1A1HA

Qgsr (zif268 variant) zinc finger-dna complex (gcac site)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
85
structure length
85
Chain Sequence
RPYACPVESCDRRFSQSGSLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*AP*C)-3')
publication title High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
total genus 26
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1hA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1hA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1hA03
2EPZA 2GHFA 2EPCA 1YUIA 2EQ0A 1WJPA 2RPCA 2DLKA 1TF6A 1X6FA 2EL4A 1A1JA 2WBTA 4M9VC 2EL6A 2ELZA 4R2PA 3EPHA 2EOXA 2DLQA 1A1HA 2MDGA 2LCEA 2EN2A 2ENCA 2EOJA 2EMGA 2PRTA 2EMBA 2YRMA 2EM4A 2R1FA 5KL2A 5KL3A 1X3CA 2YTQA 4WSGA 2EM0A 2D9HA 1YSAC 3EPLA 1JK2A 2WBUA 2EOFA 2EP3A 2ADRA 1X6EA 1MEYC 2EOZA 2EOIA 4R2RA 3EPKA 1UN6B 2EN4A 1RMDA 2LO3A 4GZNC 2CT1A 1DGCA 1X6HA 2EM6A 2EMZA 4R2AA 1G2FC 2EQ3A 4IJDA 2YRKA 2WCC3 1KJKA 1X5WA 2EOYA 2YRHA 2BB8A 2YTEA 2EOMA 5KL5A 2HGHA 2YTDA 4F2JC 2NABA 2A25A 2EMFA 1B69A 4R2SA 1UBDC 2I13A 2ENAA 2J7JA 2MKNA 2EMWA 1NCSA 2EN8A 2EJ4A 2EOOA 4R2EA 2E72A 2CSHA 2YSOA 2EN3A 2EPUA 3UK3C 2MKDA 2CTDA 2DMIA 2EOSA 2EMLA 2EMCA 1G2DC 2EL5A 4R2QA 2LV2A 1ZAAC 3MHHC 1A1GA 2RSIA 2JP9A 2EQ1A 2DRPA 2YSPA 2YTNA 2YTGA 1BB8A 2EMKA 2YU5A 3MHSC 2GLIA 2EPRA 2EPXA 5KL7A 1BBOA 1ZR9A 2EN1A 2EMAA 2LT7A 1LLMC 1F2IG 2EE8A 1ZU1A 4F6MA 1AAYA 2EMHA 4IS1C 2EMXA 1A1IA 2EMYA 1P47A 3M99B 2EM8A 2EM9A 1TF3A 2EN6A 2YTFA 2ELYA 2EORA 5KL6A 3VHTB 1JK1A 2WBSA 4R2DA 2EM7A 2LVHA 2ENHA 2M9AA 2EN7A 3EPJA 2EPPA 2YTJA 4R2CA 4X9JA 1TN9A 4FK5C 2EOQA 1Z1BA 2YU8A 2EM2A 1YUJA 2VRDA 2YTOA 2JPAA 2YTIA 2EOHA 2EOEA 4F6NA 2EMIA 2EM5A 1A1LA 2YTPA 2EM3A 1A1FA 2DGCA 5KL4A 1A1KA 2EPAA
chains in the Genus database with same CATH superfamily
