1T4LB

Solution structure of double-stranded rna binding domain of s. cerevisiae rnase iii (rnt1p) in complex with the 5' terminal rna hairpin of snr47 precursor
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
90
structure length
90
Chain Sequence
GSLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein/rna
molecule keywords 5' terminal hairpin of snR47 precursor
publication title Structural basis for recognition of the AGNN tetraloop RNA fold by the double-stranded RNA-binding domain of Rnt1p RNase III.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 15
structure length 90
sequence length 90
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2004-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1t4lB00
2LRSA 1XMQE 1J5EE 1XMOE 2DIXA 4JI5E 4DV2E 2VQFE 4X62E 4LF5E 1XNRE 4DV0E 4X66E 3LLHA 3HTXA 4DV7E 1I94E 1HNZE 1N32E 1QU6A 4B3SE 2LUQA 1YYOA 2YT4A 1GQEA 1IBKE 4DR5E 1FKAE 1RC7A 5BR8E 2N3GA 3C4TA 2B3TB 2LJHA 2RTXA 2L3CA 2NUEA 1O0WA 2NUGA 1HNXE 4YHHE 1T4NA 1YZ9A 1ZBTA 4LF8E 4M30A 1IBLE 1YYWA 2B7TA 2RSMA 3J7Yp 2L2NA 2ZM6E 4K0KE 4WYQB 1STUA 3OTOE 1IBME 4JV5E 1N33E 2F4VE 4DR6E 1WHQA 2E5LE 2LUPB 1X49A 3ADIA 3ADLA 5LMNE 1FJGE 1J26A 2UU9E 1N34E 1RQ0A 3C4BA 4DR1E 4DR2E 1PKPA 3VYYA 4B3TE 4NXME 4JI8E 2N3HA 1X47A 2L33A 4JI4E 2RS6A 2LBSB 2NUFA 1UHZA 5LMUE 1HR0E 2NA2A 4WFTA 4DV4E 2LTSA 4LF6E 2UXDE 4LF7E 4OOGC 4LFBE 1N36E 4DUZE 2JY9A 3T1HE 2B7VA 2UUCE 4B3ME 2EZ6A 4DKKA 4YY3E 2L2KB 5IWAE 1T4LB 2CPNA 2L2MA 1YYKA 1T4OA 1X48A 4X8WA 4JI6E 4LFCE 2LTRA 2VQEE 5CFFE 3T1YE 2HHHE 2UUAE 4NXNE 4GKKE 2UXBE 2JVAA 1UILA 4DV3E 4JI2E 4DR3E 2MDRA 3ADJA 4M2ZA 4JI3E 4JYAE 2L3JA 1EKZA 4DV6E 2UUBE 4LF4E 3VYXA 4LF9E 3P1XA 2DB2A 2KHXA 4DR4E 4DUYE 4DV5E 4JI1E 4B3RE 4GKJE 4LFAE 2RS7A 2UXCE 4KHPE 1XNQE 4JI7E 2IHR1 4JI0E 4OX9E 1HNWE 4AQYE 4X65E 2DMYA 1WHNA 4DR7E 4X64E 1DI2A 3ADGA 4DV1E
chains in the Genus database with same CATH superfamily
