1T4LB

Solution structure of double-stranded rna binding domain of s. cerevisiae rnase iii (rnt1p) in complex with the 5' terminal rna hairpin of snr47 precursor
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
90
structure length
90
Chain Sequence
GSLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5' terminal hairpin of snR47 precursor
publication title Structural basis for recognition of the AGNN tetraloop RNA fold by the double-stranded RNA-binding domain of Rnt1p RNase III.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein/rna
total genus 15
structure length 90
sequence length 90
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2004-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1t4lB00
4DR5E 1WHQA 4LF4E 1YYKA 2L2NA 1GQEA 2NA2A 1IBKE 1RC7A 2UUCE 3VYYA 5CFFE 4DV1E 2LRSA 1YYWA 4B3ME 1N32E 1WHNA 2LTSA 1N34E 3T1HE 2MDRA 3P1XA 1N36E 2RS7A 1X47A 4LF6E 4M30A 3ADIA 2LTRA 4WFTA 2CPNA 2RTXA 2B7TA 1J26A 2HHHE 4DR1E 2RSMA 4DV3E 4JI2E 4GKJE 4JI8E 4X65E 4JI1E 2L2MA 1UILA 2N3GA 1IBME 4NXME 4DR2E 4DV7E 4DKKA 4LF5E 2JVAA 4YY3E 1T4LB 4LF8E 4JI7E 3T1YE 1X48A 4DR3E 4DUZE 2NUGA 4X66E 4LFBE 4K0KE 1X49A 4DV6E 4B3RE 1UHZA 4JI6E 4JI4E 2ZM6E 1RQ0A 1N33E 1XMOE 1ZBTA 4B3TE 2VQFE 5IWAE 5LMUE 1XNQE 2VQEE 4M2ZA 3HTXA 2UXDE 1DI2A 4YHHE 4JI5E 1FJGE 1XNRE 3C4BA 2UU9E 2YT4A 4DR6E 2L3JA 2LUQA 2E5LE 2NUEA 1O0WA 1HNZE 3J7Yp 4OOGC 4JI3E 5LMNE 1PKPA 4LF7E 1YZ9A 1HNXE 2F4VE 4X62E 3C4TA 2L3CA 4X64E 4NXNE 2JY9A 2UXCE 4WYQB 4JV5E 2L2KB 2DIXA 1XMQE 1IBLE 4DR7E 4LF9E 4LFAE 2RS6A 1T4NA 4DV0E 2UXBE 2LBSB 1T4OA 3ADJA 4AQYE 1EKZA 2DMYA 4JI0E 4LFCE 2L33A 4JYAE 3LLHA 5BR8E 2LJHA 1STUA 1I94E 2LUPB 4DR4E 1QU6A 3OTOE 4OX9E 4DV4E 4DV5E 2N3HA 1HR0E 4DV2E 1HNWE 2UUBE 2IHR1 2UUAE 2EZ6A 3VYXA 2B7VA 2DB2A 4KHPE 1J5EE 1YYOA 4GKKE 2NUFA 3ADGA 1FKAE 4B3SE 4X8WA 4DUYE 3ADLA 2KHXA 2B3TB
chains in the Genus database with same CATH superfamily
