1A1HA

Qgsr (zif268 variant) zinc finger-dna complex (gcac site)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
85
structure length
85
Chain Sequence
RPYACPVESCDRRFSQSGSLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*AP*C)-3')
total genus 26
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1hA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1hA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1hA03
2EM3A 4F6MA 2EORA 2LV2A 1P47A 4R2SA 1BB8A 1A1JA 2EMAA 2EPRA 1TF6A 4F6NA 2LCEA 1JK2A 2DMIA 2EM9A 4IS1C 2EN6A 2EOFA 2EN2A 2ENAA 4R2CA 2J7JA 2EMWA 2EMZA 2M9AA 2ENHA 2EM8A 1JK1A 2E72A 1X6FA 1Z1BA 2EE8A 2EOQA 2EOMA 1X6EA 4IJDA 2EOJA 5KL2A 2EOXA 2EMYA 2YSPA 2EN1A 2YTNA 2YRKA 2LVHA 2EM4A 2EJ4A 1A1KA 1AAYA 2BB8A 2YTIA 4R2RA 2YTPA 2EMKA 2EQ3A 2EPPA 2EPCA 2R1FA 2YTDA 2WBTA 3VHTB 2EM0A 2VRDA 2EM5A 2EQ0A 1G2DC 2PRTA 1X6HA 2EOHA 2YTFA 2YU5A 2EN8A 2YSOA 5KL6A 1ZU1A 2EOIA 3MHHC 2EN3A 2EOZA 2YU8A 2EOYA 2YTEA 2GHFA 2I13A 4WSGA 1A1HA 4R2AA 4F2JC 1X5WA 2DLKA 1A1GA 1YUJA 4GZNC 3EPJA 2YRHA 2CSHA 2JPAA 4M9VC 2LO3A 2WCC3 2A25A 2YTJA 1YSAC 2YRMA 2EMFA 3EPKA 2EPXA 1ZR9A 2CT1A 1RMDA 2EM7A 1G2FC 4R2EA 1UBDC 2EMGA 2LT7A 1WJPA 1DGCA 2EOEA 2EPZA 2EMLA 1MEYC 2EMBA 4R2DA 2EP3A 3MHSC 2DLQA 2EQ1A 1YUIA 2GLIA 1BBOA 2ENCA 2RPCA 2ELYA 2EL5A 2MKNA 2EN7A 1LLMC 2CTDA 3M99B 2HGHA 2ADRA 1ZAAC 2EMIA 2NABA 2DGCA 3UK3C 4R2PA 2DRPA 2JP9A 3EPHA 2EMHA 2YTQA 2EPAA 1NCSA 4FK5C 2EN4A 1A1LA 2EMCA 1F2IG 1KJKA 2D9HA 2EL6A 2WBSA 2YTOA 2EOSA 5KL4A 2RSIA 2EM2A 2EOOA 5KL5A 2EL4A 1A1IA 5KL3A 5KL7A 2EM6A 1B69A 1TN9A 1X3CA 3EPLA 4X9JA 4R2QA 2EPUA 1TF3A 2WBUA 2MKDA 1A1FA 2EMXA 2YTGA 1UN6B 2ELZA 2MDGA
chains in the Genus database with same CATH superfamily
