMXA 2YRHA 2YTOA 1DGCA 1A1LA 2EM8A 2E72A 4R2CA 1AAYA 1BBOA 5KL7A 2EN8A 2CT1A 2LCEA 1A1JA 2CSHA 2MKNA 2EM2A 2D9HA 2LO3A 2EMKA 2YTDA 3EPHA 2YTQA 2EOXA 2BB8A 2EPXA 2WBUA 2DGCA 2YTJA 1WJPA 4R2EA 2EP3A 2JPAA 4R2PA 2EMLA 4F2JC 2EOIA 2EMYA 2I13A 2DLQA 2YSOA 1X5WA 1X6HA 2MDGA 2WCC3 1X6FA 2EJ4A 2PRTA 1BB8A 1X3CA 2ENAA 2EOOA 2R1FA 2YU8A 2WBSA 3EPJA 5KL5A 2EPZA 1Z1BA 1B69A 4F6MA 2EOEA 2EMWA 2EL4A 2RSIA 2EPUA 3MHSC 1F2IG 1LLMC 2EN4A 2EM6A 1KJKA 1P47A 1A1KA 1UBDC 2EM5A 2EN3A 2EORA 5KL6A 1RMDA 2YTPA 2EL5A 1NCSA 1YSAC 3EPKA 2EN2A 2YTGA 2EOQA 5KL4A 1TN9A 2EPRA 1YUJA 2EMHA 1UN6B 2YTNA 2ELZA 2YTEA 4R2DA 2EPCA 4FK5C 4GZNC 2EE8A 2M9AA 2EOYA 2LV2A 2EQ0A 2EOSA
chains in the Genus database with same CATH superfamily
2EMCA 4R2QA 4DV5E 2V89A 4ZYEA 2EMBA 2EOFA 4JI0E 2MDRA 2EMAA 2ODRC 4R03A 1J5EE 4WYQB 3C6KA 4BMJA 2MKDA 3KZYA 4DR3E 2ELYA 1NEIA 2GPIA 2UUAE 4OOGC 1YUIA 4M0VA 3VYXA 2YRKA 3MHHC 3DJWA 2VQFE 2UUCE 2EQ3A 2L2KB 2CTDA 2RPCA 1N34E 4LFCE 5LMNE 3J7AG 2JOBA 2EMZA 2EN7A 4DR5E 1JK2A 2CPNA 4IJDA 1HNZE 2N8XA 2L8TA 2A25A 2RS6A 4WXCA 1X47A 3H09A 4YHHE 1WHNA 1G2FC 2EM0A 2FV4B 2EMXA 2YTOA 1DGCA 5A2QC 1A1LA 2EPOA 4R2CA 1BBOA 2Q8UA 2VF1A 3JTZA 4DR2E 5AC4A 4RHBB 1YYWA 3VYYA 2HC5A 4WX9A 2VQEE 2H36X 2EM2A 1KYQA 1YYKA 2YWQA 3JAMC 2YTDA 3ZOQB 4GKKE 2RQLA 1ZBQA 1GZ6A 4R2PA 2EMLA 4M30A 2EOIA 4BHBA 1PKPA 4DKKA 2MDGA 3F6HA 1X3CA 2K7IA 2R1FA 4JYAE 2B9DA 3KWRA 1I94E 4X66E 2EOEA 2V86A 1N36E 2RSIA 3MHSC 3HPSA 2RTXA 4JV5E 2EN4A 1HNXE 2EPMX 3J81C 1A1KA 2DMYA 4JI4E 2EN3A 2DSYA 1RC7A 2V88A 4BHCA 2JXPA 1N33E 4RH8A 1NCSA 4LF8E 2UXBE 1EH8A 1IBKE 1ZBTA 3HQ1A 2EMHA 1UN6B 2LTSA 2YTEA 4F9CB 4R2DA 2NUEA 2WZOA 1T4OA 5KL3A 1HNWE 2EOMA 2FGGA 2LT7A 4NXME 2NABA 4Q28A 3EPLA 3IWCA 3JU0A 4K0KE 4X9JA 4X64E 4JI7E 2EM4A 2N3GA 1T4NA 4LFAE 4JI8E 4BC7A 4TUGA 3M99B 5A6AA 2KOUA 2DRPA 1N32E 4LTYA 1X49A 3RMPA 2JP9A 2EM3A 4WSPA 5IXMB 