2EPUA 2CT1A 1PJSA 3EPJA 2NA2A 3OMLA 2FV4B 2UUCE 4ZYHA 2LCEA 1A1JA 2YTPA 4IJDA 2YTEA 2EL5A 2EPMX 2LT7A 2EOQA 2K7IA 4O43A 1UBDC 1X3CA 1G2DC 1N36E 4R2RA 4LF6E 4FK5C 2LTRA 2YTOA 4LTYA 2GHFA 1ZBQA 3MHSC 4O24A 2HC5A 1Z1BA 4WSGA 5AE2A 2EOOA 3BGHA 3VHTB 4WX9A 4Q28A 1NEIA 1PJTA 2L2MA 2EOXA 4DKKA 4LF5E 2YRHA 4O5GA 1EH7A 2EPRA 2NUGA 4LFBE 1ZAAC 1X49A 4JI4E 4F6NA 4R2QA 2JP9A 1RQ0A 1XMOE 2EPZA 2KONA 2LVHA 2YTIA 2PRTA 2EPCA 5LMUE 1JK1A 2Q8UA 1A1KA 2EPPA 2F8BA 1SR9A 1G2FC 1FJGE 2FTXB 1UN6B 4BHBA 3EPKA 2EL6A 3J7Yp 4OOGC 4JI3E 1A1FA 2EM9A 2EM2A 1YZ9A 4X62E 2DLKA 2ODRD 4NXNE 2K4VA 4WYQB 4JV5E 2RSIA 2L2KB 1YUIA 4R8OA 1L4SA 1XMQE 2MDGA 2EE8A 2YPNA 4DR7E 2FGGA 3HPZA 2EMCA 4LFAE 1BB8A 2EOJA 4BC7A 1EKZA 2LJUA 1EH8A 4JI0E 5BR8E 4R2AA 1STUA 2EQ1A 3F6GA 2YTFA 4N4RB 1QU6A 4OX9E 1B69A 1ZR9A 3JAMC 2ELYA 4WPYA 1A1IA 2EPAA 2N3HA 1X6HA 3C6KA 1HNWE 1A1HA 2DSYA 4KWYA 5A2QC 2DB2A 2R1FA 1IQOA 1KYQA 1YYOA 4GZNC 4GKKE 5A6BD 4DUYE 1ZU1A 2ADRA 5FLXC 1WHQA 4F9BB 4LF4E 1YYKA 2L2NA 2EPNA 2DRPA 3DJWA 2H36X 4BMJA 5CFFE 2V86A 2EN2A 2EM3A 4DV1E 1X6FA 5T6JA 2V83A 2LTSA 3T1HE 2EMLA 2KOUA 1AH5A 2R76A 2EN7A 2RS7A 2HGHA 3J7AG 2YTJA 2CPNA 1J26A 3ECRA 4DV3E 2GLIA 4JI2E 3M99B 4GKJE 1X5WA 3IWCA 3H09A 4P78A 2EMFA 1IBME 2YWQA 4HEIA 2EMBA 4DV7E 2BB8A 2EMYA 2EOYA 4WXDA 4YY3E 2YU5A 2WBUA 1X48A 2G7HA 4B3RE 5A6AA 4JI6E 4MLQA 4B3TE 1RMDA 5IWAE 1KJKA 1XNQE 4ZYEA 2EM8A 4WXCA 5KL5A 2EOFA 1BBOA 2V88A 2UU9E 5KL3A 2JOXA 4KZSA 2NUEA 1HNZE 1T38A 1DQ3A 1NCSA 4F9AB 4BBYA 4LF7E 2EOHA 2L3CA 4I8OA 2JY9A 2LV2A 1N3GA 2EN6A 5KL4A 3AUZA 4R2DA 3HPSA 2EN8A 1WXRA 4MLVA 1F2IG 2LBSB 3ADJA 3J80C 2DMYA 2YU8A 4NHRA 5F3WA 4DR4E 3EPLA 3K6QA 1TN9A 4RH8A 4DV4E 4DV5E 2UUBE 2L6MA 1PDAA 3HQ1A 5LLQA 3HXLA 2CSHA 2NABA 2V87A 4GEQB 2NUFA 3ADGA 3IWDA 1FKAE 4X8WA 2I9IA 2E72A 3TQMA 1IQSA 3LMLA 1RC7A 2L8TA 2YRMA 4WSPA 3KWRA 2LRSA 1YYWA 2VRDA 2EP3A 4B3ME 1WRJA 2EORA 4M0VA 5IT9C 1MGTA 2MDRA 3P1XA 2LE2A 1X47A 2DGCA 3MHHC 5LL6R 2JR1A 3THNA 2VF1A 2YTQA 5AC4A 2VE7C 5AASA 1YSAC 1BBGA 2EN4A 2JPAA 2EPOA 4X65E 1UILA 2N3GA 1P47A 2EQ0A 2CTDA 2EOMA 4R2CA 2JVAA 2A25A 4JI7E 2EMWA 2RQLA 4X66E 4K0KE 3DF6A 1UHZA 5A6BA 2RPCA 3AV0A 1YFHA 1N33E 1ZBTA 3VK6A 2VQFE 3J81C 2VQEE 4M2ZA 3JTZA 3HTXA 2UXDE 1A1LA 1YUJA 2ENCA 4YHHE 2V89A 2EOZA 4BC9A 2JXPA 4JI5E 1XNRE 2DLQA 2L3JA 2WBTA 2LUQA 1O0WA 2L92A 4R2SA 2WBSA 4TUGA 5KL2A 4HTGA 1QNTA 2DIXA 3JU0A 1GZ6A 4RHBB 1YPNA 2EL4A 4LF9E 1LLMC 1T4NA 2UXBE 2V85A 2LMZA 3F6HA 2EM5A 2EM0A 4AQYE 4JYAE 