1A1HA

Qgsr (zif268 variant) zinc finger-dna complex (gcac site)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
85
structure length
85
Chain Sequence
RPYACPVESCDRRFSQSGSLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*AP*C)-3')
total genus 26
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1hA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1hA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1hA03
1G2FC 1TF3A 2YRKA 2YU8A 1ZAAC 2CSHA 2EQ1A 2YTOA 2EOOA 1NCSA 2EQ0A 2DLKA 3EPJA 1A1IA 2LCEA 2EM7A 2YTPA 2LV2A 2YU5A 5KL4A 1RMDA 4R2RA 4F2JC 2NABA 1G2DC 2E72A 2EN4A 2WCC3 4R2QA 2EOEA 5KL3A 3M99B 2EOSA 4F6MA 2YTEA 2EMYA 3MHSC 1YSAC 2WBUA 2ADRA 2LT7A 1A1FA 1UN6B 2PRTA 5KL6A 3EPKA 4IS1C 2ELZA 2EMBA 2EMIA 2LO3A 1KJKA 1B69A 2EPAA 2RSIA 1Z1BA 2EMXA 2EN3A 3EPLA 1X3CA 2EMKA 2I13A 2YTGA 2EM9A 4IJDA 2EPUA 2MKDA 2GLIA 2J7JA 2YTNA 2YRHA 2YSPA 2ENHA 1BBOA 1A1JA 2EPPA 1TF6A 2EL5A 2EN7A 4R2SA 4WSGA 2JP9A 2BB8A 2EOYA 2EL6A 2YTFA 2EE8A 2M9AA 2EM0A 2EPCA 2EPZA 1JK1A 2EOQA 2EMLA 5KL2A 1A1LA 1YUIA 1X6FA 2RPCA 2YTJA 3UK3C 2EL4A 2DGCA 2EOMA 2YSOA 1A1KA 1JK2A 2EM8A 2EM4A 2EOIA 2YTDA 1P47A 2EOHA 1LLMC 2DRPA 2EPRA 2EM3A 2EORA 2EM5A 4FK5C 1A1HA 2CTDA 2A25A 2EOFA 2EQ3A 2EOZA 2YTIA 2EMWA 2D9HA 2CT1A 2EM6A 2EOJA 4R2AA 4GZNC 2EM2A 1X6EA 2EN8A 1YUJA 2EMAA 2YTQA 2EMHA 1BB8A 5KL7A 2EOXA 1WJPA 1A1GA 2WBTA 4R2DA 2ELYA 2EMCA 2MKNA 2GHFA 2EP3A 2DLQA 2LVHA 1ZU1A 2MDGA 2JPAA 2EN2A 1TN9A 4F6NA 4R2CA 3VHTB 2ENCA 2VRDA 1UBDC 2R1FA 1DGCA 2EJ4A 2EN1A 2EPXA 3MHHC 3EPHA 2ENAA 2EMZA 1X5WA 4R2EA 4M9VC 1MEYC 1F2IG 2HGHA 2WBSA 4R2PA 2EN6A 2EMGA 2DMIA 1X6HA 2YRMA 5KL5A 1ZR9A 4X9JA 2EMFA 1AAYA
chains in the Genus database with same CATH superfamily