1ZAAC 4M0VA 2EM9A 2V86A 2DIXA 4DV2E 5A6BA 2VQFE 1XNRE 2ODRD 4X66E 5KL2A 4WPYA 1A1HA 3M99B 2FGGA 4B3SE 2LUQA 2ENAA 2BB8A 4WSPA 1GZ6A 1RC7A 3BF2A 4F9CB 3JU0A 1NCSA 3OMLA 2N3GA 1A1JA 3MHSC 2NUEA 2NUGA 3ZOQB 3J81C 1HNXE 2EMWA 1ZBTA 2V87A 1X3CA 2YTOA 5LLQA 4L5NC 3J7Yp 3BBGA 4K0KE 3C6KA 2VRDA 4JV5E 2H36X 2F8BA 2F4VE 4R2RA 2Q8UA 1WHQA 5AC4A 1FJGE 1J26A 4P78A 4DR1E 3K6QA 1F2IG 3MSWA 2EM3A 2EMCA 2EE8A 2YTPA 2MDGA 1X47A 4O5GA 2L33A 2YU5A 5F3WA 2EMGA 4R2PA 1HR0E 3IWDA 2YTEA 2EL6A 2EM0A 4LF6E 2M7QA 2EM4A 4LF7E 2EOYA 4LFBE 3T1HE 1IQSA 2JY9A 4DKKA 3EPHA 2L2KB 1T4LB 2CPNA 2YU8A 1T4OA 4R2AA 2YTNA 4JI6E 5LL6R 2EOOA 4M2ZA 2JPAA 2FTXB 2EMFA 4JI3E 2PRTA 1EKZA 2UUBE 3HXLA 4LF4E 4LTYA 2YTFA 3VYXA 1TF6A 2EWLA 1EH6A 2KHXA 2NABA 2A25A 2M1SA 2V88A 4B3RE 3THOB 2RS7A 1X5WA 1PJQA 3UK3C 1AAYA 1XNQE 3IWCA 4JI0E 2R1FA 1HNWE 5A6KA 2VF1A 3KZZA 1ZBQA 2EPPA 2CTDA 3HQ1A 1BBGA 2LRSA 2LJUA 4JI5E 2EN3A 2YSOA 1T38A 4N4RB 4DV0E 1I94E 2V85A 1HNZE 1N32E 1IMUA 1QU6A 4O24A 4MLVA 2YTIA 1YYOA 1GQEA 1IBKE 3L00A 2EN7A 2JR1A 1DGCA 1P47A 4ZYGA 2LJHA 4GEQB 2YTGA 1YUJA 3THNA 2EPKX 2RSMA 2EMZA 2EOIA 3DF6A 3QG5C 5A69A 3OTOE 1IBME 2MKNA 2EL4A 2EN1A 5TSEA 2JXPA 2EPAA 1EH7A 3JTZA 1X49A 4TUGA 2LUPB 2L92A 2YZTA 1A1LA 4DR2E 2DRPA 2ELZA 4NXME 4JI8E 4BS9A 2N3HA 3AUZA 2EOZA 4Q28A 2LBSB 4RHBB 1A1KA 4WX9A 2MC5A 2I9IA 1LLMC 2EQ3A 2YTJA 4WFTA 2EL5A 2EMYA 2UXDE 3AV0A 4KWYA 1SFEA 4DUZE 2UUCE 4B3ME 2EQ1A 2WBTA 2FV4B 4WXDA 3HPZA 2YRMA 5IWAE 4R2CA 5A2QC 4X8WA 4O43A 1ZU1A 4LFCE 2VQEE 2EM8A 3T1YE 5AE2A 2DLQA 2EPRA 3F6HA 1G2FC 2EN4A 4RH8A 4GKKE 2JVAA 1UILA 4DV3E 4JI2E 3ADJA 5DNYA 3H09A 2EQ0A 2K4VA 1DQ3A 4R2QA 5KL3A 4WSGA 2DMIA 4LU9A 2DB2A 2EN6A 3EPJA 2CSHA 4DUYE 4DV5E 2G7HA 2N8XA 3HPSA 3J80C 4F2JC 1X6EA 1MEYC 2LMZA 2LCEA 5IV8B 4OX9E 3JAMC 2EM2A 3EPKA 3ADGA 4DV4E 2JP9A 5T6JA 4BHBA 1XMQE 1J5EE 2CT1A 1A1FA 1XMOE 2EPMX 2YRHA 2R76A 3MHHC 1B69A 4Q35B 3LLHA 1UN6B 5KL7A 2JYAA 2YT4A 1TF3A 4DR5E 4NZVA 5BR8E 1G2DC 1L4SA 2EP3A 2RTXA 1O0WA 2EOEA 2EOMA 1T39A 5A6AA 2LV2A 4BC9A 1SR9A 4LF8E 4M30A 1YYWA 4IJDA 2B9DA 2L2NA 2ZM6E 2WBSA 4BC7A 2EOJA 1N33E 2E5LE 1JK2A 1TN9A 2UU9E 2V89A 3C4BA 1PKPA 4M9VC 2KOUA 3VYYA 4P7DA 4F9BB 1PJTA 2EOXA 5IT9C 2L6MA 1YSAC 2EM5A 2EPOA 2RS6A 2L8TA 2NUFA 2YSPA 4R8OA 1UHZA 1YPNA 1BB8A 2ELYA 2J7JA 4BBYA 2D9HA 2EPXA 1YFHA 1N36E 1GTKA 2EMIA 2EOFA 2YTQA 4YY3E 2K7IA 4F6NA 1X48A 2KONA 2RPCA 2DLKA 2LTRA 4WXCA 1A1GA 4R2DA 4J8ZA 3BIDA 2UXBE 1QNTA 2EOSA 1UBDC 2RQLA 2MDRA 2YRKA 2M9AA 