2EWLA 1I94E 3OTOE 3MSWA 3QG5C 1GTKA 4NZVA 2EPLX 1PJQA 2M1SA 1HR0E 4DV2E 2I13A 1A1GA 2JOBA 1TF6A 2J7JA 2EMAA 4F9CB 5KL6A 4L8NA 2EZ6A 2B7VA 2EJ4A 2YTNA 4KHPE 3BF2A 2EMXA 1AAYA 2EOSA 3ADLA 2KHXA 1T39A 5DNYA 4DR5E 2EQ3A 4O4KA 1DGCA 3BIDA 1GQEA 1IBKE 4TUIA 3VYYA 3FIGA 5A69A 3L00A 3RMPA 1N32E 5IXMB 1WHNA 1N34E 1WJPA 2M7QA 2V8QB 4F54A 4ZYGA 5AE3A 4M30A 3ADIA 4WFTA 2RTXA 2B7TA 2EMGA 4J8ZA 5AE1A 2HHHE 4DR1E 2RSMA 1TF3A 2EMIA 5KL7A 2ENAA 4R2EA 2EPXA 5A6KA 2MKNA 3EPHA 3IWBA 4BHCA 2YSPA 2MKDA 4LU9A 4JI8E 1MEYC 2ELZA 4JI1E 4BCAA 2BBGA 3THOB 4F2JC 5TSEA 5A6JA 4NXME 2JYAA 2EMZA 2M9AA 2D9HA 3UK3C 4DR2E 1T4LB 1IMUA 4LF8E 3T1YE 4DR3E 4DUZE 2B9DA 4DV6E 2WCC3 2GPIA 1EH6A 2M4IA 2ZM6E 2EN1A 2YTDA 2DMIA 2EN3A 2EPKX 1DI2A 5IV8B 4R2PA 3C4BA 2YT4A 2YRKA 4IS1C 4DR6E 2E5LE 5LMNE 1PKPA 3KZYA 4DMIA 1HNXE 2F4VE 3C4TA 4X64E 2UXCE 3KZZA 2MC5A 4R03A 2ENHA 4L5NC 2EM7A 1IBLE 2LO3A 4BS9A 2YTGA 2E1MA 2EOIA 2JWOA 2RS6A 4DV0E 5ADZA 1JK2A 1T4OA 2EOEA 2N8XA 4LFCE 4Q35B 2L33A 3LLHA 2LJHA 2WZOA 2HJJA 5AC5A 3C6MA 1SFEA 2EMHA 4F6MA 2LUPB 2EM6A 2MC6A 3BBGA 4X9JA 4P7DA 4ZYDA 2IHR1 3ZOQB 2YZTA 2UUAE 3VYXA 3EQ1A 2YSOA 1J5EE 2EMKA 4M9VC 2EM4A 1X6EA 2ODRC 4B3SE 2B3TB
chains in the Genus database with same CATH topology
5DNYA 5FLXC 4DR5E 1WHQA 4F9BB 4LF4E 1YYKA 2L2NA 1GQEA 2NA2A 1IBKE 3DJWA 3LMLA 3OMLA 2FV4B 4TUIA 1RC7A 2H36X 2UUCE 3VYYA 4BMJA 2L8TA 5CFFE 2V86A 4WSPA 3FIGA 3KWRA 4DV1E 2LRSA 1YYWA 3RMPA 5T6JA 4B3ME 4M0VA 5IT9C 1N32E 2V83A 1WHNA 2LTSA 1N34E 3T1HE 2M7QA 2MDRA 2KOUA 3P1XA 2V8QB 4F54A 2RS7A 1N36E 2LE2A 5AE3A 1X47A 3J7AG 4LF6E 4M30A 3ADIA 2LTRA 4LTYA 4WFTA 2CPNA 2RTXA 2B7TA 2JR1A 4J8ZA 5LL6R 2VF1A 5AE1A 2HHHE 1J26A 1ZBQA 4DR1E 2RSMA 4DV3E 2VE7C 5AASA 4JI2E 4GKJE 5AE2A 3IWBA 3IWCA 4Q28A 4LU9A 4JI8E 3H09A 4P78A 4X65E 4JI1E 2L2MA 4BCAA 1UILA 2N3GA 1IBME 4NXME 4DR2E 4DV7E 4DKKA 4LF5E 2JVAA 4YY3E 1T4LB 4LF8E 4JI7E 3T1YE 1X48A 4DR3E 4DUZE 2B9DA 2NUGA 2G7HA 4X66E 4LFBE 4K0KE 1X49A 4DV6E 3DF6A 4B3RE 1UHZA 2M4IA 3AV0A 4JI6E 4JI4E 2ZM6E 1RQ0A 1N33E 1XMOE 1ZBTA 2KONA 4B3TE 3VK6A 5IWAE 2VQFE 5LMUE 3J81C 2VQEE 4M2ZA 1XNQE 3JTZA 3HTXA 2UXDE 1DI2A 2F8BA 1SR9A 4YHHE 2V89A 2V88A 4BC9A 4JI5E 2FTXB 3C4BA 2UU9E 1FJGE 2YT4A 