1G2FC 2FTXB 2V88A 1IBLE 1ZAAC 2EPKX 2EQ1A 2YTOA 5IT9C 2EQ0A 1A1IA 2LCEA 2EM7A 5TSEA 2V87A 2YTPA 4O5GA 2LV2A 3J7Yp 1HNZE 5KL4A 4R2RA 5LLQA 5A6KA 4LF6E 1PJQA 2MC5A 2EN4A 4N4RB 4R2QA 3M99B 4JI6E 2EOSA 3H09A 4F6MA 4JI3E 4BMJA 1YSAC 2FV4B 1ZBTA 2LUPB 2L2MA 5AC5A 1A1FA 1UN6B 4DR6E 5KL6A 2YT4A 2VQEE 4WX9A 2DMYA 2EWLA 4IS1C 2EMBA 1EH8A 2EMIA 2LO3A 4JI4E 1N34E 2HHHE 1KJKA 2RSIA 1Z1BA 2E1MA 2EMXA 4DV7E 2KOUA 4LTYA 4M0VA 5ADZA 3KZZA 2EM9A 4IJDA 2MKDA 5AE2A 3L00A 2YSPA 4ZYHA 2E5LE 2MC6A 2UUCE 4M30A 2JVAA 2EN7A 2ODRC 1PJTA 2BBGA 2M9AA 5IWAE 2EM0A 2F8BA 2V8QB 4JI5E 2EOQA 1YUIA 1X6FA 3JTZA 4O24A 4Q28A 3UK3C 3DJWA 2EOMA 3MSWA 1JK2A 4BCAA 3OTOE 1UHZA 4DR2E 2EM4A 1N32E 2EOIA 2JR1A 1P47A 2EPRA 1WRJA 1A1HA 2YTIA 2EOFA 2EQ3A 2UXCE 2EMWA 2EM6A 2EN8A 4LF5E 2RS6A 2NUFA 4B3ME 4GKKE 4LF4E 2EOXA 1A1GA 2G7HA 4WXCA 2EMCA 2UXDE 2DIXA 4YY3E 1ZU1A 2MDGA 2VQFE 4JI1E 1IQOA 3C4TA 5A2QC 2Q8UA 3C6KA 1WHNA 2EPXA 3EPHA 2RS7A 2ENAA 1IBME 2KONA 3HPSA 4RHBB 1T4OA 2HJJA 2UU9E 1X6HA 2YRMA 4X64E 2VF1A 1AAYA 4DR4E 2K7IA 4I8OA 1TF3A 4JYAE 2YRKA 2YU8A 4DV3E 2CSHA 5A6BA 2L8TA 1QU6A 2UXBE 5IV8B 1GQEA 2E72A 2L3CA 2WCC3 2EOEA 1EKZA 1N3GA 4LFCE 2B9DA 2N3HA 1EH7A 1PDAA 2IHR1 4DV0E 2V86A 1WXRA 2ADRA 1BBGA 2LT7A 1XMQE 2PRTA 5T6JA 1DI2A 2LE2A 3FIGA 4JI0E 4BHBA 3THOB 4DMIA 2EPAA 4R03A 3AUZA 1SFEA 2UUBE 1IQSA 4B3RE 3EPLA 4NZVA 2I13A 2R76A 1XNRE 2YTGA 2EPUA 1NEIA 2YRHA 4TUGA 3JAMC 3JU0A 1L4SA 2EL5A 2V89A 4LF8E 3J80C 2RQLA 2EE8A 1J5EE 2EPNA 4L8NA 1JK1A 2JOXA 2F4VE 4P7DA 4WFTA 2LRSA 2V85A 4DR3E 2YTJA 2NUGA 4DV6E 2YSOA 5AASA 2NUEA 4WYQB 2EM8A 1IMUA 1XMOE 1HNXE 3AV0A 2YZTA 2ODRD 2EM3A 4BHCA 2EORA 2EM5A 2CTDA 4GZNC 2EOJA 4DV4E 5AE3A 2L2NA 1X6EA 4DR5E 3DF6A 2CPNA 1T38A 3IWDA 2WBTA 3BGHA 1N36E 1YYKA 4LFAE 4LU9A 5AE1A 4X65E 2EP3A 5DNYA 3HTXA 2LVHA 1YPNA 2EN2A 4F6NA 2RTXA 2ENCA 2FGGA 2VRDA 5CFFE 3HXLA 5LL6R 1DGCA 2EN1A 4F54A 2WZOA 4R2EA 4OX9E 2WBSA 2M7QA 1ZBQA 5IXMB 1T4LB 2EPLX 3J81C 2KHXA 3HPZA 1IBKE 4JI2E 4ZYDA 3IWCA 2LBSB 3IWBA 4LF7E 1GZ6A 3C6MA 3EPJA 4DV1E 4YHHE 2YU5A 4F9AB 1RMDA 4NXNE 3KZYA 1PKPA 5A6JA 1X48A 1X47A 1GTKA 2L33A 1UILA 3F6HA 1J26A 4NHRA 4AQYE 3EPKA 4O4KA 3F6GA 1B69A 1X3CA 1FKAE 1I94E 2JY9A 2LUQA 2L6MA 4ZYGA 2J7JA 2V83A 2YTNA 3VYYA 2B7TA 2YPNA 4OOGC 1A1JA 2EPPA 1MGTA 3THNA 2JXPA 