1T4LB

Solution structure of double-stranded rna binding domain of s. cerevisiae rnase iii (rnt1p) in complex with the 5' terminal rna hairpin of snr47 precursor
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
90
structure length
90
Chain Sequence
GSLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5' terminal hairpin of snR47 precursor
publication title Structural basis for recognition of the AGNN tetraloop RNA fold by the double-stranded RNA-binding domain of Rnt1p RNase III.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein/rna
total genus 15
structure length 90
sequence length 90
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2004-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1t4lB00
4WYQB 4JI8E 4B3RE 1YYKA 4JI1E 1X47A 4GKKE 1XNQE 4DV0E 1HNXE 2JY9A 2UXDE 4DUZE 2NUFA 1XMQE 5LMNE 2UXBE 1O0WA 4JI0E 2UU9E 1HR0E 4LF7E 2L2NA 3VYXA 2LTRA 1RQ0A 3LLHA 4JI2E 1RC7A 2VQFE 2DB2A 4DR1E 4B3ME 4AQYE 3HTXA 1X49A 1ZBTA 3ADGA 4DV6E 1PKPA 2LBSB 2L3CA 2F4VE 4JI7E 4DR5E 2DMYA 1DI2A 2ZM6E 3P1XA 5IWAE 1UHZA 2CPNA 4DV3E 4LF6E 2LTSA 1N32E 4OX9E 1J26A 2UUAE 4NXNE 4YY3E 4DR2E 1IBME 2B3TB 4DR4E 4JYAE 4DV7E 2RS6A 1T4OA 4X62E 1EKZA 1N33E 2NUEA 2UXCE 1I94E 4LF8E 1HNWE 4DR7E 4X66E 1YYWA 4X8WA 1T4LB 1QU6A 3C4TA 4DUYE 4JI5E 4K0KE 4KHPE 1IBKE 2YT4A 1N34E 4JI4E 1STUA 2JVAA 4LFAE 5LMUE 4LF4E 1YYOA 2HHHE 2L33A 2RS7A 2L2KB 4X65E 1HNZE 2NA2A 4LF5E 4JI3E 1GQEA 2VQEE 5BR8E 2B7TA 1X48A 2LJHA 2UUCE 1WHNA 1T4NA 4DV4E 4YHHE 4OOGC 4DR3E 4JV5E 4LF9E 3VYYA 4DV2E 1J5EE 2RTXA 4B3SE 4B3TE 1YZ9A 2LUQA 2RSMA 1WHQA 4NXME 2UUBE 1FKAE 2E5LE 2DIXA 2B7VA 4M30A 2N3HA 2KHXA 1XNRE 3C4BA 4LFCE 1IBLE 1UILA 1XMOE 2EZ6A 4X64E 1FJGE 4DKKA 5CFFE 3T1YE 2L3JA 4JI6E 3ADLA 4M2ZA 4DV1E 3ADJA 1N36E 2LRSA 3ADIA 4LFBE 2NUGA 2L2MA 4DV5E 2LUPB 3T1HE 4DR6E 3J7Yp 2MDRA 3OTOE 4GKJE 2IHR1 4WFTA 2N3GA
chains in the Genus database with same CATH superfamily