4LF5E 2EORA 3J80C 4WXDA 4R2SA 3T1HE 1GQEA 4O24A 2UXDE 2HHHE 1PJQA 2EPRA 4BC7A 2E5LE 4Q28A 1IBME 1IBLE 1JK2A 5IT9C 2KHXA 2UU9E 3LMLA 2CPNA 5A6KA 4N4RB 2EOMA 1YYKA 2EOXA 2LUPB 2YSPA 2EN1A 2YTNA 1AAYA 2BB8A 3EQ1A 4RH8A 3K6QA 3VHTB 4L5NC 2EM5A 5A6JA 4NXME 2YTFA 2EOHA 1N32E 4LTYA 4GKJE 2EN8A 1IBKE 2JOBA 2F8BA 5A6AA 2B3TB 2EN3A 2EOZA 2L2MA 2DSYA 5T6JA 4X65E 2VQFE 3VYYA 4WSGA 4R2AA 2V83A 2L2NA 4F2JC 2LTSA 2DLKA 4ZYGA 3JTZA 4JI0E 1XMOE 2CSHA 4X64E 4BC9A 1NEIA 1EH7A 4DR7E 2YTJA 2UXCE 1ZR9A 2EM7A 1FKAE 3TQMA 1WJPA 1DGCA 4GEQB 5CFFE 4B3SE 5AE1A 2EMLA 2EMBA 4R2DA 2EP3A 1X49A 2GLIA 3HTXA 4DUYE 5DNYA 4DR4E 2RPCA 2JWOA 4JI3E 1T38A 1LLMC 1T4LB 2HGHA 1ZAAC 1RC7A 1YFHA 2JY9A 1XNQE 4WFTA 1BBGA 1IQSA 3EPHA 2EMHA 4BHCA 4AQYE 4B3TE 2BBGA 3AUZA 1UILA 1PDAA 1HNWE 4M30A 2YTOA 1HNXE 4L8NA 5FLXC 4LFBE 5KL7A 1N3GA 2MC5A 2ODRD 1TN9A 1X3CA 2L2KB 1A1FA 2EMXA 5AE3A 1WXRA 4DR1E 1RQ0A 4NHRA 2EM3A 2LV2A 1MGTA 2RS6A 4WYQB 3ECRA 4K0KE 1X48A 4DV5E 2DB2A 2LCEA 2EN6A 2ODRC 3VYXA 2RSMA 2M9AA 2ENHA 4O43A 4WPYA 2EM8A 4ZYHA 1JK1A 2E72A 3ADGA 1EKZA 2EE8A 2DMYA 1X6EA 4IJDA 2EMYA 4ZYEA 4HEIA 3OMLA 2B7TA 2YRKA 2EJ4A 2EM4A 1PJSA 2LBSB 5A6BA 1SFEA 4R2RA 2WBTA 5IWAE 1G2DC 1DI2A 3AV0A 4DKKA 3BGHA 2EPMX 1YPNA 2G7HA 4DR6E 2GPIA 2YU8A 2UUAE 1ZBTA 2EOYA 2GHFA 4F54A 2YPNA 2I13A 2UUBE 4DR3E 1J5EE 1X5WA 3C6KA 4JI6E 2NUEA 2FGGA 3THOB 5BR8E 2YRHA 2JPAA 1QNTA 1KYQA 2LO3A 2WCC3 2A25A 2HJJA 5F3WA 1YSAC 2YRMA 2CT1A 1G2FC 1YYWA 5AASA 3HQ1A 2EPZA 1YZ9A 2M7QA 2EPKX 3KZYA 1J26A 4P78A 2DLQA 3BF2A 4LF7E 2CTDA 3M99B 2L92A 4BCAA 2JYAA 3C4BA 4BS9A 2LTRA 2V89A 1WHNA 2DRPA 4JYAE 1NCSA 2EN4A 3J7Yp 4NZVA 3KZZA 1F2IG 5TSEA 2WBSA 4JV5E 4KZSA 4R8OA 3HPZA 5A6BD 1B69A 2VF1A 1TF3A 2EPUA 2JR1A 4BHBA 2WBUA 2B7VA 2EWLA 1FJGE 1T4NA 2MDGA 2IHR1 1BB8A 3VK6A 2V86A 2YZTA 3F6GA 4BBYA 4JI7E 4R03A 1WRJA 4F6NA 1TF6A 2EPLX 2DMIA 2EM9A 4TUGA 4IS1C 2EOFA 2EN2A 2ENAA 2EMZA 1ZBQA 4LFAE 2F4VE 1GZ6A 2RS7A 4LF9E 4DV0E 1Z1BA 4KWYA 1WHQA 2EOQA 5KL2A 2EZ6A 2EOJA 2MC6A 2R76A 2YWQA 4X62E 2LVHA 4YY3E 1EH8A 1A1KA 2YTIA 2R1FA 2I9IA 2EM0A 2EQ0A 2PRTA 1X6HA 4WSPA 1SR9A 1ZU1A 2EOIA 1AH5A 3MHHC 5LMUE 2V87A 2UUCE 4RHBB 5IV8B 3DF6A 4DUZE 4WXCA 1A1GA 1T39A 1YUJA 4DV2E 3EPJA 4M9VC 5AC5A 1PJTA 3EPKA 1RMDA 3IWBA 3THNA 1XNRE 5A69A 2EMGA 2LT7A 4O5GA 