4WSGA 4X62E 1DQ3A 1RC7A 2EPCA 4NXME 2EPZA 1T4NA 2DSYA 4JI7E 5KL2A 2RPCA 1AH5A 2EL4A 4M2ZA 5LMNE 2H36X 2EOHA 4HTGA 4KZSA 4FK5C 3LLHA 2EOZA 2D9HA 2CT1A 3J7AG 1FJGE 1X49A 2EMAA 4TUIA 2EMHA 2RSMA 5BR8E 2EZ6A 5A6AA 1BB8A 5KL7A 4DV2E 3ADIA 2MDRA 4HEIA 2ELYA 2MKNA 3BBGA 2JPAA 2L2KB 1TN9A 4R2CA 2N3GA 3RMPA 2LTRA 1UBDC 2R1FA 5F3WA 2I9IA 1YYOA 4BC7A 4WPYA 2EMZA 1X5WA 4M9VC 4JV5E 4DR1E 1YFHA 2HGHA 4L5NC 2DMIA 5KL5A 3P1XA 3C4BA 1ZR9A 4X9JA 2EPOA 4F9CB 2EMFA 3VYXA 2M1SA 2YWQA 4KHPE 2VE7C 1KYQA 2ZM6E 2EOOA 1NCSA 2DLKA 4P78A 4WSPA 3EQ1A 2JWOA 1EH6A 3LMLA 4GEQB 2B3TB 4F2JC 2NABA 1G2DC 2JYAA 2GPIA 4GKJE 4BS9A 5A6BD 5KL3A 2M4IA 2YTEA 2EMYA 4ZYEA 3T1YE 3MHSC 2WBUA 2DB2A 2L3JA 4B3TE 1YZ9A 3T1HE 3QG5C 4KWYA 2ELZA 3ZOQB 4JI8E 1WHQA 4DUZE 2HC5A 5A69A 2L92A 2EN3A 2EMKA 5AC4A 2B7VA 1STUA 4BBYA 2GLIA 4R8OA 1PJSA 5FLXC 4X8WA 2ENHA 3BIDA 4LFBE 1BBOA 1TF6A 2LMZA 3ADLA 1RQ0A 4LF9E 4R2SA 3OMLA 2JP9A 2N8XA 2BB8A 2EOYA 2EL6A 2YTFA 4DR7E 4DV5E 4DUYE 2JOBA 2EMLA 4J8ZA 1A1LA 3VK6A 4X66E 2LJHA 2DGCA 3HQ1A 2K4VA 3ADGA 1A1KA 3TQMA 5LMUE 4BC9A 2YTDA 1LLMC 2DRPA 2NA2A 2A25A 3K6QA 4R2AA 3ADJA 4K0KE 3BF2A 1XNQE 4MLQA 2EM2A 2UUAE 1T39A 1YUJA 2YTQA 4F9BB 4B3SE 1QNTA 2LTSA 2EPMX 1O0WA 4MLVA 1WJPA 4WXDA 4R2DA 3ECRA 2GHFA 2DLQA 4DKKA 1HR0E 3VHTB 1HNWE 2EJ4A 4O43A 3MHHC 1YYWA 1SR9A 4Q35B 3KWRA 1MEYC 1F2IG 4R2PA 2EN6A 2LJUA 2EMGA 1N33E 4RH8A
chains in the Genus database with same CATH topology
1G2FC 1TF3A 2YRKA 2YU8A 1ZAAC 2CSHA 2EQ1A 2YTOA 2EOOA 1NCSA 2EQ0A 2DLKA 3EPJA 1A1IA 2LCEA 2EM7A 2YTPA 2LV2A 2YU5A 5KL4A 1RMDA 4R2RA 4F2JC 2NABA 1G2DC 2E72A 2EN4A 2WCC3 4R2QA 2EOEA 5KL3A 3M99B 2EOSA 4F6MA 2YTEA 2EMYA 3MHSC 1YSAC 2WBUA 2ADRA 2LT7A 1A1FA 1UN6B 2PRTA 5KL6A 3EPKA 4IS1C 2ELZA 2EMBA 2EMIA 2LO3A 1KJKA 1B69A 2EPAA 2RSIA 1Z1BA 2EMXA 2EN3A 3EPLA 1X3CA 2EMKA 2I13A 2YTGA 2EM9A 4IJDA 2EPUA 2MKDA 2GLIA 2J7JA 2YTNA 2YRHA 2YSPA 2ENHA 1BBOA 1A1JA 2EPPA 1TF6A 2EL5A 2EN7A 4R2SA 4WSGA 2JP9A 2BB8A 2EOYA 2EL6A 2YTFA 2EE8A 2M9AA 2EM0A 2EPCA 