2E1MA 2K7IA 2L92A 2L6MA 2EM6A 4DV0E 3FIGA 2ODRC 5AE2A 5A69A 4JI0E 2UU9E 3AUZA 1HR0E 2LT7A 4F9AB 2MDGA 2DRPA 3IWDA 3HTXA 1X49A 2J7JA 3EPKA 2F4VE 2EL5A 4DR5E 1DI2A 2YRHA 2ENHA 2EPAA 4J8ZA 2YRKA 4MLQA 4ZYGA 2K4VA 2YTDA 2D9HA 3QG5C 4I8OA 4BC9A 4DR2E 2B3TB 1ZAAC 1ZR9A 3M99B 4DV7E 1EKZA 1T4OA 1UN6B 1N33E 3F6GA 2EMKA 4WSPA 2EMYA 3EPHA 2EORA 4X66E 3F6HA 4JI5E 4R8OA 4BBYA 1N34E 4JI4E 2JR1A 4DMIA 1KJKA 2WBSA 2L33A 2VF1A 2EOYA 2EMCA 4IJDA 4RH8A 3C6KA 3BIDA 4MLVA 2EMGA 2V8QB 3BF2A 4YHHE 1YSAC 2YU5A 4B3SE 1AAYA 1WRJA 3L00A 2LUQA 1PJQA 2HC5A 1FKAE 5KL2A 2ELYA 2DIXA 2FGGA 2EM7A 2YU8A 3VK6A 2EOEA 4R2SA 1XMOE 4X64E 3BBGA 4GZNC 2RPCA 1AH5A 3ADJA 1N36E 2EE8A 1BBGA 5TSEA 4Q35B 2EL4A 2WBUA 1YUIA 3OTOE 2MDRA 2VRDA 4WX9A 3IWCA 3BGHA 4GKJE 1SFEA 1Z1BA 2N3GA 4WYQB 4JI8E 4B3RE 5ADZA 4JI1E 4GKKE 1YFHA 2YTOA 2LO3A 1HNXE 4M9VC 2UXDE 4DUZE 2NUFA 5LMNE 4KWYA 2LJUA 1KYQA 4LF7E 2V89A 4JI2E 2WBTA 4B3ME 2I9IA 3C6MA 4AQYE 1F2IG 1X5WA 2G7HA 1A1HA 5KL4A 4DV3E 3J7AG 4F9CB 2EOFA 2LCEA 3JU0A 4NXNE 4WSGA 2EQ1A 4DR4E 1IBME 4JYAE 2EM3A 3EPJA 4N4RB 2YTEA 1N3GA 2M4IA 5A6JA 3JTZA 4LF8E 2YRMA 2DLQA 4TUGA 2EPPA 1YYWA 2EQ0A 1QU6A 2A25A 4WPYA 4DUYE 4HTGA 2HJJA 4BCAA 4LFAE 2EPKX 3TQMA 2EOZA 5A6KA 2DSYA 1A1GA 4Q28A 1X3CA 3OMLA 2EMHA 2HHHE 2RS7A 2M9AA 2WCC3 2PRTA 3ECRA 4X65E 2YTGA 1T38A 5IV8B 1TF3A 1GQEA 5BR8E 2EMWA 1EH7A 1JK1A 2LJHA 1BB8A 2JYAA 3THNA 5KL5A 3RMPA 2Q8UA 1ZU1A 4O4KA 2EM9A 4OOGC 4LF9E 3KWRA 5A6BA 1WXRA 2RSMA 2YTPA 4F6MA 4LTYA 2KONA 1BBOA 4M30A 5A6AA 5T6JA 2EMLA 4WXCA 4R2RA 4O5GA 1YPNA 2EZ6A 4BHBA 1FJGE 5CFFE 4R2DA 2L3JA 2JXPA 4DV1E 5AC5A 1T39A 4F54A 2L2MA 4DV5E 4DR6E 2DMIA 1LLMC 2ELZA 4KZSA 5AE3A 3THOB 4BHCA 1SR9A 2CT1A 2EMBA 5IT9C 2E72A 5KL6A 4BMJA 1O0WA 2JOXA 3MSWA 2M1SA 3VYXA 2LTRA 2YTFA 3LLHA 1RC7A 2EN2A 3AV0A 4HEIA 4DR1E 2DB2A 2GLIA 2EL6A 3HQ1A 1ZBTA 2ENCA 1PKPA 2YPNA 4FK5C 2L3CA 2I13A 2EN4A 4X9JA 2CSHA 4R2CA 2DMYA 2ZM6E 2LMZA 2JP9A 1UHZA 2CPNA 1DQ3A 2FTXB 1PDAA 1N32E 1A1JA 2EN1A 2EPZA 4L5NC 4BS9A 1ZBQA 1TF6A 4YY3E 2RS6A 4X62E 2M7QA 4LU9A 2UXCE 2YSOA 4F9BB 1I94E 1HNWE 4ZYHA 1B69A 3ZOQB 3UK3C 5A6BD 3IWBA 2L8TA 1T4LB 3C4TA 4K0KE 2EOOA 2EOIA 2EN8A 1IBKE 1IQOA 3HXLA 3DF6A 2LV2A 1PJSA 2EM2A 5AC4A 1YUJA 2JVAA 2ODRD 2EPNA 4LF4E 1YYOA 2GHFA 2BB8A 1QNTA 2L2KB 1HNZE 4M0VA 1GZ6A 1IQSA 2EOHA 1X48A 2NABA 4P78A 4R2EA 1L4SA 1WHNA 2KOUA 2EOSA 4DV4E 2EN7A 2YSPA 1A1FA 2EPLX 2JOBA 2YTQA 4JV5E 2N8XA 2YZTA 4DV2E 1WHQA 4NXME 2UUBE 2EPUA 2ENAA 4R2PA 4IS1C 3C4BA 4R2QA 