2FGGA

Crystal structure of rv2632c
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
SEHVGKTCQIDVLIEEHDERTRAKARLSWAGRQMVGVGLARLDPADEPVAQIGDELAIARALSDLANQLFALTSSDIEASTHQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Rv2632c/MT2708
publication title Crystal Structure of Rv2632c
rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08962 DUF1876 Domain of unknown function (DUF1876)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.240 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2fggA01
4WSPA 4WPYA 2FGGA
chains in the Genus database with same CATH superfamily
1PKPA 2RQLA 2YTFA 2K4VA 2ENHA 2EN8A 2EL5A 4F2JC 1I94E 2MDGA 1AH5A 1GZ6A 5KL2A 4X66E 2EOSA 4MLVA 3J7Yp 4GKKE 4ZYEA 2L3CA 1SR9A 2EMBA 2LT7A 4WXCA 2EOOA 2EMKA 5KL5A 4BHCA 4TUGA 4R2AA 4Q35B 4RHBB 3J7AG 2EOHA 3MHSC 4IS1C 1A1LA 5KL6A 1DGCA 2YPNA 3H09A 4IJDA 3ECRA 4LFBE 1KYQA 4F6MA 4R03A 1G2FC 2LUPB 2EOMA 3T1HE 2JP9A 4R2QA 1XMOE 3UK3C 1YUIA 4DMIA 2EMWA 1HR0E 4BC9A 1ZAAC 1MGTA 2KOUA 4BS9A 4R2DA 4I8OA 2J7JA 2YTNA 1WHNA 2NABA 3OTOE 5AE1A 1X3CA 2EOFA 3C4BA 5A6BA 1XMQE 1ZU1A 4M9VC 2MC5A 2A25A 1X6FA 1YYWA 5CFFE 2M1SA 2EMGA 2EPCA 3K6QA 4LF7E 2FV4B 1A1GA 2NUEA 4O4KA 4L5NC 3T1YE 1SFEA 2GPIA 3P1XA 2VE7C 2ODRD 1EH8A 4DR5E 2EOJA 3L00A 2EPNA 2IHR1 4LU9A 4DV1E 2EMCA 4JI7E 2JPAA 2B7TA 3ADIA 2WZOA 2EOEA 2EMYA 2EPPA 3ADGA 1XNRE 4ZYGA 5DNYA 1RC7A 1B69A 1WRJA 2E72A 4NXNE 2EQ1A 3EPJA 2EOXA 2EPRA 5A6AA 1X49A 1J5EE 1X48A 2EL6A 3JU0A 2ZM6E 2EE8A 1XNQE 1IBME 1TF6A 2F4VE 4LF8E 4M2ZA 4L8NA 3FIGA 1HNXE 4BC7A 2KHXA 3HPZA 2VF1A 1HNWE 2EMHA 2EM4A 2ENCA 2YTGA 1UILA 4F9CB 2DRPA 1FJGE 4GEQB 2EZ6A 2EPXA 4DKKA 1PDAA 3THOB 2WBTA 2GLIA 3LMLA 4R2EA 2DMYA 3JAMC 1EKZA 5AASA 3ADLA 2EMAA 2UU9E 2EP3A 5AC4A 2EL4A 2LJHA 3KWRA 1RQ0A 1AAYA 1A1KA 2I9IA 2LVHA 2GHFA 2EM6A 2V86A 4JI8E 5LLQA 2YTQA 4P7DA 2D9HA 4R2SA 3AUZA 4OX9E 1G2DC 4GKJE 4WFTA 2MKDA 2EMFA 2ELZA 2YTEA 3EQ1A 4LTYA 1BBOA 4DV3E 2MKNA 4BCAA 1WXRA 2EOYA 2EM5A 2EPKX 4WSPA 5KL7A 2VQFE 1LLMC 1IQOA 5IWAE 1F2IG 3MSWA 4KHPE 5LMNE 4F9BB 2EN7A 1EH6A 2EPZA 2YRHA 1QNTA 4DV4E 1RMDA 2EPUA 