2EPZA 1JK1A 2EOQA 2EMLA 5KL2A 1A1LA 1YUIA 1X6FA 2RPCA 2YTJA 3UK3C 2EL4A 2DGCA 2EOMA 2YSOA 1A1KA 1JK2A 2EM8A 2EM4A 2EOIA 2YTDA 1P47A 2EOHA 1LLMC 2DRPA 2EPRA 2EM3A 2EORA 2EM5A 4FK5C 1A1HA 2CTDA 2A25A 2EOFA 2EQ3A 2EOZA 2YTIA 2EMWA 2D9HA 2CT1A 2EM6A 2EOJA 4R2AA 4GZNC 2EM2A 1X6EA 2EN8A 1YUJA 2EMAA 2YTQA 2EMHA 1BB8A 5KL7A 2EOXA 1WJPA 1A1GA 2WBTA 4R2DA 2ELYA 2EMCA 2MKNA 2GHFA 2EP3A 2DLQA 2LVHA 1ZU1A 2MDGA 2JPAA 2EN2A 1TN9A 4F6NA 4R2CA 3VHTB 2ENCA 2VRDA 1UBDC 2R1FA 1DGCA 2EJ4A 2EN1A 2EPXA 3MHHC 3EPHA 2ENAA 2EMZA 1X5WA 4R2EA 4M9VC 1MEYC 1F2IG 2HGHA 2WBSA 4R2PA 2EN6A 2EMGA 2DMIA 1X6HA 2YRMA 5KL5A 1ZR9A 4X9JA 2EMFA 1AAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2F C;  1TF3 A;  2YRK A;  2YU8 A;  1ZAA C;  2CSH A;  2EQ1 A;  2YTO A;  2EOO A;  1NCS A;  2EQ0 A;  2DLK A;  3EPJ A;  1A1I A;  2LCE A;  2EM7 A;  2YTP A;  2LV2 A;  2YU5 A;  5KL4 A;  1RMD A;  4R2R A;  4F2J C;  2NAB A;  1G2D C;  2E72 A;  2EN4 A;  2WCC 3;  4R2Q A;  2EOE A;  5KL3 A;  3M99 B;  2EOS A;  4F6M A;  2YTE A;  2EMY A;  3MHS C;  1YSA C;  2WBU A;  2ADR A;  2LT7 A;  1A1F A;  1UN6 B;  2PRT A;  5KL6 A;  3EPK A;  4IS1 C;  2ELZ A;  2EMB A;  2EMI A;  2LO3 A;  1KJK A;  1B69 A;  2EPA A;  2RSI A;  1Z1B A;  2EMX A;  2EN3 A;  3EPL A;  1X3C A;  2EMK A;  2I13 A;  2YTG A;  2EM9 A;  4IJD A;  2EPU A;  2MKD A;  2GLI A;  2J7J A;  2YTN A;  2YRH A;  2YSP A;  2ENH A;  1BBO A;  1A1J A;  2EPP A;  1TF6 A;  2EL5 A;  2EN7 A;  4R2S A;  4WSG A;  2JP9 A;  2BB8 A;  2EOY A;  2EL6 A;  2YTF A;  2EE8 A;  2M9A A;  2EM0 A;  2EPC A;  2EPZ A;  1JK1 A;  2EOQ A;  2EML A;  5KL2 A;  1A1L A;  1YUI A;  1X6F A;  2RPC A;  2YTJ A;  3UK3 C;  2EL4 A;  2DGC A;  2EOM A;  2YSO A;  1A1K A;  1JK2 A;  2EM8 A;  2EM4 A;  2EOI A;  2YTD A;  1P47 A;  2EOH A;  1LLM C;  2DRP A;  2EPR A;  2EM3 A;  2EOR A;  2EM5 A;  4FK5 C;  1A1H A;  2CTD A;  2A25 A;  2EOF A;  2EQ3 A;  2EOZ A;  2YTI A;  2EMW A;  2D9H A;  2CT1 A;  2EM6 A;  2EOJ A;  4R2A A;  4GZN C;  2EM2 A;  1X6E A;  2EN8 A;  1YUJ A;  2EMA A;  2YTQ A;  2EMH A;  1BB8 A;  5KL7 A;  2EOX A;  1WJP A;  1A1G A;  2WBT A;  4R2D A;  2ELY A;  2EMC A;  2MKN A;  2GHF A;  2EP3 A;  2DLQ A;  2LVH A;  1ZU1 A;  2MDG A;  2JPA A;  2EN2 A;  1TN9 A;  4F6N A;  4R2C A;  3VHT B;  2ENC A;  2VRD A;  1UBD C;  2R1F A;  1DGC A;  2EJ4 A;  2EN1 A;  2EPX A;  3MHH C;  3EPH A;  2ENA A;  2EMZ A;  1X5W A;  4R2E A;  4M9V C;  1MEY C;  1F2I G;  2HGH A;  2WBS A;  4R2P A;  2EN6 A;  2EMG A;  2DMI A;  1X6H A;  2YRM A;  5KL5 A;  1ZR9 A;  4X9J A;  2EMF A;  1AAY A; 
#chains in the Genus database with same CATH topology
 1G2F C;  2FTX B;  2V88 A;  1IBL E;  1ZAA C;  2EPK X;  2EQ1 A;  2YTO A;  5IT9 C;  2EQ0 A;  1A1I A;  2LCE A;  2EM7 A;  5TSE A;  2V87 A;  2YTP A;  4O5G A;  2LV2 A;  3J7Y p;  1HNZ E;  5KL4 A;  4R2R A;  5LLQ A;  5A6K A;  4LF6 E;  1PJQ A;  2MC5 A;  2EN4 A;  4N4R B;  4R2Q A;  3M99 B;  4JI6 E;  2EOS A;  3H09 A;  4F6M A;  4JI3 E;  4BMJ A;  1YSA C;  2FV4 B;  1ZBT A;  2LUP B;  2L2M A;  5AC5 A;  1A1F A;  1UN6 B;  4DR6 E;  5KL6 A;  2YT4 A;  2VQE E;  4WX9 A;  2DMY A;  2EWL A;  4IS1 C;  2EMB A;  1EH8 A;  2EMI A;  2LO3 A;  4JI4 E;  1N34 E;  2HHH E;  1KJK A;  2RSI A;  1Z1B A;  2E1M A;  2EMX A;  4DV7 E;  2KOU A;  4LTY A;  4M0V A;  5ADZ A;  3KZZ A;  2EM9 A;  4IJD A;  2MKD A;  5AE2 A;  3L00 A;  2YSP A;  4ZYH A;  2E5L E;  2MC6 A;  2UUC E;  4M30 A;  2JVA A;  2EN7 A;  2ODR C;  1PJT A;  2BBG A;  2M9A A;  5IWA E;  2EM0 A;  2F8B A;  2V8Q B;  4JI5 E;  2EOQ A;  1YUI A;  1X6F A;  3JTZ A;  4O24 A;  4Q28 A;  3UK3 C;  3DJW A;  2EOM A;  3MSW A;  1JK2 A;  4BCA A;  3OTO E;  1UHZ A;  4DR2 E;  2EM4 A;  1N32 E;  2EOI A;  2JR1 A;  1P47 A;  2EPR A;  1WRJ A;  1A1H A;  2YTI A;  2EOF A;  2EQ3 A;  2UXC E;  2EMW A;  2EM6 A;  2EN8 A;  4LF5 E;  2RS6 A;  2NUF A;  4B3M E;  4GKK E;  4LF4 E;  2EOX A;  1A1G A;  2G7H A;  4WXC A;  2EMC A;  2UXD E;  2DIX A;  4YY3 E;  1ZU1 A;  2MDG A;  2VQF E;  4JI1 E;  1IQO A;  3C4T A;  5A2Q C;  2Q8U A;  3C6K A;  1WHN A;  2EPX A;  3EPH A;  2RS7 A;  