4L5NC 5A6BD 1TF3A 2EPNA 1ZR9A 2M1SA 2E1MA 2VE7C 2L92A 2LVHA 2WBTA 3OMLA 2EQ1A 1IMUA 3ADGA 2EL6A 2EM9A 2DLKA 1UILA 4DMIA 4AQYE 2YTFA 2HJJA 1RQ0A 1T4LB 5AE3A 1T39A 2ENCA 1QU6A 4BS9A 1FJGE 4R2AA 2LBSB 3MSWA 5A6JA 2NUFA 2EM8A 4LF5E 1AAYA 2FTXB 4KZSA 3IWDA 2CT1A 2EN8A 2JR1A 2LE2A 1A1JA 2DB2A 4ZYDA 4B3RE 2CSHA 2L2MA 1DQ3A 5AASA 4GKJE 1DI2A 2WBUA 2BB8A 4DR4E 1EKZA 2JY9A 4F2JC 1L4SA 2EMYA 4DV3E 3DF6A 1X5WA 2NUGA 4O5GA 1X6FA 4O24A 1GQEA 2DIXA 2EOOA 3ECRA 2F8BA 2YU8A 5ADZA 3OTOE 1SFEA 1Z1BA 3J7Yp 4F6MA 2EMWA 4J8ZA 2IHR1 1WXRA 2EPUA 2K4VA 4GEQB 4DV0E 1WRJA 2B7VA 1KJKA 4DV7E 3BBGA 2EM5A 2ODRD 5F3WA 1EH7A 2V85A 5KL6A 1XMOE 2RS7A 4L8NA 2I9IA 1YZ9A 3EPKA 4MLQA 1TN9A 1YUJA 2MC5A 2V87A 4P78A 2YZTA 4GZNC 2LJHA 4R8OA 1PDAA 4DR7E 5LMUE 3ADLA 1TF6A 2RSMA 4LF4E 1A1FA 2VRDA 3ADJA 1A1IA 2M4IA 1PJQA 5AE1A 2EOZA 5FLXC 2EN6A 4BBYA 4O4KA 5KL2A 2EOHA 1EH6A 3UK3C 3IWBA 1G2DC 2B7TA 4LF6E 1A1HA 3FIGA 1A1GA 4R2RA 2B3TB 1YPNA 4LFBE 1WHQA 4DV2E 5AC5A 4B3TE 1AH5A 2EMIA 1PJSA 4JI3E 2GLIA 4BCAA 3VHTB 2HGHA 2EPPA 2EMFA 4F6NA 4DUYE 2EN1A 5LL6R 4M9VC 4P7DA 1IBLE 3BGHA 4JI6E 1BBGA 2LCEA 2L3CA 4DR6E 3HXLA 2L33A 4JI2E 1FKAE 2D9HA 2LO3A 2EMKA 2YTQA 2EOXA 2NA2A 1GTKA 4F9AB 4B3ME 3THNA 3HPZA 1WJPA 2HHHE 2JPAA 2JOXA 2I13A 2DLQA 1X6HA 5A6KA 4HEIA 4JI1E 2EJ4A 1BB8A 2ENAA 2JWOA 2WBSA 1YFHA 5CFFE 5TSEA 3F6GA 4X65E 2EL4A 2E5LE 1F2IG 5IT9C 4ZYGA 5AE2A 1XMQE 1P47A 1UBDC 2ZM6E 1HR0E 3C4BA 2L6MA 2UUBE 4B3SE 4M2ZA 2R76A 2EL5A 4TUIA 2JYAA 1YSAC 2EN2A 2EOQA 5KL4A 3LLHA 3K6QA 5DNYA 2BBGA 2YTNA 1SR9A 2EPCA 4FK5C 2L2NA 2EE8A 2M9AA 3BF2A 2LV2A 2EQ0A 2ELZA 1X6EA 2ADRA 4HTGA 4X8WA 4KHPE 2M7QA 2ENHA 1IQSA 2DMIA 2V83A 2EOJA 4KWYA 1IBME 2LRSA 3EQ1A 2YU5A 2MC6A 1MEYC 1N3GA 2EPKX 2EPAA 2F4VE 1O0WA 2YT4A 2KONA 3J80C 2YRMA 1J26A 2EMGA 2EM7A 2GHFA 3ADIA 5A6BA 4DR1E 2J7JA 2N3HA 2YTIA 3LMLA 1X48A 4LU9A 2LUPB 4N4RB 4IS1C 4DV6E 4I8OA 