1BBOA 2EN8A 1KJKA 4NHRA 4JYAE 2L3JA 1N3GA 2EPUA 1X6FA 2LVHA 4LF9E 4L8NA 4DR4E 2GPIA 4I8OA 4KZSA 1WJPA 2EM6A 2M4IA 4HTGA 4ZYDA 2LT7A 4JI1E 3DJWA 1WRJA 2EMXA 1NEIA 2E1MA 4BHCA 2EORA 3TQMA 2IHR1 5KL5A 4AQYE 4BCAA 1PJSA 2EJ4A 4X65E 4R2SA 3IWBA 1WHNA 2HGHA 5KL6A 4DR7E 2EMKA 3C6MA 1DI2A 2I13A 5A6JA 3VK6A 3EPLA 2LO3A 4X62E 4LF5E 2YTDA 3LMLA 5AE3A 3HTXA 4DV7E 3F6GA 4R2EA 2EMAA 2V83A 4BMJA 1FKAE 2HC5A 4F6MA 2GLIA 2ENCA 5FLXC 2GHFA 3C4TA 2B3TB 2EPLX 2EOQA 2EMBA 2L3CA 2ODRC 4O4KA 3J7AG 2EPCA 2MC6A 1T4NA 1WXRA 4YHHE 1YZ9A 3KWRA 2LE2A 4FK5C 2B7TA 2WCC3 1IBLE 2ENHA 4WYQB 1STUA 4X9JA 2MKDA 2VE7C 1KYQA 4ZYEA 4DR6E 2EPZA 2YPNA 5ADZA 3ADIA 5AC5A 3ADLA 5LMNE 1N34E 1RQ0A 2ADRA 4F54A 1MGTA 4B3TE 2EM7A 3KZYA 1EH8A 3VHTB 2JOBA 5IXMB 5KL4A 4JI4E 3FIGA 1YUIA 1Z1BA 1JK1A 3ECRA 4DMIA 1ZR9A 5LMUE 2NA2A 2DSYA 5AASA 2LTSA 2EPNA 2JOXA 4OOGC 2B7VA 2EZ6A 2EMHA 2E72A 2YWQA 4GZNC 1AH5A 1PDAA 2JWOA 2L2MA 1YYKA 4ZYHA 3RMPA 3BGHA 5CFFE 2HHHE 2UUAE 4NXNE 1RMDA 1X6HA 2DGCA 5A6BD 4DR3E 2V8QB 2EMLA 4DV6E 4MLQA 2EOHA 5AE1A 4IS1C 3P1XA 1IQOA 2BBGA 3EQ1A 1A1IA 4GKJE 4LFAE 2UXCE 4R03A 2EN2A 4KHPE 2HJJA 4HEIA 4JI7E 4F9AB 4TUIA 2WZOA 2DMYA 4X64E 2RSIA 2WBUA 4DV1E
chains in the Genus database with same CATH topology
3VK6A 2LRSA 5T6JA 1XMQE 1J5EE 4M0VA 2V86A 1XMOE 2DIXA 4JI5E 4DV2E 2VQFE 4X62E 4LF5E 3LMLA 1XNRE 2ODRD 5AE3A 4DV0E 4X66E 3LLHA 3HTXA 4WPYA 4DV7E 1I94E 2V85A 3F6GA 1HNZE 1N32E 1QU6A 2FGGA 4B3SE 2LUQA 1YYOA 2V83A 2YT4A 1GQEA 4BMJA 1IBKE 4DR5E 4WSPA 3HQ1A 1GZ6A 1FKAE 1RC7A 2JR1A 4F9CB 3JU0A 3OMLA 5BR8E 2N3GA 5FLXC 3C4TA 2B3TB 2LJHA 2RTXA 2L3CA 2NUEA 1O0WA 2ODRC 3J7AG 4GEQB 2NUGA 3ZOQB 3J81C 1HNXE 2MC6A 1T4NA 1WXRA 4YHHE 4BC9A 1YZ9A 1SR9A 1ZBTA 2V87A 4M30A 4LF8E 3KWRA 2LE2A 1IBLE 2B7TA 4L5NC 1YYWA 2RSMA 2B9DA 3J7Yp 2L2NA 2ZM6E 4K0KE 4WYQB 1STUA 3DF6A 2VE7C 4BC7A 3OTOE 1IBME 2H36X 4JV5E 2F8BA 1N33E 2F4VE 4DR6E 5ADZA 1WHQA 2E5LE 3JTZA 4TUGA 1X49A 2LUPB 3ADIA 3ADLA 2L92A 5LMNE 1FJGE 1J26A 2UU9E 2V89A 1N34E 1RQ0A 2YZTA 3C4BA 4P78A 4DR1E 4F54A 3K6QA 4DR2E 1PKPA 3MSWA 2KOUA 3VYYA 4P7DA 4B3TE 4F9BB 4NXME 4JI8E 4BS9A 2N3HA 1X47A 2JOBA 2L6MA 2L33A 3AUZA 5IT9C 4Q28A 5F3WA 3FIGA 2RS6A 2LBSB 4JI4E 2L8TA 2NUFA 2MC5A 4R8OA 1UHZA 4DMIA 5LMUE 1HR0E 3IWDA 2NA2A 4BBYA 4WFTA 4DV4E 2DSYA 5AASA 2LTSA 4LF6E 3AV0A 2M7QA 4LF7E 2UXDE 2JOXA 4OOGC 4LFBE 1N36E 4DUZE 2JY9A 3T1HE 2B7VA 2UUCE 4B3ME 2EZ6A 4DKKA 2FV4B 3HPZA 4YY3E 2L2KB 5IWAE 1T4LB 2CPNA 2JWOA 2L2MA 1YYKA 1T4OA 1X48A 2KONA 5A2QC 3RMPA 4X8WA 4JI6E 4LFCE 2LTRA 2VQEE 5CFFE 3T1YE 2HHHE 5AE2A 2UUAE 4NXNE 5LL6R 3F6HA 4J8ZA 4GKKE 2UXBE 2JVAA 1UILA 4DV3E 4JI2E 4DR3E 2MDRA 2V8QB 3ADJA 5DNYA 4M2ZA 2FTXB 3H09A 4JI3E 2K4VA 4JYAE 2L3JA 1DQ3A 1EKZA 4DV6E 2UUBE 3HXLA 4LF4E 5AE1A 4LTYA 3VYXA 2EWLA 3P1XA 4L8NA 4LF9E 2DB2A 2KHXA 4LU9A 4DR4E 4I8OA 4KZSA 4DUYE 4DV5E 2M1SA 2M4IA 4JI1E 2G7HA 2V88A 3DJWA 4B3RE 4GKJE 4LFAE 3HPSA 3J80C 2RS7A 2UXCE 2E1MA 4R03A 2LMZA 4KHPE 1XNQE 3IWCA 2IHR1 4JI7E 4JI0E 4OX9E 4F9AB 1HNWE 3JAMC 2WZOA 4BCAA 4TUIA 4AQYE 4X65E 2DMYA 2VF1A 1WHNA 3IWBA 4DR7E 4X64E 1DI2A 1ZBQA 3ADGA 4DV1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRS A;  1XMQ E;  1J5E E;  1XMO E;  2DIX A;  4JI5 E;  4DV2 E;  2VQF E;  4X62 E;  4LF5 E;  1XNR E;  4DV0 E;  4X66 E;  3LLH A;  3HTX A;  4DV7 E;  1I94 E;  1HNZ E;  1N32 E;  1QU6 A;  4B3S E;  2LUQ A;  1YYO A;  2YT4 A;  1GQE A;  1IBK E;  4DR5 E;  1FKA E;  1RC7 A;  5BR8 E;  2N3G A;  3C4T A;  2B3T B;  2LJH A;  2RTX A;  2L3C A;  2NUE A;  1O0W A;  2NUG A;  1HNX E;  4YHH E;  1T4N A;  1YZ9 A;  1ZBT A;  4LF8 E;  4M30 A;  1IBL E;  1YYW A;  2B7T A;  2RSM A;  3J7Y p;  2L2N A;  2ZM6 E;  4K0K E;  4WYQ B;  1STU A;  3OTO E;  1IBM E;  4JV5 E;  1N33 E;  2F4V E;  4DR6 E;  1WHQ A;  2E5L E;  2LUP B;  1X49 A;  3ADI A;  3ADL A;  5LMN E;  1FJG E;  1J26 A;  2UU9 E;  1N34 E;  1RQ0 A;  3C4B A;  4DR1 E;  4DR2 E;  1PKP A;  3VYY A;  4B3T E;  4NXM E;  4JI8 E;  2N3H A;  1X47 A;  2L33 A;  4JI4 E;  2RS6 A;  2LBS B;  2NUF A;  1UHZ A;  5LMU E;  1HR0 E;  2NA2 A;  4WFT A;  4DV4 E;  2LTS A;  4LF6 E;  2UXD E;  4LF7 E;  4OOG C;  4LFB E;  1N36 E;  4DUZ E;  2JY9 A;  3T1H E;  2B7V A;  2UUC E;  4B3M E;  2EZ6 A;  4DKK A;  4YY3 E;  2L2K B;  5IWA E;  1T4L B;  2CPN A;  2L2M A;  1YYK A;  1T4O A;  1X48 A;  4X8W A;  4JI6 E;  4LFC E;  2LTR A;  2VQE E;  5CFF E;  3T1Y E;  2HHH E;  2UUA E;  4NXN E;  4GKK E;  2UXB E;  2JVA A;  1UIL A;  4DV3 E;  