4X62E 2EQ0A 2DLKA 1X48A 1X6FA 2EPMX 2LJUA 1FJGE 1IBLE 4O4KA 3THOB 3C6MA 5CFFE 4TUGA 3J80C 4BMJA 3ADLA 4P7DA 2EP3A 2ADRA 2EOZA 4JI2E 4X64E 1RMDA 2CT1A 1X49A 2BBGA 5A6BD 1N33E 3VK6A 4LF9E 2B9DA 2EOYA 4DR6E 4OX9E 1XNRE 4DV1E 2FV4B 3BIDA 1EKZA 1MGTA 4O24A 5AASA 2NABA 1DQ3A 3RMPA 4R2SA 1I94E 2UUAE 4LTYA 2J7JA 2MKNA 4NXME 3UK3C 5LMUE 2CTDA 1T4OA 2RTXA 2DMIA 2EOSA 2EMLA 3KWRA 5A6AA 5IV8B 1ZAAC 3MHHC 1IQSA 1IQOA 3KZYA 1UILA 2V83A 2YSPA 1QNTA 2JWOA 2YU5A 1BBOA 1KYQA 1ZR9A 4F9AB 4ZYDA 1LLMC 4DV7E 1F2IG 3J7AG 1YYOA 4DMIA 4ZYHA 2V88A 3BGHA 1A1IA 2EMYA 3IWBA 4B3RE 2EN6A 4JI3E 2EORA 3VHTB 2LVHA 2ENHA 3EPJA 4JI7E 2NUEA 5A6JA 2YTJA 1HNZE 4DV0E 4JI5E 4MLVA 1TN9A 5A6KA 1Z1BA 1YPNA 1YUJA 5DNYA 2YTOA 2JPAA 4AQYE 2EOHA 1AH5A 4DUZE 2EM5A 3MSWA 4WPYA 1FKAE 2EM3A 2JOXA 5LMNE 3OTOE 2EPAA 3KZZA 4ZYEA 2EPZA 3ADIA 1X47A 2LRSA 3JTZA 1N32E 2RPCA 1TF6A 4TUIA 4NXNE 3J81C 4M9VC 2LMZA 2MDGA 2YZTA 2EN2A 3JAMC 2PRTA 4O5GA 2YRMA 1PJSA 2N3GA 5AE3A 2JOBA 5KL3A 1X3CA 1O0WA 3HPSA 2VQFE 4B3SE 4LF6E 1YSAC 1XMQE 3LMLA 4HTGA 4LF7E 3HQ1A 2EPOA 3EPKA 4R2RA 1PKPA 1DGCA 2EMZA 2LUPB 1SFEA 3DJWA 1G2FC 2UUBE 5LL6R 1BBGA 2VE7C 3IWCA 2BB8A 1ZBTA 5IWAE 4F2JC 2DMYA 4L5NC 2A25A 2LBSB 1B69A 3BBGA 2I13A 2ENAA 2GPIA 4R03A 5A6BA 2EN8A 1NCSA 4J8ZA 4DV4E 2EJ4A 4RH8A 2CSHA 2YSOA 2M7QA 2EPUA 5LLQA 3F6GA 2B3TB 4KZSA 4DR3E 2NUFA 2EL5A 1PJTA 4R2QA 3QG5C 1A1GA 2ZM6E 2JYAA 2VQEE 1BB8A 3MHSC 1YYKA 2I9IA 1HR0E 2EN1A 2EMAA 3FIGA 1ZU1A 1AAYA 4M30A 2EMHA 2V85A 2FGGA 4IS1C 2EPKX 3M99B 5AE1A 2EM8A 2EM9A 5TSEA 1TF3A 2RS7A 4RHBB 4N4RB 2WBSA 1PDAA 2M9AA 2EN7A 2EPPA 1N3GA 4WX9A 2WZOA 4GKKE 1T4NA 4X9JA 2K7IA 3K6QA 2IHR1 1YFHA 2EM2A 1QU6A 4BHBA 4F9CB 2RSMA 2EPNA 2KONA 2EOEA 4DR4E 5FLXC 2L3CA 2UUCE 4M2ZA 2HC5A 2LE2A 2V86A 2YT4A 2EPLX 1IMUA 2EPCA 2L2NA 2KOUA 4JV5E 1WJPA 4DUYE 1L4SA 4DV2E 5BR8E 2EL4A 2UXDE 2L8TA 4DR1E 2LTSA 3EPHA 4F54A 5IXMB 2EOXA 3J7Yp 2DLQA 2LCEA 2L2KB 1YYWA 2EMBA 2K4VA 3BF2A 4X65E 2R1FA 2N3HA 1XMOE 4JI6E 2YTQA 3LLHA 4WSGA 3H09A 2D9HA 3EPLA 1JK2A 2M1SA 2V87A 2LUQA 2EOFA 4WXCA 3T1YE 1J26A 5ADZA 4GZNC 2LO3A 4LF5E 4DR7E 4R2AA 1SR9A 2EQ3A 4IJDA 2YRKA 3C4TA 3C4BA 1X5WA 2EOMA 2FTXB 4ZYGA 5KL5A 2HHHE 2EMFA 1UBDC 2JR1A 2RQLA 1WHNA 4DV6E 4P78A 4YY3E 