2V89A 3HPSA 2EM2A 3C6KA 4WYQB 5KL4A 4X64E 2RTXA 2EPOA 2RS7A 2E5LE 2EN6A 3HTXA 3J81C 3HXLA 2BB8A 1ZR9A 2NUGA 5BR8E 4DR3E 2LTRA 1UBDC 4DR1E 2YTDA 2LBSB 2DIXA 2DMIA 4WPYA 2YTPA 2EWLA 2EOZA 3BIDA 2JOBA 2HHHE 4NHRA 4LF4E 2DB2A 4N4RB 3BBGA 2HC5A 1A1JA 2FTXB 2WBSA 2MDRA 4X8WA 1YYOA 2LO3A 4ZYDA 2RSMA 4LF5E 1T38A 1PJQA 3C6MA 3VHTB 4B3SE 1A1HA 2N3HA 4DR4E 4B3ME 4JI4E 3IWCA 3C4TA 2L2MA 2ENAA 4F9AB 4JI3E 2EQ3A 4DV0E 1YZ9A 2EOQA 2JR1A 2DGCA 2EN3A 1BB8A 3JTZA 4X65E 2RS6A 4OOGC 1YYKA 4NZVA 2V88A 4B3TE 4DR7E 2YSPA 4JI2E 2YRKA 1T4LB 4GZNC 5AE2A 5FLXC 2MC6A 1EH7A 3QG5C 4ZYHA 5LMUE 2NUFA 4RH8A 4DR2E 2R76A 4DUYE 2EM9A 2JY9A 4KZSA 2EJ4A 4P78A 1GTKA 2DLQA 4JYAE 1MEYC 2KONA 2WCC3 3VYYA 1QU6A 2CPNA 4YHHE 2VQEE 4R2RA 4JI6E 4O5GA 1BBGA 2FGGA 1UHZA 2HJJA 2EM8A 2Q8UA 2B3TB 2B9DA 3IWDA 4M30A 2YTJA 2L2KB 4WX9A 2YZTA 4WSGA 1STUA 2YRMA 2EMIA 5F3WA 2N8XA 4BMJA 1NCSA 4FK5C 2CSHA 1ZBTA 2YT4A 2RSIA 1HNZE 1P47A 4LFCE 1T39A 5A6JA 3M99B 4HEIA 4BBYA 5A2QC 4NXME 2EN2A 4R8OA 1UN6B 4BHBA 1IQSA 2YU8A 4JI1E 1PJSA 2NA2A 1DI2A 2EN1A 2VRDA 2UXBE 5KL3A 1T4OA 2JXPA 2V83A 3THNA 3OMLA 1KJKA 3RMPA 2L3JA 2UUCE 5A6BD 4B3RE 2R1FA 2ELYA 4MLQA 5TSEA 2L8TA 4O43A 2LE2A 3KZZA 4F54A 2YWQA 4DUZE 3ADJA 4JI0E 2LUQA 3BF2A 3HQ1A 1WJPA 2ADRA 2DLKA 4K0KE 1JK1A 2EPMX 3DF6A 1A1IA 1IBLE 4LFAE 5IV8B 4HTGA 2DSYA 2YTOA 2M7QA 3VK6A 3EPHA 1X6HA 2G7HA 1N33E 2ODRC 2V8QB 3MHHC 4KWYA 4JI5E 2M9AA 4DV5E 2JWOA 1X5WA 4X62E 2CT1A 3TQMA 5ADZA 1A1FA 3VYXA 2PRTA 4M0VA 2LMZA 2EQ0A 4DR6E 2UXDE 3BGHA 4X9JA 3DJWA 1N32E 1YPNA 1DQ3A 1T4NA 1IBKE 3EPLA 2EM3A 2YU5A 4F6NA 1TN9A 4J8ZA 3LLHA 5IT9C 1JK2A 5A6KA 4DV7E 4JV5E 1Z1BA 3J80C 1N3GA 2UUBE 4O24A 1YFHA 2JVAA 3F6GA 1YSAC 2CTDA 2LRSA 1WHQA 3EPKA 1TF3A 2L2NA 1IMUA 2I13A 4TUIA 1X6EA 4R2CA 2BBGA 2EPLX 2JYAA 1GQEA 2UXCE 2EORA 3IWBA 2EPAA 2M4IA 2E1MA 4AQYE 2V87A 2JOXA 1L4SA 2EOIA 2L92A 2RPCA 2YSOA 4DV2E 3KZYA 5AC5A 1NEIA 1YUJA 3ZOQB 2H36X 5A69A 4LF9E 2EMLA 3F6HA 2LTSA 2YTIA 2EMXA 1ZBQA 1J26A 1O0WA 2B7VA 2EN4A 2L33A 4LF6E 4Q28A 4R2PA 4WXDA 5AE3A 2UUAE 4DV6E 4YY3E 5IXMB 2N3GA 1X47A 1N36E 2EMZA 1FKAE 2LJUA 2HGHA 2V85A 5T6JA 2EM0A 2K7IA 2WBUA 3AV0A 2L6MA 5LL6R 2LV2A 2LCEA 2F8BA 1PJTA 1N34E 2EM7A
