1QNTA

X-ray structure of human o6alkylguanine-dna alkyltransferase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
171
structure length
166
Chain Sequence
EMKRTTLDSPLGKLELSGCEQGLHEIKLLGKDAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human O(6)-Alkylguanine-DNA Alkyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna repair
molecule keywords METHYLATED-DNA--PROTEIN-CYSTEINE METHYLTRANSFERASE
total genus 42
structure length 166
sequence length 171
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 1999-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1qntA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1qntA01
3KEQA 2DFIA 3ROUA 1GXPA 3LA2A 2X0LA 4G9YA 3TKYA 2YSRA 1G6NA 4HX4A 1YIOA 2RDPA 4KMUX 4ESBA 1I5ZA 2VOPA 3JTGA 3MCZA 2RVCA 3EUHA 2Y75A 2A69F 3JSOA 2O61A 5IT3A 3RYRA 4IRHA 4KFCA 2ELHA 2XASA 1B9NA 1I6XA 4ZYEA 3GLXA 1A04A 3KFWX 1ODDA 2J5PA 2H6CA 2ZJ2A 1STZA 5E8IA 2K02A 1QBJA 3RDIA 2HKOA 3P9KA 5CVUA 5BQTA 2YU3A 1XSXA 4GYIA 1KU7A 3R0JA 1HXDA 4LLLA 3PQKA 4A2UA 1DUXC 5LGNA 3MWMA 3CO7C 4IJAA 2CQKA 1JHFA 1S8NA 4EJWA 1QGPA 1D3YA 4PGGA 4LJZF 1TW3A 4YFKF 1F5TA 3LA3A 5BPIA 4HF0A 3GFIA 1AWCA 3M8FA 5TRDA 3L7WA 1YS7A 3M8EA 1ONVA 1BBYA 2FBIA 2MBFA 2VBWA 3HOSA 2FOKA 3B73A 2HQNA 1YFHA 2V6CA 2F5DA 2FRHA 4RGRA 1R00A 1S7AA 3QU3A 1MZBA 1FLIA 1XCBA 1H0MA 3GO5A 5HVQC 1MDMB 1KYWA 2NYXA 1ULYA 4G7ZF 3J80Z 1FT9A 2EV5A 2CGPA 3CDHA 2H6BA 3GF2A 1HSJA 2C6YA 1L3LA 4MQ9F 3K69A 4EGYA 3WTYC 1BI2A 1UCRA 5A2QK 2HYFA 2HZTA 2NNYA 2Z9OA 1FWZA 3DKWA 4AIJA 3KLOA 2J5OA 1IAWA 3IRQA 4ASNA 1Z05A 3WODF 3KZZA 3F23A 2QLZA 3HSFA 3SFZA 3CUOA 2QQBA 3K1PA 3QOPA 1FOKA 4L9TA 5EEGA 2QWWA 3R61A 5HS7A 3CJNA 2EJRA 3F72A 3JTHA 3WTUC 4M73A 1HKSA 3IKVA 1XGNA 1XD7A 4HDUA 1P2FA 1XSDA 1AOYA 4ENJA 1Z91A 1V3FA 2FQ3A 1B4AA 2TDXA 3ZQ7A 5A2QZ 4D0PA 3I71A 4A6DA 3BWGA 5F1RA 3CUQA 1YYVA 3FMRA 1K78B 2QBYA 4U7BA 4ZZDA 1GXQA 1Z6RA 3KE2A 2P7CB 2OA4A 4EV0A 4CXFA 1IRFA 3EETA 1T98A 2LDUA 5D8LB 1EV7A 3W6JB 2H27A 3L00A 1ZAOA 2Q8KA 4KIFA 