1HNXE 2EOOA 4R2EA 2E72A 4JI4E 4M0VA 2EN3A 2V8QB 4DV5E 3ADGA 2H36X 1ZBQA 3EQ1A 3P1XA 3C6KA 4WFTA 4WYQB 2DRPA 2YTNA 2UXCE 2YTGA 4B3ME 2NUGA 5KL7A 4YHHE 4L8NA 1T4LB 2LT7A 5AC4A 4F9BB 2L3JA 4F6MA 2G7HA 2B7VA 3HPZA 1P47A 1IBKE 4WXDA 2EZ6A 2YTFA 2L33A 4Q28A 1N36E 1IBME 2JY9A 4DKKA 2EM7A 3VYYA 1T39A 4LU9A 1T38A 4R2CA 2ODRC 4FK5C 2EOQA 4LF8E 3JU0A 3HTXA 2V89A 2YU8A 2YWQA 1GQEA 4X8WA 4GKJE 3L00A 2LTRA 2L92A 4K0KE 2JXPA 3AUZA 2B7TA 4BC9A 2M4IA 1A1FA 2VF1A 5KL4A 1A1KA 4WSPA 3ZOQB 4DR5E 2YPNA 2GHFA 2N8XA 1YZ9A 1YUIA 2DB2A 4BHCA 5A2QC 1RC7A 1A1JA 2WBTA 4NHRA 2EL6A 2ELZA 4R2PA 1A1HA 4JI1E 2ENCA 2EOJA 2EMGA 4JYAE 2R76A 2EM4A 5F3WA 4LFBE 5KL2A 1UHZA 3F6HA 5AC5A 2DSYA 2EM0A 5AE2A 2WBUA 5A69A 1DI2A 1X6EA 3ECRA 4DV3E 1STUA 3T1HE 1EH7A 2EWLA 4Q35B 1MEYC 2EOIA 2MDRA 3THNA 1UN6B 2EN4A 2UXBE 2KHXA 4BCAA 4JI8E 3IWDA 1X6HA 2EM6A 3DF6A 4BC7A 2L6MA 4LFCE 1GZ6A 1EH6A 1WHQA 2WCC3 1KJKA 2YRHA 2YTEA 2RS6A 2HGHA 4OOGC 2YTDA 4LFAE 4BBYA 2UU9E 2NA2A 3AV0A 2E5LE 4X66E 2EMWA 1HNWE 2L2MA 1NEIA 2MC5A 3VYXA 4B3TE 2MKDA 2DIXA 2EMCA 3TQMA 1G2DC 1EH8A 2MC6A 2LV2A 2HJJA 2RSIA 2JP9A 2EQ1A 2EMKA 2LJHA 1RQ0A 4O43A 2EPRA 2EPXA 2CPNA 2Q8UA 1WXRA 2GLIA 1XNQE 4JI0E 3OMLA 2EE8A 2E1MA 5IT9C 2F8BA 2F4VE 2EMXA 2JVAA 1N34E 4MLQA 3HXLA 2ELYA 4BS9A 5KL6A 1JK1A 4NZVA 1WRJA 4GEQB 4R2DA 1J5EE 4DR2E 4HEIA 1PJQA 4LF4E 4KHPE 3ADJA 5T6JA 2VRDA 2YTIA 4I8OA 1GTKA 2ODRD 4R8OA 4F6NA 2EMIA 4KWYA 1A1LA 2YTPA 2DGCA
chains in the Genus database with same CATH topology
2EPZA 2GHFA 2EPCA 1YUIA 2EQ0A 1WJPA 2RPCA 2DLKA 1TF6A 1X6FA 2EL4A 1A1JA 2WBTA 4M9VC 2EL6A 2ELZA 4R2PA 3EPHA 2EOXA 2DLQA 1A1HA 2MDGA 2LCEA 2EN2A 2ENCA 2EOJA 2EMGA 2PRTA 2EMBA 2YRMA 2EM4A 2R1FA 5KL2A 5KL3A 1X3CA 2YTQA 4WSGA 2EM0A 2D9HA 1YSAC 3EPLA 1JK2A 2WBUA 2EOFA 2EP3A 2ADRA 1X6EA 1MEYC 2EOZA 2EOIA 4R2RA 3EPKA 1UN6B 2EN4A 1RMDA 2LO3A 4GZNC 2CT1A 1DGCA 1X6HA 2EM6A 2EMZA 4R2AA 1G2FC 2EQ3A 4IJDA 2YRKA 2WCC3 1KJKA 1X5WA 2EOYA 2YRHA 2BB8A 2YTEA 2EOMA 5KL5A 2HGHA 2YTDA 4F2JC 2NABA 2A25A 2EMFA 