chains in the Genus database with same CATH topology
4M2ZA 1PKPA 2L8TA 4L8NA 2K4VA 3FIGA 2LE2A 4F54A 1HNXE 4DUZE 4JI0E 3ADJA 4BC7A 2KHXA 3HPZA 2VF1A 1HNWE 2LUQA 2FTXB 3HQ1A 1I94E 4LFCE 4K0KE 1GZ6A 2MDRA 1UILA 4X8WA 3DF6A 4X66E 1YYOA 1IBLE 4F9CB 4LFAE 2RSMA 4LF5E 3J7Yp 1FJGE 4GEQB 4GKKE 2EZ6A 2L3CA 1SR9A 4B3SE 4DKKA 2DSYA 2M7QA 2N3HA 4DR4E 3VK6A 4B3ME 3LMLA 4JI4E 3IWCA 2DMYA 3C4TA 3JAMC 2L2MA 5AASA 1EKZA 3ADLA 2G7HA 4F9AB 2UU9E 4TUGA 4JI3E 4DV0E 2ODRC 1YZ9A 1N33E 2V8QB 2JR1A 3J7AG 2LJHA 3KWRA 1RQ0A 4JI5E 3JTZA 4X65E 2RS6A 4OOGC 4DV5E 1YYKA 4DR7E 2JWOA 2V88A 4B3TE 4X62E 3H09A 4JI2E 5ADZA 3VYXA 1T4LB 5AE2A 4LFBE 5FLXC 4M0VA 2V86A 2LMZA 2MC6A 4JI8E 4R03A 5LMUE 4P7DA 2LUPB 2NUFA 4DR6E 3T1HE 4DR2E 2UXDE 1XMOE 4DUYE 3DJWA 4DMIA 2JY9A 1HR0E 1DQ3A 4KZSA 4BC9A 1T4NA 1IBKE 1N32E 2KOUA 3AUZA 4BS9A 4P78A 4OX9E 4GKJE 4WFTA 4I8OA 4J8ZA 4LTYA 3LLHA 5IT9C 4JYAE 2KONA 1WHNA 3VYYA 1QU6A 2CPNA 5AE1A 4YHHE 3OTOE 2VQEE 4DV3E 4DV7E 4JV5E 3C4BA 1XMQE 4JI6E 3J80C 4BCAA 1WXRA 2UUBE 2MC5A 2JVAA 3F6GA 2FGGA 1UHZA 1YYWA 5CFFE 2M1SA 4WSPA 2LRSA 1WHQA 2VQFE 3K6QA 2L2NA 2B3TB 2B9DA 5IWAE 4LF7E 3MSWA 2FV4B 4KHPE 4TUIA 5LMNE 3IWDA 4M30A 2NUEA 2L2KB 1GQEA 2YZTA 4F9BB 2UXCE 4L5NC 3IWBA 3T1YE 2M4IA 1STUA 2E1MA 3P1XA 2VE7C 4AQYE 2V87A 2ODRD 2JOXA 2L92A 4DR5E 4DV4E 4DV2E 5F3WA 2V89A 3HPSA 3ZOQB 2IHR1 2H36X 4LU9A 4BMJA 4LF9E 2LTSA 3F6HA 4DV1E 1J26A 1ZBQA 1ZBTA 4JI7E 1O0WA 2B7VA 2YT4A 4WYQB 4X64E 1HNZE 2L33A 2RTXA 2RS7A 4Q28A 2E5LE 4LF6E 2B7TA 5AE3A 3HTXA 3J81C 5A2QC 4BBYA 4DV6E 2UUAE 3HXLA 4YY3E 4NXME 3ADIA 2N3GA 2NUGA 4R8OA 2WZOA 5BR8E 4DR3E 1X47A 1N36E 1FKAE 4JI1E 2LTRA 3ADGA 1XNRE 2NA2A 5DNYA 4DR1E 1RC7A 2LBSB 1DI2A 2V85A 5T6JA 2UXBE 4NXNE 2DIXA 1T4OA 2V83A 4WPYA 3AV0A 2L6MA 2EWLA 1J5EE 5LL6R 1X49A 1X48A 3JU0A 3OMLA 2JOBA 2ZM6E 2HHHE 3RMPA 1XNQE 2L3JA 1IBME 2UUCE 2F8BA 4LF4E 4B3RE 2F4VE 1N34E 4LF8E 2DB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WSP A;  4WPY A;  2FGG A; 
#chains in the Genus database with same CATH topology
