2FGGA

Crystal structure of rv2632c
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
SEHVGKTCQIDVLIEEHDERTRAKARLSWAGRQMVGVGLARLDPADEPVAQIGDELAIARALSDLANQLFALTSSDIEASTHQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Rv2632c/MT2708
publication title Crystal Structure of Rv2632c
rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08962 DUF1876 Domain of unknown function (DUF1876)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.240 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2fggA01
4WPYA 2FGGA 4WSPA
chains in the Genus database with same CATH superfamily
4JI7E 2YRMA 2UU9E 2GHFA 4DR7E 4DKKA 1TF3A 4B3TE 3KZYA 2V85A 1DGCA 2MDGA 5AE1A 1KYQA 1ZBQA 1LLMC 2EN3A 1Z1BA 2EPMX 2FV4B 1QNTA 4I8OA 3VYYA 2BBGA 4JYAE 2DB2A 5KL6A 2JVAA 2K4VA 2LTSA 2EOZA 3EPHA 2L8TA 2RPCA 2EM3A 4JI3E 2ZM6E 4DV2E 4WSPA 4TUGA 1BBOA 4YHHE 1N34E 3ADIA 2RS6A 4R03A 4FK5C 2YTEA 1IQSA 3M99B 4P78A 2LE2A 2EOIA 2RSIA 3HQ1A 2J7JA 4BC7A 1STUA 1N32E 4GKJE 4JI5E 1A1IA 1XMQE 2EPLX 4DR4E 2EOMA 2EMWA 4KWYA 2MDRA 2YTGA 2EMHA 5BR8E 1XNRE 3JU0A 3T1YE 2KOUA 3KZZA 2L2KB 2ENAA 2JYAA 5A2QC 3HTXA 2A25A 2F8BA 1ZR9A 4DR5E 3P1XA 2EL5A 2ELYA 2JXPA 2RQLA 2LT7A 2MC5A 2R1FA 4DV7E 2JOBA 3MHSC 2RS7A 5IV8B 5AASA 3IWCA 2LO3A 4Q35B 1YFHA 4KHPE 4DV0E 1X47A 2EOOA 3K6QA 3IWDA 4AQYE 1A1GA 2YTDA 4DR6E 2M4IA 4LF5E 1EKZA 1HR0E 3JTZA 2Q8UA 3OTOE 3VHTB 2WBSA 2EPPA 2LCEA 1A1LA 5LMUE 4LFCE 1A1KA 3J80C 2M7QA 2V86A 2ELZA 2DRPA 2KONA 4O5GA 2MC6A 4KZSA 1EH8A 1HNWE 4BMJA 5LL6R 1J26A 2EMAA 5T6JA 4DV3E 2B9DA 2V89A 1YYKA 4WXCA 2EN2A 1X6FA 2EPCA 2EPUA 1WRJA 2YSPA 4O43A 3BF2A 2CSHA 4F9BB 1N36E 3EPLA 4J8ZA 2H36X 1TN9A 1A1HA 2JPAA 1N33E 3ADGA 5KL4A 2YU8A 2EOXA 2HHHE 4F9AB 2N3HA 4R2EA 2K7IA 1P47A 4ZYDA 2VF1A 4DUYE 3EQ1A 2EM5A 1WXRA 4DMIA 2WBTA 5KL2A 3RMPA 1PJQA 2DMIA 2EPZA 1A1JA 4R2CA 2EMLA 1UN6B 2L3CA 2YZTA 2IHR1 5KL5A 4R2SA 1JK2A 4O4KA 2JP9A 2EWLA 4M9VC 3C4BA 5IWAE 2DSYA 4DR2E 4JV5E 1ZAAC 2EOFA 3J81C 4X8WA 4YY3E 2FTXB 5FLXC 1IBLE 1GZ6A 4LFBE 1UHZA 2LUQA 4DV5E 3J7Yp 4L8NA 4LF9E 2EN4A 1MGTA 2I13A 2LJUA 2ENCA 4R2QA 2EN6A 4K0KE 