1B69A 4R2SA 1UBDC 2I13A 2ENAA 2J7JA 2MKNA 2EMWA 1NCSA 2EN8A 2EJ4A 2EOOA 4R2EA 2E72A 2CSHA 2YSOA 2EN3A 2EPUA 3UK3C 2MKDA 2CTDA 2DMIA 2EOSA 2EMLA 2EMCA 1G2DC 2EL5A 4R2QA 2LV2A 1ZAAC 3MHHC 1A1GA 2RSIA 2JP9A 2EQ1A 2DRPA 2YSPA 2YTNA 2YTGA 1BB8A 2EMKA 2YU5A 3MHSC 2GLIA 2EPRA 2EPXA 5KL7A 1BBOA 1ZR9A 2EN1A 2EMAA 2LT7A 1LLMC 1F2IG 2EE8A 1ZU1A 4F6MA 1AAYA 2EMHA 4IS1C 2EMXA 1A1IA 2EMYA 1P47A 3M99B 2EM8A 2EM9A 1TF3A 2EN6A 2YTFA 2ELYA 2EORA 5KL6A 3VHTB 1JK1A 2WBSA 4R2DA 2EM7A 2LVHA 2ENHA 2M9AA 2EN7A 3EPJA 2EPPA 2YTJA 4R2CA 4X9JA 1TN9A 4FK5C 2EOQA 1Z1BA 2YU8A 2EM2A 1YUJA 2VRDA 2YTOA 2JPAA 2YTIA 2EOHA 2EOEA 4F6NA 2EMIA 2EM5A 1A1LA 2YTPA 2EM3A 1A1FA 2DGCA 5KL4A 1A1KA 2EPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPZ A;  2GHF A;  2EPC A;  1YUI A;  2EQ0 A;  1WJP A;  2RPC A;  2DLK A;  1TF6 A;  1X6F A;  2EL4 A;  1A1J A;  2WBT A;  4M9V C;  2EL6 A;  2ELZ A;  4R2P A;  3EPH A;  2EOX A;  2DLQ A;  1A1H A;  2MDG A;  2LCE A;  2EN2 A;  2ENC A;  2EOJ A;  2EMG A;  2PRT A;  2EMB A;  2YRM A;  2EM4 A;  2R1F A;  5KL2 A;  5KL3 A;  1X3C A;  2YTQ A;  4WSG A;  2EM0 A;  2D9H A;  1YSA C;  3EPL A;  1JK2 A;  2WBU A;  2EOF A;  2EP3 A;  2ADR A;  1X6E A;  1MEY C;  2EOZ A;  2EOI A;  4R2R A;  3EPK A;  1UN6 B;  2EN4 A;  1RMD A;  2LO3 A;  4GZN C;  2CT1 A;  1DGC A;  1X6H A;  2EM6 A;  2EMZ A;  4R2A A;  1G2F C;  2EQ3 A;  4IJD A;  2YRK A;  2WCC 3;  1KJK A;  1X5W A;  2EOY A;  2YRH A;  2BB8 A;  2YTE A;  2EOM A;  5KL5 A;  2HGH A;  2YTD A;  4F2J C;  2NAB A;  2A25 A;  2EMF A;  1B69 A;  4R2S A;  1UBD C;  2I13 A;  2ENA A;  2J7J A;  2MKN A;  2EMW A;  1NCS A;  2EN8 A;  2EJ4 A;  2EOO A;  4R2E A;  2E72 A;  2CSH A;  2YSO A;  2EN3 A;  2EPU A;  3UK3 C;  2MKD A;  2CTD A;  2DMI A;  2EOS A;  2EML A;  2EMC A;  1G2D C;  2EL5 A;  4R2Q A;  2LV2 A;  1ZAA C;  3MHH C;  1A1G A;  2RSI A;  2JP9 A;  2EQ1 A;  2DRP A;  2YSP A;  2YTN A;  2YTG A;  1BB8 A;  2EMK A;  2YU5 A;  3MHS C;  2GLI A;  2EPR A;  2EPX A;  5KL7 A;  1BBO A;  1ZR9 A;  2EN1 A;  2EMA A;  