4JI2 E;  4DR3 E;  2MDR A;  3ADJ A;  4M2Z A;  4JI3 E;  4JYA E;  2L3J A;  1EKZ A;  4DV6 E;  2UUB E;  4LF4 E;  3VYX A;  4LF9 E;  3P1X A;  2DB2 A;  2KHX A;  4DR4 E;  4DUY E;  4DV5 E;  4JI1 E;  4B3R E;  4GKJ E;  4LFA E;  2RS7 A;  2UXC E;  4KHP E;  1XNQ E;  4JI7 E;  2IHR 1;  4JI0 E;  4OX9 E;  1HNW E;  4AQY E;  4X65 E;  2DMY A;  1WHN A;  4DR7 E;  4X64 E;  1DI2 A;  3ADG A;  4DV1 E; 
#chains in the Genus database with same CATH topology
 1ZAA C;  4M0V A;  2EM9 A;  2V86 A;  2DIX A;  4DV2 E;  5A6B A;  2VQF E;  1XNR E;  2ODR D;  4X66 E;  5KL2 A;  4WPY A;  1A1H A;  3M99 B;  2FGG A;  4B3S E;  2LUQ A;  2ENA A;  2BB8 A;  4WSP A;  1GZ6 A;  1RC7 A;  3BF2 A;  4F9C B;  3JU0 A;  1NCS A;  3OML A;  2N3G A;  1A1J A;  3MHS C;  2NUE A;  2NUG A;  3ZOQ B;  3J81 C;  1HNX E;  2EMW A;  1ZBT A;  2V87 A;  1X3C A;  2YTO A;  5LLQ A;  4L5N C;  3J7Y p;  3BBG A;  4K0K E;  3C6K A;  2VRD A;  4JV5 E;  2H36 X;  2F8B A;  2F4V E;  4R2R A;  2Q8U A;  1WHQ A;  5AC4 A;  1FJG E;  1J26 A;  4P78 A;  4DR1 E;  3K6Q A;  1F2I G;  3MSW A;  2EM3 A;  2EMC A;  2EE8 A;  2YTP A;  2MDG A;  1X47 A;  4O5G A;  2L33 A;  2YU5 A;  5F3W A;  2EMG A;  4R2P A;  1HR0 E;  3IWD A;  2YTE A;  2EL6 A;  2EM0 A;  4LF6 E;  2M7Q A;  2EM4 A;  4LF7 E;  2EOY A;  4LFB E;  3T1H E;  1IQS A;  2JY9 A;  4DKK A;  3EPH A;  2L2K B;  1T4L B;  2CPN A;  2YU8 A;  1T4O A;  4R2A A;  2YTN A;  4JI6 E;  5LL6 R;  2EOO A;  4M2Z A;  2JPA A;  2FTX B;  2EMF A;  4JI3 E;  2PRT A;  1EKZ A;  2UUB E;  3HXL A;  4LF4 E;  4LTY A;  2YTF A;  3VYX A;  1TF6 A;  2EWL A;  1EH6 A;  2KHX A;  2NAB A;  2A25 A;  2M1S A;  2V88 A;  4B3R E;  3THO B;  2RS7 A;  1X5W A;  1PJQ A;  3UK3 C;  1AAY A;  1XNQ E;  3IWC A;  4JI0 E;  2R1F A;  1HNW E;  5A6K A;  2VF1 A;  3KZZ A;  1ZBQ A;  2EPP A;  2CTD A;  3HQ1 A;  1BBG A;  2LRS A;  2LJU A;  4JI5 E;  2EN3 A;  2YSO A;  1T38 A;  4N4R B;  4DV0 E;  1I94 E;  2V85 A;  1HNZ E;  1N32 E;  1IMU A;  1QU6 A;  4O24 A;  4MLV A;  2YTI A;  1YYO A;  1GQE A;  1IBK E;  3L00 A;  2EN7 A;  2JR1 A;  1DGC A;  1P47 A;  4ZYG A;  2LJH A;  4GEQ B;  2YTG A;  1YUJ A;  3THN A;  2EPK X;  2RSM A;  2EMZ A;  2EOI A;  3DF6 A;  3QG5 C;  5A69 A;  3OTO E;  1IBM E;  2MKN A;  2EL4 A;  2EN1 