1X6EA 3DF6A 3EPKA 1BB8A 2EM7A 3IWBA 3C6MA 2EQ3A 2EPXA 4X65E 1QU6A 1GQEA 1WHQA 2UXBE 4WSGA 1YYWA 2EQ0A 2ODRC 2UXDE 1AH5A 2EOQA 1AAYA 1I94E 1X49A 2M1SA 2NUEA 4B3ME 2PRTA 2VRDA 2UUCE 3ADLA 1O0WA 2L33A 1YUJA 2LTRA 2YU5A 2EPRA 2JR1A 3KWRA 2EPKX 5CFFE 2EE8A 3AUZA 4LF7E 1YZ9A 5A6JA 2CPNA 4NZVA 4WX9A 1PJSA 3THNA 4B3SE 3H09A 2DMYA 1T4NA 2L92A 4JI4E 2ENHA 3VK6A 5LMNE 5KL3A 4X66E 2WCC3 3MSWA 2NUFA 5AC4A 3L00A 2EN1A 1KJKA 4P7DA 3ZOQB 2NABA 2L3JA 4F9CB 2GLIA 2DGCA 2LJHA 1G2FC 4WXDA 2UXCE 4NXME 1RQ0A 4JI6E 2V88A 2EN7A 2RSMA 2EM4A 2MKNA 1HNXE 5DNYA 1BBGA 3AV0A 1DQ3A 2YTNA 2VE7C 1EH7A 2YTFA 2HC5A 1PDAA 2HJJA 4F6MA 3BGHA 4BC9A 4R2PA 2EOEA 2L6MA 2I9IA 3DJWA 2EM9A 4RHBB 2EMGA 2B7TA 1ZU1A 5A6KA 4DUZE 3VYXA 2F4VE 4X64E 4O24A 2EM8A 4MLQA 5F3WA 2CT1A 1NEIA 2E1MA 2EMKA 1IMUA 5KL7A 3BIDA 1T4OA 4LF8E 2DIXA 4DV1E 2M9AA 2EPAA 5A6BA 4F54A 1FKAE 1TF6A 2EZ6A 2YWQA 4LU9A 2YTIA 2YPNA 2MKDA 4RH8A 3EPJA 2EQ1A 4OX9E 2R76A 2DLQA 4TUIA 4GZNC 3JAMC 2YSOA 3HPZA 4BS9A 1T38A 2EM6A 5A6BD 3OMLA 4LTYA 2LMZA 2EMZA 4HEIA 1IBME 4MLVA 2V87A 5ADZA 1GTKA 4IJDA 4IS1C 2RTXA 2L2NA 3QG5C 2LBSB 4ZYGA 3FIGA 1T39A 2V83A 4JI1E 1N3GA 2BB8A 1YYOA 3C4TA 2WBUA 2VQFE 4DR3E 2YRKA 4X62E 4WPYA 2YTJA 4HTGA 1WHNA 2NA2A 5AE2A 2NUGA 1XNQE 2UUBE 2YTOA 2G7HA 2GPIA 3T1HE 1X3CA 2EM0A 1RMDA 2EP3A 1SFEA 1X5WA 4BHCA 2D9HA 4ZYEA 2EOYA 1YSAC 4LF6E 3J7AG 3ADJA 2EJ4A 3HPSA 3F6HA 2JWOA 4B3RE 2VQEE 1PKPA 3BBGA 2EL4A 5A6AA 4L5NC 2UUAE 4GKKE 4OOGC 1X6HA 2EMBA 3ECRA 1L4SA 4BCAA 3HXLA 4F2JC 4M0VA 2EOHA 2E72A 1ZBTA 4DR1E 3LLHA 5AC5A 3LMLA 2LVHA 5A69A 2L2MA 2ADRA 2EM2A 2LUPB 4JI8E 2HGHA 2DLKA 2EMFA 2WZOA 4BBYA 3F6GA 4BHBA 4M30A 2N8XA 2N3GA 4NHRA 2E5LE 1F2IG 1FJGE 4R8OA 2JY9A 4LF4E 2EL6A 1UILA 1NCSA 2YTPA 2EOJA 2YTQA 1G2DC 4NXNE 1XMOE 1YUIA 5IT9C 3C6KA 4X9JA 3TQMA 4Q28A 1IQOA 4R2AA 1UBDC 4GEQB 5TSEA 4R2RA 1HNZE 4DV6E 1MEYC 4F6NA 1EH6A 1B69A 3UK3C 4DV4E 4N4RB 1YPNA 2B7VA 2FGGA 3MHHC 1T4LB 1J5EE 2EN8A 4M2ZA 1IBKE 2EMCA 5IXMB 4JI0E 2B3TB 4WYQB 2KHXA 2EMYA 2JOXA 4JI2E 2CTDA 1PJTA 2YT4A 2EMIA 4LFAE 2EMXA 5LLQA 4ZYHA 1RC7A 2EOSA 1JK1A 4R2DA 3THOB 1SR9A 4WFTA 2EPNA 1DI2A 2ODRD 2EORA 5AE3A 2EPOA 2YRHA 1A1FA 2LV2A 1X48A 1WJPA 2LRSA 2V8QB