3ABUA 1D8JA 4KMFA 3DP7A 3NQOA 1O3TA 1FNNA 1LJ9A 3U9GA 2VOOA 5LBQA 4F7ZA 2KKOA 3V4GA 2JTVA 2XVCA 1S29A 1BN5A 4KIBA 1F4KA 2LF8A 3BJOA 3R0AA 5E8GA 2Z3YA 3ZMUA 2BV6A 3QP6A 2VC0A 5E20A 4JK1X 3IHUA 1U5TC 1D5VA 1XMKA 2D1VA 4I0AA 3NRVA 3VB2A 1C0WA 4Y13A 1ZRFA 2PJPA 4HW0A 2XKOA 3MFKA 3E97A 3FXRA 4ENKA 2OQGA 3V8KA 3DFGA 1G3SA 4M9ZA 1W5SA 3E6BA 1BC8C 2ESHA 3BOQA 4N9HA 4AWXB 4HBLA 1U78A 5HS9A 5D4SA 2XUBA 3E5UA 4WWCA 1OPCA 4EJTA 3P9CA 4Y15A 2A6HF 3ZN0A 6PAXA 2L4AA 1PUEE 1OR7A 2P4WA 1ZRCA 1RI7A 1H9GA 3L9FA 2GIVA 4M71A 2WV0A 4GGGA 2ZXJA 5LGTA 1IW7F 1WQ2A 1IXCA 5DCMB 5LLQA 1G3YA 4HYEA 2A61A 3GUDA 4M6YA 1HW5A 1T6SA 2XAQA 1W5TA 4PCQA 1TLHB 1BIBA 4L5IA 4G8XA 4OIQF 2HFHA 3K1NA 2OZUA 2ISZA 1RZ4A 3V7RA 5D5XB 2EK5A 2KIUA 2GZWA 4UNOA 2W84A 2X4HA 1YO5C 2V1XA 5E18F 2IW5A 2YR2A 2ACJA 4HX8A 1RIOH 3BY6A 4G7HF 2XIGA 5CYVA 1BIAA 4KICA 2ZMEB 3LQRA 1WRJA 4N9IA 4PGHA 1YW7A 2VBZA 2M87A 2D1HA 5L3FA 2VONA 1IN6A 1KQ0A 3CLOA 3F21A 3G73A 3ZPLA 3BZ6A 2HDCA 3TO7A 1OYIA 5D5WB 3H3ZA 2NNNA 1DP7P 1QPMA 5KK1A 3QPTA 2HOEA 3V7CA 1JGSA 3K1MA 1ON2A 2RV8A 2FA5A 2PEXA 4ZYGA 3ECHA 1FBQA 2ZNYA 2E1CA 4U7DA 2FE3A 2PFBA 4LMYA 5H20A 2JPBA 3Q9SA 1IN5A 2QVOA 3I53A 4WX9A 3WTVC 2AS5F 1XCVA 3DPLC 4FX4A 3RPQA 4MHGA 2F5CA 3WTZA 4RAZA 2W24A 5BMZA 3HRSA 4P96A 4HF1A 4CDGA 3RJPA 4R8HA 1W4MA 2L01A 4L18B 3ABTA 4YIFA 4MEXF 3TO9A 3O6BB 1XMAA 3QAHA 1O3SA 3LFKA 4U0WA 1U5TA 4BHBA 5L3DA 1B1BA 2CWEA 4O3MA 2RN7A 2UZKA 4PZJA 3I64A 2FF4A 3NEUA 5HLGA 4A12A 3GZ5A 3KP3A 1HKTA 3LA7A 2BGCA 2JZYA 2GXBA 3W6KB 4IRGA 3WGIA 2P5VA 3LQQA 3HSRA 5L3GA 3HHGA 4KA4A 1J9IA 4YIIA 2CG4A 3GVAA 2PN6A 2JRTA 4EM1A 4Q48A 3MZYA 2L4MA 2E7WA 5F64A 5DCMA 1PP7U 5FLXZ 4P9FA 2B0LA 4NQWA 3M7GA 1KYZA 4OIRF 2BEOA 4YFNF 5FB2A 1E2XA 5BPDA 1QNTA 1F1ZA 1T38A 5L3CA 1G3WA 2L54A 4MTEA 2NRAC 1ZGAA 2R7FA 3SXYA 1MJBA 2DPUA 3D5LA 2V79A 2RC4A 4UVBA 3V8JA 3PFIA 4S04A 2LF7A 3R60A 3I0TA 2R3SA 1FZPB 4CO8A 1P92A 3QPHA 1X3UA 1YQAA 1R23A 2EWNA 2CFXA 4L9NA 2FSWA 4AIHA 3HTUA 3OV8A 4P9UA 5DD8A 1FSHA 3VFZA 3EYIA 2DPDA 1YTYA 