1QNTA

X-ray structure of human o6alkylguanine-dna alkyltransferase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
171
structure length
166
Chain Sequence
EMKRTTLDSPLGKLELSGCEQGLHEIKLLGKDAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLATED-DNA--PROTEIN-CYSTEINE METHYLTRANSFERASE
publication title Crystal Structure of the Human O(6)-Alkylguanine-DNA Alkyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna repair
total genus 42
structure length 166
sequence length 171
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 1999-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1qntA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1qntA01
1QQIA 2L4MA 4ESBA 3WTSC 3TOAA 2QQBA 4EVIA 3VOEA 4FT8A 4KYWA 1FY7A 4I2OA 4TV7A 2K4JA 4MQVA 1ZHFA 3BROA 1FX7A 1KGSA 4ZYEA 3CO7C 1R22A 5ILVA 4CGZA 3SXYA 4YIFA 3HYIA 3C3WA 6PAXA 3IC7A 2M1BA 5D5VB 3B02A 3LAJA 5F64A 3GLXA 4A12A 5LEJA 1V3FA 4I0BA 3R60A 1MJBA 1HSTA 3C1DA 3J80K 1P2FA 1B1BA 2ZNZA 3GF2A 2C6YA 5HDKA 2VT3A 3BJAA 1ZLKA 2NRAC 1PP7U 5DDGA 1SFEA 1X3UA 2OBPA 1B59A 2V1DA 2BV6A 1OMIA 5JI6A 3QU6A 3GXOA 2H09A 3GFIA 5E8GA 2DAOA 5HS7A 4ZZDA 1J9IA 2XIGA 3F6OA 3ZPLA 1HKSA 4A6DA 3P9KA 3E5UA 2NYXA 1C0WA 5LHIA 4KN7X 2COMA 3PQJA 3L00A 2EB7A 4BXUA 5CVRA 1R5HA 4EGZA 1G3SA 1R1UA 1WRJA 5D5WB 5DD8A 3DEUA 2DW4A 2K86A 4Q47A 2HQNA 3WE2A 3TDZC 1XMKA 4FX0A 1OR7A 3O6BB 1LNWA 2D2WA 4B8XA 4G7OF 2H6CA 3EYYA 4GO1A 3LA3A 4RB3C 3ERED 2YX7A 4MTEA 2CQKA 1R7JA 4CDGA 3WGHA 1IN7A 3P9CA 1ZG3A 2DPUA 2Q8KA 3I0TA 3E97A 2OA4A 1JHFA 1KU3A 1P4AA 2FEZA 3ROUA 4K2EA 1DPUA 2LNBA 4NQWA 2QYOA 3V7CA 2MC3A 2MBFA 3I54A 4O5VA 2VXZA 1W4MA 1P92A 4KIFA 4DQ2A 4EJWA 2VBWA 2VOPA 3SQNA 4DNCA 2MD5A 4L9TA 1MJAA 1R00A 2L54A 2XAJA 3WTTC 4EJTA 2PMHA 5ILUA 1XDSA 2F5DA 5LEKA 2GWRA 4M71A 3SZPA 2GIVA 3ZQ7A 3WTUC 2XROA 5E8IA 4KIBA 1FOKA 1PDNC 3I58A 1OPCA 1W5TA 3CUQB 4MGRA 1WKMA 2PJPA 1LEBA 5E1WA 3OV8A 1K6OA 4P9UA 2BEOA 2RN7A 4XLNF 4WF2A 1XSDA 5DD4A 2E1NA 1U6GA 2E7XA 4O6JA 4XSXF 3V4GA 4S05A 3TKYA 4CYDA 2A6EF 1W7PD 3BPVA 1U78A 1O3RA 1JGSA 4ENJA 2CGPA 3BPXA 1QZYA 3I64A 1TQIA 4LLGF 2DLLA 2E1CA 2F2EA 3WTZA 2EV6A 1LVAA 1T6SA 3DPLC 3KEQA 3KLOA 1UCRA 3BP8A 5FB2A 1I27A 3BZ6A 4N9IA 3DFGA 2PFBA 3GO5A 3VEPA 2NNYA 1GHCA 3HSFA 1EV7A 2EWNA 2RVCA 2YU3A 4IJAA 4IRIA 2K4BA 2E7WA 2HDCA 3K2ZA 3LSTA 3RTRA 1BC8C 1R36A 2P6SA 4EQQA 2PN6A 4OIQF 4HYEA 1BIAA 3E6DA 3GX4X 1XGMA 4HQMA 3ABTA 3F8MA 2ZNYA 2JT1A 2FNPA 5K5QA 1EH8A 2UWMA 4NHJA 2FMLA 2ESHA 5FFZA 5D8KB 1YW9A 1IZ1A 3MZYA 4R79A 3KP4A 2XVCA 4WCGA 2EFWA 5DCMB 3EYIA 5D5XB 3O3KA 4AIJA 3KP2A 5HS8A 1XB4A 3CUQA 2W85A 4LK1F 5KVRA 2D1VA 3TQNA 4UUVA 4HF0A 2UZKA 1REPC 3MEXA 4I01A 4HAMA 5F6FA 1XDUA 2IW5A 5CVIA 5D5UB 4A5MA 1D8JA 2PMUA 2RNJA 2V1UA 5BS6A 4L9JA 3ECOA 3KP3A 4GCVA 4R1HA 4RAZA 2HR3A 1RNLA 2M30A 4Z2YA 1HXDA 2UXXA 3TO6A 4U0WA 1KQ8A 1B9MA 1H9GA 3OOPA 1Z91A 3L09A 1UFMA 4RGUA 3LQRA 4IXAA 2R7DA 2FBKA 4HX4A 4HF1A 2DQRA 2FU4A 4WXHA 1YS7A 3P7NA 2ACJA 2Q0OA 2GXBA 2HEOA 3HRSA 2XAQA 1LDKB 1SFUA 2ADUA 1P6RA 2M45A 4BH9A 2ISZA 4LD5A 1QPMA 2ZMEB 5DUKA 4Q48A 3FZVA 1B4AA 3PFIA 1T38A 1IRGA 4KICA 2VONA 1T98A 2O61A 2HGCA 3MQ0A 1HW1A 3K69A 3JW4A 1ZYRF 3KFWX 3GYHX 2KIUA 2BGCA 3EUHA 2XV4S 3GVAA 2FQ3A 1J2XA 3NEUA 2LSOA 3GW2A 2F5FA 2R3SA 2TDXA 5EEGA 2BBYA 2O0YA 2XKOA 1BOAA 1BJAA 4BHBA 1KA8A 1SD4A 4KA4A 1IN8A 2M87A 3BY6A 1AWCA 2Z33A 3WU1B 1KYZA 1FYMA 3COAC 3J81Z 2KRFA 3NRVA 2IA1A 3RI4A 2DO7A 3V7RA 3D0SA 1K78B 4HLYA 3RKXA 3HOTA 4AWXB 5D4SA 2HZTA 3T8RA 1YYVA 5H6QA 2L01A 3IRQA 4G6QA 1I5ZA 2CO5A 2PG4A 1SAXA 2XGXA 3RJPA 2QBYA 1G3WA 1MDMB 2LF7A 1HSJA 3GZ6A 5DCFA 3IHUA 2GA1A 1QO0D 4ASNA 3I53A 3B73A 2JRTA 3U1DA 1KYWA 3R6SA 1U3EM 3CUOA 4EM0B 2L4AA 5DEQA 2R7FA 3F8FA 3LA7A 2ZMEA 2RDPA 5HDGA 5KK1A 3I4PA 3K1MA 1ZRDA 2O03A 3JAMZ 1FP2A 1XGSA 2ZBKA 3BJOA 3GUDA 2GZWA 4HZFA 1BI0A 2VE8A 2ISYA 1J75A 2OD5A 4KUMA 1WQ2A 1OKRA 1O3QA 2L3DA 2Z99A 2YSRA 4U7BA 2WC2A 2MLGA 4MQ9F 5JFRA 3J81K 5BPDA 1I1GA 2B0LA 1PP8F 5JVTA 2F5CA 5ICEA 4L9VA 3WGGA 2IT0A 1W7PB 2NNNA 1S6LA 2W25A 4GXOA 3GWZA 2IP2A 3WTVC 2O8XA 1FLIA 1FBUA 3BDDA 2IA2A 2RC4A 4LB5A 2XAHA 4HF2A 2OU2A 1K78A 1FP1D 3P9IA 4RAYA 4WXDA 1GVJA 5LHHA 1XGOA 2PLYA 1KU2A 5E1XA 4LLNA 4NB5A 2QM3A 4AD9A 1FZPB 2P6TA 2QLZA 3ZMTA 2IA0A 1R1TA 2IJLA 3RKWA 3FF5A 2G9WA 4F7ZA 3M8EA 2Z3YA 2HTJA 1WSUA 1J7KA 2O3FA 1MDMA 3K1PA 1HBXG 1UHMA 1S7OA 2NAZA 2EFQA 4LJZF 2BE5F 4HA8A 3W6JB 5LGTA 4RB1A 5LGNA 4YG2F 4AIKA 1W5SA 3WGIA 4HDUA 4MHGA 2H6BA 4OINF 1WWXA 3KP6A 1O3SA 1BI3A 2W84A 2PBIA 1XD7A 4M9ZA 3MAJA 2XHKA 4EMSA 4UVCA 3JAMK 5L3FA 3LAPA 3IWZA 1ZG1A 2CG4A 2XASA 4KT5C 1XGNA 2VODA 3WE3A 2EFPA 1MGTA 2XKPA 3F8NA 4UHTA 3VFZA 4FHTA 1R1VA 3EETA 4G8XA 3FWEA 3QP6A 3T1BA 5L3DA 2YR2A 2W57A 4ZZLA 4N0BA 1Z05A 3PQKA 2M5WA 4AIHA 2VT2A 4LG0B 2GA2A 2HFHA 1CGPA 1J0RA 3ULQB 1UHWA 4N9HA 2X0LA 5EEHA 2GAUA 3KEOA 3N97A 4M6YA 1IUYA 2HYFA 1LB2A 1TBXA 2RGVA 4IRHA 4E70A 1MJ9A 1B9NA 2P8TA 2ZO4A 2FOKA 3CDHA 4BYYA 3JSOA 1EH6A 2RV8A 1I6XA 4QWQA 4PZJA 3DQVC 1YS6A 3LWFA 5HLHA 4OMZA 1XMAA 2K7LA 1JXSA 1BI2A 4WX9A 3ML6A 3F8BA 1BN5A 3FX3A 3ABUA 4YFXF 3QPHA 4LK0F 1OYIA 1U5TC 1BIBA 4M73A 5J8FA 2MH9A 4RS8A 