 1PKP A;  2RQL A;  2YTF A;  2K4V A;  2ENH A;  2EN8 A;  2EL5 A;  4F2J C;  1I94 E;  2MDG A;  1AH5 A;  1GZ6 A;  5KL2 A;  4X66 E;  2EOS A;  4MLV A;  3J7Y p;  4GKK E;  4ZYE A;  2L3C A;  1SR9 A;  2EMB A;  2LT7 A;  4WXC A;  2EOO A;  2EMK A;  5KL5 A;  4BHC A;  4TUG A;  4R2A A;  4Q35 B;  4RHB B;  3J7A G;  2EOH A;  3MHS C;  4IS1 C;  1A1L A;  5KL6 A;  1DGC A;  2YPN A;  3H09 A;  4IJD A;  3ECR A;  4LFB E;  1KYQ A;  4F6M A;  4R03 A;  1G2F C;  2LUP B;  2EOM A;  3T1H E;  2JP9 A;  4R2Q A;  1XMO E;  3UK3 C;  1YUI A;  4DMI A;  2EMW A;  1HR0 E;  4BC9 A;  1ZAA C;  1MGT A;  2KOU A;  4BS9 A;  4R2D A;  4I8O A;  2J7J A;  2YTN A;  1WHN A;  2NAB A;  3OTO E;  5AE1 A;  1X3C A;  2EOF A;  3C4B A;  5A6B A;  1XMQ E;  1ZU1 A;  4M9V C;  2MC5 A;  2A25 A;  1X6F A;  1YYW A;  5CFF E;  2M1S A;  2EMG A;  2EPC A;  3K6Q A;  4LF7 E;  2FV4 B;  1A1G A;  2NUE A;  4O4K A;  4L5N C;  3T1Y E;  1SFE A;  2GPI A;  3P1X A;  2VE7 C;  2ODR D;  1EH8 A;  4DR5 E;  2EOJ A;  3L00 A;  2EPN A;  2IHR 1;  4LU9 A;  4DV1 E;  2EMC A;  4JI7 E;  2JPA A;  2B7T A;  3ADI A;  2WZO A;  2EOE A;  2EMY A;  2EPP A;  3ADG A;  1XNR E;  4ZYG A;  5DNY A;  1RC7 A;  1B69 A;  1WRJ A;  2E72 A;  4NXN E;  2EQ1 A;  3EPJ A;  2EOX A;  2EPR A;  5A6A A;  1X49 A;  1J5E E;  1X48 A;  2EL6 A;  3JU0 A;  2ZM6 E;  2EE8 A;  1XNQ E;  1IBM E;  1TF6 A;  2F4V E;  4LF8 E;  4M2Z A;  4L8N A;  3FIG A;  1HNX E;  4BC7 A;  2KHX A;  3HPZ A;  2VF1 A;  1HNW E;  2EMH A;  2EM4 A;  2ENC A;  2YTG A;  1UIL A;  4F9C B;  2DRP A;  1FJG E;  4GEQ B;  2EZ6 A;  2EPX A;  4DKK A;  1PDA A;  3THO B;  2WBT A;  2GLI A;  3LML A;  4R2E A;  2DMY A;  3JAM C;  1EKZ A;  5AAS A;  3ADL A;  2EMA A;  2UU9 E;  2EP3 A;  5AC4 A;  2EL4 A;  2LJH A;  3KWR A;  1RQ0 A;  1AAY A;  1A1K A;  2I9I A;  2LVH A;  2GHF A;  2EM6 A;  2V86 A;  4JI8 E;  5LLQ A;  2YTQ A;  4P7D A;  2D9H A;  4R2S A;  3AUZ A;  4OX9 E;  1G2D C;  4GKJ E;  4WFT A;  2MKD A;  2EMF A;  2ELZ A;  2YTE A;  3EQ1 A;  4LTY A;  1BBO A;  4DV3 E;  2MKN A;  4BCA A;  1WXR A;  2EOY A;  2EM5 A;  2EPK X;  4WSP A;  5KL7 A;  2VQF E;  1LLM C;  