1YG2A 2P5KA 1U3EM 1FYKA 5LHIA 4I7HA 2EFQA 4CYDA 1KQ9A 4IF4A 4BHCA 5ERIA 3J81Z 1DDNA 4AIKA 3HRUA 3VEPA 1PDNC 2GQQA 4L5JA 3HHHA 2O0YA 2Q0OA 1LDKB 3F8MA 4KN7X 2K27A 4OIPF 2W85A 2DQRA 5FD5A 4AD9A 1RNLA 3QRFF 1ZARA 1SMTA 1ZH5A 2MD5A 3K9TA 3GWZA 1ZREA 3GEZA 4IPAA 2A3SA 1WKMA 1IRGA 5IT9K 1DPRA 1HW2A 2O6GE 3ZMZA 4XLNF 1OYYA 3MQ0A 4LLGF 4UUVA 2HWVA 2GA2A 2PBIA 1B6AA 4A0ZA 4ON0A 4KUMA 2A5YB 3L09A 3HSEA 3DPTA 3FM5A 4MEYF 4RB1A 2XAHA 1JE8A 3C18A 1CF7B 1LEAA 5ILVA 3IKTA 4HQMA 1R1UA 4HLYA 5DUIA 3F8CA 4YG2F 4EVIA 2HS5A 3JW4A 4HF2A 2AXLA 3QU6A 3KP4A 1J75A 4RGUA 4BYYA 3ECOA 1R1TA 2DK8A 4M72A 2IA1A 2BYVE 4IHTA 4G94A 3V8LA 2ADUA 5DYMA 4IVNA 3KP7A 4ZH4F 3VODA 4OINF 1O7LA 4MGRA 2PMHA 4BHPA 3WE2A 5LRRA 5ILSA 3R6SA 3KCCA 2IP2A 1EH6A 2H09A 2JT1A 4G6QA 5KVRA 5D5VB 4TV7A 3I59A 3EYYA 2V1UA 1XDUA 2COMA 3TDZC 3FMSA 1ZG1A 1U6GA 1U8RA 1ZHFA 4ZZLA 3BJAA 3ZMTA 4E70A 4LK1F 4LB5A 1R7JA 2OZ6A 2VXZA 2IVMA 5CVJA 4LD5A 2F2EA 1G4DA 5HLIA 1KQ8A 5JI6A 2PQ8A 3JSPA 1R5GA 4QLCU 3JAMK 1NHAA 1USSA 3M1EA 3FM3A 3HRMA 4PDKA 3BJ6A 4LK0F 5CVVA 1LDDA 1S7OA 4RGSA 3E3VA 4BH9A 1USTA 3SHFA 1VTNC 3C7JA 1OYWA 1FYLA 5D4RA 1JHHA 4B09A 1Y0UA 1TBXA 3WTTC 4ESJA 5D6EA 1IXSB 5DD4A 2ZO4A 3GW2A 3I58A 2VN2A 3GFJA 3DEUA 5H6RA 2MLKA 5DDGA 5HOOA 3TQNA 1BOAA 1IN4A 5DCFA 5FD6A 1HW1A 1KU3A 4I0BA 4ENMA 5AONA 2P7VB 4RGXA 4EJUA 5E1WA 3ZMDA 2KJCA 3D0SA 2L3DA 4A0XA 3RKXA 1Z7UA 4BQAA 2STTA 3J80K 3K2ZA 3N97A 3CUQC 3LWFA 1KGSA 3RKWA 2JSCA 3CUQB 3FWEA 3E5QA 4LG0A 2DT5A 3WTWC 1L0OC 5EEHA 3TOBA 2K4BA 5FFZA 4EQQA 2EA4A 1I1GA 4HLXA 3O3KA 2QUFA 2CSOA 4CGZA 3BPVA 1FP1D 3Q9VA 3TOAA 1FBSA 2L02A 2BBYA 3C1DA 5BOXA 1FYMA 2FNAA 2W57A 4MTDA 3T8TA 5K1YA 3DV8A 1BI3A 2EFPA 2XKPA 3HRTA 2E1NA 2K4JA 2OQRA 3IL2A 2V1DA 3WE3A 2WTEA 3E6CC 2EV6A 1GHCA 2PMUA 3GFMA 1J2XA 2XRNA 1YW8A 5AIQA 2DAOA 1SAXA 4DQ2A 3WU1B 4OIOF 4DNCA 1G3TA 3TDUC 5LRSA 4GYGA 2A6EF 3IC7A 2Y48A 1XSVA 3IWFA 5L3EA 4IXAA 1FP2A 5D6FA 3ZMSA 3GFLA 2O3FA 4I01A 4Q5SF 2QENA 4KN4X 2V9VA 4ESFA 3PQJA 4G7OF 1FC3A 2VT3A 5FFXA 4CZZA 1FY7A 