2EOEA 3L00A 2EQ1A 2N3GA 1L4SA 3ZOQB 5AE2A 3OTOE 4X8WA 2JVAA 2ELYA 2EN7A 2EMIA 4B3ME 3FIGA 3ADIA 1N36E 4R2PA 2EPAA 2L3CA 4MLQA 2H36X 2ZM6E 1HNZE 1KJKA 2EL6A 4JI2E 1IQOA 4DMIA 2EOSA 5KL4A 2RSIA 2EOOA 2EL4A 3ADJA 1A1IA 2LMZA 2V85A 3EPLA 4R2QA 1QU6A 2MDRA 2WZOA 4JI1E 4LFCE 2MKDA 3LLHA 4MLVA 1STUA 1XMQE 1UN6B 2ELZA 3F6HA 4LF4E 2KOUA 4DV7E 4KHPE 4F6MA 1P47A 2N3HA 2E1MA 2FTXB 1A1JA 2EMAA 1X47A 3JU0A 4OX9E 3HXLA 2K7IA 4LU9A 1I94E 4JI5E 2LJUA 2RTXA 4R2CA 2J7JA 3HPSA 4DV4E 2EMWA 4DV6E 2DIXA 5LLQA 4F9BB 2EPNA 2FV4B 3C4TA 4OOGC 1X6FA 2HC5A 4I8OA 2K4VA 1DQ3A 5AC4A 2L6MA 3QG5C 4DV1E 3ADLA 3BBGA 2JXPA 2YTPA 2EMKA 2EQ3A 2EPPA 2EPCA 2YTDA 1EH6A 2L3JA 2VRDA 1UHZA 3RMPA 4F9AB 4JI4E 3C6MA 2LRSA 2YU5A 3P1XA 2YSOA 4NXNE 5KL6A 1GTKA 1N34E 3MSWA 2L33A 4F9CB 2YTEA 1O0WA 1A1HA 4M2ZA 4X66E 4M0VA 2LUQA 5LL6R 4GZNC 2N8XA 4YHHE 4ZYDA 3IWCA 5A2QC 2EMFA 1YYOA 2EPXA 2UXBE 4R2EA 1UBDC 3JAMC 3H09A 4LF8E 2B9DA 2YT4A 1T4OA 1MEYC 3MHSC 1BBOA 1YUIA 2ENCA 2L8TA 2EL5A 2MKNA 2NA2A 3J81C 2LE2A 4WX9A 4HTGA 3T1YE 2ADRA 4BMJA 3KWRA 4P7DA 2M4IA 4DV3E 4DR5E 3J7AG 1PKPA 2NUFA 2NABA 5LMNE 2V8QB 5ADZA 3UK3C 2DGCA 2JP9A 3BIDA 2LJHA 2YTQA 4FK5C 4J8ZA 1A1LA 2EMCA 4GKKE 4TUIA 2VE7C 2D9HA 4O4KA 1HR0E 1N33E 4DR2E 4LF6E 2VQEE 2V88A 2M1SA 2EM2A 2Q8UA 3IWDA 5IXMB 5KL5A 2JOXA 5KL3A 3DJWA 2KONA 4JI8E 2EM6A 2NUGA 1IMUA 4X9JA 2RQLA 2YTGA 4B3RE 2EPOA 4Q35B
chains in the Genus database with same CATH topology
2EM3A 4F6MA 2EORA 2LV2A 1P47A 4R2SA 1BB8A 1A1JA 2EMAA 2EPRA 1TF6A 4F6NA 2LCEA 1JK2A 2DMIA 2EM9A 4IS1C 2EN6A 2EOFA 2EN2A 2ENAA 4R2CA 2J7JA 2EMWA 2EMZA 2M9AA 2ENHA 2EM8A 1JK1A 2E72A 1X6FA 1Z1BA 2EE8A 2EOQA 2EOMA 1X6EA 4IJDA 2EOJA 5KL2A 2EOXA 2EMYA 2YSPA 2EN1A 2YTNA 2YRKA 2LVHA 2EM4A 2EJ4A 1A1KA 1AAYA 2BB8A 2YTIA 4R2RA 2YTPA 2EMKA 2EQ3A 2EPPA 2EPCA 2R1FA 2YTDA 2WBTA 3VHTB 2EM0A 2VRDA 2EM5A 2EQ0A 1G2DC 2PRTA 1X6HA 2EOHA 2YTFA 2YU5A 2EN8A 2YSOA 5KL6A 1ZU1A 2EOIA 3MHHC 2EN3A 2EOZA 2YU8A 2EOYA 2YTEA 2GHFA 2I13A 4WSGA 1A1HA 4R2AA 4F2JC 1X5WA 