2FGGA

Crystal structure of rv2632c
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
b'SEHVGKTCQIDVLIEEHDERTRAKARLSWAGRQMVGVGLARLDPADEPVAQIGDELAIARALSDLANQLFALTSSDIEASTHQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Rv2632c/MT2708
publication title Crystal Structure of Rv2632c
rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08962 DUF1876 Domain of unknown function (DUF1876)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.240 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2fggA01
4WPYA 4WSPA 2FGGA
chains in the Genus database with same CATH superfamily
4FK5C 4WSPA 2UU9E 2EPRA 4R2CA 1J5EE 5KL5A 1A1LA 2EN2A 2YU8A 4O4KA 4DV7E 3MSWA 4ZYGA 1PJQA 2LT7A 2UXDE 4N4RB 3AV0A 1WHQA 1IBLE 4LFBE 1X3CA 3T1HE 4HEIA 2V85A 2EMZA 4LF8E 5AE3A 1AH5A 4L5NC 2EN7A 3K6QA 2YU5A 1UHZA 2RS6A 2LUPB 1BB8A 1JK1A 4LFCE 2M4IA 1G2DC 1YUIA 2E5LE 2B7VA 2DGCA 2V83A 2EOFA 4MLQA 2UXBE 4JI0E 2RTXA 1IQOA 4BBYA 1T4NA 1EH8A 2FV4B 4GZNC 4F9BB 2EN1A 3EPHA 4DV1E 2NUFA 4LU9A 2EM8A 4R2QA 2V89A 2MC5A 4WXCA 2L8TA 1N33E 1HNXE 2MKNA 3C6KA 2YTEA 2YT4A 4F9AB 4WX9A 1A1FA 2GPIA 2NABA 1MEYC 3LMLA 4BS9A 2EPLX 1PJSA 2LTRA 2RSIA 2EPPA 1T38A 5LL6R 2ENAA 2ODRC 4DV5E 2M1SA 2EMKA 1TN9A 2JOBA 1TF3A 1XMQE 2L2MA 4X64E 3J80C 2EMBA 1FJGE 1STUA 2WCC3 4M2ZA 4B3ME 2MDRA 3IWCA 1ZBQA 2DMYA 4B3TE 2L2KB 1G2FC 2LBSB 3UK3C 1MGTA 4F6MA 2F4VE 2EN6A 2EWLA 2EM3A 2EPCA 3M99B 2YTIA 2FTXB 5A6AA 2EN4A 1EKZA 1GTKA 2ELYA 2EMXA 2EPOA 2JXPA 2CT1A 1WXRA 4DV0E 2EPMX 2EL5A 1XMOE 2L3CA 1A1JA 2ZM6E 3HXLA 1WJPA 2YRHA 1P47A 2EMIA 2UUCE 4TUGA 4B3SE 2CPNA 1N32E 2KHXA 3JAMC 2EM9A 4JV5E 5AC5A 4LF4E 4DMIA 3THOB 4DV6E 4R2DA 5IXMB 3HPSA 3VYXA 4AQYE 2B7TA 2UUBE 1X6FA 2NA2A 4KZSA 4F54A 4LTYA 1A1KA 4O5GA 1SR9A 3ADLA 2EP3A 2EN8A 4BHBA 1KJKA 1WHNA 3C4TA 4B3RE 3ZOQB 2LMZA 1DI2A 1YYKA 3OMLA 1ZBTA 2VF1A 4X66E 2PRTA 2GLIA 4DV2E 1A1IA 1TF6A 3ADGA 2DIXA 1PJTA 1FKAE 4BCAA 3F6GA 1EH6A 1JK2A 1PDAA 2EMCA 1YSAC 5IWAE 2YTGA 4X9JA 2EL4A 4RHBB 4Q28A 2HC5A 2CTDA 5BR8E 4TUIA 2E72A 5ADZA 2E1MA 2RPCA 4M30A 2EPZA 3ADIA 2CSHA 2EOQA 4DV3E 5T6JA 1O0WA 2EPXA 