A;  5TSE A;  2JXP A;  2EPA A;  1EH7 A;  3JTZ A;  1X49 A;  4TUG A;  2LUP B;  2L92 A;  2YZT A;  1A1L A;  4DR2 E;  2DRP A;  2ELZ A;  4NXM E;  4JI8 E;  4BS9 A;  2N3H A;  3AUZ A;  2EOZ A;  4Q28 A;  2LBS B;  4RHB B;  1A1K A;  4WX9 A;  2MC5 A;  2I9I A;  1LLM C;  2EQ3 A;  2YTJ A;  4WFT A;  2EL5 A;  2EMY A;  2UXD E;  3AV0 A;  4KWY A;  1SFE A;  4DUZ E;  2UUC E;  4B3M E;  2EQ1 A;  2WBT A;  2FV4 B;  4WXD A;  3HPZ A;  2YRM A;  5IWA E;  4R2C A;  5A2Q C;  4X8W A;  4O43 A;  1ZU1 A;  4LFC E;  2VQE E;  2EM8 A;  3T1Y E;  5AE2 A;  2DLQ A;  2EPR A;  3F6H A;  1G2F C;  2EN4 A;  4RH8 A;  4GKK E;  2JVA A;  1UIL A;  4DV3 E;  4JI2 E;  3ADJ A;  5DNY A;  3H09 A;  2EQ0 A;  2K4V A;  1DQ3 A;  4R2Q A;  5KL3 A;  4WSG A;  2DMI A;  4LU9 A;  2DB2 A;  2EN6 A;  3EPJ A;  2CSH A;  4DUY E;  4DV5 E;  2G7H A;  2N8X A;  3HPS A;  3J80 C;  4F2J C;  1X6E A;  1MEY C;  2LMZ A;  2LCE A;  5IV8 B;  4OX9 E;  3JAM C;  2EM2 A;  3EPK A;  3ADG A;  4DV4 E;  2JP9 A;  5T6J A;  4BHB A;  1XMQ E;  1J5E E;  2CT1 A;  1A1F A;  1XMO E;  2EPM X;  2YRH A;  2R76 A;  3MHH C;  1B69 A;  4Q35 B;  3LLH A;  1UN6 B;  5KL7 A;  2JYA A;  2YT4 A;  1TF3 A;  4DR5 E;  4NZV A;  5BR8 E;  1G2D C;  1L4S A;  2EP3 A;  2RTX A;  1O0W A;  2EOE A;  2EOM A;  1T39 A;  5A6A A;  2LV2 A;  4BC9 A;  1SR9 A;  4LF8 E;  4M30 A;  1YYW A;  4IJD A;  2B9D A;  2L2N A;  2ZM6 E;  2WBS A;  4BC7 A;  2EOJ A;  1N33 E;  2E5L E;  1JK2 A;  1TN9 A;  2UU9 E;  2V89 A;  3C4B A;  1PKP A;  4M9V C;  2KOU A;  3VYY A;  4P7D A;  4F9B B;  1PJT A;  2EOX A;  5IT9 C;  2L6M A;  1YSA C;  2EM5 A;  2EPO A;  2RS6 A;  2L8T A;  2NUF A;  2YSP A;  4R8O A;  1UHZ A;  1YPN A;  1BB8 A;  2ELY A;  2J7J A;  4BBY A;  2D9H A;  2EPX A;  1YFH A;  1N36 E;  1GTK A;  2EMI A;  2EOF A;  2YTQ A;  4YY3 E;  2K7I A;  4F6N A;  1X48 A;  2KON A;  2RPC A;  2DLK A;  2LTR A;  4WXC A;  1A1G A;  4R2D A;  4J8Z A;  3BID A;  2UXB E;  1QNT A;  2EOS A;  1UBD C;  2RQL A;  2MDR A;  2YRK A;  2M9A A;  1BBO A;  2EN8 A;  1KJK A;  4NHR A;  4JYA E;  2L3J A;  1N3G A;  2EPU A;  1X6F A;  2LVH A;  4LF9 E;  4L8N A;  4DR4 E;  2GPI A;  4I8O A;  4KZS A;  1WJP A;  2EM6 A;  2M4I A;  4HTG A;  4ZYD A;  2LT7 A;  4JI1 E;  3DJW A;  1WRJ A;  2EMX A;  1NEI