1IBLE 2EM0A 2H36X 4R03A 3T1YE 5LL6R 3J81C 3HPSA 3ADIA 1GTKA 1RMDA 2NUGA 3T1HE 2EPCA 2EPMX 3J7Yp 1A1LA 2EN6A 2MC5A 2V85A 4BC7A 2IHR1 3KZZA 3KZYA 2DLKA 3J80C 2EMFA 3MHHC 1YYKA 3K6QA 2EQ3A 1X47A 5A2QC 2R1FA 1XNQE 4RHBB 2EPOA 1X6HA 2EMAA 2JY9A 2EP3A 5KL3A 1XMQE 1P47A 2UXBE 4R2AA 2RQLA 2L2NA 2BBGA 1EH6A 2EMIA 2EPRA 1RQ0A 2LVHA 1G2FC 2VQFE 2JWOA 1UBDC 1WJPA 3ADGA 4DV6E 2LBSB 2EM4A 2F8BA 4JI7E 1IMUA 4GEQB 3P1XA 5IWAE 2V87A 4LF6E 2EMZA 2LTSA 3DJWA 4OX9E 2YWQA 2EOMA 1J26A 2UUAE 4NZVA 4ZYEA 2EWLA 4L8NA 4O24A 2NUEA 2V86A 3LMLA 1G2DC 2EM8A 4DR7E 2EPXA 3HPZA 4X8WA 2EOXA 4KHPE 2FV4B 4WXDA 2EM5A 2VE7C 3MHSC 4P7DA 1DGCA 2YT4A 1A1IA 3JAMC 4F2JC 1STUA 5LMUE 2MKNA 2HGHA 2DGCA 2R76A 2MC6A 3EQ1A 2NA2A 2GPIA 2MKDA 4O43A 2EJ4A 4LF5E 2EOJA 4JI3E 2V88A 2YTNA 1NEIA 2VQEE 2YTIA 1JK2A 3VHTB 1X6EA 2B7TA 2UUCE 5AE1A 5FLXC 2WZOA 1T4NA 4F6NA 5IXMB 1TN9A 1MEYC 2EOQA 4DR3E 3VYYA 1J5EE 2RTXA 4B3TE 2RSIA 1YZ9A 1NCSA 5F3WA 3EPLA 1MGTA 2EMXA 2E5LE 2B7VA 5AASA 4NHRA 2N3HA 4TUIA 2KHXA 1X6FA 1XNRE 2LE2A 2CTDA 4LFCE 1UILA 1PJTA 4ZYDA 4DKKA 4JI6E 2V83A 3ADLA 4M2ZA 5KL7A 2YTJA 2JPAA 2LRSA 4LFBE 2LUPB 2B9DA 5LLQA 1A1KA 2EN3A 1EH8A 2ADRA 3H09A 5DNYA 4WFTA
chains in the Genus database with same CATH topology
4KZSA 4WYQB 4JI8E 5AE3A 3J80C 4B3RE 1YYKA 5ADZA 3K6QA 4JI1E 2E1MA 1SR9A 1X47A 5A2QC 4GKKE 5DNYA 1XNQE 2L92A 5IT9C 2L6MA 4DV0E 1HNXE 2JY9A 2UXDE 4DUZE 3FIGA 4BMJA 2NUFA 2ODRC 5AE2A 5LMNE 1XMQE 2UXBE 1O0WA 4JI0E 2JOXA 2UU9E 3AUZA 3MSWA 1HR0E 4LF7E 2L2NA 2M1SA 2V89A 2LTRA 3VYXA 1RQ0A 3LLHA 4JI2E 4F9AB 1RC7A 3AV0A 2VQFE 2DB2A 4DR1E 4B3ME 2JWOA 3IWDA 4AQYE 3HQ1A 3HTXA 1X49A 1ZBTA 3ADGA 4DV6E 1PKPA 2LBSB 2L3CA 2F4VE 2F8BA 4JI7E 4GEQB 4DR5E 2DMYA 2G7HA 1DI2A 2ZM6E 2LMZA 3P1XA 5IWAE 1UHZA 2CPNA 4DV3E 1DQ3A 2V87A 3J7AG 2FTXB 4F9CB 4LF6E 2LTSA 1N32E 3DJWA 3JU0A 4OX9E 4J8ZA 1J26A 2UUAE 4NXNE 4L5NC 2K4VA 4I8OA 4BC9A 1ZBQA 4BS9A 2EWLA 4YY3E 4DR2E 2B3TB 1IBME 4DR4E 4JYAE 4DV7E 2RS6A 1T4OA 4L8NA 4X62E 1EKZA 1N33E 2NUEA 2M7QA 4LU9A 2UXCE 2M4IA 3F6GA 4F9BB 2V86A 1I94E 3JTZA 3LMLA 4WSPA 4LF8E 1HNWE 4DR7E 3HPZA 4X66E 3ZOQB 4TUGA 3F6HA 3IWBA 1YYWA 4X8WA 2L8TA 1T4LB 1QU6A 4WPYA 3C4TA 2FV4B 4DUYE 4JI5E 4K0KE 4KHPE 2VE7C 