chains in the Genus database with same CATH topology
4JI7E 3VK6A 1HNWE 2UU9E 5LMNE 4BMJA 4X66E 4DR7E 2L92A 5LL6R 4DKKA 1J26A 4B3TE 3MSWA 2NUFA 1WHNA 2V85A 2NA2A 5AE2A 2NUGA 3ADLA 1XNQE 2UUBE 4P7DA 5T6JA 4DV3E 2B9DA 2G7HA 2V89A 5AE1A 3ZOQB 1ZBQA 3T1HE 1YYKA 2FV4B 4I8OA 3VYYA 4JYAE 2L3JA 2DB2A 4F9CB 4LF6E 2JVAA 2K4VA 3J7AG 3ADJA 2LTSA 2L8TA 1N36E 2LJHA 3HPSA 4WPYA 4F9BB 2ZM6E 4DV2E 4JI3E 3F6HA 4WSPA 4TUGA 2JWOA 4J8ZA 2H36X 2UXCE 4NXME 4B3RE 1N33E 2VQEE 4YHHE 3ADGA 1PKPA 1RQ0A 1N34E 4JI6E 2RS6A 3ADIA 2HHHE 2V88A 4L5NC 2N3HA 4KZSA 2RSMA 4R03A 4F9AB 2UUAE 4GKKE 2VF1A 4OOGC 4DUYE 4P78A 5DNYA 1HNXE 3AV0A 1WXRA 2LE2A 1DQ3A 4DMIA 3HQ1A 4BC7A 1STUA 2VE7C 1N32E 3RMPA 4BCAA 3HXLA 2L3CA 2YZTA 2IHR1 4GKJE 4JI5E 4M0VA 1XMQE 4BC9A 4DR4E 2EWLA 2L6MA 3C4BA 3DJWA 2DSYA 5IWAE 1ZBTA 4DR2E 4DR1E 4JV5E 2MDRA 5BR8E 1XNRE 3LLHA 3LMLA 3JU0A 2L2MA 3J81C 3T1YE 2KOUA 4X8WA 2B7TA 4YY3E 2L2KB 2LUPB 4JI8E 5A2QC 4DUZE 2FTXB 5FLXC 3HTXA 1IBLE 2WZOA 4BBYA 3F6GA 3VYXA 2F4VE 1GZ6A 4M30A 2F8BA 4X64E 4LFBE 1UHZA 2LUQA 4DV5E 2N3GA 2E5LE 4DR5E 3J7Yp 4L8NA 3P1XA 1FJGE 4R8OA 5F3WA 4LF9E 2JY9A 2E1MA 4K0KE 4LF4E 1UILA 2MC5A 3DF6A 4DV7E 1T4OA 3H09A 4LF8E 2JOBA 3IWBA 4X65E 4NXNE 2DIXA 4DV1E 1XMOE 5IT9C 1QU6A 1FKAE 4F54A 4Q28A 2EZ6A 1GQEA 1WHQA 2RS7A 2UXBE 1YYWA 4LU9A 4GEQB 5AASA 3IWCA 1HNZE 2ODRC 4OX9E 2UXDE 4DV6E 1I94E 2NUEA 4TUIA 1X49A 2M1SA 3JAMC 4DV0E 1X47A 4KHPE 3HPZA 3K6QA 4DV4E 3IWDA 1T4LB 2B7VA 2FGGA 1J5EE 4AQYE 4B3ME 4BS9A 4M2ZA 1IBKE 4DR6E 2M4IA 3OMLA 4JI0E 4LF5E 4LTYA 2LMZA 2UUCE 1EKZA 1IBME 1O0WA 2B3TB 2L33A 2V87A 4WYQB 2KHXA 2LTRA 3JTZA 5ADZA 1HR0E 2JOXA 2RTXA 4JI2E 3OTOE 2L2NA 2JR1A 3KWRA 2LBSB 2YT4A 4LFAE 3FIGA 5CFFE 1RC7A 2V83A 4JI1E 5LMUE 3AUZA 1SR9A 4WFTA 1YYOA 4LFCE 3C4TA 1DI2A 2ODRD 4LF7E 1YZ9A 5AE3A 2VQFE 2CPNA 4DR3E 3J80C 2M7QA 2V86A 2KONA 4X62E 1X48A 4B3SE 2DMYA 1T4NA 2MC6A 2LRSA 4JI4E 2V8QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WPY A;  2FGG A;  4WSP A; 
#chains in the Genus database with same CATH topology