2LT7 A;  1LLM C;  1F2I G;  2EE8 A;  1ZU1 A;  4F6M A;  1AAY A;  2EMH A;  4IS1 C;  2EMX A;  1A1I A;  2EMY A;  1P47 A;  3M99 B;  2EM8 A;  2EM9 A;  1TF3 A;  2EN6 A;  2YTF A;  2ELY A;  2EOR A;  5KL6 A;  3VHT B;  1JK1 A;  2WBS A;  4R2D A;  2EM7 A;  2LVH A;  2ENH A;  2M9A A;  2EN7 A;  3EPJ A;  2EPP A;  2YTJ A;  4R2C A;  4X9J A;  1TN9 A;  4FK5 C;  2EOQ A;  1Z1B A;  2YU8 A;  2EM2 A;  1YUJ A;  2VRD A;  2YTO A;  2JPA A;  2YTI A;  2EOH A;  2EOE A;  4F6N A;  2EMI A;  2EM5 A;  1A1L A;  2YTP A;  2EM3 A;  1A1F A;  2DGC A;  5KL4 A;  1A1K A;  2EPA A; 
#chains in the Genus database with same CATH topology
 4X62 E;  2EQ0 A;  2DLK A;  1X48 A;  1X6F A;  2EPM X;  2LJU A;  1FJG E;  1IBL E;  4O4K A;  3THO B;  3C6M A;  5CFF E;  4TUG A;  3J80 C;  4BMJ A;  3ADL A;  4P7D A;  2EP3 A;  2ADR A;  2EOZ A;  4JI2 E;  4X64 E;  1RMD A;  2CT1 A;  1X49 A;  2BBG A;  5A6B D;  1N33 E;  3VK6 A;  4LF9 E;  2B9D A;  2EOY A;  4DR6 E;  4OX9 E;  1XNR E;  4DV1 E;  2FV4 B;  3BID A;  1EKZ A;  1MGT A;  4O24 A;  5AAS A;  2NAB A;  1DQ3 A;  3RMP A;  4R2S A;  1I94 E;  2UUA E;  4LTY A;  2J7J A;  2MKN A;  4NXM E;  3UK3 C;  5LMU E;  2CTD A;  1T4O A;  2RTX A;  2DMI A;  2EOS A;  2EML A;  3KWR A;  5A6A A;  5IV8 B;  1ZAA C;  3MHH C;  1IQS A;  1IQO A;  3KZY A;  1UIL A;  2V83 A;  2YSP A;  1QNT A;  2JWO A;  2YU5 A;  1BBO A;  1KYQ A;  1ZR9 A;  4F9A B;  4ZYD A;  1LLM C;  4DV7 E;  1F2I G;  3J7A G;  1YYO A;  4DMI A;  4ZYH A;  2V88 A;  3BGH A;  1A1I A;  2EMY A;  3IWB A;  4B3R E;  2EN6 A;  4JI3 E;  2EOR A;  3VHT B;  2LVH A;  2ENH A;  3EPJ A;  4JI7 E;  2NUE A;  5A6J A;  2YTJ A;  1HNZ E;  4DV0 E;  4JI5 E;  4MLV A;  1TN9 A;  5A6K A;  1Z1B A;  1YPN A;  1YUJ A;  5DNY A;  2YTO A;  2JPA A;  4AQY E;  2EOH A;  1AH5 A;  4DUZ E;  2EM5 A;  3MSW A;  4WPY A;  1FKA E;  2EM3 A;  2JOX A;  5LMN E;  3OTO E;  2EPA A;  3KZZ A;  4ZYE A;  2EPZ A;  3ADI A;  1X47 A;  2LRS A;  3JTZ A;  1N32 E;  2RPC A;  1TF6 A;  4TUI A;  4NXN E;  3J81 C;  4M9V C;  2LMZ A;  2MDG A;  2YZT A;  2EN2 A;  