1IBKE 4P7DA 2YT4A 3HXLA 3DF6A 4R8OA 4BCAA 4BBYA 3JAMC 1N34E 4JI4E 1STUA 2JR1A 2JVAA 2ODRD 4LFAE 4DMIA 5LMUE 2DSYA 4LF4E 4Q28A 1YYOA 3OMLA 2HHHE 2L33A 2RS7A 2VF1A 2L2KB 2MC6A 4X65E 1HNZE 2NA2A 4LF5E 4JI3E 2V88A 1GQEA 4M0VA 1GZ6A 2VQEE 5BR8E 2B7TA 1X48A 4P78A 2LJHA 2UUCE 5AE1A 5FLXC 1WHNA 2KOUA 2WZOA 3RMPA 1T4NA 2V8QB 4DV4E 4YHHE 4OOGC 2JOBA 4DR3E 4LF9E 4JV5E 3VYYA 2YZTA 4DV2E 2RTXA 1J5EE 4B3SE 4B3TE 3KWRA 2LUQA 1WXRA 1YZ9A 2RSMA 1WHQA 4NXME 2UUBE 4LTYA 5F3WA 1FKAE 2KONA 2E5LE 2DIXA 2B7VA 2FGGA 4M30A 5AASA 5T6JA 4TUIA 2N3HA 2KHXA 3VK6A 1XNRE 2LE2A 3C4BA 4LFCE 1IBLE 1UILA 1XMOE 2EZ6A 4X64E 1FJGE 4DKKA 5CFFE 2H36X 4R03A 3T1YE 2L3JA 2V83A 4JI6E 4M2ZA 5LL6R 3J81C 4DV1E 3ADLA 3ADJA 1N36E 3HPSA 2LRSA 3ADIA 4LFBE 4F54A 2NUGA 2L2MA 4DV5E 2LUPB 3T1HE 2B9DA 4DR6E 3J7Yp 2MDRA 3OTOE 2V85A 2MC5A 3IWCA 4BC7A 4GKJE 3H09A 2IHR1 4WFTA 2N3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WYQ B;  4JI8 E;  4B3R E;  1YYK A;  4JI1 E;  1X47 A;  4GKK E;  1XNQ E;  4DV0 E;  1HNX E;  2JY9 A;  2UXD E;  4DUZ E;  2NUF A;  1XMQ E;  5LMN E;  2UXB E;  1O0W A;  4JI0 E;  2UU9 E;  1HR0 E;  4LF7 E;  2L2N A;  3VYX A;  2LTR A;  1RQ0 A;  3LLH A;  4JI2 E;  1RC7 A;  2VQF E;  2DB2 A;  4DR1 E;  4B3M E;  4AQY E;  3HTX A;  1X49 A;  1ZBT A;  3ADG A;  4DV6 E;  1PKP A;  2LBS B;  2L3C A;  2F4V E;  4JI7 E;  4DR5 E;  2DMY A;  1DI2 A;  2ZM6 E;  3P1X A;  5IWA E;  1UHZ A;  2CPN A;  4DV3 E;  4LF6 E;  2LTS A;  1N32 E;  4OX9 E;  1J26 A;  2UUA E;  4NXN E;  4YY3 E;  4DR2 E;  1IBM E;  2B3T B;  4DR4 E;  4JYA E;  4DV7 E;  2RS6 A;  1T4O A;  4X62 E;  1EKZ A;  1N33 E;  2NUE A;  2UXC E;  1I94 E;  4LF8 E;  1HNW E;  4DR7 E;  4X66 E;  1YYW A;  4X8W A;  1T4L B;  1QU6 A;  3C4T A;  4DUY E;  4JI5 E;  4K0K E;  4KHP E;  1IBK E;  2YT4 A;  1N34 E;  4JI4 E;  1STU A;  2JVA A;  4LFA E;  5LMU E;  4LF4 E;  1YYO A;  2HHH E;  2L33 A;  2RS7 A;  2L2K B;  4X65 E;  1HNZ E;  2NA2 A;  4LF5 E;  4JI3 E;  1GQE A;  2VQE E;  5BR8 E;  2B7T A;  1X48 A;  2LJH A;  2UUC E;  1WHN A;  1T4N A;  4DV4 E;  4YHH E;  4OOG C;  4DR3 E;  4JV5 E;  4LF9 E;  3VYY A;  4DV2 E;  1J5E E;  2RTX A;  4B3S E;  4B3T E;  1YZ9 A;  2LUQ A;  2RSM A;  1WHQ A;  4NXM E;  2UUB E;  