1XNRE 2L3JA 2JOXA 2LUQA 4KZSA 4DR6E 2E5LE 2NUEA 1O0WA 1HNZE 2L92A 3J7Yp 4OOGC 1DQ3A 4F9AB 4JI3E 5LMNE 1PKPA 4BBYA 4LF7E 4DMIA 1YZ9A 4TUGA 1HNXE 2F4VE 4X62E 3C4TA 2L3CA 4I8OA 2ODRD 4X64E 4NXNE 2JY9A 2K4VA 4WYQB 4JV5E 2UXCE 2L2KB 2DIXA 2MC5A 4R03A 3JU0A 1GZ6A 4R8OA 4L5NC 1XMQE 3AUZA 1IBLE 4DR7E 2FGGA 3HPZA 3HPSA 4BS9A 4LF9E 4LFAE 2E1MA 1WXRA 2RS6A 2JWOA 1T4NA 4DV0E 2V85A 2LMZA 3F6HA 4BC7A 1T4OA 3ADJA 5ADZA 3J80C 2DMYA 4AQYE 2LBSB 1EKZA 2L33A 4JI0E 4LFCE 4JYAE 3LLHA 5BR8E 2LJHA 1STUA 5F3WA 2WZOA 2EWLA 3F6GA 2LUPB 1I94E 1QU6A 4DR4E 3OTOE 4OX9E 3MSWA 3K6QA 3JAMC 2MC6A 4WPYA 4DV4E 4DV5E 2N3HA 2M1SA 1HR0E 4P7DA 4DV2E 3ADLA 2JOBA 1HNWE 2UUBE 2L6MA 2IHR1 2DSYA 3ZOQB 3HQ1A 4F9CB 2YZTA 4L8NA 2UUAE 2EZ6A 3VYXA 5A2QC 2B7VA 2DB2A 3HXLA 1J5EE 4KHPE 1YYOA 2V87A 4GEQB 4GKKE 2NUFA 3ADGA 2ODRC 2UXBE 3IWDA 1FKAE 4X8WA 4DUYE 4B3SE 2KHXA 2B3TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 E;  1WHQ A;  4LF4 E;  1YYK A;  2L2N A;  1GQE A;  2NA2 A;  1IBK E;  1RC7 A;  2UUC E;  3VYY A;  5CFF E;  4DV1 E;  2LRS A;  1YYW A;  4B3M E;  1N32 E;  1WHN A;  2LTS A;  1N34 E;  3T1H E;  2MDR A;  3P1X A;  1N36 E;  2RS7 A;  1X47 A;  4LF6 E;  4M30 A;  3ADI A;  2LTR A;  4WFT A;  2CPN A;  2RTX A;  2B7T A;  1J26 A;  2HHH E;  4DR1 E;  2RSM A;  4DV3 E;  4JI2 E;  4GKJ E;  4JI8 E;  4X65 E;  4JI1 E;  2L2M A;  1UIL A;  2N3G A;  1IBM E;  4NXM E;  4DR2 E;  4DV7 E;  4DKK A;  4LF5 E;  2JVA A;  4YY3 E;  1T4L B;  4LF8 E;  4JI7 E;  3T1Y E;  1X48 A;  4DR3 E;  4DUZ E;  2NUG A;  4X66 E;  4LFB E;  4K0K E;  1X49 A;  4DV6 E;  4B3R E;  1UHZ A;  4JI6 E;  4JI4 E;  2ZM6 E;  1RQ0 A;  1N33 E;  1XMO E;  1ZBT A;  4B3T E;  2VQF E;  5IWA E;  5LMU E;  1XNQ E;  2VQE E;  4M2Z A;  3HTX A;  2UXD E;  1DI2 A;  4YHH E;  4JI5 E;  1FJG E;  1XNR E;  3C4B A;  2UU9 E;  2YT4 A;  4DR6 E;  2L3J A;  2LUQ A;  2E5L E;  2NUE A;  1O0W A;  1HNZ E;  3J7Y p;  4OOG C;  4JI3 E;  5LMN E;  1PKP A;  4LF7 E;  1YZ9 A;  1HNX E;  2F4V E;  4X62 E;  3C4T A;  2L3C A;  4X64 E;  4NXN E;  2JY9 A;  2UXC E;  4WYQ B;  4JV5 E;  2L2K B;  2DIX A;  1XMQ E;  1IBL E;  4DR7 E;  4LF9 E;  4LFA E;  2RS6 A;  1T4N A;  4DV0 E;  2UXB E;  2LBS B;  1T4O A;  3ADJ A;  4AQY E;  1EKZ A;  2DMY A;  4JI0 E;  4LFC E;  2L33 A;  4JYA E;  3LLH A;  5BR8 E;  2LJH A;  1STU A;  1I94 E;  2LUP B;  4DR4 E;  1QU6 A;  3OTO E;  4OX9 E;  4DV4 E;  4DV5 E;  2N3H A;  1HR0 E;  4DV2 E;  1HNW E;  2UUB E;  2IHR 1;  2UUA E;  2EZ6 A;  3VYX A;  2B7V A;  2DB2 A;  4KHP E;  1J5E E;  1YYO A;  4GKK E;  2NUF A;  3ADG A;  1FKA E;  4B3S E;  4X8W A;  4DUY E;  3ADL A;  2KHX A;  2B3T B; 
#chains in the Genus database with same CATH topology
 2EPU A;  2CT1 A;  1PJS A;  3EPJ A;  2NA2 A;  3OML A;  2FV4 B;  2UUC E;  4ZYH A;  2LCE A;  1A1J A;  2YTP A;  4IJD A;  2YTE A;  2EL5 A;  2EPM X;  2LT7 A;  2EOQ A;  2K7I A;  4O43 A;  1UBD C;  1X3C A;  1G2D C;  1N36 E;  4R2R A;  4LF6 E;  4FK5 C;  2LTR A;  2YTO A;  4LTY A;  2GHF A;  1ZBQ A;  3MHS C;  4O24 A;  2HC5 A;  1Z1B A;  4WSG A;  5AE2 A;  2EOO A;  3BGH A;  3VHT B;  4WX9 A;  4Q28 A;  1NEI A;  1PJT A;  2L2M A;  2EOX A;  4DKK A;  4LF5 E;  2YRH A;  4O5G A;  1EH7 A;  2EPR A;  2NUG A;  4LFB E;  1ZAA C;  1X49 A;  4JI4 E;  4F6N A;  4R2Q A;  2JP9 A;  1RQ0 A;  1XMO E;  2EPZ A;  2KON A;  2LVH A;  2YTI A;  2PRT A;  2EPC A;  5LMU E;  1JK1 A;  2Q8U A;  1A1K A;  2EPP A;  2F8B A;  1SR9 A;  1G2F C;  1FJG E;  2FTX B;  1UN6 B;  4BHB A;  3EPK A;  2EL6 A;  3J7Y p;  4OOG C;  4JI3 E;  1A1F A;  2EM9 A;  2EM2 A;  1YZ9 A;  4X62 E;  2DLK A;  2ODR D;  4NXN E;  2K4V A;  4WYQ B;  4JV5 E;  2RSI A;  2L2K B;  1YUI A;  4R8O A;  1L4S A;  1XMQ E;  2MDG A;  2EE8 A;  2YPN A;  4DR7 E;  2FGG A;  3HPZ A;  2EMC A;  4LFA E;  1BB8 A;  2EOJ A;  4BC7 A;  1EKZ A;  2LJU A;  1EH8 A;  4JI0 E;  5BR8 E;  4R2A A;  1STU A;  2EQ1 A;  3F6G A;  2YTF A;  4N4R B;  1QU6 A;  4OX9 E;  1B69 A;  1ZR9 A;  3JAM C;  2ELY A;  4WPY A;  1A1I A;  2EPA A;  2N3H A;  1X6H A;  3C6K A;  1HNW E;  1A1H A;  2DSY A;  4KWY A;  5A2Q C;  2DB2 A;  2R1F A;  1IQO A;  1KYQ A;  1YYO A;  4GZN C;  4GKK E;  5A6B D;  4DUY E;  1ZU1 A;  2ADR A;  5FLX C;  1WHQ A;  4F9B B;  4LF4 E;  1YYK A;  2L2N A;  2EPN A;  2DRP A;  3DJW A;  2H36 X;  4BMJ A;  5CFF E;  2V86 A;  2EN2 A;  2EM3 A;  4DV1 E;  1X6F A;  5T6J A;  2V83 A;  2LTS A;  3T1H E;  2EML A;  2KOU A;  1AH5 A;  2R76 A;  2EN7 A;  2RS7 A;  2HGH A;  3J7A G;  2YTJ A;  2CPN A;  1J26 A;  