2DLKA 1A1GA 1YUJA 4GZNC 3EPJA 2YRHA 2CSHA 2JPAA 4M9VC 2LO3A 2WCC3 2A25A 2YTJA 1YSAC 2YRMA 2EMFA 3EPKA 2EPXA 1ZR9A 2CT1A 1RMDA 2EM7A 1G2FC 4R2EA 1UBDC 2EMGA 2LT7A 1WJPA 1DGCA 2EOEA 2EPZA 2EMLA 1MEYC 2EMBA 4R2DA 2EP3A 3MHSC 2DLQA 2EQ1A 1YUIA 2GLIA 1BBOA 2ENCA 2RPCA 2ELYA 2EL5A 2MKNA 2EN7A 1LLMC 2CTDA 3M99B 2HGHA 2ADRA 1ZAAC 2EMIA 2NABA 2DGCA 3UK3C 4R2PA 2DRPA 2JP9A 3EPHA 2EMHA 2YTQA 2EPAA 1NCSA 4FK5C 2EN4A 1A1LA 2EMCA 1F2IG 1KJKA 2D9HA 2EL6A 2WBSA 2YTOA 2EOSA 5KL4A 2RSIA 2EM2A 2EOOA 5KL5A 2EL4A 1A1IA 5KL3A 5KL7A 2EM6A 1B69A 1TN9A 1X3CA 3EPLA 4X9JA 4R2QA 2EPUA 1TF3A 2WBUA 2MKDA 1A1FA 2EMXA 2YTGA 1UN6B 2ELZA 2MDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EM3 A;  4F6M A;  2EOR A;  2LV2 A;  1P47 A;  4R2S A;  1BB8 A;  1A1J A;  2EMA A;  2EPR A;  1TF6 A;  4F6N A;  2LCE A;  1JK2 A;  2DMI A;  2EM9 A;  4IS1 C;  2EN6 A;  2EOF A;  2EN2 A;  2ENA A;  4R2C A;  2J7J A;  2EMW A;  2EMZ A;  2M9A A;  2ENH A;  2EM8 A;  1JK1 A;  2E72 A;  1X6F A;  1Z1B A;  2EE8 A;  2EOQ A;  2EOM A;  1X6E A;  4IJD A;  2EOJ A;  5KL2 A;  2EOX A;  2EMY A;  2YSP A;  2EN1 A;  2YTN A;  2YRK A;  2LVH A;  2EM4 A;  2EJ4 A;  1A1K A;  1AAY A;  2BB8 A;  2YTI A;  4R2R A;  2YTP A;  2EMK A;  2EQ3 A;  2EPP A;  2EPC A;  2R1F A;  2YTD A;  2WBT A;  3VHT B;  2EM0 A;  2VRD A;  2EM5 A;  2EQ0 A;  1G2D C;  2PRT A;  1X6H A;  2EOH A;  2YTF A;  2YU5 A;  2EN8 A;  2YSO A;  5KL6 A;  1ZU1 A;  2EOI A;  3MHH C;  2EN3 A;  2EOZ A;  2YU8 A;  2EOY A;  2YTE A;  2GHF A;  2I13 A;  4WSG A;  1A1H A;  4R2A A;  4F2J C;  1X5W A;  2DLK A;  1A1G A;  1YUJ A;  4GZN C;  3EPJ A;  2YRH A;  2CSH A;  2JPA A;  4M9V C;  2LO3 A;  2WCC 3;  2A25 A;  2YTJ A;  1YSA C;  2YRM A;  2EMF A;  3EPK A;  2EPX A;  1ZR9 A;  2CT1 A;  1RMD A;  2EM7 A;  1G2F C;  4R2E A;  1UBD C;  2EMG A;  2LT7 A;  1WJP A;  1DGC A;  2EOE A;  2EPZ A;  2EML A;  1MEY C;  2EMB A;  4R2D A;  2EP3 A;  3MHS C;  2DLQ A;  2EQ1 A;  1YUI A;  2GLI A;  1BBO A;  2ENC A;  2RPC A;  2ELY A;  2EL5 A;  2MKN A;  2EN7 