 4JI7 E;  2YRM A;  2UU9 E;  2GHF A;  4DR7 E;  4DKK A;  1TF3 A;  4B3T E;  3KZY A;  2V85 A;  1DGC A;  2MDG A;  5AE1 A;  1KYQ A;  1ZBQ A;  1LLM C;  2EN3 A;  1Z1B A;  2EPM X;  2FV4 B;  1QNT A;  4I8O A;  3VYY A;  2BBG A;  4JYA E;  2DB2 A;  5KL6 A;  2JVA A;  2K4V A;  2LTS A;  2EOZ A;  3EPH A;  2L8T A;  2RPC A;  2EM3 A;  4JI3 E;  2ZM6 E;  4DV2 E;  4WSP A;  4TUG A;  1BBO A;  4YHH E;  1N34 E;  3ADI A;  2RS6 A;  4R03 A;  4FK5 C;  2YTE A;  1IQS A;  3M99 B;  4P78 A;  2LE2 A;  2EOI A;  2RSI A;  3HQ1 A;  2J7J A;  4BC7 A;  1STU A;  1N32 E;  4GKJ E;  4JI5 E;  1A1I A;  1XMQ E;  2EPL X;  4DR4 E;  2EOM A;  2EMW A;  4KWY A;  2MDR A;  2YTG A;  2EMH A;  5BR8 E;  1XNR E;  3JU0 A;  3T1Y E;  2KOU A;  3KZZ A;  2L2K B;  2ENA A;  2JYA A;  5A2Q C;  3HTX A;  2A25 A;  2F8B A;  1ZR9 A;  4DR5 E;  3P1X A;  2EL5 A;  2ELY A;  2JXP A;  2RQL A;  2LT7 A;  2MC5 A;  2R1F A;  4DV7 E;  2JOB A;  3MHS C;  2RS7 A;  5IV8 B;  5AAS A;  3IWC A;  2LO3 A;  4Q35 B;  1YFH A;  4KHP E;  4DV0 E;  1X47 A;  2EOO A;  3K6Q A;  3IWD A;  4AQY E;  1A1G A;  2YTD A;  4DR6 E;  2M4I A;  4LF5 E;  1EKZ A;  1HR0 E;  3JTZ A;  2Q8U A;  3OTO E;  3VHT B;  2WBS A;  2EPP A;  2LCE A;  1A1L A;  5LMU E;  4LFC E;  1A1K A;  3J80 C;  2M7Q A;  2V86 A;  2ELZ A;  2DRP A;  2KON A;  4O5G A;  2MC6 A;  4KZS A;  1EH8 A;  1HNW E;  4BMJ A;  5LL6 R;  1J26 A;  2EMA A;  5T6J A;  4DV3 E;  2B9D A;  2V89 A;  1YYK A;  4WXC A;  2EN2 A;  1X6F A;  2EPC A;  2EPU A;  1WRJ A;  2YSP A;  4O43 A;  3BF2 A;  2CSH A;  4F9B B;  1N36 E;  3EPL A;  4J8Z A;  2H36 X;  1TN9 A;  1A1H A;  2JPA A;  1N33 E;  3ADG A;  5KL4 A;  2YU8 A;  2EOX A;  2HHH E;  4F9A B;  2N3H A;  4R2E A;  2K7I A;  1P47 A;  4ZYD A;  2VF1 A;  4DUY E;  3EQ1 A;  2EM5 A;  1WXR A;  4DMI A;  2WBT A;  5KL2 A;  3RMP A;  1PJQ A;  2DMI A;  2EPZ A;  1A1J A;  4R2C A;  2EML A;  1UN6 B;  2L3C A;  2YZT A;  2IHR 1;  5KL5 A;  4R2S A;  1JK2 A;  4O4K A;  2JP9 A;  2EWL A;  4M9V C;  3C4B A;  5IWA E;  2DSY A;  4DR2 E;  4JV5 E;  1ZAA C;  2EOF A;  3J81 C;  4X8W A;  4YY3 E;  2FTX B;  5FLX C;  1IBL E;  1GZ6 A;  