2HGHA 4HTGA 3MHHC 2A25A 2V86A 3THNA 1YPNA 2EQ3A 2JVAA 5A6JA 4YHHE 5A6KA 2EMWA 2L2NA 1X6HA 1XNQE 3J81C 1T39A 3KZZA 4WSGA 4X8WA 1L4SA 2EOMA 2B9DA 2IHR1 2FGGA 1HNZE 2EOIA 2YTNA 4LF9E 2WBUA 3JU0A 1QU6A 4R2EA 2DSYA 4NZVA 2JY9A 5CFFE 4DR5E 3MHSC 1X5WA 2LJHA 1HR0E 2DRPA 1A1GA 2YPNA 5KL2A 3DJWA 1N3GA 4GKKE 4DR3E 1NEIA 4DUYE 2YSOA 1N34E 1DGCA 2J7JA 4JI6E 4JI2E 1EH7A 4ZYHA 2EMHA 1WRJA 2D9HA 2I9IA 3ECRA 4R2PA 2GHFA 4K0KE 2K4VA 2EMYA 2LVHA 2KONA 2LV2A 4BC9A 2UUAE 2YTFA 2JR1A 1X47A 2LO3A 1UN6B 1ZR9A 4M9VC 3EPJA 2EM4A 3BBGA 2RQLA 1UBDC 3C6MA 4R03A 2ENHA 4JI5E 2EOXA 4WYQB 2EMLA 2LJUA 3FIGA 2EM0A 1GQEA 3IWBA 2JPAA 2RSMA 2YZTA 3BF2A 4LF5E 2V88A 3P1XA 4YY3E 2MDGA 1RC7A 4L8NA 1LLMC 2JYAA 4NXNE 2EJ4A 4BC7A 5LMNE 1X48A 2DB2A 1IBME 2HHHE 2B3TB 3QG5C 4J8ZA 2ENCA 4F9CB 2YTOA 2YSPA 4IJDA 2EOSA 3J7Yp 5KL3A 1BBGA 4R2RA 4BHCA 2VQEE 2VE7C 3VHTB 4WPYA 3KZYA 4OX9E 5A6BA 2ADRA 3C4BA 3VK6A 1GZ6A 4X62E 4R2SA 2EPAA 1IMUA 4DR4E 2M7QA 5F3WA 4JI3E 3HQ1A 4JI4E 2WBTA 3HTXA 4GKJE 4X65E 4NHRA 2V8QB 2UXCE 2EPNA 3OTOE 2L33A 3LLHA 2KOUA 2ODRD 3BIDA 2EOZA 3AUZA 1J26A 2YTPA 4LF7E 2I13A 5KL7A 3L00A 1IQSA 4BMJA 2EPKX 3EPLA 2L92A 1YUJA 2NUGA 4DR6E 3RMPA 4R8OA 2EOEA 5TSEA 1NCSA 2LTSA 2LUQA 2N3GA 4Q35B 4DR1E 2MKDA 1HNWE 1YYWA 3F6HA 2EOHA 2DLQA 3DF6A 5FLXC 4LFAE 4JI8E 1AAYA 2K7IA 2EQ0A 2EMGA 4KHPE 2WZOA 2EMAA 3JTZA 4O24A 1RMDA 5AC4A 1YYOA 1I94E 1BBOA 1KYQA 4P7DA 4RH8A 2RS7A 4LF6E 2EOJA 1QNTA 2EQ1A 2Q8UA 4R2AA 1XNRE 2N3HA 4JI1E 5KL6A 2EE8A 5LMUE 4GEQB 1PKPA 2VRDA 2NUEA 2M9AA 2N8XA 1ZU1A 2YRMA 2EORA 4DV4E 2YWQA 2HJJA 5AASA 5AE2A 1SFEA 2YTDA 3EQ1A 2EM2A 3J7AG 2L6MA 3KWRA 3IWDA 5AE1A 2DMIA 1ZAAC 3BGHA 5DNYA 2WBSA 2JWOA 3H09A 4WFTA 2VQFE 2EM7A 2H36X 2EL6A 2R1FA 4MLVA 2EMFA 4DR7E 4P78A 1B69A 3VYYA 4DKKA 2DLKA 5LLQA 1N36E 4WXDA 1YZ9A 4I8OA 4ZYDA 4NXME 5A69A 2BBGA 2MC6A 1X49A 2EM5A 4ZYEA 1DQ3A 2LCEA 2LRSA 1T4LB 2G7HA 2LE2A 2EN3A 4F6NA 4JYAE 2YTJA 4JI7E 1Z1BA 1T4OA 5A6BD 1IBKE 3ADJA 1F2IG 2R76A 3T1YE 4OOGC 5IT9C 5A2QC 1RQ0A 2L3JA 2EOOA 2JOXA 2EM6A 3TQMA 2JP9A 5KL4A 1YFHA 3HPZA 2EOYA 4O43A 2BB8A 2F8BA 4DUZE 2YRKA 4DR2E 4KWYA 2EZ6A 2EPUA 2ELZA 1UILA 4M0VA 4F2JC 2YTQA 3EPKA 4IS1C 1A1HA 2V87A 1X6EA 5IV8B