1ZU1A 2YSPA 4DV4E 4WSGA 5A69A 1STUA 4DUZE 1JK1A 3THOB 4WXDA 1ZAAC 4O43A 2LMZA 5IV8B 4R2SA 2LTRA 3P1XA 4DV1E 2KHXA 4LF7E 4NXNE 1T38A 3TQMA 2E72A 3T1HE 2UXDE 5KL7A 3T1YE 2G7HA 2MKNA 1UHZA 3VK6A 3KZZA 1MGTA 4MLVA 3EPHA 2DGCA 2EPXA 4X62E 2YTJA 2YPNA 3AUZA 1IQOA 4Q35B 2EP3A 4R2EA 4JI5E 4F54A 3L00A 2YSOA 2L3JA 2EZ6A 2WCC3 3QG5C 4BC9A 2PRTA 4F9BB 3EPJA 1QNTA 5KL5A 1PJTA 2EPZA 4NZVA 1B69A 2EWLA 2UXCE 2EPLX 3BIDA 2JVAA 1LLMC 2V8QB 2EM6A 2LJUA 2UU9E 1XNRE 3HTXA 2EORA 4LF9E 1RMDA 2YTPA 1XNQE 5BR8E 4NHRA 5LLQA 5T6JA 4WPYA 4WFTA 4YY3E 2YTGA 3C6MA 4ZYHA 2EPRA 3C4TA 3AV0A 1YYOA 5IWAE 4OX9E 2LUQA 2YRHA 2EOYA 2EOSA
chains in the Genus database with same CATH topology
5KL3A 2EOMA 2EMCA 4R2QA 2LT7A 1X6EA 1TF6A 2ADRA 2NABA 3EPLA 2EMBA 2ENHA 2EOFA 4X9JA 1A1FA 2EM4A 2DMIA 2VRDA 2EMAA 1A1IA 2EOJA 2YU5A 3M99B 2MKDA 2DRPA 2EOZA 2EN6A 1MEYC 5KL2A 2JP9A 2EOHA 2ELYA 2EPAA 2EM3A 3UK3C 1G2DC 1TF3A 1YUIA 1A1HA 2YRMA 1A1GA 4R2RA 1ZR9A 2EMGA 2EM7A 2YRKA 3MHHC 2GHFA 2EQ3A 2J7JA 2CTDA 2WBTA 2LVHA 2RPCA 2YTIA 2EQ1A 4IS1C 2EMIA 2EL6A 2EM9A 2DLKA 2EMZA 2EN7A 2YTFA 2GLIA 1ZU1A 3VHTB 2YSPA 2HGHA 1JK2A 4WSGA 2EPPA 2EMFA 4IJDA 4F6NA 2ENCA 2EN1A 2A25A 1JK1A 4M9VC 1ZAAC 4R2AA 1G2FC 4R2SA 2EM0A 2EMXA 2YRHA 2YTOA 1DGCA 1A1LA 2EM8A 2E72A 4R2CA 1AAYA 1BBOA 5KL7A 2EN8A 2CT1A 2LCEA 1A1JA 2CSHA 2MKNA 2EM2A 2D9HA 2LO3A 2EMKA 2YTDA 3EPHA 2YTQA 2EOXA 2BB8A 2EPXA 2WBUA 2DGCA 2YTJA 1WJPA 4R2EA 2EP3A 2JPAA 4R2PA 2EMLA 4F2JC 2EOIA 2EMYA 2I13A 2DLQA 2YSOA 1X5WA 1X6HA 2MDGA 2WCC3 1X6FA 2EJ4A 2PRTA 1BB8A 1X3CA 2ENAA 2EOOA 2R1FA 2YU8A 2WBSA 3EPJA 5KL5A 2EPZA 1Z1BA 1B69A 4F6MA 2EOEA 2EMWA 2EL4A 2RSIA 2EPUA 3MHSC 1F2IG 1LLMC 2EN4A 2EM6A 1KJKA 1P47A 1A1KA 1UBDC 2EM5A 2EN3A 2EORA 5KL6A 1RMDA 2YTPA 2EL5A 1NCSA 1YSAC 3EPKA 2EN2A 2YTGA 2EOQA 5KL4A 1TN9A 2EPRA 1YUJA 2EMHA 1UN6B 2YTNA 2ELZA 2YTEA 4R2DA 2EPCA 4FK5C 4GZNC 2EE8A 