1IQO A;  5IWA E;  1F2I G;  3MSW A;  4KHP E;  5LMN E;  4F9B B;  2EN7 A;  1EH6 A;  2EPZ A;  2YRH A;  1QNT A;  4DV4 E;  1RMD A;  2EPU A;  2V89 A;  3HPS A;  2EM2 A;  3C6K A;  4WYQ B;  5KL4 A;  4X64 E;  2RTX A;  2EPO A;  2RS7 A;  2E5L E;  2EN6 A;  3HTX A;  3J81 C;  3HXL A;  2BB8 A;  1ZR9 A;  2NUG A;  5BR8 E;  4DR3 E;  2LTR A;  1UBD C;  4DR1 E;  2YTD A;  2LBS B;  2DIX A;  2DMI A;  4WPY A;  2YTP A;  2EWL A;  2EOZ A;  3BID A;  2JOB A;  2HHH E;  4NHR A;  4LF4 E;  2DB2 A;  4N4R B;  3BBG A;  2HC5 A;  1A1J A;  2FTX B;  2WBS A;  2MDR A;  4X8W A;  1YYO A;  2LO3 A;  4ZYD A;  2RSM A;  4LF5 E;  1T38 A;  1PJQ A;  3C6M A;  3VHT B;  4B3S E;  1A1H A;  2N3H A;  4DR4 E;  4B3M E;  4JI4 E;  3IWC A;  3C4T A;  2L2M A;  2ENA A;  4F9A B;  4JI3 E;  2EQ3 A;  4DV0 E;  1YZ9 A;  2EOQ A;  2JR1 A;  2DGC A;  2EN3 A;  1BB8 A;  3JTZ A;  4X65 E;  2RS6 A;  4OOG C;  1YYK A;  4NZV A;  2V88 A;  4B3T E;  4DR7 E;  2YSP A;  4JI2 E;  2YRK A;  1T4L B;  4GZN C;  5AE2 A;  5FLX C;  2MC6 A;  1EH7 A;  3QG5 C;  4ZYH A;  5LMU E;  2NUF A;  4RH8 A;  4DR2 E;  2R76 A;  4DUY E;  2EM9 A;  2JY9 A;  4KZS A;  2EJ4 A;  4P78 A;  1GTK A;  2DLQ A;  4JYA E;  1MEY C;  2KON A;  2WCC 3;  3VYY A;  1QU6 A;  2CPN A;  4YHH E;  2VQE E;  4R2R A;  4JI6 E;  4O5G A;  1BBG A;  2FGG A;  1UHZ A;  2HJJ A;  2EM8 A;  2Q8U A;  2B3T B;  2B9D A;  3IWD A;  4M30 A;  2YTJ A;  2L2K B;  4WX9 A;  2YZT A;  4WSG A;  1STU A;  2YRM A;  2EMI A;  5F3W A;  2N8X A;  4BMJ A;  1NCS A;  4FK5 C;  2CSH A;  1ZBT A;  2YT4 A;  2RSI A;  1HNZ E;  1P47 A;  4LFC E;  1T39 A;  5A6J A;  3M99 B;  4HEI A;  4BBY A;  5A2Q C;  4NXM E;  2EN2 A;  4R8O A;  1UN6 B;  4BHB A;  1IQS A;  2YU8 A;  4JI1 E;  1PJS A;  2NA2 A;  1DI2 A;  2EN1 A;  2VRD A;  2UXB E;  5KL3 A;  1T4O A;  2JXP A;  2V83 A;  3THN A;  3OML A;  1KJK A;  3RMP A;  2L3J A;  2UUC E;  5A6B D;  4B3R E;  2R1F A;  2ELY A;  4MLQ A;  5TSE A;  2L8T A;  4O43 A;  2LE2 A;  3KZZ A;  4F54 A;  2YWQ A;  4DUZ E;  3ADJ A;  4JI0 E;  2LUQ A;  3BF2 A;  3HQ1 A;  1WJP A;  2ADR A;  2DLK A;  4K0K E;  1JK1 A;  2EPM X;  3DF6 A;  1A1I A;  1IBL E;  