4M6XA 3KP5A 3C7JA 4RGSA 2EA4A 2EFNA 4G6DA 4EJUA 3DP7A 4Y15A 3SHFA 3M8FA 2FF4A 3I59B 1HW5A 5DUIA 4BHPA 3IRRA 1Z9CA 2P5KA 4RGXA 3I5UA 2J5PA 5HVQC 2Z9OA 5ICCA 2X4HA 1RI7A 1FBSA 2XAFA 1B6AA 2RKHA 3ZMSA 4L9NA 1FSEA 1F5TA 2OQGA 2LDUA 3F23A 2Y0MA 1R58A 4U0VA 3I71A 4P5OA 5BOXA 1P4WA 2JPBA 4KNYA 3E6CC 2HOEA 3ZMDA 2ELHA 3RPUA 3Q5FA 1DUXC 4UVBA 3EQLF 4ZH4F 3QRFF 3HRMA 4BQAA 1BBYA 4LG0A 3M1EA 4YIIA 4G9YA 3RIRA 5FFXA 2A68F 4HOBA 3REOA 3WODF 1WI9A 3F21A 1D5VA 2ESNA 4B09A 1QNTA 1AOYA 4OMYA 3S2WA 2QQ9A 2QZ8A 4KMUX 3K0LA 4XSZF 3FXRA 1ZLJA 4S04A 1TNTA 3QU3A 4EJOA 2G7HA 5BQTA 2FBIA 4UNOA 2AXLA 3BJ6A 4CICA 4Q4ZF 5D4RA 2VBYA 1FSHA 4Y17A 1IXCA 4OIRF 2IPQX 3FXUA 4M9SA 3O2PE 1G3TA 2O6GE 1UB9A 4Q5SF 2FSWA 3EDPA 3F8CA 2V6CA 3GEZA 2GQQA 3WTWC 2A61A 2A6HF 4OU0A 4ENMA 3N4MA 4HX7A 3F72A 4D0PA 2PI0A 2P4WA 4JQFA 3E5XA 4KFCA 3TDUC 4Y13A 3SFZA 4H0EA 4MEYF 2VBXA 5DCMA 3ZMUA 3DV8A 4I7HA 3R4KA 1IAWA 1E17A 4M72A 4KDPA 2HWVA 5E17F 4XRFA 5HDNA 2Y75A 5CVJA 4IHSA 5CYVA 3VB2A 3ZMZA 1L3LA 2KKOA 3ECHA 3H92A 1ON2A 2KIFA 1IRFA 5IT3A 4L0YB 1CF7B 3KZYA 2VOOA 4G7HF 1ZH5A 1R5GA 3WG9A 1T0FA 1SD5A 3LQQA 1D3YA 1ONVA 2FRHA 3RYPA 1FPQA 3W6KB 3DPTA 2XUBA 3KZZA 1SFXA 1FT9A 3KP7A 2V79A 1U5TB 2DI3A 4CO8A 2YPRA 1FYKA 2VN2A 2D45A 3E5QA 2K02A 3RKYA 1H0MA 4BNCA 4RB2C 1Z1DA 4CZZA 3H3ZA 5CVUA 1LQ1A 2EV5A 1RUNA 3H3UA 1SMYF 4O3MA 4M74A 5D8LB 2WTEA 1XSXA 2A5YB 2FA5A 2ZKZA 5LBQA 2STWA 1Y0UA 4EGYA 2A69F 3DKWA 1KQ0A 4OOIA 4A6EA 4KN4X 5HOOA 1T39A 4WXCA 4BAYA 2FNAA 4P9FA 5DV5A 1S8NA 3TO9A 4A2UA 1IW7F 4PGHA 3HHHA 3ISPA 5CLSA 3BOQA 2KJBA 1JHHA 1MKMA 2VBZA 4U0YA 3R0JA 3C18A 3IL2A 1TQPA 4A0ZA 1O7FA 2L02A 1DPRA 1YFHA 2JZYA 1KU7A 2Q2EA 1XSVA 4WWCA 3FMRA 2HKOA 3GZ5A 1L0OC 4PGGA 2DU9A 3G73A 4ZYHA 3DXJF 3RYRA 3WTYC 3HIFA 1TW2A 2F5EA 2V1XA 1CF7A 2CWEA 4EJVA 4UXNA 3FM5A 3SZTA 5ED4A 2PEXA 5LGUA 4UV8A 1YQAA 4HBLA 2A07F 1QBJA 3KETA 2H94A 5L3GA 4YFKF 4MEXF 3Q9VA 3CLOA 3V8JA 1ZG5A 5K5RA 4XBFA 4MTDA 2DK5A 3K9TA 1S7AA 1Q1HA 2CSOA 1U5TA 4RGRA 4HDVA 1IN6A 1SD7A 4M9XA 5L3EA 4CHUA 1S29A 3MZHA 2RQPA 3LA2A 1F4KA 2KIMA 2PQ8A 3QP5A 2OAZA 3HRUA 1DDNA 1USSA 4P55A 3D5LA 5H6RA 2EA2A 1U2WA 3LFKA 5FLXZ 1BM9A 5H20A 3T5XA 2HTSA 5LRSA 2G7UA 1U8RA 2DQLA 5IT9Z 1O7LA 1LJ9A 1YO5C 4JK1X 1IF1A 1ZRFA 1YIOA 2EJRA 1USTA 1Z7UA 1YW7A 4IF4A 2YX4A 2P7CB 4ETSA 1FC3A 4A5NA 5DYMA 1T2KA 3HRTA 5A2QZ 1MZBA 3GFMA 3MCZA 5ICFA 2LKPA 1XCBA 2QENA 1HQCA 2DBBA 3M7GA 5LHGA 3JSPA 4PCQA 4L0ZB 1FYLA 3HSEA 1DP7P 1E2XA 3F3XA 2WV0A 4BHCA 2ZJ2A 1ZGJA 4I09A 3FHZA 1I1SA 4HLXA 5F1RA 1RUOA 5AIQA 3HHGA 4LMYA 4HQEA 4EM1A 5L3BA 3DF8A 1W7PA 4L5JA 3R61A 4HW0A 1XN7A 1ZARA 4HV6A 5JHUA 1TQMA 1ON1A 2MA3A 5ICGA 4IHTA 4A0XA 4L18B 5J8CA 1G3YA 4G7ZF 4UV9A 3QOPA 4IVNA 1ODDA 1NHAA 5FGMA 5CJ9A 1TNSA 2FMYA 2P5VA 3HUGA 4GYGA 3JTGA 3K1NA 1TW3A 1S3JA 1Z6TA 2VE9A 1YG2A 5K5OA 5LRRA 5D6FA 4G94A 5FLXK 2Y48A 2EK5A 1ZAOA 1LDJA 4XLPF 3AAFA 5IT9K 2EV0A 1YW8A 4I02A 3L9FA 2DT5A 5TJJA 3U9GA 1ULYA 4MNUA 5HS9A 1J5YA 5AIPA 2Z5UA 1VTNC 2QVOA 4ENNA 5K1YA 3QPTA 3ELKA 1QGPA 3T0YA 1OYYA 5A2QK 2M8EA 1YTYA 2WWYA 3KE2A 3WTXC 2XAGA 5FD5A 2JSCA 2VC1A 2OQRA 2UXNA 1R23A 2NS0A 5ERIA 2H27A 2GXGA 2DK8A 4CXFA 5D6EA 4ZYGA 2DTRA 1G4DA 1SD6A 3IWFA 4ON0A 3KCCA 3IKTA 3IKVA 2DFIA 2QWWA 1P4XA 1F1ZA 4WK8F 2DPDA 3MWMA 4EV0A 5HLIA 3VODA 3NQOA 1FWZA 3V8LA 5E18F 2ZFWA 2IVMA 3G3ZA 1Z6RA 2CW0F 1BI1A 4ESFA 2STTA 3CJNA 4OIOF 1QZZA 4GYIA 3FXQA 1HW2A 2ETHA 5FO5A 4UVAA 1G6NA 2CYYA 1SMTA 2HYGD 3CTAA 3CO6C 4LFUA 2FE3A 1IN4A 2KJCA 5L3CA 1ZGAA 4JBAA 4U88A 2OZ6A 2FXAA 2W24A 1IN5A 1O57A 3T8TA 1K79A 2EFOA 3FM3A 5AONA 2P7VB 2ZCWA 1K7AA 2HS5A 1OYWA 3RPQA 2QBYB 2FBHA 3HTUA 3I59A 3BWGA 4U7DA 2IRFG 3E6MA 3TGNA 3Q9SA 4R8HA 4LLLA 4EM2A 4P96A 2D1HA 2QUFA 4ESJA 5FD6A 4OIPF 4HV5A 2VC0A 1ZREA 3M9AA 1TTYA 1BC7C 1MD0A 3WU0A 1FNNA 3ZN0A 1IXRC 4KMFA 1FBQA 3R0AA 4A0YA 2HQRA 1KU9A 5CVVA 4IPAA 3FMSA 3ZN1A 3V8KA 4I0AA 2A3SA 3ZMVA 1ZRCA 2XRNA 2BYVE 3HTSB 3TO7A 2ZXJA 1TLHB 2K27A 3U2RA 3J80Z 2CFXA 3V7SA 2V9VA 3CUQC 1GXQA 4FX4A 1O3TA 5ILSA 1JE8A 5HLGA 2QQAA 1YLFA 3F22A 2MH2A 4GGGA 3GFLA 4L5IA 1EH7A 3QAHA 3ZP5A 1XCVA 1A04A 2JPCA 3FMQA 3HOSA 2OZUA 1ZN2A 3HSRA 1J59A 3L7WA 1RIOH 1F9NA 4HX8A 4RB0A 1LDDA 2J5OA 3J7AO 1RZ4A 2LF8A 3MFKA 4QLCU 2HKXA 3F6VA 4ENKA 5BMZA 2AS5F 3E3VA 1STZA 3KLNA 5JR3A 4YFNF 1KQ9A 5BPIA 1GXPA 1V4RA 4IRGA 4LB6B 1HKTA 3TOBA 1PUEE 5TRDA 1H9TA 2P5LC 5E1ZB 4AVPA 5E20A 3L2CA 1LEAA 3E6BA 4I98B 4PDKA 4ZYDA 3RDIA 3JTHA 2MLKA 1D8KA 5J6XA 1IXSB 4LGWA 5LLQA 3GFJA 2JTVA 1HKQA 4KIGA
chains in the Genus database with same CATH superfamily