2M9AA 2EOYA 2LV2A 2EQ0A 2EOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KL3 A;  2EOM A;  2EMC A;  4R2Q A;  2LT7 A;  1X6E A;  1TF6 A;  2ADR A;  2NAB A;  3EPL A;  2EMB A;  2ENH A;  2EOF A;  4X9J A;  1A1F A;  2EM4 A;  2DMI A;  2VRD A;  2EMA A;  1A1I A;  2EOJ A;  2YU5 A;  3M99 B;  2MKD A;  2DRP A;  2EOZ A;  2EN6 A;  1MEY C;  5KL2 A;  2JP9 A;  2EOH A;  2ELY A;  2EPA A;  2EM3 A;  3UK3 C;  1G2D C;  1TF3 A;  1YUI A;  1A1H A;  2YRM A;  1A1G A;  4R2R A;  1ZR9 A;  2EMG A;  2EM7 A;  2YRK A;  3MHH C;  2GHF A;  2EQ3 A;  2J7J A;  2CTD A;  2WBT A;  2LVH A;  2RPC A;  2YTI A;  2EQ1 A;  4IS1 C;  2EMI A;  2EL6 A;  2EM9 A;  2DLK A;  2EMZ A;  2EN7 A;  2YTF A;  2GLI A;  1ZU1 A;  3VHT B;  2YSP A;  2HGH A;  1JK2 A;  4WSG A;  2EPP A;  2EMF A;  4IJD A;  4F6N A;  2ENC A;  2EN1 A;  2A25 A;  1JK1 A;  4M9V C;  1ZAA C;  4R2A A;  1G2F C;  4R2S A;  2EM0 A;  2EMX A;  2YRH A;  2YTO A;  1DGC A;  1A1L A;  2EM8 A;  2E72 A;  4R2C A;  1AAY A;  1BBO A;  5KL7 A;  2EN8 A;  2CT1 A;  2LCE A;  1A1J A;  2CSH A;  2MKN A;  2EM2 A;  2D9H A;  2LO3 A;  2EMK A;  2YTD A;  3EPH A;  2YTQ A;  2EOX A;  2BB8 A;  2EPX A;  2WBU A;  2DGC A;  2YTJ A;  1WJP A;  4R2E A;  2EP3 A;  2JPA A;  4R2P A;  2EML A;  4F2J C;  2EOI A;  2EMY A;  2I13 A;  2DLQ A;  2YSO A;  1X5W A;  1X6H A;  2MDG A;  2WCC 3;  1X6F A;  2EJ4 A;  2PRT A;  1BB8 A;  1X3C A;  2ENA A;  2EOO A;  2R1F A;  2YU8 A;  2WBS A;  3EPJ A;  5KL5 A;  2EPZ A;  1Z1B A;  1B69 A;  4F6M A;  2EOE A;  2EMW A;  2EL4 A;  2RSI A;  2EPU A;  3MHS C;  1F2I G;  1LLM C;  2EN4 A;  2EM6 A;  1KJK A;  1P47 A;  1A1K A;  1UBD C;  2EM5 A;  2EN3 A;  2EOR A;  5KL6 A;  1RMD A;  2YTP A;  2EL5 A;  1NCS A;  1YSA C;  3EPK A;  2EN2 A;  2YTG A;  2EOQ A;  5KL4 A;  1TN9 A;  2EPR A;  1YUJ A;  2EMH A;  1UN6 B;  2YTN A;  2ELZ A;  2YTE A;  4R2D A;  2EPC A;  4FK5 C;  4GZN C;  2EE8 A;  2M9A A;  2EOY A;  2LV2 A;  2EQ0 A;  2EOS A; 