4LFB E;  1UHZ A;  2LUQ A;  4DV5 E;  3J7Y p;  4L8N A;  4LF9 E;  2EN4 A;  1MGT A;  2I13 A;  2LJU A;  2ENC A;  4R2Q A;  2EN6 A;  4K0K E;  1X6E A;  3DF6 A;  3EPK A;  1BB8 A;  2EM7 A;  3IWB A;  3C6M A;  2EQ3 A;  2EPX A;  4X65 E;  1QU6 A;  1GQE A;  1WHQ A;  2UXB E;  4WSG A;  1YYW A;  2EQ0 A;  2ODR C;  2UXD E;  1AH5 A;  2EOQ A;  1AAY A;  1I94 E;  1X49 A;  2M1S A;  2NUE A;  4B3M E;  2PRT A;  2VRD A;  2UUC E;  3ADL A;  1O0W A;  2L33 A;  1YUJ A;  2LTR A;  2YU5 A;  2EPR A;  2JR1 A;  3KWR A;  2EPK X;  5CFF E;  2EE8 A;  3AUZ A;  4LF7 E;  1YZ9 A;  5A6J A;  2CPN A;  4NZV A;  4WX9 A;  1PJS A;  3THN A;  4B3S E;  3H09 A;  2DMY A;  1T4N A;  2L92 A;  4JI4 E;  2ENH A;  3VK6 A;  5LMN E;  5KL3 A;  4X66 E;  2WCC 3;  3MSW A;  2NUF A;  5AC4 A;  3L00 A;  2EN1 A;  1KJK A;  4P7D A;  3ZOQ B;  2NAB A;  2L3J A;  4F9C B;  2GLI A;  2DGC A;  2LJH A;  1G2F C;  4WXD A;  2UXC E;  4NXM E;  1RQ0 A;  4JI6 E;  2V88 A;  2EN7 A;  2RSM A;  2EM4 A;  2MKN A;  1HNX E;  5DNY A;  1BBG A;  3AV0 A;  1DQ3 A;  2YTN A;  2VE7 C;  1EH7 A;  2YTF A;  2HC5 A;  1PDA A;  2HJJ A;  4F6M A;  3BGH A;  4BC9 A;  4R2P A;  2EOE A;  2L6M A;  2I9I A;  3DJW A;  2EM9 A;  4RHB B;  2EMG A;  2B7T A;  1ZU1 A;  5A6K A;  4DUZ E;  3VYX A;  2F4V E;  4X64 E;  4O24 A;  2EM8 A;  4MLQ A;  5F3W A;  2CT1 A;  1NEI A;  2E1M A;  2EMK A;  1IMU A;  5KL7 A;  3BID A;  1T4O A;  4LF8 E;  2DIX A;  4DV1 E;  2M9A A;  2EPA A;  5A6B A;  4F54 A;  1FKA E;  1TF6 A;  2EZ6 A;  2YWQ A;  4LU9 A;  2YTI A;  2YPN A;  2MKD A;  4RH8 A;  3EPJ A;  2EQ1 A;  4OX9 E;  2R76 A;  2DLQ A;  4TUI A;  4GZN C;  3JAM C;  2YSO A;  3HPZ A;  4BS9 A;  1T38 A;  2EM6 A;  5A6B D;  3OML A;  4LTY A;  2LMZ A;  2EMZ A;  4HEI A;  1IBM E;  4MLV A;  2V87 A;  5ADZ A;  1GTK A;  4IJD A;  4IS1 C;  2RTX A;  2L2N A;  3QG5 C;  2LBS B;  4ZYG A;  3FIG A;  1T39 A;  2V83 A;  4JI1 E;  1N3G A;  2BB8 A;  1YYO A;  3C4T A;  2WBU A;  2VQF E;  4DR3 E;  2YRK A;  4X62 E;  4WPY A;  2YTJ A;  4HTG A;  1WHN A;  2NA2 A;  5AE2 A;  2NUG A;  1XNQ E;  2UUB E;  2YTO A;  2G7H A;  2GPI A;  3T1H E;  1X3C A;  2EM0 A;  1RMD A;  