3ECR A;  4DV3 E;  2GLI A;  4JI2 E;  3M99 B;  4GKJ E;  1X5W A;  3IWC A;  3H09 A;  4P78 A;  2EMF A;  1IBM E;  2YWQ A;  4HEI A;  2EMB A;  4DV7 E;  2BB8 A;  2EMY A;  2EOY A;  4WXD A;  4YY3 E;  2YU5 A;  2WBU A;  1X48 A;  2G7H A;  4B3R E;  5A6A A;  4JI6 E;  4MLQ A;  4B3T E;  1RMD A;  5IWA E;  1KJK A;  1XNQ E;  4ZYE A;  2EM8 A;  4WXC A;  5KL5 A;  2EOF A;  1BBO A;  2V88 A;  2UU9 E;  5KL3 A;  2JOX A;  4KZS A;  2NUE A;  1HNZ E;  1T38 A;  1DQ3 A;  1NCS A;  4F9A B;  4BBY A;  4LF7 E;  2EOH A;  2L3C A;  4I8O A;  2JY9 A;  2LV2 A;  1N3G A;  2EN6 A;  5KL4 A;  3AUZ A;  4R2D A;  3HPS A;  2EN8 A;  1WXR A;  4MLV A;  1F2I G;  2LBS B;  3ADJ A;  3J80 C;  2DMY A;  2YU8 A;  4NHR A;  5F3W A;  4DR4 E;  3EPL A;  3K6Q A;  1TN9 A;  4RH8 A;  4DV4 E;  4DV5 E;  2UUB E;  2L6M A;  1PDA A;  3HQ1 A;  5LLQ A;  3HXL A;  2CSH A;  2NAB A;  2V87 A;  4GEQ B;  2NUF A;  3ADG A;  3IWD A;  1FKA E;  4X8W A;  2I9I A;  2E72 A;  3TQM A;  1IQS A;  3LML A;  1RC7 A;  2L8T A;  2YRM A;  4WSP A;  3KWR A;  2LRS A;  1YYW A;  2VRD A;  2EP3 A;  4B3M E;  1WRJ A;  2EOR A;  4M0V A;  5IT9 C;  1MGT A;  2MDR A;  3P1X A;  2LE2 A;  1X47 A;  2DGC A;  3MHH C;  5LL6 R;  2JR1 A;  3THN A;  2VF1 A;  2YTQ A;  5AC4 A;  2VE7 C;  5AAS A;  1YSA C;  1BBG A;  2EN4 A;  2JPA A;  2EPO A;  4X65 E;  1UIL A;  2N3G A;  1P47 A;  2EQ0 A;  2CTD A;  2EOM A;  4R2C A;  2JVA A;  2A25 A;  4JI7 E;  2EMW A;  2RQL A;  4X66 E;  4K0K E;  3DF6 A;  1UHZ A;  5A6B A;  2RPC A;  3AV0 A;  1YFH A;  1N33 E;  1ZBT A;  3VK6 A;  2VQF E;  3J81 C;  2VQE E;  4M2Z A;  3JTZ A;  3HTX A;  2UXD E;  1A1L A;  1YUJ A;  2ENC A;  4YHH E;  2V89 A;  2EOZ A;  4BC9 A;  2JXP A;  4JI5 E;  1XNR E;  2DLQ A;  2L3J A;  2WBT A;  2LUQ A;  1O0W A;  2L92 A;  4R2S A;  2WBS A;  4TUG A;  5KL2 A;  4HTG A;  1QNT A;  2DIX A;  3JU0 A;  1GZ6 A;  4RHB B;  1YPN A;  2EL4 A;  4LF9 E;  1LLM C;  1T4N A;  2UXB E;  2V85 A;  2LMZ A;  3F6H A;  2EM5 A;  2EM0 A;  4AQY E;  4JYA E;  2EWL A;  1I94 E;  3OTO E;  3MSW A;  3QG5 C;  1GTK A;  4NZV A;  2EPL X;  1PJQ A;  2M1S A;  1HR0 E;  4DV2 E;  2I13 A;  1A1G A;  2JOB A;  1TF6 A;  2J7J A;  2EMA A;  4F9C B;  5KL6 A;  4L8N A;  2EZ6 A;  2B7V A;  2EJ4 A;  2YTN A;  4KHP E;  3BF2 