1QQIA 5KL4A 1LE8B 3GTPJ 3F6HA 2CRGA 1WJ5A 4IX7A 2B9DA 3ZXSA 4BL0B 2L4MA 3DCFA 4Z6YA 4ESBA 3WTSC 2XC7A 2JRMA 2QQ8A 3FDYA 3HB9A 3BR6A 2QQBA 3TOAA 4EVIA 2W7NA 4IS1C 2X1CA 1A1LA 5AE2A 5GAEJ 3VOEA 3AG2H 2ELJA 4FT8A 4KYWA 1UHZA 1FY7A 1SVOA 3SFIA 4I2OA 2XPVA 1UELB 4ZDPA 4TV7A 3ADGA 2K4JA 3PO3J 4XKWA 4MQVA 1ZHFA 4A3MJ 3BROA 1S9HA 3SYTA 1FX7A 1KGSA 4ZYEA 3CO7C 1H88C 4FQGA 1R22A 4A69C 2Z2SB 5ILVA 4QPOA 3A01A 4CGZA 2LKSA 4UB6C 3SXYA 1ITYA 4YIFA 3HYIA 3C3WA 3K4JA 3IC7A 6PAXA 2M1BA 2DSYA 5D5VB 5T6JA 3B02A 2NS7A 5J1UA 3LAJA 2EN2A 3ABLH 5F64A 4DOZA 2E2IJ 3GLXA 3CP2A 4A12A 1RQ0A 5J1YA 2V86A 5LEJA 5FLXC 1V3FA 4I0BA 3R60A 1MJBA 5KL6A 2NVYJ 1H8AC 1HSTA 3C1DA 3J80K 1P2FA 5IT9C 3I56I 1B1BA 2A6TA 2ZNZA 2VQFE 1FOXA 3GF2A 2C6YA 2DMNA 2VT3A 5HDKA 3BJAA 1N3GA 3LNQA 5B5EC 1A1GA 2GBYA 3L1PA 4TUIA 1ZLKA 2NRAC 4F2JC 2JK3A 2EZHA 3EUHC 3H5NA 1PP7U 2NVQJ 1X58A 2KISA 1SFEA 5DDGA 2WY7Q 1X3UA 1HCRA 4LTYA 1GVDA 2OBPA 4MO7A 1SR9A 3HOVJ 1B59A 2V1DA 1JTYA 2BV6A 3A02A 1OMIA 5JI6A 3FBIB 2RS7A 2VF1A 3JTZA 3QU6A 3GXOA 2H09A 2CUFA 3K4NA 3GFIA 5E8GA 3EPLA 2HXOA 2OUMA 1IDZA 5A2QC 1IBME 2DAOA 5HS7A 2LH9A 4A93J 4ZZDA 4DYQA 1J9IA 1XNQE 5K7ZA 2XIGA 3H9GA 3F6OA 4RLFA 5FKMA 4FK5C 5F3WA 1Z7LA 2A5WA 1VQ7I 3ZPLA 2R7ZJ 1X5WA 4AM3A 1HKSA 4A6DA 3P9KA 3E5UA 2WADA 2NYXA 2VL8A 1C0WA 5LHIA 1MNDA 4U87A 4UUSB 4B48A 1ZBTA 1E3PA 2ECBA 1AH5A 5B3SH 1T0FC 2IGOA 4KN7X 2COMA 3EUAA 1I3AA 3L00A 2EB7A 3PQJA 1R5ID 2YZTA 2YU5A 1V5GA 1X19A 3HEFA 2VKVA 4BXUA 5CVRA 4IHXA 3CCQI 1R5HA 1IV8A 3LSRA 3MKWB 4EGZA 1G3SA 2K4VA 4WSGA 1R1UA 4JYKA 2LLKA 2F4IA 1YJWI 1WRJA 5D5WB 5DD8A 3DEUA 2DW4A 2K86A 3AG1H 4Q47A 2HQNA 2DJIA 1YYOA 1ENHA 2M0CA 3TDZC 3WE2A 1XMKA 1U8BA 2VPLA 2EM2A 1BB8A 4FX0A 2VB6A 1OR7A 2EOIA 3O6BB 1LNWA 2D2WA 2LBFB 4B8XA 2DJNA 4G7OF 2H6CA 5HODA 3EYYA 2DYRH 1YI2I 4GO1A 4IKFA 5FRNA 1T08B 1MMSA 2JYAA 3LA3A 4RB3C 1OCPA 3ERED 1WI3A 2YX7A 3BCAA 4NC7A 2CQKA 4MTEA 2R7TA 2V9KA 4DBRA 1R7JA 4CDGA 4YIRX 3WGHA 1A31A 1DU6A 1N32E 4M3FA 1IN7A 3BTJA 3P9CA 1ZG3A 2UXDE 2DPUA 2Q8KA 3I0TA 2EOHA 1DP3A 2YTPA 3CMEI 3U21A 3E97A 2OA4A 2V6EA 1JHFA 1KU3A 1P4AA 1VQOI 4M6VA 4IQ4A 2EPXA 2FEZA 3ROUA 3G71I 3ZGKA 2HI3A 4K2EA 1DPUA 1RPWA 2LNBA 4Y4RA 1YUJA 3H35A 4NQWA 4DYCA 2QYOA 3I4MJ 4QPQA 4DR1E 4DV7E 5F04A 3V7CA 4F9AB 5H2FC 2GXAA 1BBGA 2MC3A 2MBFA 3I54A 5B66C 3HOUJ 4AYBN 2GM4A 4DBQA 4O5VA 3DLAA 3S3NA 2UUCE 2VXZA 1W4MA 3ABMH 4XM3A 2JUCA 3S1RJ 1P92A 4KIFA 4DQ2A 4EJWA 2VBWA 2B7EA 2O8KA 2VOPA 3SQNA 2K9NA 2EM8A 4DNCA 3PUFA 2MD5A 1IO2A 1A1KA 4L9TA 1BR4A 1MJAA 1R00A 3HZJA 2L54A 3THNA 2MC5A 2LCEA 2CQQA 3FK6A 4E7KA 2XAJA 3BR3A 1EJ9A 5GP9A 2L9NA 2EN8A 3WTTC 1E3OC 4EJTA 2PMHA 3FXMA 2JVGA 5ILUA 2WBSA 2ZMEC 1CQTA 1X1DA 2MSYA 1XDSA 2DA6A 2F5DA 4YY3E 5KAFC 5LEKA 4X8WA 3OS0A 3ZR8X 2GWRA 4DKKA 4M71A 3SZPA 2GIVA 1YIJI 2DODA 3ZQ7A 3WTUC 4B3ME 3GMEA 4XL9A 2XROA 2DLQA 1WCMJ 1N36E 2EL6A 5E8IA 2WCC3 4Y3OA 4KIBA 1ZKGA 1PDNC 1FOKA 3I58A 1OPCA 5C44J 3EPHA 1W5TA 3CUQB 2HC5A 4MGRA 3C4BA 1WKMA 3QYBA 4NC8A 2PJPA 1FTTA 1LEBA 5E1WA 3OV8A 1K6OA 4P9UA 1BW5A 1SC7A 2BEOA 3GTKJ 2IS2A 5ADZA 2RN7A 2OCEA 4XLNF 3THOB 2EPRA 4WF2A 3QQAA 1XSDA 2YT4A 1JKOC 5DD4A 1MBGA 1Z21A 2E1NA 2L3CA 1U6GA 2E7XA 3Q0WA 4O6JA 5J3LA 2YS9A 4XSXF 4I99C 4LIUA 4MIMA 3V4GA 1NCSA 4S05A 1A6IA 5DS9A 3TKYA 1A35A 3DU6A 2EPUA 4CYDA 2NUGA 3C4TA 1OISA 2A6EF 2IBDA 2EMCA 1W7PD 3ZQLA 2EMXA 3AV0A 2DMTA 3JCUC 3BPVA 1U78A 1O3RA 4R2EA 1JGSA 2EL5A 3RKQA 4FE7A 5IYDJ 3VHTB 4ENJA 3E1SA 4BBSJ 4NUBA 2DYSH 2LD5A 2CGPA 3BPXA 3JREA 1QZYA 2K3FA 3VYRB 2I13A 3I64A 5GAGJ 4UUSA 2EOMA 1TQIA 4M3BA 2EMYA 2EPKX 2VJJA 2D5VA 4LLGF 3J7AY 5GADJ 2AHQA 2DLLA 3OYIA 4DV0E 2MABA 3M07A 4OWRB 2AQEA 3DTEA 2EZKA 2GOXB 5KL5A 1R49A 2F2EA 2E1CA 4KT6A 3WTZA 2KZVA 5IP6A 2EV6A 1LVAA 1T6SA 2ZSHB 3DPLC 3C6KA 3MD2A 3KEQA 3H0DA 3KLOA 3S16J 2BVLA 1BR1A 4V2GA 4V2FA 2V85A 1UCRA 2YTIA 5EZHA 3BP8A 4JI5E 5FB2A 1I27A 2ZJRF 2LBFA 3BZ6A 4KWYA 4N9IA 1KJKA 4ANJA 2L0KA 2M3AA 3RCOA 3BZCA 1VQNI 3DFGA 2PFBA 2H8WA 5F1JA 3OYCA 4OX9E 2JOXA 4PJJA 1TL8A 2XF6A 3GO5A 3LSIA 2DMUA 4R2RA 3VEPA 2NNYA 3HOWJ 1U0JA 2DT6A 1GHCA 3I4NJ 3HSFA 5J47A 4BJ6C 1EV7A 2EWNA 1PJTA 2RVCA 2YU3A 4IJAA 5A6KA 1YYWA 5TISC 4JOMA 4IRIA 2K4BA 2E7WA 2HJJA 3DJWA 3KZIC 2HDCA 1YRNB 5E3MA 2VRDA 2W00A 1WXRA 3K2ZA 3LSTA 3RTRA 1BC8C 1WHQA 2HQAA 1N75A 5TGTA 4G12A 3CC7I 4E7JA 1R36A 2JR1A 2P6SA 4LF4E 4EQQA 2XPUA 2YU8A 2PN6A 4OIQF 4HYEA 1BIAA 2MYSA 3E6DA 1VZ0A 3GX4X 1XGMA 2DFHA 4HQMA 2JVHA 3ABTA 3F8MA 3GBGA 4C3HJ 2EMHA 2ZNYA 3HM5A 2JT1A 2OCCH 2FNPA 4AU7A 2HQ5A 5K5QA 1EH8A 2LTPA 4HPQA 3AG3H 2G0EA 5IY5H 2UWMA 2KDOA 1NK2P 1D1CA 3OIOA 4NHJA 2FMLA 2YWQA 2ESHA 3OYBA 1MEYC 2QKMB 3H5RA 4I76A 1YOVB 5FFZA 5CKTA 1YW9A 5D8KB 1OCTC 1IZ1A 3MZYA 2W48A 2CV1A 3VK6A 4FISA 5C4JJ 3P1XA 2LVSA 3DTIA 3KP4A 4R79A 2XVCA 4BE0A 1XPXA 2KRCA 4WCGA 4FASD 2E2JJ 2BXZA 3HKZA 2JVAA 4II2A 2EFWA 2HDDA 3VDXA 5DCMB 5F27A 1VQKI 3EYIA 3RPUD 5D5XB 3O3KA 1R4NB 4AIJA 2X1EA 3KP2A 1S72I 5HS8A 1XB4A 2Y0SN 3K4KA 3CUQA 2RAEA 2KMUA 1ETOA 2KIQA 2W85A 1SVMA 2LY1A 1PYVA 4LK1F 5KVRA 4CYCB 3W2WA 2F5VA 2D1VA 2KT0A 1WJCA 4F3QA 3BG6A 3IAS2 2K7IA 1ETKA 3TQNA 2EE8A 4UUVA 1PDAA 4HF0A 2UZKA 4J8ZA 1REPC 3MEXA 4I01A 4HAMA 4XLHA 5F6FA 5M5YJ 5EDNA 2EOZA 3ZOQB 1XDUA 2IW5A 3Q0UA 4CUGA 5CVIA 5D5UB 4A5MA 2LRSA 2LK2A 1D8JA 3K6GA 2PMUA 3K7AJ 2RNJA 1HDDC 2V1UA 5BS6A 4L9JA 3ECOA 3PNYA 2I9IA 4XN0A 2HHHE 3LL7A 2X85A 1GQEA 3KP3A 4GCVA 4R1HA 1TWAJ 1TWCJ 4RAZA 1LPQA 1YX5A 5FKOA 3DLLF 2HR3A 1RNLA 1OCOH 2EPCA 2M30A 4DR5E 2NA2A 3BG9A 4JI7E 1TC3C 1JGGA 2I5UA 4KJZA 1HXDA 2UXXA 4Z2YA 3HOXJ 3TO6A 4X62E 4U0WA 2M4GA 4CZCA 1KQ8A 1B9MA 2JA2A 1EA3A 2KONA 1SFOJ 1H9GA 5B1AH 2HXIA 3OOPA 1JK2A 4UB8C 4DV2E 2Y30A 1Z91A 4B43A 2ID6A 3J80C 1K4TA 3L09A 1UFMA 4X9JA 4RGUA 2QSGX 