chains in the Genus database with same CATH topology
4DR1E 4WSPA 2ZM6E 3HXLA 4JI6E 4JI2E 1HNWE 2UU9E 1J5EE 1YYWA 3F6HA 2UUCE 3DF6A 4TUGA 4B3SE 4K0KE 2K4VA 2CPNA 5FLXC 4LFAE 4JI8E 1N32E 2KHXA 3JAMC 2KONA 4BC9A 4DV7E 2UUAE 4JV5E 2JR1A 4KHPE 1X47A 2WZOA 3JTZA 3MSWA 4DMIA 4DV6E 4LF4E 3HPSA 4R03A 3VYXA 4AQYE 1YYOA 4JI5E 4WYQB 2UXDE 2B7TA 1I94E 3AV0A 2UUBE 1WHQA 4P7DA 2NA2A 1IBLE 3FIGA 4KZSA 4F54A 4LFBE 1GQEA 2RS7A 4LF6E 3IWBA 4LTYA 3T1HE 1XNRE 2RSMA 1SR9A 2V85A 2YZTA 4LF5E 4LF8E 2V88A 3ADLA 5AE3A 3P1XA 2N3HA 4L5NC 4YY3E 1WHNA 4JI1E 3C4TA 5LMUE 3K6QA 4B3RE 1RC7A 3ZOQB 1UHZA 2LMZA 2RS6A 4L8NA 4GEQB 1PKPA 2LUPB 1DI2A 1YYKA 4LFCE 3OMLA 1ZBTA 4NXNE 4BC7A 2NUEA 2M4IA 2VF1A 4X66E 5LMNE 4DV4E 1X48A 5AASA 5AE2A 4DV2E 2DB2A 2E5LE 2B7VA 3ADGA 2V83A 2DIXA 3J7AG 1IBME 2HHHE 2B3TB 2UXBE 2L6MA 3KWRA 1FKAE 4BCAA 3F6GA 3IWDA 4J8ZA 5AE1A 4JI0E 5IWAE 2RTXA 4F9CB 4BBYA 5DNYA 1T4NA 2JWOA 3H09A 4WFTA 2VQFE 2FV4B 3J7Yp 4F9BB 4DV1E 2H36X 2NUFA 4LU9A 4DR7E 4P78A 4Q28A 2V89A 2MC5A 3VYYA 4DKKA 5BR8E 2L8TA 2VQEE 2VE7C 1N36E 1HNXE 1N33E 4F9AB 2YT4A 4TUIA 1YZ9A 4WPYA 3LMLA 4BS9A 4OX9E 5ADZA 4I8OA 2E1MA 2LTRA 4M30A 4NXME 3C4BA 3VK6A 3ADIA 1GZ6A 5LL6R 2MC6A 4X62E 4DV3E 5T6JA 1X49A 1O0WA 2ODRC 4DV5E 2M1SA 1DQ3A 4DR4E 2JOBA 2LRSA 1T4LB 2G7HA 2LE2A 2V86A 2M7QA 2L2MA 5F3WA 1XMQE 4X64E 3J80C 4JYAE 4JI3E 2JVAA 4JI7E 1FJGE 3HQ1A 4YHHE 1T4OA 2L2NA 1STUA 1IBKE 4JI4E 1XNQE 3ADJA 3J81C 3HTXA 4M2ZA 4B3ME 3T1YE 4GKJE 4OOGC 5IT9C 2MDRA 3IWCA 1ZBQA 2DMYA 4X65E 5A2QC 1RQ0A 2V8QB 2L3JA 4B3TE 2L2KB 4X8WA 2LBSB 2JOXA 2F4VE 2UXCE 2B9DA 3OTOE 2L33A 2IHR1 2EWLA 2FGGA 3LLHA 2KOUA 2ODRD 1HNZE 4LF9E 3AUZA 3JU0A 3HPZA 1QU6A 2FTXB 1J26A 2DSYA 2F8BA 4DUZE 5CFFE 2JY9A 1EKZA 4DR5E 1HR0E 2LJHA 4LF7E 4BMJA 4DR2E 3DJWA 1WXRA 2EZ6A 4DV0E 4GKKE 2L92A 1UILA 4M0VA 4DR3E 4R8OA 3RMPA 2NUGA 4DR6E 2LTSA 1XMOE 2L3CA 2LUQA 2N3GA 1N34E 2V87A 4DUYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WPY A;  4WSP A;  2FGG A; 
#chains in the Genus database with same CATH topology