4LFA E;  5IV8 B;  4HTG A;  2DSY A;  2YTO A;  2M7Q A;  3VK6 A;  3EPH A;  1X6H A;  2G7H A;  1N33 E;  2ODR C;  2V8Q B;  3MHH C;  4KWY A;  4JI5 E;  2M9A A;  4DV5 E;  2JWO A;  1X5W A;  4X62 E;  2CT1 A;  3TQM A;  5ADZ A;  1A1F A;  3VYX A;  2PRT A;  4M0V A;  2LMZ A;  2EQ0 A;  4DR6 E;  2UXD E;  3BGH A;  4X9J A;  3DJW A;  1N32 E;  1YPN A;  1DQ3 A;  1T4N A;  1IBK E;  3EPL A;  2EM3 A;  2YU5 A;  4F6N A;  1TN9 A;  4J8Z A;  3LLH A;  5IT9 C;  1JK2 A;  5A6K A;  4DV7 E;  4JV5 E;  1Z1B A;  3J80 C;  1N3G A;  2UUB E;  4O24 A;  1YFH A;  2JVA A;  3F6G A;  1YSA C;  2CTD A;  2LRS A;  1WHQ A;  3EPK A;  1TF3 A;  2L2N A;  1IMU A;  2I13 A;  4TUI A;  1X6E A;  4R2C A;  2BBG A;  2EPL X;  2JYA A;  1GQE A;  2UXC E;  2EOR A;  3IWB A;  2EPA A;  2M4I A;  2E1M A;  4AQY E;  2V87 A;  2JOX A;  1L4S A;  2EOI A;  2L92 A;  2RPC A;  2YSO A;  4DV2 E;  3KZY A;  5AC5 A;  1NEI A;  1YUJ A;  3ZOQ B;  2H36 X;  5A69 A;  4LF9 E;  2EML A;  3F6H A;  2LTS A;  2YTI A;  2EMX A;  1ZBQ A;  1J26 A;  1O0W A;  2B7V A;  2EN4 A;  2L33 A;  4LF6 E;  4Q28 A;  4R2P A;  4WXD A;  5AE3 A;  2UUA E;  4DV6 E;  4YY3 E;  5IXM B;  2N3G A;  1X47 A;  1N36 E;  2EMZ A;  1FKA E;  2LJU A;  2HGH A;  2V85 A;  5T6J A;  2EM0 A;  2K7I A;  2WBU A;  3AV0 A;  2L6M A;  5LL6 R;  2LV2 A;  2LCE A;  2F8B A;  1PJT A;  1N34 E;  2EM7 A; 
#chains in the Genus database with same CATH homology
 4M2Z A;  1PKP A;  2L8T A;  4L8N A;  2K4V A;  3FIG A;  2LE2 A;  4F54 A;  1HNX E;  4DUZ E;  4JI0 E;  3ADJ A;  4BC7 A;  2KHX A;  3HPZ A;  2VF1 A;  1HNW E;  2LUQ A;  2FTX B;  3HQ1 A;  1I94 E;  4LFC E;  4K0K E;  1GZ6 A;  2MDR A;  1UIL A;  4X8W A;  3DF6 A;  4X66 E;  1YYO A;  1IBL E;  4F9C B;  4LFA E;  2RSM A;  4LF5 E;  3J7Y p;  1FJG E;  4GEQ B;  4GKK E;  2EZ6 A;  2L3C A;  1SR9 A;  4B3S E;  4DKK A;  2DSY A;  2M7Q A;  2N3H A;  4DR4 E;  3VK6 A;  4B3M E;  3LML A;  4JI4 E;  3IWC A;  2DMY A;  3C4T A;  3JAM C;  2L2M A;  5AAS A;  1EKZ A;  3ADL A;  2G7H A;  4F9A B;  2UU9 E;  4TUG A;  4JI3 E;  4DV0 E;  2ODR C;  1YZ9 A;  1N33 E;  2V8Q B;  2JR1 A;  3J7A G;  2LJH A;  3KWR A;  1RQ0 A;  4JI5 