3LQRA 4IXAA 1JUPA 2R7DA 2RREA 3RMPA 1X2NA 2DMYA 2TCTA 5AE3A 1MH4A 2FBKA 4HX4A 4HF1A 2FJ1A 2HZDA 4DR3E 1OJLA 2DQRA 4JI3E 1Y1WJ 4R2PA 3HPGA 3ZQGA 2FU4A 2D9HA 4WXHA 2WB1A 3HDDA 2XB5A 2EOSA 1YS7A 3P7NA 4IEJA 4A3JJ 4Y52J 2ACJA 2Q0OA 2GXBA 2VQLA 2ZC2A 2HEOA 3HRSA 2XAQA 2M9AA 4MLVA 4DYRA 1I50J 1LDKB 4JI2E 2MKDA 2L8TA 4B3XA 1SFUA 3CDLA 2R92J 2R4GA 1Z3YA 1ORKA 2K5CA 2MD0A 1KONA 2L33A 3LOCA 2XF5A 1T4OA 1X6FA 4AQYE 2ADUA 3FK7A 4JP0A 1P6RA 2M45A 4BH9A 2ISZA 2LYCA 2EPPA 1FIPA 2K9LA 4LD5A 3W2AA 2F4VE 1QPMA 2ZMEB 4XKVA 5DUKA 1K61A 4Q48A 3FZVA 4ZTFA 3RZOJ 1B4AA 1NG6A 3I55I 3PFIA 1T38A 3EPKA 4R2QA 1IRGA 1D0XA 3ASOH 4KICA 4A3DJ 1HF0A 1QA6A 2VONA 1T98A 3OS1A 2O61A 4JX4A 3UNGC 2LRDA 2DLKA 2V83A 2HGCA 3VYUB 3MQ0A 4KISA 3SEZA 2L9SA 2RNGA 1AAYA 1WJDA 1RC7A 2EN7A 1HW1A 3K69A 3JW4A 1ZYRF 3KFWX 4PK4A 2Q2EB 3QPSA 4CCOA 3K4MA 2KIUA 4OAYA 3MKZA 2LREA 3GYHX 4E7IA 2BGCA 3EUHA 2XV4S 3FIWA 3GVAA 2FQ3A 1IJWC 3W3CA 1N25A 4JYAE 1J2XA 3NEUA 2ENAA 2LSOA 2N3HA 5IYBJ 2ENHA 2BY2A 2HDWA 4PJMA 3GW2A 2F5FA 2R3SA 3RQ4A 2JQ7A 2TDXA 5EEGA 2WAEA 3BQZA 2BBYA 2R7XA 3S32A 2F4OB 2O0YA 2XKOA 1BOAA 1BJAA 4BHBA 1KA8A 2ODRD 1SD4A 4KA4A 4BKXA 1JTXA 1IN8A 2M87A 3CDIA 1DGRM 3BY6A 3SDGA 3G2BA 2Z33A 2NS8A 3JRIA 3G1OA 4J01A 1AWCA 3WU1B 4NNJA 1D0YA 1KYZA 4L5NC 5TSEA 1X1CA 3VYSB 1FYMA 4P78A 2QKLB 3COAC 3TQMA 3J81Z 2EMLA 2R5YB 4IZZA 1VQ8I 2MGQA 2KRFA 1R4MB 2ADRA 3CJTB 3ERMA 4FETA 3NRVA 3W6VA 4XICA 3IH3A 2IA1A 3BGHA 4XLCA 3RI4A 2DO7A 3V7RA 3D0SA 1TWFJ 4B44A 3IUOA 3S1QJ 3ZOBA 2BOLA 1K78B 3G1LA 4XLAA 4HLYA 2OTLI 3RKXA 2WAQA 3ESWB 3JRAA 3HOTA 2L7FP 4BY7J 2Q1ZB 2BY0A 4LU9A 4AWXB 2O7OA 2M7BA 2MKNA 5D4SA 2YRKA 2PJRB 2HZTA 2ME6A 2L3JA 3T8RA 3EQ1A 1YYVA 1LFBA 2WBUA 4P1WA 3W2VA 4AUXA 5H6QA 2L01A 3QYEA 5JLXA 5KL3A 4I8OA 2UV1A 3IRQA 4G6QA 5IYCJ 1I5ZA 2BVMA 4R03A 1X49A 2E60A 2CO5A 2NOJB 2CU7A 2PG4A 1SAXA 1IQSA 3BTIA 2EM0A 4LG3A 2XGXA 3RJPA 5JHFA 4XQFA 2V26A 4BACA 5M3FJ 1HC8A 2QBYA 2LV2A 1G3WA 5IPAA 1MDMB 2EMKA 2LF7A 1HSJA 2X48A 3GZ6A 1O4XA 5DCFA 3IHUA 3QWLA 2LFBA 4XRMA 2E34A 1K4SA 1DGWY 2GA1A 1Z1BA 2JJ7A 4OOGC 3K6QA 1QO0D 4Q28A 4ASNA 3I53A 4XLEA 3B73A 4R2CA 2KFDA 2CUJA 4O43A 2XGDA 2JRTA 3U1DA 1Z77A 3S93A 4N4RB 2QGUA 1KYWA 2KL4A 4K0KE 3R6SA 1T56A 3WHCA 1ZR9A 1X4PA 4F6NA 1T33A 2O5RA 2R1FA 4GEQB 2EOXA 2YPNA 3OWTA 5FJ8J 1U3EM 3G4SI 1JJ6C 3CUOA 2LUQA 2BW3B 1MIJA 3CCJI 1VQMI 2Y69H 4EM0B 2L4AA 5DEQA 2ZB9A 4BGDA 2R7FA 3F8FA 1GV2A 3LA7A 1HNXE 2ZMEA 3BZKA 5M5XJ 1IMUA 1A6QA 3ZQIA 3H09A 2X6WA 3ZCOA 2RDPA 5HDGA 5KK1A 2EQRA 3CCEI 3I4PA 3QG5C 3K1MA 1DI2A 4FE4A 2PX9A 1ZRDA 4LITA 2O03A 5EGOB 2EN1A 3WU2C 1A5JA 2VI6A 2LJUA 3OYAA 3JAMZ 3IP4B 3L2UA 1BA5A 1FP2A 2I10A 1XGSA 3BLYA 3DKXA 2V4JC 2VLAA 3VPRA 4E7ZA 1G2FC 3OL3A 2NOGA 2ZBKA 3BJOA 2L5QA 3GUDA 1UN6B 2GZWA 2IGKA 4HZFA 2VUMJ 1BI0A 2VE8A 4D5FA 2M7QA 2ISYA 3EPJA 1HR0E 2JSPA 1J75A 2M8GX 2E2HJ 2OD5A 4KHPE 4KUMA 1WQ2A 1OKRA 1O3QA 2L3DA 2Z99A 1ZBQA 2YSRA 1P7JA 1AKHB 2F8BA 4U7BA 2WC2A 4DV3E 3OR2C 4C30A 2MLGA 4MQ9F 4D9JA 5JFRA 3J81K 1J5EE 4BQOA 5BPDA 3TP3A 1HNZE 1I1GA 1X2MA 2EPFA 4QSHA 2B0LA 2V7FA 1PP8F 5JVTA 4JX6A 2F5CA 3K70D 3S2DJ 1IQOA 5ICEA 4R8OA 4L9VA 2EMWA 2ODRC 3WGGA 2IT0A 1W7PB 1B8IA 2KHXA 2NUEA 2NNNA 1S6LA 1JT0A 1W36D 1YX3A 1ACIA 2W25A 4GXOA 4R2DA 2QF7A 3GWZA 2R5YA 2IP2A 3WTVC 2ELYA 4A3LJ 1FOYA 2O8XA 1FLIA 1FBUA 4X64E 1AA7A 2EPOA 2KZGA 1ETXA 3BDDA 2IA2A 3OYNA 1IG7A 2RC4A 4F9CB 4LB5A 1WFXA 1AHDP 4KITB 2XAHA 1MMGA 4HF2A 4F54A 2OU2A 3DBHB 1FP1D 1K78A 2JXPA 3OYMA 2WV1A 3P9IA 2YU9J 4RAYA 4WXDA 3VSLA 1GVJA 2XB0X 5LHHA 1XGOA 2E1MC 3S3OA 2PLYA 1KU2A 2BY3A 5E1XA 4NB5A 4LLNA 2BXYA 2PMZN 3HUGB 2QM3A 1RRJA 3O8GA 3ZQHA 4D7NA 5HNFA 1MBKA 4AD9A 1FZPB 2P6TA 2QLZA 3HGGA 3ZMTA 2IA0A 1R1TA 2IJLA 3RKWA 3FF5A 2G9WA 4F7ZA 4ZTJA 3M8EA 4MLOA 2Z3YA 2HTJA 1WSUA 1J7KA 2EZLA 2O3FA 1MDMA 2QSFX 3K1PA 1HBXG 1UHMA 4LFBE 5KL7A 1S7OA 2NAZA 5FKNA 5LD2C 1LE8A 3GCMA 2EFQA 4LJZF 2BE5F 4HA8A 3W6JB 5LGTA 2ELZA 1Y39A 3LFUA 5DNYA 1JK1A 3CZ6A 4RB1A 4JI6E 2EP3A 5LGNA 4YG2F 4AIKA 2B7VA 4C2TA 4DR6E 1W5SA 3WGIA 5E3NA 2EM4A 2NVUB 4HDUA 2R7UA 4MHGA 2H6BA 3MKLA 4OINF 1WWXA 4B3RE 3KP6A 4NDLA 1O3SA 2V87A 1MBJA 4IHWA 4DR2E 1BI3A 2DDBA 2W84A 5DM6F 5DTDA 3L2QA 3TW6A 2PBIA 1SAUA 1XD7A 4BUPA 4M9ZA 1PUFB 2K9MA 4IHYA 3MAJA 4B3AA 1X1BA 2XHKA 4EMSA 4UVCA 3PNTA 1V5FA 3JAMK 5L3FA 5A6BA 4RA2A 3LAPA 5C4XJ 1FOWA 3IWZA 3JRCA 9ANTA 3N05A 1ZG1A 2EM5A 2CG4A 2XASA 4KT5C 2CQ7A 2EL4A 2QA4I 2CT1A 1XGNA 2VODA 3KPHA 3WE3A 3OYJA 2EFPA 2JA5J 1MGTA 2XKPA 3F8NA 3GTMJ 4UHTA 3U1KA 2JWOA 3VFZA 4FHTA 1R1VA 2IXSA 3EETA 3PFYA 2DA1A 4G8XA 3FWEA 2CV0A 3QP6A 3T1BA 2EM6A 5L3DA 1QU3A 2YR2A 2W57A 3J7ZI 4ZZLA 4N0BA 1Z05A 3PQKA 2IS1A 2M5WA 3MKYB 1F43A 4AIHA 4I6ZA 2VT2A 5J40A 4LG0B 2L2NA 1GTKA 1FMWA 4XRSA 3PJRA 2GA2A 2HFHA 2E35A 3WHBA 1UG0A 4BDZA 1CGPA 1QHGA 1AKHA 2Q8UA 1J0RA 4AYBA 3ULQB 3CCUI 1UHWA 1AU7A 4N9HA 5GTIC 2MFZA 4R2SA 2X0LA 3FHNA 5EEHA 2GAUA 3KEOA 1UAAA 4ABZA 4DV5E 3E0JB 2IAIA 5IOZA 3N97A 3C2HA 4M6YA 3OYLA 3JU0A 2W4SA 4DGWB 4DZJA 3OYKA 4FTHA 2UUBE 1IUYA 2HYFA 1LB2A 3ONQA 1TZLA 3LSHA 4BJTA 1TBXA 3K70C 3S2HJ 2CUZA 2RGVA 4IRHA 4E70A 4M9VC 1MJ9A 3BG7A 3OYFA 1B9NA 4PSWA 3TEDA 