 4FK5 C;  4WSP A;  2UU9 E;  2EPR A;  4R2C A;  1J5E E;  5KL5 A;  1A1L A;  2EN2 A;  2YU8 A;  4O4K A;  4DV7 E;  3MSW A;  4ZYG A;  1PJQ A;  2LT7 A;  2UXD E;  4N4R B;  3AV0 A;  1WHQ A;  1IBL E;  4LFB E;  1X3C A;  3T1H E;  4HEI A;  2V85 A;  2EMZ A;  4LF8 E;  5AE3 A;  1AH5 A;  4L5N C;  2EN7 A;  3K6Q A;  2YU5 A;  1UHZ A;  2RS6 A;  2LUP B;  1BB8 A;  1JK1 A;  4LFC E;  2M4I A;  1G2D C;  1YUI A;  2E5L E;  2B7V A;  2DGC A;  2V83 A;  2EOF A;  4MLQ A;  2UXB E;  4JI0 E;  2RTX A;  1IQO A;  4BBY A;  1T4N A;  1EH8 A;  2FV4 B;  4GZN C;  4F9B B;  2EN1 A;  3EPH A;  4DV1 E;  2NUF A;  4LU9 A;  2EM8 A;  4R2Q A;  2V89 A;  2MC5 A;  4WXC A;  2L8T A;  1N33 E;  1HNX E;  2MKN A;  3C6K A;  2YTE A;  2YT4 A;  4F9A B;  4WX9 A;  1A1F A;  2GPI A;  2NAB A;  1MEY C;  3LML A;  4BS9 A;  2EPL X;  1PJS A;  2LTR A;  2RSI A;  2EPP A;  1T38 A;  5LL6 R;  2ENA A;  2ODR C;  4DV5 E;  2M1S A;  2EMK A;  1TN9 A;  2JOB A;  1TF3 A;  1XMQ E;  2L2M A;  4X64 E;  3J80 C;  2EMB A;  1FJG E;  1STU A;  2WCC 3;  4M2Z A;  4B3M E;  2MDR A;  3IWC A;  1ZBQ A;  2DMY A;  4B3T E;  2L2K B;  1G2F C;  2LBS B;  3UK3 C;  1MGT A;  4F6M A;  2F4V E;  2EN6 A;  2EWL A;  2EM3 A;  2EPC A;  3M99 B;  2YTI A;  2FTX B;  5A6A A;  2EN4 A;  1EKZ A;  1GTK A;  2ELY A;  2EMX A;  2EPO A;  2JXP A;  2CT1 A;  1WXR A;  4DV0 E;  2EPM X;  2EL5 A;  1XMO E;  2L3C A;  1A1J A;  2ZM6 E;  3HXL A;  1WJP A;  2YRH A;  1P47 A;  2EMI A;  2UUC E;  4TUG A;  4B3S E;  2CPN A;  1N32 E;  2KHX A;  3JAM C;  2EM9 A;  4JV5 E;  5AC5 A;  4LF4 E;  4DMI A;  3THO B;  4DV6 E;  4R2D A;  5IXM B;  3HPS A;  3VYX A;  4AQY E;  2B7T A;  2UUB E;  1X6F A;  2NA2 A;  4KZS A;  4F54 A;  4LTY A;  1A1K A;  4O5G A;  1SR9 A;  3ADL A;  2EP3 A;  2EN8 A;  4BHB A;  1KJK A;  1WHN A;  3C4T A;  4B3R E;  3ZOQ B;  2LMZ A;  1DI2 A;  1YYK A;  3OML A;  1ZBT A;  2VF1 A;  4X66 E;  2PRT A;  2GLI A;  4DV2 E;  1A1I A;  1TF6 A;  3ADG A;  2DIX A;  1PJT A;  1FKA E;  4BCA A;  3F6G A;  1EH6 A;  1JK2 A;  1PDA A;  2EMC A;  1YSA C;  5IWA E;  2YTG A;  4X9J A;  2EL4 A;  4RHB B;  4Q28 A;  2HC5 A;  2CTD A;  