A;  1LLM C;  2CTD A;  3M99 B;  2HGH A;  2ADR A;  1ZAA C;  2EMI A;  2NAB A;  2DGC A;  3UK3 C;  4R2P A;  2DRP A;  2JP9 A;  3EPH A;  2EMH A;  2YTQ A;  2EPA A;  1NCS A;  4FK5 C;  2EN4 A;  1A1L A;  2EMC A;  1F2I G;  1KJK A;  2D9H A;  2EL6 A;  2WBS A;  2YTO A;  2EOS A;  5KL4 A;  2RSI A;  2EM2 A;  2EOO A;  5KL5 A;  2EL4 A;  1A1I A;  5KL3 A;  5KL7 A;  2EM6 A;  1B69 A;  1TN9 A;  1X3C A;  3EPL A;  4X9J A;  4R2Q A;  2EPU A;  1TF3 A;  2WBU A;  2MKD A;  1A1F A;  2EMX A;  2YTG A;  1UN6 B;  2ELZ A;  2MDG A; 
#chains in the Genus database with same CATH topology
 4LF5 E;  2EOR A;  3J80 C;  4WXD A;  4R2S A;  3T1H E;  1GQE A;  4O24 A;  2UXD E;  2HHH E;  1PJQ A;  2EPR A;  4BC7 A;  2E5L E;  4Q28 A;  1IBM E;  1IBL E;  1JK2 A;  5IT9 C;  2KHX A;  2UU9 E;  3LML A;  2CPN A;  5A6K A;  4N4R B;  2EOM A;  1YYK A;  2EOX A;  2LUP B;  2YSP A;  2EN1 A;  2YTN A;  1AAY A;  2BB8 A;  3EQ1 A;  4RH8 A;  3K6Q A;  3VHT B;  4L5N C;  2EM5 A;  5A6J A;  4NXM E;  2YTF A;  2EOH A;  1N32 E;  4LTY A;  4GKJ E;  2EN8 A;  1IBK E;  2JOB A;  2F8B A;  5A6A A;  2B3T B;  2EN3 A;  2EOZ A;  2L2M A;  2DSY A;  5T6J A;  4X65 E;  2VQF E;  3VYY A;  4WSG A;  4R2A A;  2V83 A;  2L2N A;  4F2J C;  2LTS A;  2DLK A;  4ZYG A;  3JTZ A;  4JI0 E;  1XMO E;  2CSH A;  4X64 E;  4BC9 A;  1NEI A;  1EH7 A;  4DR7 E;  2YTJ A;  2UXC E;  1ZR9 A;  2EM7 A;  1FKA E;  3TQM A;  1WJP A;  1DGC A;  4GEQ B;  5CFF E;  4B3S E;  5AE1 A;  2EML A;  2EMB A;  4R2D A;  2EP3 A;  1X49 A;  2GLI A;  3HTX A;  4DUY E;  5DNY A;  4DR4 E;  2RPC A;  2JWO A;  4JI3 E;  1T38 A;  1LLM C;  1T4L B;  2HGH A;  1ZAA C;  1RC7 A;  1YFH A;  2JY9 A;  1XNQ E;  4WFT A;  1BBG A;  1IQS A;  3EPH A;  2EMH A;  4BHC A;  4AQY E;  4B3T E;  2BBG A;  3AUZ A;  1UIL A;  1PDA A;  1HNW E;  4M30 A;  2YTO A;  1HNX E;  4L8N A;  5FLX C;  4LFB E;  5KL7 A;  1N3G A;  2MC5 A;  2ODR D;  1TN9 A;  1X3C A;  2L2K B;  1A1F A;  2EMX A;  5AE3 A;  1WXR A;  4DR1 E;  1RQ0 A;  4NHR A;  2EM3 A;  2LV2 A;  1MGT A;  2RS6 A;  4WYQ B;  