2ENA A;  1IBM E;  2KON A;  3HPS A;  4RHB B;  1T4O A;  2HJJ A;  2UU9 E;  1X6H A;  2YRM A;  4X64 E;  2VF1 A;  1AAY A;  4DR4 E;  2K7I A;  4I8O A;  1TF3 A;  4JYA E;  2YRK A;  2YU8 A;  4DV3 E;  2CSH A;  5A6B A;  2L8T A;  1QU6 A;  2UXB E;  5IV8 B;  1GQE A;  2E72 A;  2L3C A;  2WCC 3;  2EOE A;  1EKZ A;  1N3G A;  4LFC E;  2B9D A;  2N3H A;  1EH7 A;  1PDA A;  2IHR 1;  4DV0 E;  2V86 A;  1WXR A;  2ADR A;  1BBG A;  2LT7 A;  1XMQ E;  2PRT A;  5T6J A;  1DI2 A;  2LE2 A;  3FIG A;  4JI0 E;  4BHB A;  3THO B;  4DMI A;  2EPA A;  4R03 A;  3AUZ A;  1SFE A;  2UUB E;  1IQS A;  4B3R E;  3EPL A;  4NZV A;  2I13 A;  2R76 A;  1XNR E;  2YTG A;  2EPU A;  1NEI A;  2YRH A;  4TUG A;  3JAM C;  3JU0 A;  1L4S A;  2EL5 A;  2V89 A;  4LF8 E;  3J80 C;  2RQL A;  2EE8 A;  1J5E E;  2EPN A;  4L8N A;  1JK1 A;  2JOX A;  2F4V E;  4P7D A;  4WFT A;  2LRS A;  2V85 A;  4DR3 E;  2YTJ A;  2NUG A;  4DV6 E;  2YSO A;  5AAS A;  2NUE A;  4WYQ B;  2EM8 A;  1IMU A;  1XMO E;  1HNX E;  3AV0 A;  2YZT A;  2ODR D;  2EM3 A;  4BHC A;  2EOR A;  2EM5 A;  2CTD A;  4GZN C;  2EOJ A;  4DV4 E;  5AE3 A;  2L2N A;  1X6E A;  4DR5 E;  3DF6 A;  2CPN A;  1T38 A;  3IWD A;  2WBT A;  3BGH A;  1N36 E;  1YYK A;  4LFA E;  4LU9 A;  5AE1 A;  4X65 E;  2EP3 A;  5DNY A;  3HTX A;  2LVH A;  1YPN A;  2EN2 A;  4F6N A;  2RTX A;  2ENC A;  2FGG A;  2VRD A;  5CFF E;  3HXL A;  5LL6 R;  1DGC A;  2EN1 A;  4F54 A;  2WZO A;  4R2E A;  4OX9 E;  2WBS A;  2M7Q A;  1ZBQ A;  5IXM B;  1T4L B;  2EPL X;  3J81 C;  2KHX A;  3HPZ A;  1IBK E;  4JI2 E;  4ZYD A;  3IWC A;  2LBS B;  3IWB A;  4LF7 E;  1GZ6 A;  3C6M A;  3EPJ A;  4DV1 E;  4YHH E;  2YU5 A;  4F9A B;  1RMD A;  4NXN E;  3KZY A;  1PKP A;  5A6J A;  1X48 A;  1X47 A;  1GTK A;  2L33 A;  1UIL A;  3F6H A;  1J26 A;  4NHR A;  4AQY E;  3EPK A;  4O4K A;  3F6G A;  1B69 A;  1X3C A;  1FKA E;  1I94 E;  2JY9 A;  2LUQ A;  2L6M A;  4ZYG A;  2J7J A;  2V83 A;  2YTN A;  3VYY A;  2B7T A;  2YPN A;  4OOG C;  1A1J A;  2EPP A;  1MGT A;  3THN A;  2JXP A;  4WSG