1FKA E;  2E5L E;  2DIX A;  2B7V A;  4M30 A;  2N3H A;  2KHX A;  1XNR E;  3C4B A;  4LFC E;  1IBL E;  1UIL A;  1XMO E;  2EZ6 A;  4X64 E;  1FJG E;  4DKK A;  5CFF E;  3T1Y E;  2L3J A;  4JI6 E;  3ADL A;  4M2Z A;  4DV1 E;  3ADJ A;  1N36 E;  2LRS A;  3ADI A;  4LFB E;  2NUG A;  2L2M A;  4DV5 E;  2LUP B;  3T1H E;  4DR6 E;  3J7Y p;  2MDR A;  3OTO E;  4GKJ E;  2IHR 1;  4WFT A;  2N3G A; 
#chains in the Genus database with same CATH topology
 2E1M A;  2K7I A;  2L92 A;  2L6M A;  2EM6 A;  4DV0 E;  3FIG A;  2ODR C;  5AE2 A;  5A69 A;  4JI0 E;  2UU9 E;  3AUZ A;  1HR0 E;  2LT7 A;  4F9A B;  2MDG A;  2DRP A;  3IWD A;  3HTX A;  1X49 A;  2J7J A;  3EPK A;  2F4V E;  2EL5 A;  4DR5 E;  1DI2 A;  2YRH A;  2ENH A;  2EPA A;  4J8Z A;  2YRK A;  4MLQ A;  4ZYG A;  2K4V A;  2YTD A;  2D9H A;  3QG5 C;  4I8O A;  4BC9 A;  4DR2 E;  2B3T B;  1ZAA C;  1ZR9 A;  3M99 B;  4DV7 E;  1EKZ A;  1T4O A;  1UN6 B;  1N33 E;  3F6G A;  2EMK A;  4WSP A;  2EMY A;  3EPH A;  2EOR A;  4X66 E;  3F6H A;  4JI5 E;  4R8O A;  4BBY A;  1N34 E;  4JI4 E;  2JR1 A;  4DMI A;  1KJK A;  2WBS A;  2L33 A;  2VF1 A;  2EOY A;  2EMC A;  4IJD A;  4RH8 A;  3C6K A;  3BID A;  4MLV A;  2EMG A;  2V8Q B;  3BF2 A;  4YHH E;  1YSA C;  2YU5 A;  4B3S E;  1AAY A;  1WRJ A;  3L00 A;  2LUQ A;  1PJQ A;  2HC5 A;  1FKA E;  5KL2 A;  2ELY A;  2DIX A;  2FGG A;  2EM7 A;  2YU8 A;  3VK6 A;  2EOE A;  4R2S A;  1XMO E;  4X64 E;  3BBG A;  4GZN C;  2RPC A;  1AH5 A;  3ADJ A;  1N36 E;  2EE8 A;  1BBG A;  5TSE A;  4Q35 B;  2EL4 A;  2WBU A;  1YUI A;  3OTO E;  2MDR A;  2VRD A;  4WX9 A;  3IWC A;  3BGH A;  4GKJ E;  1SFE A;  1Z1B A;  2N3G A;  4WYQ B;  4JI8 E;  4B3R E;  5ADZ A;  4JI1 E;  4GKK E;  1YFH A;  2YTO A;  2LO3 A;  1HNX E;  4M9V C;  2UXD E;  4DUZ E;  2NUF A;  5LMN E;  4KWY A;  2LJU A;  1KYQ A;  4LF7 E;  2V89 A;  4JI2 E;  2WBT A;  4B3M E;  2I9I A;  3C6M A;  4AQY E;  1F2I G;  1X5W A;  2G7H A;  1A1H A;  5KL4 A;  4DV3 E;  3J7A G;  4F9C B;  2EOF A;  2LCE A;  3JU0 A;  4NXN E;  4WSG A;  2EQ1 A;  4DR4 E;  1IBM E;  4JYA E;  2EM3 A;  3EPJ A;  4N4R B;  2YTE A;  1N3G A;  2M4I A;  5A6J A;  3JTZ A;  4LF8 E;  2YRM A;  2DLQ A;  4TUG A;  2EPP A;  1YYW A;  2EQ0 A;  1QU6 A;  2A25 A;  4WPY A;  