2EP3 A;  1SFE A;  1X5W A;  4BHC A;  2D9H A;  4ZYE A;  2EOY A;  1YSA C;  4LF6 E;  3J7A G;  3ADJ A;  2EJ4 A;  3HPS A;  3F6H A;  2JWO A;  4B3R E;  2VQE E;  1PKP A;  3BBG A;  2EL4 A;  5A6A A;  4L5N C;  2UUA E;  4GKK E;  4OOG C;  1X6H A;  2EMB A;  3ECR A;  1L4S A;  4BCA A;  3HXL A;  4F2J C;  4M0V A;  2EOH A;  2E72 A;  1ZBT A;  4DR1 E;  3LLH A;  5AC5 A;  3LML A;  2LVH A;  5A69 A;  2L2M A;  2ADR A;  2EM2 A;  2LUP B;  4JI8 E;  2HGH A;  2DLK A;  2EMF A;  2WZO A;  4BBY A;  3F6G A;  4BHB A;  4M30 A;  2N8X A;  2N3G A;  4NHR A;  2E5L E;  1F2I G;  1FJG E;  4R8O A;  2JY9 A;  4LF4 E;  2EL6 A;  1UIL A;  1NCS A;  2YTP A;  2EOJ A;  2YTQ A;  1G2D C;  4NXN E;  1XMO E;  1YUI A;  5IT9 C;  3C6K A;  4X9J A;  3TQM A;  4Q28 A;  1IQO A;  4R2A A;  1UBD C;  4GEQ B;  5TSE A;  4R2R A;  1HNZ E;  4DV6 E;  1MEY C;  4F6N A;  1EH6 A;  1B69 A;  3UK3 C;  4DV4 E;  4N4R B;  1YPN A;  2B7V A;  2FGG A;  3MHH C;  1T4L B;  1J5E E;  2EN8 A;  4M2Z A;  1IBK E;  2EMC A;  5IXM B;  4JI0 E;  2B3T B;  4WYQ B;  2KHX A;  2EMY A;  2JOX A;  4JI2 E;  2CTD A;  1PJT A;  2YT4 A;  2EMI A;  4LFA E;  2EMX A;  5LLQ A;  4ZYH A;  1RC7 A;  2EOS A;  1JK1 A;  4R2D A;  3THO B;  1SR9 A;  4WFT A;  2EPN A;  1DI2 A;  2ODR D;  2EOR A;  5AE3 A;  2EPO A;  2YRH A;  1A1F A;  2LV2 A;  1X48 A;  1WJP A;  2LRS A;  2V8Q B; 
#chains in the Genus database with same CATH homology
 4JI7 E;  3VK6 A;  1HNW E;  2UU9 E;  5LMN E;  4BMJ A;  4X66 E;  4DR7 E;  2L92 A;  5LL6 R;  4DKK A;  1J26 A;  4B3T E;  3MSW A;  2NUF A;  1WHN A;  2V85 A;  2NA2 A;  5AE2 A;  2NUG A;  3ADL A;  1XNQ E;  2UUB E;  4P7D A;  5T6J A;  4DV3 E;  2B9D A;  2G7H A;  2V89 A;  5AE1 A;  3ZOQ B;  1ZBQ A;  3T1H E;  1YYK A;  2FV4 B;  4I8O A;  3VYY A;  4JYA E;  2L3J A;  2DB2 A;  4F9C B;  4LF6 E;  2JVA A;  2K4V A;  3J7A G;  3ADJ A;  2LTS A;  2L8T A;  1N36 E;  2LJH A;  3HPS A;  4WPY A;  4F9B B;  2ZM6 E;  4DV2 E;  4JI3 E;  3F6H A;  4WSP A;  4TUG A;  2JWO A;  4J8Z A;  2H36 X;  2UXC E;  4NXM E;  4B3R E;  1N33 E;  2VQE E;  4YHH E;  3ADG A;  1PKP A;  1RQ0 A;  1N34 E;  4JI6 E;  2RS6 A;  3ADI A;  2HHH