A;  2E1M A;  4BHC A;  2EOR A;  3TQM A;  2IHR 1;  5KL5 A;  4AQY E;  4BCA A;  1PJS A;  2EJ4 A;  4X65 E;  4R2S A;  3IWB A;  1WHN A;  2HGH A;  5KL6 A;  4DR7 E;  2EMK A;  3C6M A;  1DI2 A;  2I13 A;  5A6J A;  3VK6 A;  3EPL A;  2LO3 A;  4X62 E;  4LF5 E;  2YTD A;  3LML A;  5AE3 A;  3HTX A;  4DV7 E;  3F6G A;  4R2E A;  2EMA A;  2V83 A;  4BMJ A;  1FKA E;  2HC5 A;  4F6M A;  2GLI A;  2ENC A;  5FLX C;  2GHF A;  3C4T A;  2B3T B;  2EPL X;  2EOQ A;  2EMB A;  2L3C A;  2ODR C;  4O4K A;  3J7A G;  2EPC A;  2MC6 A;  1T4N A;  1WXR A;  4YHH E;  1YZ9 A;  3KWR A;  2LE2 A;  4FK5 C;  2B7T A;  2WCC 3;  1IBL E;  2ENH A;  4WYQ B;  1STU A;  4X9J A;  2MKD A;  2VE7 C;  1KYQ A;  4ZYE A;  4DR6 E;  2EPZ A;  2YPN A;  5ADZ A;  3ADI A;  5AC5 A;  3ADL A;  5LMN E;  1N34 E;  1RQ0 A;  2ADR A;  4F54 A;  1MGT A;  4B3T E;  2EM7 A;  3KZY A;  1EH8 A;  3VHT B;  2JOB A;  5IXM B;  5KL4 A;  4JI4 E;  3FIG A;  1YUI A;  1Z1B A;  1JK1 A;  3ECR A;  4DMI A;  1ZR9 A;  5LMU E;  2NA2 A;  2DSY A;  5AAS A;  2LTS A;  2EPN A;  2JOX A;  4OOG C;  2B7V A;  2EZ6 A;  2EMH A;  2E72 A;  2YWQ A;  4GZN C;  1AH5 A;  1PDA A;  2JWO A;  2L2M A;  1YYK A;  4ZYH A;  3RMP A;  3BGH A;  5CFF E;  2HHH E;  2UUA E;  4NXN E;  1RMD A;  1X6H A;  2DGC A;  5A6B D;  4DR3 E;  2V8Q B;  2EML A;  4DV6 E;  4MLQ A;  2EOH A;  5AE1 A;  4IS1 C;  3P1X A;  1IQO A;  2BBG A;  3EQ1 A;  1A1I A;  4GKJ E;  4LFA E;  2UXC E;  4R03 A;  2EN2 A;  4KHP E;  2HJJ A;  4HEI A;  4JI7 E;  4F9A B;  4TUI A;  2WZO A;  2DMY A;  4X64 E;  2RSI A;  2WBU A;  4DV1 E; 
#chains in the Genus database with same CATH homology
 3VK6 A;  2LRS A;  5T6J A;  1XMQ E;  1J5E E;  4M0V A;  2V86 A;  1XMO E;  2DIX A;  4JI5 E;  4DV2 E;  2VQF E;  4X62 E;  4LF5 E;  3LML A;  1XNR E;  2ODR D;  5AE3 A;  4DV0 E;  4X66 E;  3LLH A;  3HTX A;  4WPY A;  4DV7 E;  1I94 E;  2V85 A;  3F6G A;  1HNZ E;  1N32 E;  1QU6 A;  2FGG A;  4B3S E;  2LUQ A;  1YYO A;  2V83 A;  2YT4 A;  1GQE A;  4BMJ A;  1IBK E;  4DR5 E;  4WSP A;  3HQ1 A;  1GZ6 A;  1FKA E;  1RC7 A;  2JR1 A;  4F9C B;  3JU0 A;  3OML A;  5BR8 E;  2N3G A;  5FLX C;  3C4T A;  2B3T B;  2LJH A;  2RTX A;  2L3C A;  2NUE A;  1O0W A;  2ODR C;  3J7A G;  4GEQ B;  2NUG A;  3ZOQ B;  