#chains in the Genus database with same CATH topology
 2EMC A;  4R2Q A;  4DV5 E;  2V89 A;  4ZYE A;  2EMB A;  2EOF A;  4JI0 E;  2MDR A;  2EMA A;  2ODR C;  4R03 A;  1J5E E;  4WYQ B;  3C6K A;  4BMJ A;  2MKD A;  3KZY A;  4DR3 E;  2ELY A;  1NEI A;  2GPI A;  2UUA E;  4OOG C;  1YUI A;  4M0V A;  3VYX A;  2YRK A;  3MHH C;  3DJW A;  2VQF E;  2UUC E;  2EQ3 A;  2L2K B;  2CTD A;  2RPC A;  1N34 E;  4LFC E;  5LMN E;  3J7A G;  2JOB A;  2EMZ A;  2EN7 A;  4DR5 E;  1JK2 A;  2CPN A;  4IJD A;  1HNZ E;  2N8X A;  2L8T A;  2A25 A;  2RS6 A;  4WXC A;  1X47 A;  3H09 A;  4YHH E;  1WHN A;  1G2F C;  2EM0 A;  2FV4 B;  2EMX A;  2YTO A;  1DGC A;  5A2Q C;  1A1L A;  2EPO A;  4R2C A;  1BBO A;  2Q8U A;  2VF1 A;  3JTZ A;  4DR2 E;  5AC4 A;  4RHB B;  1YYW A;  3VYY A;  2HC5 A;  4WX9 A;  2VQE E;  2H36 X;  2EM2 A;  1KYQ A;  1YYK A;  2YWQ A;  3JAM C;  2YTD A;  3ZOQ B;  4GKK E;  2RQL A;  1ZBQ A;  1GZ6 A;  4R2P A;  2EML A;  4M30 A;  2EOI A;  4BHB A;  1PKP A;  4DKK A;  2MDG A;  3F6H A;  1X3C A;  2K7I A;  2R1F A;  4JYA E;  2B9D A;  3KWR A;  1I94 E;  4X66 E;  2EOE A;  2V86 A;  1N36 E;  2RSI A;  3MHS C;  3HPS A;  2RTX A;  4JV5 E;  2EN4 A;  1HNX E;  2EPM X;  3J81 C;  1A1K A;  2DMY A;  4JI4 E;  2EN3 A;  2DSY A;  1RC7 A;  2V88 A;  4BHC A;  2JXP A;  1N33 E;  4RH8 A;  1NCS A;  4LF8 E;  2UXB E;  1EH8 A;  1IBK E;  1ZBT A;  3HQ1 A;  2EMH A;  1UN6 B;  2LTS A;  2YTE A;  4F9C B;  4R2D A;  2NUE A;  2WZO A;  1T4O A;  5KL3 A;  1HNW E;  2EOM A;  2FGG A;  2LT7 A;  4NXM E;  2NAB A;  4Q28 A;  3EPL A;  3IWC A;  3JU0 A;  4K0K E;  4X9J A;  4X64 E;  4JI7 E;  2EM4 A;  2N3G A;  1T4N A;  4LFA E;  4JI8 E;  4BC7 A;  4TUG A;  3M99 B;  5A6A A;  2KOU A;  2DRP A;  1N32 E;  4LTY A;  1X49 A;  3RMP A;  2JP9 A;  2EM3 A;  4WSP A;  5IXM B;  4L5N C;  5A6B D;  1TF3 A;  2EPN A;  1ZR9 A;  2M1S A;  2E1M A;  2VE7 C;  