A;  4X62 E;  1DQ3 A;  1RC7 A;  2EPC A;  4NXM E;  2EPZ A;  1T4N A;  2DSY A;  4JI7 E;  5KL2 A;  2RPC A;  1AH5 A;  2EL4 A;  4M2Z A;  5LMN E;  2H36 X;  2EOH A;  4HTG A;  4KZS A;  4FK5 C;  3LLH A;  2EOZ A;  2D9H A;  2CT1 A;  3J7A G;  1FJG E;  1X49 A;  2EMA A;  4TUI A;  2EMH A;  2RSM A;  5BR8 E;  2EZ6 A;  5A6A A;  1BB8 A;  5KL7 A;  4DV2 E;  3ADI A;  2MDR A;  4HEI A;  2ELY A;  2MKN A;  3BBG A;  2JPA A;  2L2K B;  1TN9 A;  4R2C A;  2N3G A;  3RMP A;  2LTR A;  1UBD C;  2R1F A;  5F3W A;  2I9I A;  1YYO A;  4BC7 A;  4WPY A;  2EMZ A;  1X5W A;  4M9V C;  4JV5 E;  4DR1 E;  1YFH A;  2HGH A;  4L5N C;  2DMI A;  5KL5 A;  3P1X A;  3C4B A;  1ZR9 A;  4X9J A;  2EPO A;  4F9C B;  2EMF A;  3VYX A;  2M1S A;  2YWQ A;  4KHP E;  2VE7 C;  1KYQ A;  2ZM6 E;  2EOO A;  1NCS A;  2DLK A;  4P78 A;  4WSP A;  3EQ1 A;  2JWO A;  1EH6 A;  3LML A;  4GEQ B;  2B3T B;  4F2J C;  2NAB A;  1G2D C;  2JYA A;  2GPI A;  4GKJ E;  4BS9 A;  5A6B D;  5KL3 A;  2M4I A;  2YTE A;  2EMY A;  4ZYE A;  3T1Y E;  3MHS C;  2WBU A;  2DB2 A;  2L3J A;  4B3T E;  1YZ9 A;  3T1H E;  3QG5 C;  4KWY A;  2ELZ A;  3ZOQ B;  4JI8 E;  1WHQ A;  4DUZ E;  2HC5 A;  5A69 A;  2L92 A;  2EN3 A;  2EMK A;  5AC4 A;  2B7V A;  1STU A;  4BBY A;  2GLI A;  4R8O A;  1PJS A;  5FLX C;  4X8W A;  2ENH A;  3BID A;  4LFB E;  1BBO A;  1TF6 A;  2LMZ A;  3ADL A;  1RQ0 A;  4LF9 E;  4R2S A;  3OML A;  2JP9 A;  2N8X A;  2BB8 A;  2EOY A;  2EL6 A;  2YTF A;  4DR7 E;  4DV5 E;  4DUY E;  2JOB A;  2EML A;  4J8Z A;  1A1L A;  3VK6 A;  4X66 E;  2LJH A;  2DGC A;  3HQ1 A;  2K4V A;  3ADG A;  1A1K A;  3TQM A;  5LMU E;  4BC9 A;  2YTD A;  1LLM C;  2DRP A;  2NA2 A;  2A25 A;  3K6Q A;  4R2A A;  3ADJ A;  4K0K E;  3BF2 A;  1XNQ E;  4MLQ A;  2EM2 A;  2UUA E;  1T39 A;  1YUJ A;  2YTQ A;  4F9B B;  4B3S E;  1QNT A;  2LTS A;  2EPM X;  1O0W A;  4MLV A;  1WJP A;  4WXD A;  4R2D A;  3ECR A;  2GHF A;  2DLQ A;  4DKK A;  1HR0 E;  3VHT B;  1HNW E;  2EJ4 A;  4O43 A;  3MHH C;  1YYW A;  1SR9 A;  4Q35 B;  3KWR A;  1MEY C;  1F2I G;  4R2P A;  2EN6 A;  2LJU A;  2EMG A;  1N33 E;  4RH8 A; 