E;  3JTZ A;  4X65 E;  2RS6 A;  4OOG C;  4DV5 E;  1YYK A;  4DR7 E;  2JWO A;  2V88 A;  4B3T E;  4X62 E;  3H09 A;  4JI2 E;  5ADZ A;  3VYX A;  1T4L B;  5AE2 A;  4LFB E;  5FLX C;  4M0V A;  2V86 A;  2LMZ A;  2MC6 A;  4JI8 E;  4R03 A;  5LMU E;  4P7D A;  2LUP B;  2NUF A;  4DR6 E;  3T1H E;  4DR2 E;  2UXD E;  1XMO E;  4DUY E;  3DJW A;  4DMI A;  2JY9 A;  1HR0 E;  1DQ3 A;  4KZS A;  4BC9 A;  1T4N A;  1IBK E;  1N32 E;  2KOU A;  3AUZ A;  4BS9 A;  4P78 A;  4OX9 E;  4GKJ E;  4WFT A;  4I8O A;  4J8Z A;  4LTY A;  3LLH A;  5IT9 C;  4JYA E;  2KON A;  1WHN A;  3VYY A;  1QU6 A;  2CPN A;  5AE1 A;  4YHH E;  3OTO E;  2VQE E;  4DV3 E;  4DV7 E;  4JV5 E;  3C4B A;  1XMQ E;  4JI6 E;  3J80 C;  4BCA A;  1WXR A;  2UUB E;  2MC5 A;  2JVA A;  3F6G A;  2FGG A;  1UHZ A;  1YYW A;  5CFF E;  2M1S A;  4WSP A;  2LRS A;  1WHQ A;  2VQF E;  3K6Q A;  2L2N A;  2B3T B;  2B9D A;  5IWA E;  4LF7 E;  3MSW A;  2FV4 B;  4KHP E;  4TUI A;  5LMN E;  3IWD A;  4M30 A;  2NUE A;  2L2K B;  1GQE A;  2YZT A;  4F9B B;  2UXC E;  4L5N C;  3IWB A;  3T1Y E;  2M4I A;  1STU A;  2E1M A;  3P1X A;  2VE7 C;  4AQY E;  2V87 A;  2ODR D;  2JOX A;  2L92 A;  4DR5 E;  4DV4 E;  4DV2 E;  5F3W A;  2V89 A;  3HPS A;  3ZOQ B;  2IHR 1;  2H36 X;  4LU9 A;  4BMJ A;  4LF9 E;  2LTS A;  3F6H A;  4DV1 E;  1J26 A;  1ZBQ A;  1ZBT A;  4JI7 E;  1O0W A;  2B7V A;  2YT4 A;  4WYQ B;  4X64 E;  1HNZ E;  2L33 A;  2RTX A;  2RS7 A;  4Q28 A;  2E5L E;  4LF6 E;  2B7T A;  5AE3 A;  3HTX A;  3J81 C;  5A2Q C;  4BBY A;  4DV6 E;  2UUA E;  3HXL A;  4YY3 E;  4NXM E;  3ADI A;  2N3G A;  2NUG A;  4R8O A;  2WZO A;  5BR8 E;  4DR3 E;  1X47 A;  1N36 E;  1FKA E;  4JI1 E;  2LTR A;  3ADG A;  1XNR E;  2NA2 A;  5DNY A;  4DR1 E;  1RC7 A;  2LBS B;  1DI2 A;  2V85 A;  5T6J A;  2UXB E;  4NXN E;  2DIX A;  1T4O A;  2V83 A;  4WPY A;  3AV0 A;  2L6M A;  2EWL A;  1J5E E;  5LL6 R;  1X49 A;  1X48 A;  3JU0 A;  3OML A;  2JOB A;  2ZM6 E;  2HHH E;  3RMP A;  1XNQ E;  2L3J A;  1IBM E;  2UUC E;  2F8B A;  4LF4 E;  4B3R E;  2F4V E;  1N34 E;  4LF8 E;  2DB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...