3ECR A;  4K0K E;  1X48 A;  4DV5 E;  2DB2 A;  2LCE A;  2EN6 A;  2ODR C;  3VYX A;  2RSM A;  2M9A A;  2ENH A;  4O43 A;  4WPY A;  2EM8 A;  4ZYH A;  1JK1 A;  2E72 A;  3ADG A;  1EKZ A;  2EE8 A;  2DMY A;  1X6E A;  4IJD A;  2EMY A;  4ZYE A;  4HEI A;  3OML A;  2B7T A;  2YRK A;  2EJ4 A;  2EM4 A;  1PJS A;  2LBS B;  5A6B A;  1SFE A;  4R2R A;  2WBT A;  5IWA E;  1G2D C;  1DI2 A;  3AV0 A;  4DKK A;  3BGH A;  2EPM X;  1YPN A;  2G7H A;  4DR6 E;  2GPI A;  2YU8 A;  2UUA E;  1ZBT A;  2EOY A;  2GHF A;  4F54 A;  2YPN A;  2I13 A;  2UUB E;  4DR3 E;  1J5E E;  1X5W A;  3C6K A;  4JI6 E;  2NUE A;  2FGG A;  3THO B;  5BR8 E;  2YRH A;  2JPA A;  1QNT A;  1KYQ A;  2LO3 A;  2WCC 3;  2A25 A;  2HJJ A;  5F3W A;  1YSA C;  2YRM A;  2CT1 A;  1G2F C;  1YYW A;  5AAS A;  3HQ1 A;  2EPZ A;  1YZ9 A;  2M7Q A;  2EPK X;  3KZY A;  1J26 A;  4P78 A;  2DLQ A;  3BF2 A;  4LF7 E;  2CTD A;  3M99 B;  2L92 A;  4BCA A;  2JYA A;  3C4B A;  4BS9 A;  2LTR A;  2V89 A;  1WHN A;  2DRP A;  4JYA E;  1NCS A;  2EN4 A;  3J7Y p;  4NZV A;  3KZZ A;  1F2I G;  5TSE A;  2WBS A;  4JV5 E;  4KZS A;  4R8O A;  3HPZ A;  5A6B D;  1B69 A;  2VF1 A;  1TF3 A;  2EPU A;  2JR1 A;  4BHB A;  2WBU A;  2B7V A;  2EWL A;  1FJG E;  1T4N A;  2MDG A;  2IHR 1;  1BB8 A;  3VK6 A;  2V86 A;  2YZT A;  3F6G A;  4BBY A;  4JI7 E;  4R03 A;  1WRJ A;  4F6N A;  1TF6 A;  2EPL X;  2DMI A;  2EM9 A;  4TUG A;  4IS1 C;  2EOF A;  2EN2 A;  2ENA A;  2EMZ A;  1ZBQ A;  4LFA E;  2F4V E;  1GZ6 A;  2RS7 A;  4LF9 E;  4DV0 E;  1Z1B A;  4KWY A;  1WHQ A;  2EOQ A;  5KL2 A;  2EZ6 A;  2EOJ A;  2MC6 A;  2R76 A;  2YWQ A;  4X62 E;  2LVH A;  4YY3 E;  1EH8 A;  1A1K A;  2YTI A;  2R1F A;  2I9I A;  2EM0 A;  2EQ0 A;  2PRT A;  1X6H A;  4WSP A;  1SR9 A;  1ZU1 A;  2EOI A;  1AH5 A;  3MHH C;  5LMU E;  2V87 A;  2UUC E;  4RHB B;  5IV8 B;  3DF6 A;  4DUZ E;  4WXC A;  1A1G A;  1T39 A;  1YUJ A;  4DV2 E;  3EPJ A;  4M9V C;  5AC5 A;  1PJT A;  3EPK A;  1RMD A;  3IWB A;  3THN A;  1XNR E;  5A69 A;  2EMG A;  2LT7 A;  4O5G A;  2EOE