2L92 A;  2LVH A;  2WBT A;  3OML A;  2EQ1 A;  1IMU A;  3ADG A;  2EL6 A;  2EM9 A;  2DLK A;  1UIL A;  4DMI A;  4AQY E;  2YTF A;  2HJJ A;  1RQ0 A;  1T4L B;  5AE3 A;  1T39 A;  2ENC A;  1QU6 A;  4BS9 A;  1FJG E;  4R2A A;  2LBS B;  3MSW A;  5A6J A;  2NUF A;  2EM8 A;  4LF5 E;  1AAY A;  2FTX B;  4KZS A;  3IWD A;  2CT1 A;  2EN8 A;  2JR1 A;  2LE2 A;  1A1J A;  2DB2 A;  4ZYD A;  4B3R E;  2CSH A;  2L2M A;  1DQ3 A;  5AAS A;  4GKJ E;  1DI2 A;  2WBU A;  2BB8 A;  4DR4 E;  1EKZ A;  2JY9 A;  4F2J C;  1L4S A;  2EMY A;  4DV3 E;  3DF6 A;  1X5W A;  2NUG A;  4O5G A;  1X6F A;  4O24 A;  1GQE A;  2DIX A;  2EOO A;  3ECR A;  2F8B A;  2YU8 A;  5ADZ A;  3OTO E;  1SFE A;  1Z1B A;  3J7Y p;  4F6M A;  2EMW A;  4J8Z A;  2IHR 1;  1WXR A;  2EPU A;  2K4V A;  4GEQ B;  4DV0 E;  1WRJ A;  2B7V A;  1KJK A;  4DV7 E;  3BBG A;  2EM5 A;  2ODR D;  5F3W A;  1EH7 A;  2V85 A;  5KL6 A;  1XMO E;  2RS7 A;  4L8N A;  2I9I A;  1YZ9 A;  3EPK A;  4MLQ A;  1TN9 A;  1YUJ A;  2MC5 A;  2V87 A;  4P78 A;  2YZT A;  4GZN C;  2LJH A;  4R8O A;  1PDA A;  4DR7 E;  5LMU E;  3ADL A;  1TF6 A;  2RSM A;  4LF4 E;  1A1F A;  2VRD A;  3ADJ A;  1A1I A;  2M4I A;  1PJQ A;  5AE1 A;  2EOZ A;  5FLX C;  2EN6 A;  4BBY A;  4O4K A;  5KL2 A;  2EOH A;  1EH6 A;  3UK3 C;  3IWB A;  1G2D C;  2B7T A;  4LF6 E;  1A1H A;  3FIG A;  1A1G A;  4R2R A;  2B3T B;  1YPN A;  4LFB E;  1WHQ A;  4DV2 E;  5AC5 A;  4B3T E;  1AH5 A;  2EMI A;  1PJS A;  4JI3 E;  2GLI A;  4BCA A;  3VHT B;  2HGH A;  2EPP A;  2EMF A;  4F6N A;  4DUY E;  2EN1 A;  5LL6 R;  4M9V C;  4P7D A;  1IBL E;  3BGH A;  4JI6 E;  1BBG A;  2LCE A;  2L3C A;  4DR6 E;  3HXL A;  2L33 A;  4JI2 E;  1FKA E;  2D9H A;  2LO3 A;  2EMK A;  2YTQ A;  2EOX A;  2NA2 A;  1GTK A;  4F9A B;  4B3M E;  3THN A;  3HPZ A;  1WJP A;  2HHH E;  2JPA A;  2JOX A;  2I13 A;  2DLQ A;  1X6H A;  5A6K A;  4HEI A;  4JI1 E;  2EJ4 A;  1BB8 A;  2ENA