E;  2V88 A;  4L5N C;  2N3H A;  4KZS A;  2RSM A;  4R03 A;  4F9A B;  2UUA E;  4GKK E;  2VF1 A;  4OOG C;  4DUY E;  4P78 A;  5DNY A;  1HNX E;  3AV0 A;  1WXR A;  2LE2 A;  1DQ3 A;  4DMI A;  3HQ1 A;  4BC7 A;  1STU A;  2VE7 C;  1N32 E;  3RMP A;  4BCA A;  3HXL A;  2L3C A;  2YZT A;  2IHR 1;  4GKJ E;  4JI5 E;  4M0V A;  1XMQ E;  4BC9 A;  4DR4 E;  2EWL A;  2L6M A;  3C4B A;  3DJW A;  2DSY A;  5IWA E;  1ZBT A;  4DR2 E;  4DR1 E;  4JV5 E;  2MDR A;  5BR8 E;  1XNR E;  3LLH A;  3LML A;  3JU0 A;  2L2M A;  3J81 C;  3T1Y E;  2KOU A;  4X8W A;  2B7T A;  4YY3 E;  2L2K B;  2LUP B;  4JI8 E;  5A2Q C;  4DUZ E;  2FTX B;  5FLX C;  3HTX A;  1IBL E;  2WZO A;  4BBY A;  3F6G A;  3VYX A;  2F4V E;  1GZ6 A;  4M30 A;  2F8B A;  4X64 E;  4LFB E;  1UHZ A;  2LUQ A;  4DV5 E;  2N3G A;  2E5L E;  4DR5 E;  3J7Y p;  4L8N A;  3P1X A;  1FJG E;  4R8O A;  5F3W A;  4LF9 E;  2JY9 A;  2E1M A;  4K0K E;  4LF4 E;  1UIL A;  2MC5 A;  3DF6 A;  4DV7 E;  1T4O A;  3H09 A;  4LF8 E;  2JOB A;  3IWB A;  4X65 E;  4NXN E;  2DIX A;  4DV1 E;  1XMO E;  5IT9 C;  1QU6 A;  1FKA E;  4F54 A;  4Q28 A;  2EZ6 A;  1GQE A;  1WHQ A;  2RS7 A;  2UXB E;  1YYW A;  4LU9 A;  4GEQ B;  5AAS A;  3IWC A;  1HNZ E;  2ODR C;  4OX9 E;  2UXD E;  4DV6 E;  1I94 E;  2NUE A;  4TUI A;  1X49 A;  2M1S A;  3JAM C;  4DV0 E;  1X47 A;  4KHP E;  3HPZ A;  3K6Q A;  4DV4 E;  3IWD A;  1T4L B;  2B7V A;  2FGG A;  1J5E E;  4AQY E;  4B3M E;  4BS9 A;  4M2Z A;  1IBK E;  4DR6 E;  2M4I A;  3OML A;  4JI0 E;  4LF5 E;  4LTY A;  2LMZ A;  2UUC E;  1EKZ A;  1IBM E;  1O0W A;  2B3T B;  2L33 A;  2V87 A;  4WYQ B;  2KHX A;  2LTR A;  3JTZ A;  5ADZ A;  1HR0 E;  2JOX A;  2RTX A;  4JI2 E;  3OTO E;  2L2N A;  2JR1 A;  3KWR A;  2LBS B;  2YT4 A;  4LFA E;  3FIG A;  5CFF E;  1RC7 A;  2V83 A;  4JI1 E;  5LMU E;  3AUZ A;  1SR9 A;  4WFT A;  1YYO A;  4LFC E;  3C4T A;  1DI2 A;  2ODR D;  4LF7 E;  1YZ9 A;  5AE3 A;  2VQF E;  2CPN A;  4DR3 E;  3J80 C;  2M7Q A;  2V86 A;  2KON A;  4X62 E;  1X48 A;  4B3S E;  2DMY A;  1T4N A;  2MC6 A;  2LRS A;  4JI4 E;  2V8Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...