4DUY E;  4HTG A;  2HJJ A;  4BCA A;  4LFA E;  2EPK X;  3TQM A;  2EOZ A;  5A6K A;  2DSY A;  1A1G A;  4Q28 A;  1X3C A;  3OML A;  2EMH A;  2HHH E;  2RS7 A;  2M9A A;  2WCC 3;  2PRT A;  3ECR A;  4X65 E;  2YTG A;  1T38 A;  5IV8 B;  1TF3 A;  1GQE A;  5BR8 E;  2EMW A;  1EH7 A;  1JK1 A;  2LJH A;  1BB8 A;  2JYA A;  3THN A;  5KL5 A;  3RMP A;  2Q8U A;  1ZU1 A;  4O4K A;  2EM9 A;  4OOG C;  4LF9 E;  3KWR A;  5A6B A;  1WXR A;  2RSM A;  2YTP A;  4F6M A;  4LTY A;  2KON A;  1BBO A;  4M30 A;  5A6A A;  5T6J A;  2EML A;  4WXC A;  4R2R A;  4O5G A;  1YPN A;  2EZ6 A;  4BHB A;  1FJG E;  5CFF E;  4R2D A;  2L3J A;  2JXP A;  4DV1 E;  5AC5 A;  1T39 A;  4F54 A;  2L2M A;  4DV5 E;  4DR6 E;  2DMI A;  1LLM C;  2ELZ A;  4KZS A;  5AE3 A;  3THO B;  4BHC A;  1SR9 A;  2CT1 A;  2EMB A;  5IT9 C;  2E72 A;  5KL6 A;  4BMJ A;  1O0W A;  2JOX A;  3MSW A;  2M1S A;  3VYX A;  2LTR A;  2YTF A;  3LLH A;  1RC7 A;  2EN2 A;  3AV0 A;  4HEI A;  4DR1 E;  2DB2 A;  2GLI A;  2EL6 A;  3HQ1 A;  1ZBT A;  2ENC A;  1PKP A;  2YPN A;  4FK5 C;  2L3C A;  2I13 A;  2EN4 A;  4X9J A;  2CSH A;  4R2C A;  2DMY A;  2ZM6 E;  2LMZ A;  2JP9 A;  1UHZ A;  2CPN A;  1DQ3 A;  2FTX B;  1PDA A;  1N32 E;  1A1J A;  2EN1 A;  2EPZ A;  4L5N C;  4BS9 A;  1ZBQ A;  1TF6 A;  4YY3 E;  2RS6 A;  4X62 E;  2M7Q A;  4LU9 A;  2UXC E;  2YSO A;  4F9B B;  1I94 E;  1HNW E;  4ZYH A;  1B69 A;  3ZOQ B;  3UK3 C;  5A6B D;  3IWB A;  2L8T A;  1T4L B;  3C4T A;  4K0K E;  2EOO A;  2EOI A;  2EN8 A;  1IBK E;  1IQO A;  3HXL A;  3DF6 A;  2LV2 A;  1PJS A;  2EM2 A;  5AC4 A;  1YUJ A;  2JVA A;  2ODR D;  2EPN A;  4LF4 E;  1YYO A;  2GHF A;  2BB8 A;  1QNT A;  2L2K B;  1HNZ E;  4M0V A;  1GZ6 A;  1IQS A;  2EOH A;  1X48 A;  2NAB A;  4P78 A;  4R2E A;  1L4S A;  1WHN A;  2KOU A;  2EOS A;  4DV4 E;  2EN7 A;  2YSP A;  1A1F A;  2EPL X;  2JOB A;  2YTQ A;  4JV5 E;  2N8X A;  2YZT A;  4DV2 E;  1WHQ A;  4NXM E;  2UUB E;  2EPU A;  2ENA A;  4R2P A;  4IS1 C;  3C4B A;  4R2Q A;  1IBL E;  2EM0 A;  2H36 X;  4R03 A;  3T1Y E;  5LL6 R;  3J81 C;  3HPS A;  3ADI A;  1GTK A;  1RMD A;  2NUG A;  3T1H E;  2EPC A;  2EPM X;  3J7Y p;  1A1L A;  2EN6 A;  2MC5 A;  2V85 A;  4BC7 A;  2IHR 1;  3KZZ A;  3KZY A;  2DLK A;  3J80 