2TRTA 2P8TA 3ADLA 2ZO4A 2LO3A 2R7OA 3BCBA 2LTRA 2FOKA 3CDHA 4BYYA 2PRTA 3JSOA 1EH6A 2RV8A 1I6XA 1M1EB 4QWQA 5HLTA 4HEA2 4PZJA 4XMYA 3DQVC 1YS6A 3LWFA 5HLHA 2FGGA 1XMOE 2UU9E 4OMZA 2LKXA 1XMAA 2K7LA 1JXSA 2H36X 1BI2A 1ZR2A 4NC6A 4F6MA 4WX9A 3ML6A 3F8BA 1BN5A 2FD5A 4CSWA 2N3GA 3FX3A 3ABUA 4YFXF 4X6AJ 3QPLA 3FISA 3QPHA 4LK0F 1OYIA 1OCCH 2V1NA 1GDTA 1U5TC 1BIBA 3K2AA 1W0TA 4M73A 3CCRI 2JA7J 5J8FA 4WPYA 4MFDA 4AIDA 3S1MJ 4WFTA 2MH9A 1TP4A 1RKTA 4RS8A 4LFCE 4M6XA 2VKEA 2FOWA 3L2VA 3D5RC 3KP5A 3C7JA 4RGSA 3CC2I 3AKZA 2EA4A 2EPLX 1OQYA 1TWHJ 1OR7C 1MBFA 3I3LA 4MLQA 3ADIA 2EFNA 2DMQA 4G6DA 3OL4A 3PIPF 2KDZA 3RZDJ 4PFOA 1QPIA 4DW6A 4EJUA 2YTNA 3DP7A 2GHFA 4Y15A 1WHUA 3SHFA 3M8FA 1YE9A 2FF4A 3I59B 1HW5A 5DUIA 2Z1DA 4BHPA 3IRRA 1LFUP 2DFEA 2ICWG 3G6EI 2L9RA 3AFHA 4E4HA 2YTDA 2LY2A 2V9PA 1Z9CA 2EIMH 2P5KA 4M30A 4DUYE 1UILA 2DGCA 3NWTA 2YRHA 4RGXA 3CLQA 3LMLA 3I5UA 2J5PA 5HVQC 2Z9OA 2Y9YA 5ICCA 2X4HA 3I9V2 1RI7A 2DOAA 1FBSA 2XAFA 1X47A 2VXDA 1A1FA 3BR1A 1B6AA 2RKHA 4JX5A 3ZMSA 2MDGA 4DR4E 2E1OA 4L9NA 1FSEA 3HG9A 2OQGA 2LDUA 3F23A 1F5TA 1PJSA 3GTQJ 1PVEA 2Y0MA 1R58A 4U0VA 3I71A 4P5OA 5BOXA 3CCVI 1GT0C 4F9BB 2DT7B 4BQNA 1P4WA 4E7LA 2XGCA 2JPBA 4KNYA 3HOYJ 2WZOA 2LC2A 3E6CC 3NAUA 1MSFC 3C6MA 2P81A 1WJFA 2HOEA 3ZMDA 4DV1E 2KHMA 1LUJB 1PKPA 1DQ3A 2ZJPF 2VE7C 4N4NB 2ELHA 3OS2A 3RPUA 1YPNA 2RQLA 3H9QA 3Q5FA 4RBOA 3BTLA 1DUXC 4UVBA 2EM3A 1FJGE 2LBSB 1N33E 3EQLF 3D5SC 4ZH4F 5CQGA 1HLVA 3HOZJ 2EN6A 2CS3A 4ZC3A 1FKAE 1JKRC 3QRFF 2OJED 3HRMA 4BQAA 3DBLB 1BBYA 2K3PA 4LG0A 2R7RA 3CF2A 3M1EA 4YIIA 3GZNB 3JRBA 4G9YA 3RIRA 3HXLA 1IGNA 5FFXA 2EINH 2EILH 2A68F 4C2MJ 3OYEA 1V5EA 4HOBA 2HGHA 3REOA 3O8HA 3WODF 1WI9A 2EPNA 3SZGA 3F21A 4CCNA 1ETQA 4CCJA 1N78A 1D5VA 1DGCA 4JI8E 2EPZA 3FIGA 2X1DA 2ESNA 5KCMA 4B09A 4GZNC 2AXTC 4DIQA 3MN2A 3B6AA 1T4LB 1QNTA 1AOYA 4HRIA 4A3GJ 2IS4A 1YYKA 1QRYA 5GPCA 2E1MB 2EMBA 4RH8A 4HG2A 4OMYA 1TF3A 2HNHA 3S2WA 2CQXA 2QQ9A 1B72B 5AASA 1ZK8A 1A1JA 2QZ8A 4KMUX 1EKEA 3K0LA 2M4KA 4XSZF 4KFCA 3FXRA 1ZLJA 4S0HB 4S04A 2Y0SA 1TNTA 3QU3A 4EJOA 2G7HA 4IJDA 3CJRB 3VYXA 4NHRA 3CMAI 3A0BC 2ZM6E 1VQLI 5LMUE 5BQTA 2DCEA 2FBIA 1VI0A 4UNOA 2AXLA 4RMNA 1HA8A 3H36A 2QCOA 3BJ6A 5KNLA 5BNGA 4CICA 1XG1A 4ZYAA 4Q4ZF 5D4RA 2VBYA 2R0QC 1S7EA 1FSHA 1Y8RB 2ZXWH 1LVKA 2L7ZA 2A05A 2EBIA 4Y17A 2CJJA 1Q1VA 3K4LA 1IXCA 2ECCA 3J81C 4OIRF 4M2ZA 1UZCA 1BW6A 2IPQX 2QSHX 3FXUA 4M9SA 3IWCA 3BTCA 3O2PE 5F0HA 3PO2J 1JI8A 2EN4A 1G3TA 4B47A 2O6GE 4LF9E 1UB9A 2LMZA 1YRNA 2EMGA 1FMVA 1X1PA 4HSTA 3EPZA 3QODA 1W0UA 1Y56A 1E0EA 4Q5SF 4XOPA 3BR5A 2DMIA 1WGXA 2FSWA 3EDPA 3F8CA 3OOUA 1YJNI 3LLHA 2V6CA 2DTZA 2Z16A 3GEZA 3H9JA 1JJ8C 2GQQA 2EPMX 1IBLE 1T4NA 3JRHA 3Q3SA 2XGEA 3UKGA 1GZ6A 1MMAA 3WTWC 4Q35B 3KWRA 3KYDB 3X2QH 2A61A 2A6HF 3IH4A 4OU0A 1TN9A 2R7WA 1VFCA 5EEAA 4ENMA 2EOEA 2GIZA 3N4MA 1BBOA 4HX7A 5CPRB 3F72A 4D0PA 2PI0A 2P4WA 1W1WE 4JQFA 2NUFA 4EATA 4PSXA 2BB8A 2VQHA 2F48A 3DPUA 1ETWA 3E5XA 4YEJA 1UHSA 3TDUC 3OY9A 3JRDA 4J19A 4Y13A 3SFZA 4H0EA 2LTSA 4MEYF 2VBXA 4XNFA 5DCMA 3ZMUA 3DV8A 3F6GA 3BQYA 1TF6A 4XKBA 3SJMA 1IRZA 4I7HA 2EM7A 2OV7A 3M4OJ 1NH3A 3R4KA 4XN3A 4BDYA 1IAWA 1E17A 4M72A 4KDPA 4W97A 2HWVA 2NABA 1MBEA 2LJHA 5E17F 3BR0A 2DN0A 4PJLA 4XRFA 5HDNA 1FJLA 1OCRH 2Y75A 4CYCA 5CVJA 2DFFA 4IHSA 3PL8A 2XDVA 5CYVA 1STUA 4M0VA 1IDYA 3VB2A 2X51A 3ZMZA 3MHSC 1N77A 1L3LA 5DM7F 2KKOA 1POGA 3ECHA 1LFPA 3H92A 1LKXA 1YSAC 1ON2A 2KIFA 1IRFA 3K10A 1B69A 2L7MP 1TWGJ 2FUG2 4XORA 5IT3A 4IQJA 4L0YB 4G6TB 1CF7B 3HQ1A 3KZYA 2VOOA 1J26A 1ZQ3P 2HU9A 4G7HF 2WY8Q 1ZH5A 1R5GA 2XSDC 3BBGA 3CJQB 1UG2A 5E3LA 3CESA 3WG9A 2H8RA 1T0FA 5AE1A 3QOEA 2DIXA 1SD5A 3LQQA 1QVTA 3CQZJ 1P7IA 1D3YA 1ONVA 3A4CA 3RSNA 2KOUA 2FRHA 3RYPA 1MNMC 2R7VA 1O0WA 2YTFA 2E5ZA 3WG7H 1FPQA 4HNTA 2W82A 2NVTJ 3W6KB 5IP7J 2K85A 2DA5A 3DPTA 4QIWN 2XUBA 3KZZA 2VQCA 4IHVA 4YELA 4W1UA 1R9TJ 3FXKA 3JAMC 4A3EJ 3LSPA 1SFXA 1FT9A 4EEFG 1Z0XA 3KP7A 3QYFA 2E1MA 2JWTA 3C2GA 1JUMA 3GTOJ 2VQEE 2V79A 3M1CA 1XTAA 1U5TB 2DI3A 4B4CA 4DMIA 1YUIA 2R5ZB 2EPAA 3VWBA 1ETYA 4CO8A 4C9YA 2YPRA 2OC6A 4II3A 1FYKA 2L9VA 2VN2A 4F92B 2D45A 1D5YA 1X48A 3E5QA 3BG5A 4O5GA 2K02A 3RKYA 1H0MA 4BNCA 4RB2C 1Z1DA 4O4KA 4CZZA 3H3ZA 5CVUA 1D1AA 3DTKA 4P7DA 5LMNE 3KYCB 2E19A 1LQ1A 2EORA 2EV5A 1RUNA 5C3EJ 4Y33A 4IO9F 1Y8QB 2AQFA 1G2HA 3H3UA 5K7HA 2R93J 1BL0A 1SMYF 4O3MA 2JPAA 4NZVA 2X6XA 4E6KG 4M74A 2L6MA 3DU5A 2BHZA 4DV4E 2J7JA 2XPWA 5CFFE 5D8LB 4M3DA 5GTHC 3J7Yp 2WTEA 4A3BJ 2UUZA 1XSXA 2A5YB 2FA5A 4HEIA 2ZSIB 4XLFA 2ZKZA 5LBQA 2STWA 1Y0UA 1SFKA 3Q0VA 3E7LA 2I8DA 2ZJQF 4EGYA 2A69F 3ZRGA 3FXLA 4GKJE 4A3FJ 1JUSA 3DKWA 3S17J 4F52A 1KQ0A 2HVSA 3BIDA 4OOIA 4A6EA 5KL2A 3CCYA 4KN4X 5HOOA 1T39A 4WXCA 4BAYA 5HNHA 2R7SA 2EMZA 1MSEC 2N8XA 2FNAA 4P9FA 5DV5A 1S8NA 3TO9A 2GLIA 4A2UA 1X4OA 2DXIA 4M3GA 5EZGA 3MHHC 1IW7F 5A6AA 2HVQA 4PGHA 3VYTB 4F93B 4X1EA 3HHHA 3ISPA 5CLSA 4BE2A 3BOQA 2KJBA 5FKKA 1JHHA 1MKMA 1Y0NA 2VBZA 2VKHA 4U0YA 3SEQA 4LF5E 3R0JA 3C18A 2RS6A 3GTGJ 3IL2A 1TQPA 4A0ZA 1O7FA 3KEYA 1S5LC 2L02A 1DPRA 2ELKA 1YFHA 2JZYA 4GRIA 4XR6A 4BEHB 1KU7A 1IBKE 2RSMA 3TP0A 1X6HA 2Q2EA 1VNDA 5IOYA 4F55A 