3JAM C;  2PRT A;  4O5G A;  2YRM A;  1PJS A;  2N3G A;  5AE3 A;  2JOB A;  5KL3 A;  1X3C A;  1O0W A;  3HPS A;  2VQF E;  4B3S E;  4LF6 E;  1YSA C;  1XMQ E;  3LML A;  4HTG A;  4LF7 E;  3HQ1 A;  2EPO A;  3EPK A;  4R2R A;  1PKP A;  1DGC A;  2EMZ A;  2LUP B;  1SFE A;  3DJW A;  1G2F C;  2UUB E;  5LL6 R;  1BBG A;  2VE7 C;  3IWC A;  2BB8 A;  1ZBT A;  5IWA E;  4F2J C;  2DMY A;  4L5N C;  2A25 A;  2LBS B;  1B69 A;  3BBG A;  2I13 A;  2ENA A;  2GPI A;  4R03 A;  5A6B A;  2EN8 A;  1NCS A;  4J8Z A;  4DV4 E;  2EJ4 A;  4RH8 A;  2CSH A;  2YSO A;  2M7Q A;  2EPU A;  5LLQ A;  3F6G A;  2B3T B;  4KZS A;  4DR3 E;  2NUF A;  2EL5 A;  1PJT A;  4R2Q A;  3QG5 C;  1A1G A;  2ZM6 E;  2JYA A;  2VQE E;  1BB8 A;  3MHS C;  1YYK A;  2I9I A;  1HR0 E;  2EN1 A;  2EMA A;  3FIG A;  1ZU1 A;  1AAY A;  4M30 A;  2EMH A;  2V85 A;  2FGG A;  4IS1 C;  2EPK X;  3M99 B;  5AE1 A;  2EM8 A;  2EM9 A;  5TSE A;  1TF3 A;  2RS7 A;  4RHB B;  4N4R B;  2WBS A;  1PDA A;  2M9A A;  2EN7 A;  2EPP A;  1N3G A;  4WX9 A;  2WZO A;  4GKK E;  1T4N A;  4X9J A;  2K7I A;  3K6Q A;  2IHR 1;  1YFH A;  2EM2 A;  1QU6 A;  4BHB A;  4F9C B;  2RSM A;  2EPN A;  2KON A;  2EOE A;  4DR4 E;  5FLX C;  2L3C A;  2UUC E;  4M2Z A;  2HC5 A;  2LE2 A;  2V86 A;  2YT4 A;  2EPL X;  1IMU A;  2EPC A;  2L2N A;  2KOU A;  4JV5 E;  1WJP A;  4DUY E;  1L4S A;  4DV2 E;  5BR8 E;  2EL4 A;  2UXD E;  2L8T A;  4DR1 E;  2LTS A;  3EPH A;  4F54 A;  5IXM B;  2EOX A;  3J7Y p;  2DLQ A;  2LCE A;  2L2K B;  1YYW A;  2EMB A;  2K4V A;  3BF2 A;  4X65 E;  2R1F A;  2N3H A;  1XMO E;  4JI6 E;  2YTQ A;  3LLH A;  4WSG A;  3H09 A;  2D9H A;  3EPL A;  1JK2 A;  2M1S A;  2V87 A;  2LUQ A;  2EOF A;  4WXC A;  3T1Y E;  1J26 A;  5ADZ A;  4GZN C;  2LO3 A;  4LF5 E;  4DR7 E;  4R2A A;  1SR9 A;  2EQ3 A;  4IJD A;  2YRK A;  3C4T A;  3C4B A;  1X5W A;  2EOM A;  2FTX B;  4ZYG A;  5KL5 A;  2HHH E;  2EMF A;  1UBD C;  2JR1 A;  2RQL A;  1WHN A;  4DV6 E;  4P78 A;  4YY3 E;  1HNX E;  2EOO A;  4R2E A;  2E72 A;  4JI4 E;  4M0V A;  2EN3 A;  2V8Q