3J81 C;  1HNX E;  2MC6 A;  1T4N A;  1WXR A;  4YHH E;  4BC9 A;  1YZ9 A;  1SR9 A;  1ZBT A;  2V87 A;  4M30 A;  4LF8 E;  3KWR A;  2LE2 A;  1IBL E;  2B7T A;  4L5N C;  1YYW A;  2RSM A;  2B9D A;  3J7Y p;  2L2N A;  2ZM6 E;  4K0K E;  4WYQ B;  1STU A;  3DF6 A;  2VE7 C;  4BC7 A;  3OTO E;  1IBM E;  2H36 X;  4JV5 E;  2F8B A;  1N33 E;  2F4V E;  4DR6 E;  5ADZ A;  1WHQ A;  2E5L E;  3JTZ A;  4TUG A;  1X49 A;  2LUP B;  3ADI A;  3ADL A;  2L92 A;  5LMN E;  1FJG E;  1J26 A;  2UU9 E;  2V89 A;  1N34 E;  1RQ0 A;  2YZT A;  3C4B A;  4P78 A;  4DR1 E;  4F54 A;  3K6Q A;  4DR2 E;  1PKP A;  3MSW A;  2KOU A;  3VYY A;  4P7D A;  4B3T E;  4F9B B;  4NXM E;  4JI8 E;  4BS9 A;  2N3H A;  1X47 A;  2JOB A;  2L6M A;  2L33 A;  3AUZ A;  5IT9 C;  4Q28 A;  5F3W A;  3FIG A;  2RS6 A;  2LBS B;  4JI4 E;  2L8T A;  2NUF A;  2MC5 A;  4R8O A;  1UHZ A;  4DMI A;  5LMU E;  1HR0 E;  3IWD A;  2NA2 A;  4BBY A;  4WFT A;  4DV4 E;  2DSY A;  5AAS A;  2LTS A;  4LF6 E;  3AV0 A;  2M7Q A;  4LF7 E;  2UXD E;  2JOX A;  4OOG C;  4LFB E;  1N36 E;  4DUZ E;  2JY9 A;  3T1H E;  2B7V A;  2UUC E;  4B3M E;  2EZ6 A;  4DKK A;  2FV4 B;  3HPZ A;  4YY3 E;  2L2K B;  5IWA E;  1T4L B;  2CPN A;  2JWO A;  2L2M A;  1YYK A;  1T4O A;  1X48 A;  2KON A;  5A2Q C;  3RMP A;  4X8W A;  4JI6 E;  4LFC E;  2LTR A;  2VQE E;  5CFF E;  3T1Y E;  2HHH E;  5AE2 A;  2UUA E;  4NXN E;  5LL6 R;  3F6H A;  4J8Z A;  4GKK E;  2UXB E;  2JVA A;  1UIL A;  4DV3 E;  4JI2 E;  4DR3 E;  2MDR A;  2V8Q B;  3ADJ A;  5DNY A;  4M2Z A;  2FTX B;  3H09 A;  4JI3 E;  2K4V A;  4JYA E;  2L3J A;  1DQ3 A;  1EKZ A;  4DV6 E;  2UUB E;  3HXL A;  4LF4 E;  5AE1 A;  4LTY A;  3VYX A;  2EWL A;  3P1X A;  4L8N A;  4LF9 E;  2DB2 A;  2KHX A;  4LU9 A;  4DR4 E;  4I8O A;  4KZS A;  4DUY E;  4DV5 E;  2M1S A;  2M4I A;  4JI1 E;  2G7H A;  2V88 A;  3DJW A;  4B3R E;  4GKJ E;  4LFA E;  3HPS A;  3J80 C;  2RS7 A;  2UXC E;  2E1M A;  4R03 A;  2LMZ A;  4KHP E;  1XNQ E;  3IWC A;  2IHR 1;  4JI7 E;  4JI0 E;  4OX9 E;  4F9A B;  1HNW E;  3JAM C;  2WZO A;  4BCA A;  4TUI A;  4AQY E;  4X65 E;  2DMY A;  2VF1 A;  1WHN A;  3IWB A;  4DR7 E;  4X64 E;  1DI2 A;  1ZBQ A;  3ADG A;  4DV1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...