C;  2EMF A;  3MHH C;  1YYK A;  3K6Q A;  2EQ3 A;  1X47 A;  5A2Q C;  2R1F A;  1XNQ E;  4RHB B;  2EPO A;  1X6H A;  2EMA A;  2JY9 A;  2EP3 A;  5KL3 A;  1XMQ E;  1P47 A;  2UXB E;  4R2A A;  2RQL A;  2L2N A;  2BBG A;  1EH6 A;  2EMI A;  2EPR A;  1RQ0 A;  2LVH A;  1G2F C;  2VQF E;  2JWO A;  1UBD C;  1WJP A;  3ADG A;  4DV6 E;  2LBS B;  2EM4 A;  2F8B A;  4JI7 E;  1IMU A;  4GEQ B;  3P1X A;  5IWA E;  2V87 A;  4LF6 E;  2EMZ A;  2LTS A;  3DJW A;  4OX9 E;  2YWQ A;  2EOM A;  1J26 A;  2UUA E;  4NZV A;  4ZYE A;  2EWL A;  4L8N A;  4O24 A;  2NUE A;  2V86 A;  3LML A;  1G2D C;  2EM8 A;  4DR7 E;  2EPX A;  3HPZ A;  4X8W A;  2EOX A;  4KHP E;  2FV4 B;  4WXD A;  2EM5 A;  2VE7 C;  3MHS C;  4P7D A;  1DGC A;  2YT4 A;  1A1I A;  3JAM C;  4F2J C;  1STU A;  5LMU E;  2MKN A;  2HGH A;  2DGC A;  2R76 A;  2MC6 A;  3EQ1 A;  2NA2 A;  2GPI A;  2MKD A;  4O43 A;  2EJ4 A;  4LF5 E;  2EOJ A;  4JI3 E;  2V88 A;  2YTN A;  1NEI A;  2VQE E;  2YTI A;  1JK2 A;  3VHT B;  1X6E A;  2B7T A;  2UUC E;  5AE1 A;  5FLX C;  2WZO A;  1T4N A;  4F6N A;  5IXM B;  1TN9 A;  1MEY C;  2EOQ A;  4DR3 E;  3VYY A;  1J5E E;  2RTX A;  4B3T E;  2RSI A;  1YZ9 A;  1NCS A;  5F3W A;  3EPL A;  1MGT A;  2EMX A;  2E5L E;  2B7V A;  5AAS A;  4NHR A;  2N3H A;  4TUI A;  2KHX A;  1X6F A;  1XNR E;  2LE2 A;  2CTD A;  4LFC E;  1UIL A;  1PJT A;  4ZYD A;  4DKK A;  4JI6 E;  2V83 A;  3ADL A;  4M2Z A;  5KL7 A;  2YTJ A;  2JPA A;  2LRS A;  4LFB E;  2LUP B;  2B9D A;  5LLQ A;  1A1K A;  2EN3 A;  1EH8 A;  2ADR A;  3H09 A;  5DNY A;  4WFT A; 
#chains in the Genus database with same CATH homology
 4KZS A;  4WYQ B;  4JI8 E;  5AE3 A;  3J80 C;  4B3R E;  1YYK A;  5ADZ A;  3K6Q A;  4JI1 E;  2E1M A;  1SR9 A;  1X47 A;  5A2Q C;  4GKK E;  5DNY A;  1XNQ E;  2L92 A;  5IT9 C;  2L6M A;  4DV0 E;  1HNX E;  2JY9 A;  2UXD E;  4DUZ E;  3FIG A;  4BMJ A;  2NUF A;  2ODR C;  5AE2 A;  5LMN E;  1XMQ E;  2UXB E;  1O0W A;  4JI0 E;  2JOX A;  2UU9 E;  3AUZ A;  3MSW A;  1HR0 E;  4LF7 E;  2L2N A;  2M1S A;  2V89 A;  2LTR A;  3VYX A;  1RQ0 A;  3LLH A;  4JI2 E;  4F9A B;  1RC7 A;  3AV0 A;  2VQF E;  2DB2 A;  4DR1 E;  4B3M E;  2JWO A;  3IWD A;  4AQY E;  3HQ1 A;  3HTX A;  1X49 A;  1ZBT A;  3ADG A;  