5BR8 E;  4TUI A;  2E72 A;  5ADZ A;  2E1M A;  2RPC A;  4M30 A;  2EPZ A;  3ADI A;  2CSH A;  2EOQ A;  4DV3 E;  5T6J A;  1O0W A;  2EPX A;  2HGH A;  4HTG A;  3MHH C;  2A25 A;  2V86 A;  3THN A;  1YPN A;  2EQ3 A;  2JVA A;  5A6J A;  4YHH E;  5A6K A;  2EMW A;  2L2N A;  1X6H A;  1XNQ E;  3J81 C;  1T39 A;  3KZZ A;  4WSG A;  4X8W A;  1L4S A;  2EOM A;  2B9D A;  2IHR 1;  2FGG A;  1HNZ E;  2EOI A;  2YTN A;  4LF9 E;  2WBU A;  3JU0 A;  1QU6 A;  4R2E A;  2DSY A;  4NZV A;  2JY9 A;  5CFF E;  4DR5 E;  3MHS C;  1X5W A;  2LJH A;  1HR0 E;  2DRP A;  1A1G A;  2YPN A;  5KL2 A;  3DJW A;  1N3G A;  4GKK E;  4DR3 E;  1NEI A;  4DUY E;  2YSO A;  1N34 E;  1DGC A;  2J7J A;  4JI6 E;  4JI2 E;  1EH7 A;  4ZYH A;  2EMH A;  1WRJ A;  2D9H A;  2I9I A;  3ECR A;  4R2P A;  2GHF A;  4K0K E;  2K4V A;  2EMY A;  2LVH A;  2KON A;  2LV2 A;  4BC9 A;  2UUA E;  2YTF A;  2JR1 A;  1X47 A;  2LO3 A;  1UN6 B;  1ZR9 A;  4M9V C;  3EPJ A;  2EM4 A;  3BBG A;  2RQL A;  1UBD C;  3C6M A;  4R03 A;  2ENH A;  4JI5 E;  2EOX A;  4WYQ B;  2EML A;  2LJU A;  3FIG A;  2EM0 A;  1GQE A;  3IWB A;  2JPA A;  2RSM A;  2YZT A;  3BF2 A;  4LF5 E;  2V88 A;  3P1X A;  4YY3 E;  2MDG A;  1RC7 A;  4L8N A;  1LLM C;  2JYA A;  4NXN E;  2EJ4 A;  4BC7 A;  5LMN E;  1X48 A;  2DB2 A;  1IBM E;  2HHH E;  2B3T B;  3QG5 C;  4J8Z A;  2ENC A;  4F9C B;  2YTO A;  2YSP A;  4IJD A;  2EOS A;  3J7Y p;  5KL3 A;  1BBG A;  4R2R A;  4BHC A;  2VQE E;  2VE7 C;  3VHT B;  4WPY A;  3KZY A;  4OX9 E;  5A6B A;  2ADR A;  3C4B A;  3VK6 A;  1GZ6 A;  4X62 E;  4R2S A;  2EPA A;  1IMU A;  4DR4 E;  2M7Q A;  5F3W A;  4JI3 E;  3HQ1 A;  4JI4 E;  2WBT A;  3HTX A;  4GKJ E;  4X65 E;  4NHR A;  2V8Q B;  2UXC E;  2EPN A;  3OTO E;  2L33 A;  3LLH A;  2KOU A;  2ODR D;  3BID A;  2EOZ A;  3AUZ A;  1J26 A;  2YTP A;  4LF7 E;  2I13 A;  5KL7 A;  3L00 A;  1IQS A;  4BMJ A;  2EPK X;  3EPL A;  2L92 A;  1YUJ A;  2NUG A;  4DR6 E;  3RMP A;  4R8O A;  2EOE A;  5TSE A;  1NCS A;  2LTS A;  2LUQ A;  2N3G A;  4Q35 B;  4DR1 E;  2MKD A;  1HNW E;  1YYW A;  3F6H A;  2EOH A;  2DLQ A;  3DF6 A;  5FLX C;  4LFA E;  4JI8 E;  