A;  3L00 A;  2EQ1 A;  2N3G A;  1L4S A;  3ZOQ B;  5AE2 A;  3OTO E;  4X8W A;  2JVA A;  2ELY A;  2EN7 A;  2EMI A;  4B3M E;  3FIG A;  3ADI A;  1N36 E;  4R2P A;  2EPA A;  2L3C A;  4MLQ A;  2H36 X;  2ZM6 E;  1HNZ E;  1KJK A;  2EL6 A;  4JI2 E;  1IQO A;  4DMI A;  2EOS A;  5KL4 A;  2RSI A;  2EOO A;  2EL4 A;  3ADJ A;  1A1I A;  2LMZ A;  2V85 A;  3EPL A;  4R2Q A;  1QU6 A;  2MDR A;  2WZO A;  4JI1 E;  4LFC E;  2MKD A;  3LLH A;  4MLV A;  1STU A;  1XMQ E;  1UN6 B;  2ELZ A;  3F6H A;  4LF4 E;  2KOU A;  4DV7 E;  4KHP E;  4F6M A;  1P47 A;  2N3H A;  2E1M A;  2FTX B;  1A1J A;  2EMA A;  1X47 A;  3JU0 A;  4OX9 E;  3HXL A;  2K7I A;  4LU9 A;  1I94 E;  4JI5 E;  2LJU A;  2RTX A;  4R2C A;  2J7J A;  3HPS A;  4DV4 E;  2EMW A;  4DV6 E;  2DIX A;  5LLQ A;  4F9B B;  2EPN A;  2FV4 B;  3C4T A;  4OOG C;  1X6F A;  2HC5 A;  4I8O A;  2K4V A;  1DQ3 A;  5AC4 A;  2L6M A;  3QG5 C;  4DV1 E;  3ADL A;  3BBG A;  2JXP A;  2YTP A;  2EMK A;  2EQ3 A;  2EPP A;  2EPC A;  2YTD A;  1EH6 A;  2L3J A;  2VRD A;  1UHZ A;  3RMP A;  4F9A B;  4JI4 E;  3C6M A;  2LRS A;  2YU5 A;  3P1X A;  2YSO A;  4NXN E;  5KL6 A;  1GTK A;  1N34 E;  3MSW A;  2L33 A;  4F9C B;  2YTE A;  1O0W A;  1A1H A;  4M2Z A;  4X66 E;  4M0V A;  2LUQ A;  5LL6 R;  4GZN C;  2N8X A;  4YHH E;  4ZYD A;  3IWC A;  5A2Q C;  2EMF A;  1YYO A;  2EPX A;  2UXB E;  4R2E A;  1UBD C;  3JAM C;  3H09 A;  4LF8 E;  2B9D A;  2YT4 A;  1T4O A;  1MEY C;  3MHS C;  1BBO A;  1YUI A;  2ENC A;  2L8T A;  2EL5 A;  2MKN A;  2NA2 A;  3J81 C;  2LE2 A;  4WX9 A;  4HTG A;  3T1Y E;  2ADR A;  4BMJ A;  3KWR A;  4P7D A;  2M4I A;  4DV3 E;  4DR5 E;  3J7A G;  1PKP A;  2NUF A;  2NAB A;  5LMN E;  2V8Q B;  5ADZ A;  3UK3 C;  2DGC A;  2JP9 A;  3BID A;  2LJH A;  2YTQ A;  4FK5 C;  4J8Z A;  1A1L A;  2EMC A;  4GKK E;  4TUI A;  2VE7 C;  2D9H A;  4O4K A;  1HR0 E;  1N33 E;  4DR2 E;  4LF6 E;  2VQE E;  2V88 A;  2M1S A;  2EM2 A;  2Q8U A;  3IWD A;  5IXM B;  5KL5 A;  2JOX A;  5KL3 A;  3DJW A;  2KON A;  4JI8 E;  2EM6 A;  2NUG A;  1IMU A;  4X9J A;  2RQL A;  2YTG A;  4B3R E;  2EPO A;  4Q35 B; 