4XRFA 3KETA 5ICEA 4CHUA 3V7SA 3E6MA 2FMYA 4M6XA 1Z1DA 2DTRA 2UWMA 5K5OA 2O8XA 4HDVA 3HYIA 3H3UA 2XAJA 4L0YB 2VBXA 1WSUA 1REPC 3J7AO 2EFOA 2WC2A 2XGXA 2P6TA 2DK5A 5HDGA 4LFUA 4GO1A 4OOIA 2CW0F 3KP2A 3FXUA 1T39A 4L9VA 1GVJA 1SD7A 2VODA 2M30A 1FBUA 1FSEA 5J6XA 1O3QA 1J0RA 4A0YA 4RAYA 2FMLA 1R22A 4UHTA 2F5FA 3MEXA 3P7NA 3RKYA 4P5OA 1XGOA 4WXHA 2IRFG 3SZTA 1LEBA 1R5HA 5D5UB 3ZMVA 2PG4A 3CO6C 3RPUA 1T0FA 4HA8A 4GXOA 4BNCA 2IJLA 3FMQA 1V4RA 2YX4A 2ZBKA 3GYHX 5L3BA 3B02A 5FLXK 2GAUA 2OD5A 5FGMA 2WWYA 1R1VA 3KZYA 4EMSA 1P6RA 3RYPA 5LEJA 1W7PD 2KRFA 2M5WA 5CLSA 3I5UA 2IA0A 5DUKA 2STWA 2ETHA 4UV9A 3U2RA 3GXOA 2QQ9A 5AIPA 1IXRC 4M74A 4R79A 2IT0A 4Y17A 1LB2A 1TNTA 2P5LC 1HBXG 1YLFA 2MLGA 1HKQA 1Q1HA 4OMZA 1B9MA 1U5TB 2G7UA 3REOA 4XSXF 4Z2YA 3ML6A 2DQLA 3BROA 3HOTA 2MA3A 2EB7A 1W7PB 2HR3A 2W25A 1ZRDA 5LGUA 3T5XA 1JXSA 1O57A 3EDPA 2HKXA 1TQMA 2Q2EA 3MAJA 1SD5A 2H94A 2ZCWA 4HV6A 4NB5A 1LNWA 4Q47A 3TGNA 5J8CA 4H0EA 1QZZA 1BC7C 5JFRA 5K5QA 2MC3A 4RB3C 2Y0MA 1D8KA 2HEOA 1BJAA 4KIGA 1RUOA 5HDKA 1XN7A 4EGZA 1TQPA 2KJBA 4ZYHA 1QZYA 2VBYA 4UXNA 1K79A 1W7PA 3E6DA 2VT2A 1IZ1A 2E7XA 2FU4A 1R36A 1R58A 3HUGA 3I4PA 3Q5FA 5J8FA 2RQPA 3WGGA 4EJVA 4N0BA 5LEKA 5CVRA 4JQFA 4MNUA 4O6JA 2XHKA 2PLYA 2GA1A 2YX7A 3QP5A 3BP8A 5ICGA 4XBFA 1PP8F 2ZMEA 1F9NA 4BAYA 1XGSA 4I2OA 4EJOA 5FO5A 2UXNA 2QQAA 1IN8A 2HTJA 3GZ6A 2FBHA 2XV4S 5HLHA 1DPUA 2GXGA 1MJ9A 3LSTA 1T2KA 1K6OA 3T8RA 1I1SA 4R1HA 3WTXC 1BI1A 1CF7A 3N4MA 5JHUA 3OOPA 4RB2C 2EA2A 5E1XA 2FBKA 5LHGA 3LAJA 3ISPA 2VC1A 3K0LA 4IRIA 3O2PE 3GX4X 3T1BA 1UB9A 4XSZF 3DQVC 3FF5A 5CVIA 2D45A 4ENNA 2QZ8A 4LLNA 3RI4A 2NS0A 2G9WA 1SFUA 5CJ9A 4LGWA 2P6SA 3FX3A 2FNPA 3MZHA 3HTSB 2A07F 1K7AA 4FX0A 1KU2A 4A5MA 3J81K 2EFWA 1J5YA 3F8BA 1OKRA 4QWQA 1MJAA 3IWZA 1P4XA 4GCVA 1IN7A 2LSOA 5E1ZB 2UXXA 5F6FA 1HSTA 2KIFA 1OMIA 3ZP5A 1LVAA 2GWRA 5ILUA 1SFEA 4IHSA 1I27A 5HS8A 4RS8A 1MGTA 4ZYDA 1FPQA 5ED4A 3WU0A 5K5RA 2Z33A 3I59B 3ERED 1LQ1A 1IF1A 1TQIA 4Q4ZF 4HX7A 4OU0A 1ZG3A 2IA2A 1BI0A 1UFMA 3ELKA 1IUYA 