A;  2EMX A;  1AAY A;  2EOS A;  3ADL A;  2KHX A;  1T39 A;  5DNY A;  4DR5 E;  2EQ3 A;  4O4K A;  1DGC A;  3BID A;  1GQE A;  1IBK E;  4TUI A;  3VYY A;  3FIG A;  5A69 A;  3L00 A;  3RMP A;  1N32 E;  5IXM B;  1WHN A;  1N34 E;  1WJP A;  2M7Q A;  2V8Q B;  4F54 A;  4ZYG A;  5AE3 A;  4M30 A;  3ADI A;  4WFT A;  2RTX A;  2B7T A;  2EMG A;  4J8Z A;  5AE1 A;  2HHH E;  4DR1 E;  2RSM A;  1TF3 A;  2EMI A;  5KL7 A;  2ENA A;  4R2E A;  2EPX A;  5A6K A;  2MKN A;  3EPH A;  3IWB A;  4BHC A;  2YSP A;  2MKD A;  4LU9 A;  4JI8 E;  1MEY C;  2ELZ A;  4JI1 E;  4BCA A;  2BBG A;  3THO B;  4F2J C;  5TSE A;  5A6J A;  4NXM E;  2JYA A;  2EMZ A;  2M9A A;  2D9H A;  3UK3 C;  4DR2 E;  1T4L B;  1IMU A;  4LF8 E;  3T1Y E;  4DR3 E;  4DUZ E;  2B9D A;  4DV6 E;  2WCC 3;  2GPI A;  1EH6 A;  2M4I A;  2ZM6 E;  2EN1 A;  2YTD A;  2DMI A;  2EN3 A;  2EPK X;  1DI2 A;  5IV8 B;  4R2P A;  3C4B A;  2YT4 A;  2YRK A;  4IS1 C;  4DR6 E;  2E5L E;  5LMN E;  1PKP A;  3KZY A;  4DMI A;  1HNX E;  2F4V E;  3C4T A;  4X64 E;  2UXC E;  3KZZ A;  2MC5 A;  4R03 A;  2ENH A;  4L5N C;  2EM7 A;  1IBL E;  2LO3 A;  4BS9 A;  2YTG A;  2E1M A;  2EOI A;  2JWO A;  2RS6 A;  4DV0 E;  5ADZ A;  1JK2 A;  1T4O A;  2EOE A;  2N8X A;  4LFC E;  4Q35 B;  2L33 A;  3LLH A;  2LJH A;  2WZO A;  2HJJ A;  5AC5 A;  3C6M A;  1SFE A;  2EMH A;  4F6M A;  2LUP B;  2EM6 A;  2MC6 A;  3BBG A;  4X9J A;  4P7D A;  4ZYD A;  2IHR 1;  3ZOQ B;  2YZT A;  2UUA E;  3VYX A;  3EQ1 A;  2YSO A;  1J5E E;  2EMK A;  4M9V C;  2EM4 A;  1X6E A;  2ODR C;  4B3S E;  2B3T B; 
#chains in the Genus database with same CATH homology
 5DNY A;  5FLX C;  4DR5 E;  1WHQ A;  4F9B B;  4LF4 E;  1YYK A;  2L2N A;  1GQE A;  2NA2 A;  1IBK E;  3DJW A;  3LML A;  3OML A;  2FV4 B;  4TUI A;  1RC7 A;  2H36 X;  2UUC E;  3VYY A;  4BMJ A;  2L8T A;  5CFF E;  2V86 A;  4WSP A;  3FIG A;  3KWR A;  4DV1 E;  2LRS A;  1YYW A;  3RMP A;  5T6J A;  4B3M E;  4M0V A;  5IT9 C;  1N32 E;  2V83 A;  1WHN A;  2LTS A;  1N34 E;  3T1H E;  2M7Q A;  2MDR A;  2KOU A;  3P1X A;  2V8Q B;  4F54 A;  2RS7 A;  1N36 E;  2LE2 A;  5AE3 A;  1X47 A;  3J7A G;  4LF6 E;  4M30 A;  3ADI A;  2LTR A;  4LTY A;  4WFT A;  2CPN A;  2RTX A;  2B7T A;  2JR1 A;  4J8Z A;  