B;  4DV5 E;  3ADG A;  2H36 X;  1ZBQ A;  3EQ1 A;  3P1X A;  3C6K A;  4WFT A;  4WYQ B;  2DRP A;  2YTN A;  2UXC E;  2YTG A;  4B3M E;  2NUG A;  5KL7 A;  4YHH E;  4L8N A;  1T4L B;  2LT7 A;  5AC4 A;  4F9B B;  2L3J A;  4F6M A;  2G7H A;  2B7V A;  3HPZ A;  1P47 A;  1IBK E;  4WXD A;  2EZ6 A;  2YTF A;  2L33 A;  4Q28 A;  1N36 E;  1IBM E;  2JY9 A;  4DKK A;  2EM7 A;  3VYY A;  1T39 A;  4LU9 A;  1T38 A;  4R2C A;  2ODR C;  4FK5 C;  2EOQ A;  4LF8 E;  3JU0 A;  3HTX A;  2V89 A;  2YU8 A;  2YWQ A;  1GQE A;  4X8W A;  4GKJ E;  3L00 A;  2LTR A;  2L92 A;  4K0K E;  2JXP A;  3AUZ A;  2B7T A;  4BC9 A;  2M4I A;  1A1F A;  2VF1 A;  5KL4 A;  1A1K A;  4WSP A;  3ZOQ B;  4DR5 E;  2YPN A;  2GHF A;  2N8X A;  1YZ9 A;  1YUI A;  2DB2 A;  4BHC A;  5A2Q C;  1RC7 A;  1A1J A;  2WBT A;  4NHR A;  2EL6 A;  2ELZ A;  4R2P A;  1A1H A;  4JI1 E;  2ENC A;  2EOJ A;  2EMG A;  4JYA E;  2R76 A;  2EM4 A;  5F3W A;  4LFB E;  5KL2 A;  1UHZ A;  3F6H A;  5AC5 A;  2DSY A;  2EM0 A;  5AE2 A;  2WBU A;  5A69 A;  1DI2 A;  1X6E A;  3ECR A;  4DV3 E;  1STU A;  3T1H E;  1EH7 A;  2EWL A;  4Q35 B;  1MEY C;  2EOI A;  2MDR A;  3THN A;  1UN6 B;  2EN4 A;  2UXB E;  2KHX A;  4BCA A;  4JI8 E;  3IWD A;  1X6H A;  2EM6 A;  3DF6 A;  4BC7 A;  2L6M A;  4LFC E;  1GZ6 A;  1EH6 A;  1WHQ A;  2WCC 3;  1KJK A;  2YRH A;  2YTE A;  2RS6 A;  2HGH A;  4OOG C;  2YTD A;  4LFA E;  4BBY A;  2UU9 E;  2NA2 A;  3AV0 A;  2E5L E;  4X66 E;  2EMW A;  1HNW E;  2L2M A;  1NEI A;  2MC5 A;  3VYX A;  4B3T E;  2MKD A;  2DIX A;  2EMC A;  3TQM A;  1G2D C;  1EH8 A;  2MC6 A;  2LV2 A;  2HJJ A;  2RSI A;  2JP9 A;  2EQ1 A;  2EMK A;  2LJH A;  1RQ0 A;  4O43 A;  2EPR A;  2EPX A;  2CPN A;  2Q8U A;  1WXR A;  2GLI A;  1XNQ E;  4JI0 E;  3OML A;  2EE8 A;  2E1M A;  5IT9 C;  2F8B A;  2F4V E;  2EMX A;  2JVA A;  1N34 E;  4MLQ A;  3HXL A;  2ELY A;  4BS9 A;  5KL6 A;  1JK1 A;  4NZV A;  1WRJ A;  4GEQ B;  4R2D A;  1J5E E;  4DR2 E;  4HEI A;  1PJQ A;  4LF4 E;  4KHP E;  3ADJ A;  5T6J A;  2VRD A;  2YTI A;  4I8O A;  1GTK A;  2ODR D;  4R8O A;  4F6N A;  2EMI A;  4KWY A;  1A1L A;  2YTP A;  2DGC A; 