5J4VA 1XSVA 4WWCA 2EOOA 3IV5A 3L2RA 3FMRA 2HKOA 3GZ5A 1L0OC 3EUKL 4PGGA 2DU9A 2EQ3A 1X3WB 2DOFA 2KLOA 3AL0B 3UR3C 4E7SA 2A25A 3G73A 1WVRA 3FKJA 2EZ6A 4ZYHA 3C2BA 5IWAE 1XX5A 3IWBA 3DXJF 2CMPA 3RYRA 1XNRE 3WTYC 3A1YA 3HIFA 1TW2A 2F5EA 3LMMA 2V1XA 1CF7A 1R71A 2CWEA 5F08A 4RAGA 4EJVA 4UXNA 1X6EA 3FM5A 3SZTA 5ED4A 2CW8A 2PEXA 2O9LA 5LGUA 4XIDA 4UV8A 1YQAA 3M8JA 1WH5A 4HBLA 2RTXA 2A07F 1QBJA 3KETA 2EWLA 4M3EA 4XKCA 2LE2A 2H94A 5L3GA 4YFKF 1YJ9I 4MEXF 3KIOA 3Q9VA 1RR7A 3CLOA 4V19K 3V8JA 1ZG5A 2KQRA 5K5RA 4JI4E 2DDAA 4XBFA 1D1BA 3K9TA 2DK5A 4MTDA 2PJRA 1S7AA 4QTRA 1V54H 2EOJA 2YTGA 4UY8I 1Q1HA 2CSOA 2JN6A 1VQ5I 4TUGA 2DRPA 1U5TA 4RGRA 4FCYA 3J7YJ 4HDVA 2HOAA 1IN6A 2L7KA 2R5ZA 1SD7A 4M9XA 3JRGA 5L3EA 2V89A 5FKLA 4CHUA 1S29A 2FQ4A 3MZHA 1KYQA 1MBHA 1NG7A 2ME0A 1X3ZB 2RQPA 3LA2A 1F4KA 1UBDC 2KIMA 2VQGA 2PQ8A 3QP5A 2OAZA 3HRUA 4L8NA 3PUBA 1IV6A 2HPIA 3G1MA 1DDNA 2OTJI 2IGMA 1USSA 3OMYA 3PIOF 1I6HJ 4P55A 1TT5B 3D5LA 3DEWA 2EA2A 1RC9A 1U2WA 5H6RA 1ERDA 3PNVA 3OYGA 3LFKA 5FLXZ 1BM9A 1GLNA 4NBQA 5H20A 4PJ0C 3T5XA 2HTSA 5LRSA 4X66E 1DQUA 2G7UA 1U8RA 2DQLA 1JKQC 5IT9Z 2EQ0A 2EM9A 1O7LA 1LJ9A 1DU0A 5AC4A 1SANA 1YO5C 4JK1X 3T1HE 1IF1A 3JR9A 1ZRFA 5F0CA 3KX2A 1YIOA 2EJRA 4RM2A 4NXNE 4CA0A 2DA2A 1YHQI 1USTA 1Z7UA 2OPTA 2EMAA 1YW7A 4IF4A 3FBNB 4LF7E 2YX4A 2BW3A 3A2KA 2P7CB 2E5NA 4ETSA 3GTLJ 1FC3A 4A5NA 2YTJA 2E5LE 2X6YA 1E3HA 1XC5A 1OCZH 3NWSA 2B9SA 4LF8E 5DYMA 1T2KA 3HRTA 1I94E 5M3MJ 5A2QZ 3HPZA 1HNWE 2PMZA 4PJNA 3DF6A 1MZBA 4DJAA 3GFMA 1T95A 3MCZA 1VQ6I 5ICFA 2LKPA 1VQ4I 4RM3A 1XCBA 2QENA 1HQCA 2X6OA 3OSFA 1R6RA 2DBBA 5EGOA 1A36A 2WA0A 3M3YJ 5A6BD 3M7GA 2R76A 1V55H 5LHGA 3RQIA 3JSPA 4PCQA 4BC9A 1XS9A 2JY9A 2YTOA 5E79C 4L0ZB 1FYLA 3HSEA 4BEHA 4E7HA 1DP7P 3LSGA 3OIPA 1WH7A 1E2XA 3F3XA 2WV0A 2KPMA 4CCLA 4YHHE 4IOCF 4BCAA 3H3VK 3CMYA 4BHCA 3HPHA 2R7QA 2ZJ2A 2M2EA 5E3OA 3TL4X 1ZGJA 1SEUA 4I09A 3FHZA 1I39A 2VIXA 4AC0A 2IHR1 4DR7E 2EOYA 2EIKH 1T8IA 1J09A 1FIAA 1I1SA 4HLXA 5F1RA 3HBLA 5LFAA 1RUOA 5AIQA 1G2DC 3HHGA 4LMYA 4HQEA 3LSMA 4EM1A 5L3BA 2FX0A 2LOOA 1A1HA 1GV5A 1BJZA 3DF8A 1W7PA 4L5JA 4C2UA 2H1LA 3R61A 4HW0A 1XN7A 1ZARA 4J00A 4HV6A 2EH3A 5JHUA 1TQMA 1ON1A 2MA3A 5ICGA 1W36C 4A0XA 1BR2A 4IHTA 1FTZA 1U9NA 1UJ8A 4L18B 5J8CA 1G3YA 1IUFA 4BC7A 4BS9A 4HNVA 5K7FA 1VQPI 4MFEA 4G7ZF 4UV9A 3QOPA 4BXFA 4IVNA 4IOAF 1ODDA 4B1RA 1NHAA 5FGMA 4LFAE 3IWDA 5CJ9A 1IC8A 2M4IA 2P0WA 2GLOA 3TW7A 5JLWA 2EMIA 1TNSA 4BU2A 2FMYA 2P5VA 4RLQA 1SVLA 1Y1VJ 4ZDLA 3HUGA 3VYYA 4GYGA 1P47A 3JTGA 2YTEA 3K1NA 2UUAE 1TW3A 1S3JA 1Z6TA 1X1AA 1K83J 2VE9A 2AO9A 1YG2A 5K5OA 5LRRA 3KYLA 1RETA 5D6FA 4G94A 5FLXK 2Y48A 2EK5A 1ZAOA 1LDJA 3CP8A 3ZQFA 3HKZN 4XLPF 2B63J 3K4CA 3AAFA 2CQNA 5IT9K 2EV0A 1YW8A 4X0GA 4I02A 3L9FA 2HOTA 2DT5A 3OYDA 2M7AA 5TJJA 2BZTA 2BBGA 3U9GA 1ULYA 4MNUA 5HS9A 3ZQCA 1J5YA 2CW7A 1NEIA 2LR8A 5AIPA 2Z5UA 1VTNC 1RESA 3DEEA 5EJCA 1HDPA 3BF2A 2QVOA 4ENNA 5K1YA 3QPTA 3NARA 1MNEA 1F36A 3ELKA 3DWLE 1QGPA 3T0YA 1QHHD 1OYYA 5A2QK 3H0GJ 4BQQA 3BC8A 2M8EA 1UMQA 1YTYA 3M99B 2WWYA 1PUFA 3KE2A 2Y2ZA 2BHYA 1H89C 5EG0B 3WTXC 2XAGA 4WYQB 1XMXA 2LVHA 5FD5A 2L2MA 2JSCA 2VC1A 1G8XA 2OQRA 2UXNA 2BY1A 2KRHA 4F91B 2E36A 1I3QJ 1R23A 3LSJA 2NS0A 2QEXI 2JA8J 2B7TA 5IP9J 3CD6I 1QU6A 2B3TB 5ERIA 2L2OA 2H27A 4L5EA 4BBYA 1ZELA 2GXGA 3FKIJ 4RAFA 1OLTA 2GPIA 3HPSA 2DK8A 2LT7A 4GFBA 2CTDA 4CXFA 5D6EA 4ZYGA 4O24A 3CCSI 5J1RA 3B6CA 2DTRA 1G4DA 1LLMC 3DKYA 2MG4A 1SD6A 4Y7NJ 2K9QA 2VPRA 3IWFA 3HC7A 3S3MA 2YUSA 2VJIA 1NK3P 4ON0A 1F2IG 2FV4B 2XSJC 1WJBA 2HOSA 3KCCA 1G59A 4C3JJ 2LY9A 2ID3A 3GTJJ 3IKTA 1ZR4A 2HVRA 3IKVA 4ITVA 4XOTA 3TMOA 2DFIA 1ZAAC 3HGYA 2QWWA 1P4XA 1F1ZA 4WK8F 5J4YA 2DPDA 2Y31A 2UXCE 3AG4H 5JVGF 3MWMA 3S8PA 5HLIA 4EV0A 1YZ9A 4JI0E 2WBTA 4HSRA 3BR2A 3VODA 2NVXJ 4HTGA 3NQOA 1FWZA 3V8LA 3AL0C 5E18F 2LUPB 2ZFWA 2M9HA 2IVMA 3G3ZA 1Z6RA 1WZ2A 2VKDA 2IGNA 1QVUA 4GKKE 2EZIA 2JA6J 3S1NJ 2MC6A 5FROA 2CW0F 1BI1A 4ESFA 3ABKH 2YSPA 2STTA 3CJNA 4LIVA 5F0FA 4OIOF 3MSWA 1QZZA 2HYJA 2CUEA 4GYIA 4OAZA 2H1KA 3FXQA 2E72A 2WB1N 1HW2A 2F4MB 2ETHA 2W1OA 5LL6R 5FO5A 2EMFA 1WJEA 3DBRB 4UVAA 1G6NA 2MW8A 2DA3A 2CYYA 1Z3XA 4BMJA 1GUUA 4WSPA 1SMTA 1QZEA 1WHNA 2HYGD 3CTAA 3CO6C 3BT9A 4LFUA 2LP0A 3ZQQA 2FE3A 1IN4A 2KJCA 5A6JA 4ZJZA 5FLMJ 5L3CA 2GOMA 1ZGAA 4JBAA 4XK4A 4U88A 4LOCA 1KZHA 1D0ZA 4UUTA 1P9QC 2OZ6A 3LSKA 1ZU1A 2FXAA 4KZSA 2W24A 2CV2A 3FXJA 1IN5A 3S14J 4D1QA 4DUZE 5KAIC 1O57A 3F9KA 4ZDOA 3HJEA 5A69A 3ASNH 3T8TA 2CFOA 1K79A 2IS6A 5FRMA 2X9DA 4BXXJ 2EFOA 3FM3A 3A0HC 5AONA 4HNUA 2P7VB 2YRMA 1RKWA 1Y6IA 1ZGWA 3TBIA 1EKZA 1K6YA 1MW7A 4LF6E 3K4BA 2XRLA 1YITI 4PUSA 2DA7A 1IRXA 4JI1E 2ZCWA 3HL2A 1K7AA 2VJ4A 2HS5A 1OYWA 2XAUA 2LG4A 3RPQA 2ZXIA 2QBYB 2EJ4A 3HTXA 2WBMA 2FBHA 3FXOA 2EQ1A 1VF9A 2M34A 3HTUA 3I59A 3BWGA 4U7DA 2DMPA 1JT6A 3IH2A 2IRFG 3JRFA 4N4OB 1ZTRA 3E6MA 5M5WJ 3TGNA 3MVPA 4XONA 4BBRJ 3H5AA 3Q9SA 4R8HA 4LLLA 3ECRA 4EM2A 4BE1A 2FTXB 2CH0A 4IL6C 4P96A 3PSIA 2D1HA 2QUFA 3T1YE 2LMDA 4ESJA 1MMNA 5FD6A 3SDBA 4CCMA 3CF5F 4OIPF 4HV5A 2VC0A 4D7MA 3OMLA 3PSFA 1ZREA 2M0MA 2IEKA 4A3KJ 4AVZA 3GLLA 4X65E 3M9AA 1TTYA 5EG0A 2F6CA 1BC7C 2COBA 4D5CA 