#chains in the Genus database with same CATH homology
 2EM3 A;  4F6M A;  2EOR A;  2LV2 A;  1P47 A;  4R2S A;  1BB8 A;  1A1J A;  2EMA A;  2EPR A;  1TF6 A;  4F6N A;  2LCE A;  1JK2 A;  2DMI A;  2EM9 A;  4IS1 C;  2EN6 A;  2EOF A;  2EN2 A;  2ENA A;  4R2C A;  2J7J A;  2EMW A;  2EMZ A;  2M9A A;  2ENH A;  2EM8 A;  1JK1 A;  2E72 A;  1X6F A;  1Z1B A;  2EE8 A;  2EOQ A;  2EOM A;  1X6E A;  4IJD A;  2EOJ A;  5KL2 A;  2EOX A;  2EMY A;  2YSP A;  2EN1 A;  2YTN A;  2YRK A;  2LVH A;  2EM4 A;  2EJ4 A;  1A1K A;  1AAY A;  2BB8 A;  2YTI A;  4R2R A;  2YTP A;  2EMK A;  2EQ3 A;  2EPP A;  2EPC A;  2R1F A;  2YTD A;  2WBT A;  3VHT B;  2EM0 A;  2VRD A;  2EM5 A;  2EQ0 A;  1G2D C;  2PRT A;  1X6H A;  2EOH A;  2YTF A;  2YU5 A;  2EN8 A;  2YSO A;  5KL6 A;  1ZU1 A;  2EOI A;  3MHH C;  2EN3 A;  2EOZ A;  2YU8 A;  2EOY A;  2YTE A;  2GHF A;  2I13 A;  4WSG A;  1A1H A;  4R2A A;  4F2J C;  1X5W A;  2DLK A;  1A1G A;  1YUJ A;  4GZN C;  3EPJ A;  2YRH A;  2CSH A;  2JPA A;  4M9V C;  2LO3 A;  2WCC 3;  2A25 A;  2YTJ A;  1YSA C;  2YRM A;  2EMF A;  3EPK A;  2EPX A;  1ZR9 A;  2CT1 A;  1RMD A;  2EM7 A;  1G2F C;  4R2E A;  1UBD C;  2EMG A;  2LT7 A;  1WJP A;  1DGC A;  2EOE A;  2EPZ A;  2EML A;  1MEY C;  2EMB A;  4R2D A;  2EP3 A;  3MHS C;  2DLQ A;  2EQ1 A;  1YUI A;  2GLI A;  1BBO A;  2ENC A;  2RPC A;  2ELY A;  2EL5 A;  2MKN A;  2EN7 A;  1LLM C;  2CTD A;  3M99 B;  2HGH A;  2ADR A;  1ZAA C;  2EMI A;  2NAB A;  2DGC A;  3UK3 C;  4R2P A;  2DRP A;  2JP9 A;  3EPH A;  2EMH A;  2YTQ A;  2EPA A;  1NCS A;  4FK5 C;  2EN4 A;  1A1L A;  2EMC A;  1F2I G;  1KJK A;  2D9H A;  2EL6 A;  2WBS A;  2YTO A;  2EOS A;  5KL4 A;  2RSI A;  2EM2 A;  2EOO A;  5KL5 A;  2EL4 A;  1A1I A;  5KL3 A;  5KL7 A;  2EM6 A;  1B69 A;  1TN9 A;  1X3C A;  3EPL A;  4X9J A;  4R2Q A;  2EPU A;  1TF3 A;  2WBU A;  2MKD A;  1A1F A;  2EMX A;  2YTG A;  1UN6 B;  2ELZ A;  2MDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...