#chains in the Genus database with same CATH homology
 2EPZ A;  2GHF A;  2EPC A;  1YUI A;  2EQ0 A;  1WJP A;  2RPC A;  2DLK A;  1TF6 A;  1X6F A;  2EL4 A;  1A1J A;  2WBT A;  4M9V C;  2EL6 A;  2ELZ A;  4R2P A;  3EPH A;  2EOX A;  2DLQ A;  1A1H A;  2MDG A;  2LCE A;  2EN2 A;  2ENC A;  2EOJ A;  2EMG A;  2PRT A;  2EMB A;  2YRM A;  2EM4 A;  2R1F A;  5KL2 A;  5KL3 A;  1X3C A;  2YTQ A;  4WSG A;  2EM0 A;  2D9H A;  1YSA C;  3EPL A;  1JK2 A;  2WBU A;  2EOF A;  2EP3 A;  2ADR A;  1X6E A;  1MEY C;  2EOZ A;  2EOI A;  4R2R A;  3EPK A;  1UN6 B;  2EN4 A;  1RMD A;  2LO3 A;  4GZN C;  2CT1 A;  1DGC A;  1X6H A;  2EM6 A;  2EMZ A;  4R2A A;  1G2F C;  2EQ3 A;  4IJD A;  2YRK A;  2WCC 3;  1KJK A;  1X5W A;  2EOY A;  2YRH A;  2BB8 A;  2YTE A;  2EOM A;  5KL5 A;  2HGH A;  2YTD A;  4F2J C;  2NAB A;  2A25 A;  2EMF A;  1B69 A;  4R2S A;  1UBD C;  2I13 A;  2ENA A;  2J7J A;  2MKN A;  2EMW A;  1NCS A;  2EN8 A;  2EJ4 A;  2EOO A;  4R2E A;  2E72 A;  2CSH A;  2YSO A;  2EN3 A;  2EPU A;  3UK3 C;  2MKD A;  2CTD A;  2DMI A;  2EOS A;  2EML A;  2EMC A;  1G2D C;  2EL5 A;  4R2Q A;  2LV2 A;  1ZAA C;  3MHH C;  1A1G A;  2RSI A;  2JP9 A;  2EQ1 A;  2DRP A;  2YSP A;  2YTN A;  2YTG A;  1BB8 A;  2EMK A;  2YU5 A;  3MHS C;  2GLI A;  2EPR A;  2EPX A;  5KL7 A;  1BBO A;  1ZR9 A;  2EN1 A;  2EMA A;  2LT7 A;  1LLM C;  1F2I G;  2EE8 A;  1ZU1 A;  4F6M A;  1AAY A;  2EMH A;  4IS1 C;  2EMX A;  1A1I A;  2EMY A;  1P47 A;  3M99 B;  2EM8 A;  2EM9 A;  1TF3 A;  2EN6 A;  2YTF A;  2ELY A;  2EOR A;  5KL6 A;  3VHT B;  1JK1 A;  2WBS A;  4R2D A;  2EM7 A;  2LVH A;  2ENH A;  2M9A A;  2EN7 A;  3EPJ A;  2EPP A;  2YTJ A;  4R2C A;  4X9J A;  1TN9 A;  4FK5 C;  2EOQ A;  1Z1B A;  2YU8 A;  2EM2 A;  1YUJ A;  2VRD A;  2YTO A;  2JPA A;  2YTI A;  2EOH A;  2EOE A;  4F6N A;  2EMI A;  2EM5 A;  1A1L A;  2YTP A;  2EM3 A;  1A1F A;  2DGC A;  5KL4 A;  1A1K A;  2EPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...