A;  2JWO A;  2WBS A;  1YFH A;  5CFF E;  5TSE A;  3F6G A;  4X65 E;  2EL4 A;  2E5L E;  1F2I G;  5IT9 C;  4ZYG A;  5AE2 A;  1XMQ E;  1P47 A;  1UBD C;  2ZM6 E;  1HR0 E;  3C4B A;  2L6M A;  2UUB E;  4B3S E;  4M2Z A;  2R76 A;  2EL5 A;  4TUI A;  2JYA A;  1YSA C;  2EN2 A;  2EOQ A;  5KL4 A;  3LLH A;  3K6Q A;  5DNY A;  2BBG A;  2YTN A;  1SR9 A;  2EPC A;  4FK5 C;  2L2N A;  2EE8 A;  2M9A A;  3BF2 A;  2LV2 A;  2EQ0 A;  2ELZ A;  1X6E A;  2ADR A;  4HTG A;  4X8W A;  4KHP E;  2M7Q A;  2ENH A;  1IQS A;  2DMI A;  2V83 A;  2EOJ A;  4KWY A;  1IBM E;  2LRS A;  3EQ1 A;  2YU5 A;  2MC6 A;  1MEY C;  1N3G A;  2EPK X;  2EPA A;  2F4V E;  1O0W A;  2YT4 A;  2KON A;  3J80 C;  2YRM A;  1J26 A;  2EMG A;  2EM7 A;  2GHF A;  3ADI A;  5A6B A;  4DR1 E;  2J7J A;  2N3H A;  2YTI A;  3LML A;  1X48 A;  4LU9 A;  2LUP B;  4N4R B;  4IS1 C;  4DV6 E;  4I8O A;  1ZU1 A;  2YSP A;  4DV4 E;  4WSG A;  5A69 A;  1STU A;  4DUZ E;  1JK1 A;  3THO B;  4WXD A;  1ZAA C;  4O43 A;  2LMZ A;  5IV8 B;  4R2S A;  2LTR A;  3P1X A;  4DV1 E;  2KHX A;  4LF7 E;  4NXN E;  1T38 A;  3TQM A;  2E72 A;  3T1H E;  2UXD E;  5KL7 A;  3T1Y E;  2G7H A;  2MKN A;  1UHZ A;  3VK6 A;  3KZZ A;  1MGT A;  4MLV A;  3EPH A;  2DGC A;  2EPX A;  4X62 E;  2YTJ A;  2YPN A;  3AUZ A;  1IQO A;  4Q35 B;  2EP3 A;  4R2E A;  4JI5 E;  4F54 A;  3L00 A;  2YSO A;  2L3J A;  2EZ6 A;  2WCC 3;  3QG5 C;  4BC9 A;  2PRT A;  4F9B B;  3EPJ A;  1QNT A;  5KL5 A;  1PJT A;  2EPZ A;  4NZV A;  1B69 A;  2EWL A;  2UXC E;  2EPL X;  3BID A;  2JVA A;  1LLM C;  2V8Q B;  2EM6 A;  2LJU A;  2UU9 E;  1XNR E;  3HTX A;  2EOR A;  4LF9 E;  1RMD A;  2YTP A;  1XNQ E;  5BR8 E;  4NHR A;  5LLQ A;  5T6J A;  4WPY A;  4WFT A;  4YY3 E;  2YTG A;  3C6M A;  4ZYH A;  2EPR A;  3C4T A;  3AV0 A;  1YYO A;  5IWA E;  4OX9 E;  2LUQ A;  2YRH A;  2EOY A;  2EOS A; 
#chains in the Genus database with same CATH homology