1RR8C 1MD0A 3A01B 3WU0A 1FNNA 3ZN0A 1IXRC 1PJRA 4KMFA 1FBQA 3R0AA 5EF6A 1XMQE 4A0YA 2HQRA 5FLVA 2MDRA 3OYHA 1KU9A 2RQQA 2XF7A 5CVVA 1MH3A 4IPAA 2WAQN 3FMSA 3ZN1A 3V8KA 4I0AA 1Z67A 4C3IJ 2DA4A 2A3SA 2NXNB 2JUGA 3F0CA 5KHDA 2ENCA 2ZFUA 4R2AA 3MMYB 3ZMVA 1ZRCA 2XRNA 4RHBB 2BYVE 3P5JA 3HTSB 3TO7A 2ZXHA 1EF4A 2EOFA 3OTOE 5AC5A 3D1NI 2ZXJA 1TLHB 2RPCA 3OIQA 2L2KB 2K27A 4BJ5C 3U2RA 3J80Z 2CFXA 3V7SA 4B3TE 2V9VA 2UXBE 3CCLI 3CUQC 2HPMA 2M1SA 1GXQA 2MC4A 4FX4A 2K40A 1O3TA 5ILSA 1JE8A 2CPNA 5HLGA 4A3IJ 2V8QB 3AUZA 2QQAA 1ETVA 3OSGA 1YLFA 2CSHA 3F22A 2EN3A 2MH2A 4GGGA 4PFPA 3S15J 3GFLA 4L5IA 1EH7A 3PM1A 3QAHA 1OFCX 1XCVA 1A04A 2JPCA 3FMQA 3HOSA 3ZP5A 2JP9A 4A3CJ 3BG3A 1A1IA 4RDUA 4XRSG 2OZUA 1ZN2A 1MMDA 1B8IB 3HSRA 3V42A 1BOBA 1J59A 3L7WA 1RIOH 1F9NA 2WAFA 4HX8A 2V88A 4RB0A 1PJQA 3CMMA 1LDDA 1HOMA 1RMDA 2J5OA 1W5CC 3J7AO 1WPKA 2Y9ZA 4CH7A 1B72A 1RZ4A 2LF8A 3MFKA 4QLCU 2VJ5A 2HKXA 3F6VA 1U9OA 5IXMB 4ENKA 2YSOA 3UK3C 5BMZA 5IV8B 2DOEA 2OF7A 2DB2A 5EYRA 2AS5F 3E3VA 1WJAA 4YRVA 1STZA 3L2WA 3KLNA 5CQEA 5JR3A 5B1BH 4YFNF 2VASA 1KQ9A 5BPIA 4NXME 2N8GA 1GXPA 1V4RA 4IRGA 1X3CA 3VSKA 3IAM2 4LB6B 4JV5E 1HKTA 3TOBA 1PUEE 5TRDA 1H9TA 3H1CA 1N34E 2P5LC 4GDFA 5E1ZB 4AVPA 4BY1J 5BR8E 3J7AG 5E20A 3L2CA 2JOBA 1LEAA 3E6BA 4I98B 5GAHJ 2KP6A 1TT0A 4PDKA 2EIJH 4ZYDA 2E71A 1APLC 3ADJA 3RDIA 3JTHA 4DZPA 2YTQA 2MLKA 1D8KA 3OR1C 5J6XA 1IXSB 1JKPC 2EOQA 4LGWA 1VQ9I 2RSIA 5LLQA 3GFJA 3CCMI 1NTCA 3CC4I 1FEXA 2JMWA 4H4KC 1WJPA 1L4SA 3MZ8A 2JTVA 5GPAA 4B3SE 1HKQA 4DV6E 2L92A 4KIGA 2K9SA 3A03A 4CCKA 4NQWB
chains in the Genus database with same CATH topology
1QQIA 2L4MA 4ESBA 3WTSC 3TOAA 2QQBA 4EVIA 3VOEA 4FT8A 4KYWA 1FY7A 4I2OA 4TV7A 2K4JA 4MQVA 1ZHFA 3BROA 1FX7A 1KGSA 4ZYEA 3CO7C 1R22A 5ILVA 4CGZA 3SXYA 4YIFA 3HYIA 3C3WA 6PAXA 3IC7A 2M1BA 5D5VB 3B02A 3LAJA 5F64A 3GLXA 4A12A 5LEJA 1V3FA 4I0BA 3R60A 1MJBA 1HSTA 3C1DA 3J80K 1P2FA 1B1BA 2ZNZA 3GF2A 2C6YA 5HDKA 2VT3A 3BJAA 1ZLKA 2NRAC 1PP7U 5DDGA 1SFEA 1X3UA 2OBPA 1B59A 2V1DA 2BV6A 1OMIA 5JI6A 3QU6A 3GXOA 2H09A 3GFIA 5E8GA 2DAOA 5HS7A 4ZZDA 1J9IA 2XIGA 3F6OA 3ZPLA 1HKSA 4A6DA 3P9KA 3E5UA 2NYXA 1C0WA 5LHIA 4KN7X 2COMA 3PQJA 3L00A 2EB7A 4BXUA 5CVRA 1R5HA 4EGZA 1G3SA 1R1UA 1WRJA 5D5WB 5DD8A 3DEUA 2DW4A 2K86A 4Q47A 2HQNA 3WE2A 3TDZC 1XMKA 4FX0A 1OR7A 3O6BB 1LNWA 2D2WA 4B8XA 4G7OF 2H6CA 3EYYA 4GO1A 3LA3A 4RB3C 3ERED 2YX7A 4MTEA 2CQKA 1R7JA 4CDGA 3WGHA 1IN7A 3P9CA 1ZG3A 2DPUA 2Q8KA 3I0TA 3E97A 2OA4A 1JHFA 1KU3A 1P4AA 2FEZA 3ROUA 4K2EA 1DPUA 2LNBA 4NQWA 2QYOA 3V7CA 2MC3A 2MBFA 3I54A 4O5VA 2VXZA 1W4MA 1P92A 4KIFA 4DQ2A 4EJWA 2VBWA 2VOPA 3SQNA 4DNCA 2MD5A 4L9TA 1MJAA 1R00A 2L54A 2XAJA 3WTTC 4EJTA 2PMHA 5ILUA 1XDSA 2F5DA 5LEKA 2GWRA 4M71A 3SZPA 2GIVA 3ZQ7A 3WTUC 2XROA 5E8IA 4KIBA 1FOKA 1PDNC 3I58A 1OPCA 1W5TA 3CUQB 4MGRA 1WKMA 2PJPA 1LEBA 5E1WA 3OV8A 1K6OA 4P9UA 2BEOA 2RN7A 4XLNF 4WF2A 1XSDA 5DD4A 2E1NA 1U6GA 2E7XA 4O6JA 4XSXF 3V4GA 4S05A 3TKYA 4CYDA 2A6EF 1W7PD 3BPVA 1U78A 1O3RA 1JGSA 4ENJA 2CGPA 3BPXA 1QZYA 3I64A 1TQIA 4LLGF 2DLLA 2E1CA 2F2EA 3WTZA 2EV6A 1LVAA 1T6SA 3DPLC 3KEQA 3KLOA 1UCRA 3BP8A 5FB2A 1I27A 3BZ6A 4N9IA 3DFGA 2PFBA 3GO5A 3VEPA 2NNYA 1GHCA 3HSFA 1EV7A 2EWNA 2RVCA 2YU3A 4IJAA 4IRIA 2K4BA 2E7WA 2HDCA 3K2ZA 3LSTA 3RTRA 1BC8C 1R36A 2P6SA 4EQQA 2PN6A 4OIQF 4HYEA 1BIAA 3E6DA 3GX4X 1XGMA 4HQMA 3ABTA 3F8MA 2ZNYA 2JT1A 2FNPA 5K5QA 1EH8A 2UWMA 4NHJA 2FMLA 2ESHA 5FFZA 5D8KB 1YW9A 1IZ1A 3MZYA 4R79A 3KP4A 2XVCA 4WCGA 2EFWA 5DCMB 3EYIA 5D5XB 3O3KA 4AIJA 3KP2A 5HS8A 1XB4A 3CUQA 2W85A 4LK1F 5KVRA 2D1VA 3TQNA 4UUVA 4HF0A 2UZKA 1REPC 3MEXA 4I01A 4HAMA 5F6FA 1XDUA 2IW5A 5CVIA 5D5UB 4A5MA 1D8JA 2PMUA 2RNJA 2V1UA 5BS6A 4L9JA 3ECOA 3KP3A 4GCVA 4R1HA 4RAZA 2HR3A 1RNLA 2M30A 4Z2YA 1HXDA 2UXXA 3TO6A 4U0WA 1KQ8A 1B9MA 1H9GA 3OOPA 1Z91A 3L09A 1UFMA 4RGUA 3LQRA 4IXAA 2R7DA 2FBKA 4HX4A 4HF1A 2DQRA 2FU4A 4WXHA 1YS7A 3P7NA 2ACJA 2Q0OA 2GXBA 2HEOA 3HRSA 2XAQA 1LDKB 1SFUA 2ADUA 1P6RA 2M45A 4BH9A 2ISZA 4LD5A 1QPMA 2ZMEB 5DUKA 4Q48A 3FZVA 1B4AA 3PFIA 1T38A 1IRGA 4KICA 2VONA 1T98A 2O61A 2HGCA 3MQ0A 1HW1A 3K69A 3JW4A 1ZYRF 3KFWX 3GYHX 2KIUA 2BGCA 3EUHA 2XV4S 3GVAA 2FQ3A 1J2XA 3NEUA 2LSOA 3GW2A 2F5FA 2R3SA 2TDXA 5EEGA 2BBYA 2O0YA 2XKOA 1BOAA 1BJAA 4BHBA 1KA8A 1SD4A 4KA4A 1IN8A 2M87A 3BY6A 1AWCA 2Z33A 3WU1B 1KYZA 1FYMA 3COAC 3J81Z 2KRFA 3NRVA 2IA1A 3RI4A 2DO7A 3V7RA 3D0SA 1K78B 4HLYA 3RKXA 3HOTA 4AWXB 5D4SA 2HZTA 3T8RA 1YYVA 5H6QA 2L01A 3IRQA 4G6QA 1I5ZA 2CO5A 2PG4A 1SAXA 2XGXA 3RJPA 2QBYA 1G3WA 1MDMB 2LF7A 1HSJA 3GZ6A 5DCFA 3IHUA 2GA1A 1QO0D 4ASNA 3I53A 3B73A 2JRTA 3U1DA 1KYWA 3R6SA 1U3EM 3CUOA 4EM0B 2L4AA 5DEQA 2R7FA 3F8FA 3LA7A 2ZMEA 2RDPA 5HDGA 5KK1A 3I4PA 3K1MA 1ZRDA 2O03A 3JAMZ 1FP2A 1XGSA 2ZBKA 3BJOA 3GUDA 2GZWA 4HZFA 1BI0A 2VE8A 2ISYA 1J75A 2OD5A 4KUMA 1WQ2A 1OKRA 1O3QA 2L3DA 2Z99A 2YSRA 4U7BA 2WC2A 2MLGA 4MQ9F 5JFRA 3J81K 5BPDA 1I1GA 2B0LA 1PP8F 5JVTA 2F5CA 5ICEA 4L9VA 3WGGA 2IT0A 1W7PB 2NNNA 1S6LA 2W25A 4GXOA 3GWZA 2IP2A 3WTVC 2O8XA 1FLIA 1FBUA 3BDDA 2IA2A 2RC4A 4LB5A 2XAHA 4HF2A 2OU2A 1K78A 1FP1D 3P9IA 4RAYA 4WXDA 1GVJA 5LHHA 1XGOA 2PLYA 1KU2A 5E1XA 4LLNA 4NB5A 