5LL6 R;  2VF1 A;  5AE1 A;  2HHH E;  1J26 A;  1ZBQ A;  4DR1 E;  2RSM A;  4DV3 E;  2VE7 C;  5AAS A;  4JI2 E;  4GKJ E;  5AE2 A;  3IWB A;  3IWC A;  4Q28 A;  4LU9 A;  4JI8 E;  3H09 A;  4P78 A;  4X65 E;  4JI1 E;  2L2M A;  4BCA A;  1UIL A;  2N3G A;  1IBM E;  4NXM E;  4DR2 E;  4DV7 E;  4DKK A;  4LF5 E;  2JVA A;  4YY3 E;  1T4L B;  4LF8 E;  4JI7 E;  3T1Y E;  1X48 A;  4DR3 E;  4DUZ E;  2B9D A;  2NUG A;  2G7H A;  4X66 E;  4LFB E;  4K0K E;  1X49 A;  4DV6 E;  3DF6 A;  4B3R E;  1UHZ A;  2M4I A;  3AV0 A;  4JI6 E;  4JI4 E;  2ZM6 E;  1RQ0 A;  1N33 E;  1XMO E;  1ZBT A;  2KON A;  4B3T E;  3VK6 A;  5IWA E;  2VQF E;  5LMU E;  3J81 C;  2VQE E;  4M2Z A;  1XNQ E;  3JTZ A;  3HTX A;  2UXD E;  1DI2 A;  2F8B A;  1SR9 A;  4YHH E;  2V89 A;  2V88 A;  4BC9 A;  4JI5 E;  2FTX B;  3C4B A;  2UU9 E;  1FJG E;  2YT4 A;  1XNR E;  2L3J A;  2JOX A;  2LUQ A;  4KZS A;  4DR6 E;  2E5L E;  2NUE A;  1O0W A;  1HNZ E;  2L92 A;  3J7Y p;  4OOG C;  1DQ3 A;  4F9A B;  4JI3 E;  5LMN E;  1PKP A;  4BBY A;  4LF7 E;  4DMI A;  1YZ9 A;  4TUG A;  1HNX E;  2F4V E;  4X62 E;  3C4T A;  2L3C A;  4I8O A;  2ODR D;  4X64 E;  4NXN E;  2JY9 A;  2K4V A;  4WYQ B;  4JV5 E;  2UXC E;  2L2K B;  2DIX A;  2MC5 A;  4R03 A;  3JU0 A;  1GZ6 A;  4R8O A;  4L5N C;  1XMQ E;  3AUZ A;  1IBL E;  4DR7 E;  2FGG A;  3HPZ A;  3HPS A;  4BS9 A;  4LF9 E;  4LFA E;  2E1M A;  1WXR A;  2RS6 A;  2JWO A;  1T4N A;  4DV0 E;  2V85 A;  2LMZ A;  3F6H A;  4BC7 A;  1T4O A;  3ADJ A;  5ADZ A;  3J80 C;  2DMY A;  4AQY E;  2LBS B;  1EKZ A;  2L33 A;  4JI0 E;  4LFC E;  4JYA E;  3LLH A;  5BR8 E;  2LJH A;  1STU A;  5F3W A;  2WZO A;  2EWL A;  3F6G A;  2LUP B;  1I94 E;  1QU6 A;  4DR4 E;  3OTO E;  4OX9 E;  3MSW A;  3K6Q A;  3JAM C;  2MC6 A;  4WPY A;  4DV4 E;  4DV5 E;  2N3H A;  2M1S A;  1HR0 E;  4P7D A;  4DV2 E;  3ADL A;  2JOB A;  1HNW E;  2UUB E;  2L6M A;  2IHR 1;  2DSY A;  3ZOQ B;  3HQ1 A;  4F9C B;  2YZT A;  4L8N A;  2UUA E;  2EZ6 A;  3VYX A;  5A2Q C;  2B7V A;  2DB2 A;  3HXL A;  1J5E E;  4KHP E;  1YYO A;  2V87 A;  4GEQ B;  4GKK E;  2NUF A;  3ADG A;  2ODR C;  2UXB E;  3IWD A;  1FKA E;  4X8W A;  4DUY E;  4B3S E;  2KHX A;  2B3T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...