 5KL3 A;  2EOM A;  2EMC A;  4R2Q A;  2LT7 A;  1X6E A;  1TF6 A;  2ADR A;  2NAB A;  3EPL A;  2EMB A;  2ENH A;  2EOF A;  4X9J A;  1A1F A;  2EM4 A;  2DMI A;  2VRD A;  2EMA A;  1A1I A;  2EOJ A;  2YU5 A;  3M99 B;  2MKD A;  2DRP A;  2EOZ A;  2EN6 A;  1MEY C;  5KL2 A;  2JP9 A;  2EOH A;  2ELY A;  2EPA A;  2EM3 A;  3UK3 C;  1G2D C;  1TF3 A;  1YUI A;  1A1H A;  2YRM A;  1A1G A;  4R2R A;  1ZR9 A;  2EMG A;  2EM7 A;  2YRK A;  3MHH C;  2GHF A;  2EQ3 A;  2J7J A;  2CTD A;  2WBT A;  2LVH A;  2RPC A;  2YTI A;  2EQ1 A;  4IS1 C;  2EMI A;  2EL6 A;  2EM9 A;  2DLK A;  2EMZ A;  2EN7 A;  2YTF A;  2GLI A;  1ZU1 A;  3VHT B;  2YSP A;  2HGH A;  1JK2 A;  4WSG A;  2EPP A;  2EMF A;  4IJD A;  4F6N A;  2ENC A;  2EN1 A;  2A25 A;  1JK1 A;  4M9V C;  1ZAA C;  4R2A A;  1G2F C;  4R2S A;  2EM0 A;  2EMX A;  2YRH A;  2YTO A;  1DGC A;  1A1L A;  2EM8 A;  2E72 A;  4R2C A;  1AAY A;  1BBO A;  5KL7 A;  2EN8 A;  2CT1 A;  2LCE A;  1A1J A;  2CSH A;  2MKN A;  2EM2 A;  2D9H A;  2LO3 A;  2EMK A;  2YTD A;  3EPH A;  2YTQ A;  2EOX A;  2BB8 A;  2EPX A;  2WBU A;  2DGC A;  2YTJ A;  1WJP A;  4R2E A;  2EP3 A;  2JPA A;  4R2P A;  2EML A;  4F2J C;  2EOI A;  2EMY A;  2I13 A;  2DLQ A;  2YSO A;  1X5W A;  1X6H A;  2MDG A;  2WCC 3;  1X6F A;  2EJ4 A;  2PRT A;  1BB8 A;  1X3C A;  2ENA A;  2EOO A;  2R1F A;  2YU8 A;  2WBS A;  3EPJ A;  5KL5 A;  2EPZ A;  1Z1B A;  1B69 A;  4F6M A;  2EOE A;  2EMW A;  2EL4 A;  2RSI A;  2EPU A;  3MHS C;  1F2I G;  1LLM C;  2EN4 A;  2EM6 A;  1KJK A;  1P47 A;  1A1K A;  1UBD C;  2EM5 A;  2EN3 A;  2EOR A;  5KL6 A;  1RMD A;  2YTP A;  2EL5 A;  1NCS A;  1YSA C;  3EPK A;  2EN2 A;  2YTG A;  2EOQ A;  5KL4 A;  1TN9 A;  2EPR A;  1YUJ A;  2EMH A;  1UN6 B;  2YTN A;  2ELZ A;  2YTE A;  4R2D A;  2EPC A;  4FK5 C;  4GZN C;  2EE8 A;  2M9A A;  2EOY A;  2LV2 A;  2EQ0 A;  2EOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...