#chains in the Genus database with same CATH homology
 1G2F C;  1TF3 A;  2YRK A;  2YU8 A;  1ZAA C;  2CSH A;  2EQ1 A;  2YTO A;  2EOO A;  1NCS A;  2EQ0 A;  2DLK A;  3EPJ A;  1A1I A;  2LCE A;  2EM7 A;  2YTP A;  2LV2 A;  2YU5 A;  5KL4 A;  1RMD A;  4R2R A;  4F2J C;  2NAB A;  1G2D C;  2E72 A;  2EN4 A;  2WCC 3;  4R2Q A;  2EOE A;  5KL3 A;  3M99 B;  2EOS A;  4F6M A;  2YTE A;  2EMY A;  3MHS C;  1YSA C;  2WBU A;  2ADR A;  2LT7 A;  1A1F A;  1UN6 B;  2PRT A;  5KL6 A;  3EPK A;  4IS1 C;  2ELZ A;  2EMB A;  2EMI A;  2LO3 A;  1KJK A;  1B69 A;  2EPA A;  2RSI A;  1Z1B A;  2EMX A;  2EN3 A;  3EPL A;  1X3C A;  2EMK A;  2I13 A;  2YTG A;  2EM9 A;  4IJD A;  2EPU A;  2MKD A;  2GLI A;  2J7J A;  2YTN A;  2YRH A;  2YSP A;  2ENH A;  1BBO A;  1A1J A;  2EPP A;  1TF6 A;  2EL5 A;  2EN7 A;  4R2S A;  4WSG A;  2JP9 A;  2BB8 A;  2EOY A;  2EL6 A;  2YTF A;  2EE8 A;  2M9A A;  2EM0 A;  2EPC A;  2EPZ A;  1JK1 A;  2EOQ A;  2EML A;  5KL2 A;  1A1L A;  1YUI A;  1X6F A;  2RPC A;  2YTJ A;  3UK3 C;  2EL4 A;  2DGC A;  2EOM A;  2YSO A;  1A1K A;  1JK2 A;  2EM8 A;  2EM4 A;  2EOI A;  2YTD A;  1P47 A;  2EOH A;  1LLM C;  2DRP A;  2EPR A;  2EM3 A;  2EOR A;  2EM5 A;  4FK5 C;  1A1H A;  2CTD A;  2A25 A;  2EOF A;  2EQ3 A;  2EOZ A;  2YTI A;  2EMW A;  2D9H A;  2CT1 A;  2EM6 A;  2EOJ A;  4R2A A;  4GZN C;  2EM2 A;  1X6E A;  2EN8 A;  1YUJ A;  2EMA A;  2YTQ A;  2EMH A;  1BB8 A;  5KL7 A;  2EOX A;  1WJP A;  1A1G A;  2WBT A;  4R2D A;  2ELY A;  2EMC A;  2MKN A;  2GHF A;  2EP3 A;  2DLQ A;  2LVH A;  1ZU1 A;  2MDG A;  2JPA A;  2EN2 A;  1TN9 A;  4F6N A;  4R2C A;  3VHT B;  2ENC A;  2VRD A;  1UBD C;  2R1F A;  1DGC A;  2EJ4 A;  2EN1 A;  2EPX A;  3MHH C;  3EPH A;  2ENA A;  2EMZ A;  1X5W A;  4R2E A;  4M9V C;  1MEY C;  1F2I G;  2HGH A;  2WBS A;  4R2P A;  2EN6 A;  2EMG A;  2DMI A;  1X6H A;  2YRM A;  5KL5 A;  1ZR9 A;  4X9J A;  2EMF A;  1AAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...