4DV6 E;  1PKP A;  2LBS B;  2L3C A;  2F4V E;  2F8B A;  4JI7 E;  4GEQ B;  4DR5 E;  2DMY A;  2G7H A;  1DI2 A;  2ZM6 E;  2LMZ A;  3P1X A;  5IWA E;  1UHZ A;  2CPN A;  4DV3 E;  1DQ3 A;  2V87 A;  3J7A G;  2FTX B;  4F9C B;  4LF6 E;  2LTS A;  1N32 E;  3DJW A;  3JU0 A;  4OX9 E;  4J8Z A;  1J26 A;  2UUA E;  4NXN E;  4L5N C;  2K4V A;  4I8O A;  4BC9 A;  1ZBQ A;  4BS9 A;  2EWL A;  4YY3 E;  4DR2 E;  2B3T B;  1IBM E;  4DR4 E;  4JYA E;  4DV7 E;  2RS6 A;  1T4O A;  4L8N A;  4X62 E;  1EKZ A;  1N33 E;  2NUE A;  2M7Q A;  4LU9 A;  2UXC E;  2M4I A;  3F6G A;  4F9B B;  2V86 A;  1I94 E;  3JTZ A;  3LML A;  4WSP A;  4LF8 E;  1HNW E;  4DR7 E;  3HPZ A;  4X66 E;  3ZOQ B;  4TUG A;  3F6H A;  3IWB A;  1YYW A;  4X8W A;  2L8T A;  1T4L B;  1QU6 A;  4WPY A;  3C4T A;  2FV4 B;  4DUY E;  4JI5 E;  4K0K E;  4KHP E;  2VE7 C;  1IBK E;  4P7D A;  2YT4 A;  3HXL A;  3DF6 A;  4R8O A;  4BCA A;  4BBY A;  3JAM C;  1N34 E;  4JI4 E;  1STU A;  2JR1 A;  2JVA A;  2ODR D;  4LFA E;  4DMI A;  5LMU E;  2DSY A;  4LF4 E;  4Q28 A;  1YYO A;  3OML A;  2HHH E;  2L33 A;  2RS7 A;  2VF1 A;  2L2K B;  2MC6 A;  4X65 E;  1HNZ E;  2NA2 A;  4LF5 E;  4JI3 E;  2V88 A;  1GQE A;  4M0V A;  1GZ6 A;  2VQE E;  5BR8 E;  2B7T A;  1X48 A;  4P78 A;  2LJH A;  2UUC E;  5AE1 A;  5FLX C;  1WHN A;  2KOU A;  2WZO A;  3RMP A;  1T4N A;  2V8Q B;  4DV4 E;  4YHH E;  4OOG C;  2JOB A;  4DR3 E;  4LF9 E;  4JV5 E;  3VYY A;  2YZT A;  4DV2 E;  2RTX A;  1J5E E;  4B3S E;  4B3T E;  3KWR A;  2LUQ A;  1WXR A;  1YZ9 A;  2RSM A;  1WHQ A;  4NXM E;  2UUB E;  4LTY A;  5F3W A;  1FKA E;  2KON A;  2E5L E;  2DIX A;  2B7V A;  2FGG A;  4M30 A;  5AAS A;  5T6J A;  4TUI A;  2N3H A;  2KHX A;  3VK6 A;  1XNR E;  2LE2 A;  3C4B A;  4LFC E;  1IBL E;  1UIL A;  1XMO E;  2EZ6 A;  4X64 E;  1FJG E;  4DKK A;  5CFF E;  2H36 X;  4R03 A;  3T1Y E;  2L3J A;  2V83 A;  4JI6 E;  4M2Z A;  5LL6 R;  3J81 C;  4DV1 E;  3ADL A;  3ADJ A;  1N36 E;  3HPS A;  2LRS A;  3ADI A;  4LFB E;  4F54 A;  2NUG A;  2L2M A;  4DV5 E;  2LUP B;  3T1H E;  2B9D A;  4DR6 E;  3J7Y p;  2MDR A;  3OTO E;  2V85 A;  2MC5 A;  3IWC A;  4BC7 A;  4GKJ E;  3H09 A;  2IHR 1;  4WFT A;  2N3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...