1AAY A;  2K7I A;  2EQ0 A;  2EMG A;  4KHP E;  2WZO A;  2EMA A;  3JTZ A;  4O24 A;  1RMD A;  5AC4 A;  1YYO A;  1I94 E;  1BBO A;  1KYQ A;  4P7D A;  4RH8 A;  2RS7 A;  4LF6 E;  2EOJ A;  1QNT A;  2EQ1 A;  2Q8U A;  4R2A A;  1XNR E;  2N3H A;  4JI1 E;  5KL6 A;  2EE8 A;  5LMU E;  4GEQ B;  1PKP A;  2VRD A;  2NUE A;  2M9A A;  2N8X A;  1ZU1 A;  2YRM A;  2EOR A;  4DV4 E;  2YWQ A;  2HJJ A;  5AAS A;  5AE2 A;  1SFE A;  2YTD A;  3EQ1 A;  2EM2 A;  3J7A G;  2L6M A;  3KWR A;  3IWD A;  5AE1 A;  2DMI A;  1ZAA C;  3BGH A;  5DNY A;  2WBS A;  2JWO A;  3H09 A;  4WFT A;  2VQF E;  2EM7 A;  2H36 X;  2EL6 A;  2R1F A;  4MLV A;  2EMF A;  4DR7 E;  4P78 A;  1B69 A;  3VYY A;  4DKK A;  2DLK A;  5LLQ A;  1N36 E;  4WXD A;  1YZ9 A;  4I8O A;  4ZYD A;  4NXM E;  5A69 A;  2BBG A;  2MC6 A;  1X49 A;  2EM5 A;  4ZYE A;  1DQ3 A;  2LCE A;  2LRS A;  1T4L B;  2G7H A;  2LE2 A;  2EN3 A;  4F6N A;  4JYA E;  2YTJ A;  4JI7 E;  1Z1B A;  1T4O A;  5A6B D;  1IBK E;  3ADJ A;  1F2I G;  2R76 A;  3T1Y E;  4OOG C;  5IT9 C;  5A2Q C;  1RQ0 A;  2L3J A;  2EOO A;  2JOX A;  2EM6 A;  3TQM A;  2JP9 A;  5KL4 A;  1YFH A;  3HPZ A;  2EOY A;  4O43 A;  2BB8 A;  2F8B A;  4DUZ E;  2YRK A;  4DR2 E;  4KWY A;  2EZ6 A;  2EPU A;  2ELZ A;  1UIL A;  4M0V A;  4F2J C;  2YTQ A;  3EPK A;  4IS1 C;  1A1H A;  2V87 A;  1X6E A;  5IV8 B; 
#chains in the Genus database with same CATH homology
 4DR1 E;  4WSP A;  2ZM6 E;  3HXL A;  4JI6 E;  4JI2 E;  1HNW E;  2UU9 E;  1J5E E;  1YYW A;  3F6H A;  2UUC E;  3DF6 A;  4TUG A;  4B3S E;  4K0K E;  2K4V A;  2CPN A;  5FLX C;  4LFA E;  4JI8 E;  1N32 E;  2KHX A;  3JAM C;  2KON A;  4BC9 A;  4DV7 E;  2UUA E;  4JV5 E;  2JR1 A;  4KHP E;  1X47 A;  2WZO A;  3JTZ A;  3MSW A;  4DMI A;  4DV6 E;  4LF4 E;  3HPS A;  4R03 A;  3VYX A;  4AQY E;  1YYO A;  4JI5 E;  4WYQ B;  2UXD E;  2B7T A;  1I94 E;  3AV0 A;  2UUB E;  1WHQ A;  4P7D A;  2NA2 A;  1IBL E;  3FIG A;  4KZS A;  4F54 A;  4LFB E;  1GQE A;  2RS7 A;  4LF6 E;  3IWB A;  4LTY A;  3T1H E;  1XNR E;  2RSM A;  1SR9 A;  2V85 A;  2YZT A;  4LF5 E;  4LF8 E;  2V88 A;  3ADL A;  5AE3 A;  3P1X A;  2N3H