2QM3A 4AD9A 1FZPB 2P6TA 2QLZA 3ZMTA 2IA0A 1R1TA 2IJLA 3RKWA 3FF5A 2G9WA 4F7ZA 3M8EA 2Z3YA 2HTJA 1WSUA 1J7KA 2O3FA 1MDMA 3K1PA 1HBXG 1UHMA 1S7OA 2NAZA 2EFQA 4LJZF 2BE5F 4HA8A 3W6JB 5LGTA 4RB1A 5LGNA 4YG2F 4AIKA 1W5SA 3WGIA 4HDUA 4MHGA 2H6BA 4OINF 1WWXA 3KP6A 1O3SA 1BI3A 2W84A 2PBIA 1XD7A 4M9ZA 3MAJA 2XHKA 4EMSA 4UVCA 3JAMK 5L3FA 3LAPA 3IWZA 1ZG1A 2CG4A 2XASA 4KT5C 1XGNA 2VODA 3WE3A 2EFPA 1MGTA 2XKPA 3F8NA 4UHTA 3VFZA 4FHTA 1R1VA 3EETA 4G8XA 3FWEA 3QP6A 3T1BA 5L3DA 2YR2A 2W57A 4ZZLA 4N0BA 1Z05A 3PQKA 2M5WA 4AIHA 2VT2A 4LG0B 2GA2A 2HFHA 1CGPA 1J0RA 3ULQB 1UHWA 4N9HA 2X0LA 5EEHA 2GAUA 3KEOA 3N97A 4M6YA 1IUYA 2HYFA 1LB2A 1TBXA 2RGVA 4IRHA 4E70A 1MJ9A 1B9NA 2P8TA 2ZO4A 2FOKA 3CDHA 4BYYA 3JSOA 1EH6A 2RV8A 1I6XA 4QWQA 4PZJA 3DQVC 1YS6A 3LWFA 5HLHA 4OMZA 1XMAA 2K7LA 1JXSA 1BI2A 4WX9A 3ML6A 3F8BA 1BN5A 3FX3A 3ABUA 4YFXF 3QPHA 4LK0F 1OYIA 1U5TC 1BIBA 4M73A 5J8FA 2MH9A 4RS8A 4M6XA 3KP5A 3C7JA 4RGSA 2EA4A 2EFNA 4G6DA 4EJUA 3DP7A 4Y15A 3SHFA 3M8FA 2FF4A 3I59B 1HW5A 5DUIA 4BHPA 3IRRA 1Z9CA 2P5KA 4RGXA 3I5UA 2J5PA 5HVQC 2Z9OA 5ICCA 2X4HA 1RI7A 1FBSA 2XAFA 1B6AA 2RKHA 3ZMSA 4L9NA 1FSEA 1F5TA 2OQGA 2LDUA 3F23A 2Y0MA 1R58A 4U0VA 3I71A 4P5OA 5BOXA 1P4WA 2JPBA 4KNYA 3E6CC 2HOEA 3ZMDA 2ELHA 3RPUA 3Q5FA 1DUXC 4UVBA 3EQLF 4ZH4F 3QRFF 3HRMA 4BQAA 1BBYA 4LG0A 3M1EA 4YIIA 4G9YA 3RIRA 5FFXA 2A68F 4HOBA 3REOA 3WODF 1WI9A 3F21A 1D5VA 2ESNA 4B09A 1QNTA 1AOYA 4OMYA 3S2WA 2QQ9A 2QZ8A 4KMUX 3K0LA 4XSZF 3FXRA 1ZLJA 4S04A 1TNTA 3QU3A 4EJOA 2G7HA 5BQTA 2FBIA 4UNOA 2AXLA 3BJ6A 4CICA 4Q4ZF 5D4RA 2VBYA 1FSHA 4Y17A 1IXCA 4OIRF 2IPQX 3FXUA 4M9SA 3O2PE 1G3TA 2O6GE 1UB9A 4Q5SF 2FSWA 3EDPA 3F8CA 2V6CA 3GEZA 2GQQA 3WTWC 2A61A 2A6HF 4OU0A 4ENMA 3N4MA 4HX7A 3F72A 4D0PA 2PI0A 2P4WA 4JQFA 3E5XA 4KFCA 3TDUC 4Y13A 3SFZA 4H0EA 4MEYF 2VBXA 5DCMA 3ZMUA 3DV8A 4I7HA 3R4KA 1IAWA 1E17A 4M72A 4KDPA 2HWVA 5E17F 4XRFA 5HDNA 2Y75A 5CVJA 4IHSA 5CYVA 3VB2A 3ZMZA 1L3LA 2KKOA 3ECHA 3H92A 1ON2A 2KIFA 1IRFA 5IT3A 4L0YB 1CF7B 3KZYA 2VOOA 4G7HF 1ZH5A 1R5GA 3WG9A 1T0FA 1SD5A 3LQQA 1D3YA 1ONVA 2FRHA 3RYPA 1FPQA 3W6KB 3DPTA 2XUBA 3KZZA 1SFXA 1FT9A 3KP7A 2V79A 1U5TB 2DI3A 4CO8A 2YPRA 1FYKA 2VN2A 2D45A 3E5QA 2K02A 3RKYA 1H0MA 4BNCA 4RB2C 1Z1DA 4CZZA 3H3ZA 5CVUA 1LQ1A 2EV5A 1RUNA 3H3UA 1SMYF 4O3MA 4M74A 5D8LB 2WTEA 1XSXA 2A5YB 2FA5A 2ZKZA 5LBQA 2STWA 1Y0UA 4EGYA 2A69F 3DKWA 1KQ0A 4OOIA 4A6EA 4KN4X 5HOOA 1T39A 4WXCA 4BAYA 2FNAA 4P9FA 5DV5A 1S8NA 3TO9A 4A2UA 1IW7F 4PGHA 3HHHA 3ISPA 5CLSA 3BOQA 2KJBA 1JHHA 1MKMA 2VBZA 4U0YA 3R0JA 3C18A 3IL2A 1TQPA 4A0ZA 1O7FA 2L02A 1DPRA 1YFHA 2JZYA 1KU7A 2Q2EA 1XSVA 4WWCA 3FMRA 2HKOA 3GZ5A 1L0OC 4PGGA 2DU9A 3G73A 4ZYHA 3DXJF 3RYRA 3WTYC 3HIFA 1TW2A 2F5EA 2V1XA 1CF7A 2CWEA 4EJVA 4UXNA 3FM5A 3SZTA 5ED4A 2PEXA 5LGUA 4UV8A 1YQAA 4HBLA 2A07F 1QBJA 3KETA 2H94A 5L3GA 4YFKF 4MEXF 3Q9VA 3CLOA 3V8JA 1ZG5A 5K5RA 4XBFA 4MTDA 2DK5A 3K9TA 1S7AA 1Q1HA 2CSOA 1U5TA 4RGRA 4HDVA 1IN6A 1SD7A 4M9XA 5L3EA 4CHUA 1S29A 3MZHA 2RQPA 3LA2A 1F4KA 2KIMA 2PQ8A 3QP5A 2OAZA 3HRUA 1DDNA 1USSA 4P55A 3D5LA 5H6RA 2EA2A 1U2WA 3LFKA 5FLXZ 1BM9A 5H20A 3T5XA 2HTSA 5LRSA 2G7UA 1U8RA 2DQLA 5IT9Z 1O7LA 1LJ9A 1YO5C 4JK1X 1IF1A 1ZRFA 1YIOA 2EJRA 1USTA 1Z7UA 1YW7A 4IF4A 2YX4A 2P7CB 4ETSA 1FC3A 4A5NA 5DYMA 1T2KA 3HRTA 5A2QZ 1MZBA 3GFMA 3MCZA 5ICFA 2LKPA 1XCBA 2QENA 1HQCA 2DBBA 3M7GA 5LHGA 3JSPA 4PCQA 4L0ZB 1FYLA 3HSEA 1DP7P 1E2XA 3F3XA 2WV0A 4BHCA 2ZJ2A 1ZGJA 4I09A 3FHZA 1I1SA 4HLXA 5F1RA 1RUOA 5AIQA 3HHGA 4LMYA 4HQEA 4EM1A 5L3BA 3DF8A 1W7PA 4L5JA 3R61A 4HW0A 1XN7A 1ZARA 4HV6A 5JHUA 1TQMA 1ON1A 2MA3A 5ICGA 4IHTA 4A0XA 4L18B 5J8CA 1G3YA 4G7ZF 4UV9A 3QOPA 4IVNA 1ODDA 1NHAA 5FGMA 5CJ9A 1TNSA 2FMYA 2P5VA 3HUGA 4GYGA 3JTGA 3K1NA 1TW3A 1S3JA 1Z6TA 2VE9A 1YG2A 5K5OA 5LRRA 5D6FA 4G94A 5FLXK 2Y48A 2EK5A 1ZAOA 1LDJA 4XLPF 3AAFA 5IT9K 2EV0A 1YW8A 4I02A 3L9FA 2DT5A 5TJJA 3U9GA 1ULYA 4MNUA 5HS9A 1J5YA 5AIPA 2Z5UA 1VTNC 2QVOA 4ENNA 5K1YA 3QPTA 3ELKA 1QGPA 3T0YA 1OYYA 5A2QK 2M8EA 1YTYA 2WWYA 3KE2A 3WTXC 2XAGA 5FD5A 2JSCA 2VC1A 2OQRA 2UXNA 1R23A 2NS0A 5ERIA 2H27A 2GXGA 2DK8A 4CXFA 5D6EA 4ZYGA 2DTRA 1G4DA 1SD6A 3IWFA 4ON0A 3KCCA 3IKTA 3IKVA 2DFIA 2QWWA 1P4XA 1F1ZA 4WK8F 2DPDA 3MWMA 4EV0A 5HLIA 3VODA 3NQOA 1FWZA 3V8LA 5E18F 2ZFWA 2IVMA 3G3ZA 1Z6RA 2CW0F 1BI1A 4ESFA 2STTA 3CJNA 4OIOF 1QZZA 4GYIA 3FXQA 1HW2A 2ETHA 5FO5A 4UVAA 1G6NA 2CYYA 1SMTA 2HYGD 3CTAA 3CO6C 4LFUA 2FE3A 1IN4A 2KJCA 5L3CA 1ZGAA 4JBAA 4U88A 2OZ6A 2FXAA 2W24A 1IN5A 1O57A 3T8TA 1K79A 2EFOA 3FM3A 5AONA 2P7VB 2ZCWA 1K7AA 2HS5A 1OYWA 3RPQA 2QBYB 2FBHA 3HTUA 3I59A 3BWGA 4U7DA 2IRFG 3E6MA 3TGNA 3Q9SA 4R8HA 4LLLA 4EM2A 4P96A 2D1HA 2QUFA 4ESJA 5FD6A 4OIPF 4HV5A 2VC0A 1ZREA 3M9AA 1TTYA 1BC7C 1MD0A 3WU0A 1FNNA 3ZN0A 1IXRC 4KMFA 1FBQA 3R0AA 4A0YA 2HQRA 1KU9A 5CVVA 4IPAA 3FMSA 3ZN1A 3V8KA 4I0AA 2A3SA 3ZMVA 1ZRCA 2XRNA 2BYVE 3HTSB 3TO7A 2ZXJA 1TLHB 2K27A 3U2RA 3J80Z 2CFXA 3V7SA 2V9VA 3CUQC 1GXQA 4FX4A 1O3TA 5ILSA 1JE8A 5HLGA 2QQAA 1YLFA 3F22A 2MH2A 4GGGA 3GFLA 4L5IA 1EH7A 3QAHA 3ZP5A 1XCVA 1A04A 2JPCA 3FMQA 3HOSA 2OZUA 1ZN2A 3HSRA 1J59A 3L7WA 1RIOH 1F9NA 4HX8A 4RB0A 1LDDA 2J5OA 3J7AO 1RZ4A 2LF8A 3MFKA