A;  4L5N C;  4YY3 E;  1WHN A;  4JI1 E;  3C4T A;  5LMU E;  3K6Q A;  4B3R E;  1RC7 A;  3ZOQ B;  1UHZ A;  2LMZ A;  2RS6 A;  4L8N A;  4GEQ B;  1PKP A;  2LUP B;  1DI2 A;  1YYK A;  4LFC E;  3OML A;  1ZBT A;  4NXN E;  4BC7 A;  2NUE A;  2M4I A;  2VF1 A;  4X66 E;  5LMN E;  4DV4 E;  1X48 A;  5AAS A;  5AE2 A;  4DV2 E;  2DB2 A;  2E5L E;  2B7V A;  3ADG A;  2V83 A;  2DIX A;  3J7A G;  1IBM E;  2HHH E;  2B3T B;  2UXB E;  2L6M A;  3KWR A;  1FKA E;  4BCA A;  3F6G A;  3IWD A;  4J8Z A;  5AE1 A;  4JI0 E;  5IWA E;  2RTX A;  4F9C B;  4BBY A;  5DNY A;  1T4N A;  2JWO A;  3H09 A;  4WFT A;  2VQF E;  2FV4 B;  3J7Y p;  4F9B B;  4DV1 E;  2H36 X;  2NUF A;  4LU9 A;  4DR7 E;  4P78 A;  4Q28 A;  2V89 A;  2MC5 A;  3VYY A;  4DKK A;  5BR8 E;  2L8T A;  2VQE E;  2VE7 C;  1N36 E;  1HNX E;  1N33 E;  4F9A B;  2YT4 A;  4TUI A;  1YZ9 A;  4WPY A;  3LML A;  4BS9 A;  4OX9 E;  5ADZ A;  4I8O A;  2E1M A;  2LTR A;  4M30 A;  4NXM E;  3C4B A;  3VK6 A;  3ADI A;  1GZ6 A;  5LL6 R;  2MC6 A;  4X62 E;  4DV3 E;  5T6J A;  1X49 A;  1O0W A;  2ODR C;  4DV5 E;  2M1S A;  1DQ3 A;  4DR4 E;  2JOB A;  2LRS A;  1T4L B;  2G7H A;  2LE2 A;  2V86 A;  2M7Q A;  2L2M A;  5F3W A;  1XMQ E;  4X64 E;  3J80 C;  4JYA E;  4JI3 E;  2JVA A;  4JI7 E;  1FJG E;  3HQ1 A;  4YHH E;  1T4O A;  2L2N A;  1STU A;  1IBK E;  4JI4 E;  1XNQ E;  3ADJ A;  3J81 C;  3HTX A;  4M2Z A;  4B3M E;  3T1Y E;  4GKJ E;  4OOG C;  5IT9 C;  2MDR A;  3IWC A;  1ZBQ A;  2DMY A;  4X65 E;  5A2Q C;  1RQ0 A;  2V8Q B;  2L3J A;  4B3T E;  2L2K B;  4X8W A;  2LBS B;  2JOX A;  2F4V E;  2UXC E;  2B9D A;  3OTO E;  2L33 A;  2IHR 1;  2EWL A;  2FGG A;  3LLH A;  2KOU A;  2ODR D;  1HNZ E;  4LF9 E;  3AUZ A;  3JU0 A;  3HPZ A;  1QU6 A;  2FTX B;  1J26 A;  2DSY A;  2F8B A;  4DUZ E;  5CFF E;  2JY9 A;  1EKZ A;  4DR5 E;  1HR0 E;  2LJH A;  4LF7 E;  4BMJ A;  4DR2 E;  3DJW A;  1WXR A;  2EZ6 A;  4DV0 E;  4GKK E;  2L92 A;  1UIL A;  4M0V A;  4DR3 E;  4R8O A;  3RMP A;  2NUG A;  4DR6 E;  2LTS A;  1XMO E;  2L3C A;  2LUQ A;  2N3G A;  1N34 E;  2V87 A;  4DUY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...