4I98B 3TO6A 5JVTA 3G3ZA 2K7LA 4KT5C 3F8FA 3DXJF 2XAFA 2JPCA 2ZKZA 1TTYA 3P9IA 3RIRA 1S3JA 1O7FA 2FXAA 4A6EA 4WF2A 2LNBA 1Z9CA 5E17F 4FT8A 3U1DA 1RUNA 3T0YA 3S2WA 1ZG5A 4M9SA 5HDNA 3RTRA 3HIFA 4OMYA 4UVCA 3VOEA 1ZLJA 3KEOA 2VE8A 2ISYA 4M9XA 2YPRA 1SD4A 1H9TA 3SQNA 2M1BA 1WI9A 4UVAA 4RB0A 5TJJA 2QM3A 3KP5A 3FZVA 4S05A 5H6QA 4YFXF 4I02A 4LG0B 4XLPF 5BS6A 4FHTA 5IT9Z 3DF8A 3JAMZ 1ZN2A 1Z6TA 1S6LA 2Z5UA 3F22A 2EFNA 5DV5A 1HQCA 2Z99A 3KP6A 2ZNZA 4WCGA 1WWXA 1LDJA 5ICFA 1XDSA 2OBPA 1P4WA 1K78A 2QBYB 3COAC 4KYWA 4NHJA 1UHWA 3I54A 4U0YA 2CO5A 2XAGA 2CYYA 1QQIA 3BPXA 3KLNA 2DW4A 3F8NA 4G6DA 4CICA 2P8TA 1SMYF 2HTSA 4U0VA 2QYOA 2ZFWA 1U2WA 4UV8A 4EM0B 3WGHA 2MH9A 2HQRA 4HOBA 4KDPA 3AAFA 4LB6B 3ULQB 2D2WA 1MD0A 3C3WA 3ZN1A 1O3RA 2DU9A 4EM2A 4HV5A 4A5NA 4L9JA 1BM9A 1CGPA 3E5XA 3F6VA 1FX7A 3EQLF 1ZYRF 2A68F 1MDMA 2EV0A 1ZGJA 3R4KA 4BXUA 4WK8F 1QO0D 2RKHA 1YS6A 4B8XA 4K2EA 1TNSA 3IRRA 3CTAA 2DO7A 2OAZA 2M45A 2DI3A 2M8EA 2ESNA 2F5EA 5ICCA 2R7DA 2RGVA 4HAMA 4WXDA 2RNJA 1MKMA 4O5VA 3SZPA 2G7HA 3H92A 1E17A 3M9AA 3F6OA 3WTSC 1YW9A 5DEQA 2FEZA 4I09A 3FXQA 4JBAA 2IPQX 4WXCA 1TW2A 1J7KA 4ETSA 3BDDA 1KA8A 2NAZA 1SD6A 3LAPA 2DLLA 1EH8A 1XB4A 1ON1A 2VE9A 2HYGD 1P4AA 4P55A 3F3XA 1EH7A 1J59A 1KU9A 1SFXA 4HZFA 2BE5F 2XROA 3FHZA 2DBBA 2K86A 5JR3A 2MH2A 3WG9A 2HGCA 2O03A 4U88A 4AVPA 1UHMA 4L0ZB 2OU2A 4MQVA 1XGMA 5LHHA 4KNYA 1ZLKA 5D8KB 1B59A 3L2CA 4HQEA 2LKPA 2KIMA 2PI0A
chains in the Genus database with same CATH superfamily
3KEQA 3MVPA 1RETA 2WB1N 1IGNA 3HPHA 4UUTA 3G6EI 2DFIA 2DMIA 3ROUA 1GXPA 3LA2A 2EMCA 3LMLA 3HGGA 4E7KA 1N78A 5J1YA 2X0LA 2L9NA 2YSPA 4CSWA 4LTYA 4G9YA 3TKYA 2YSRA 1G6NA 4HX4A 1X6HA 3HPZA 2W1OA 1YIOA 2RDPA 4DR3E 3PUBA 3KYLA 4KMUX 4D5CA 1LPQA 4JI8E 4ESBA 1UZCA 1I5ZA 3H3VK 2VOPA 1WPKA 4XLEA 2LVHA 2BVMA 3JTGA 4XOPA 3MCZA 2RVCA 1T0FC 3FK7A 2L2OA 3EUHA 2Y75A 2A69F 3JSOA 3UNGC 2O61A 3DBLB 4YHHE 3ESWB 5FKNA 3N05A 5IT3A 3KIOA 3RYRA 2JOXA 4IRHA 4KFCA 1JK2A 2ELHA 2XASA 1B9NA 1I6XA 4ZYEA 3GLXA 1A04A 4IKFA 3PO2J 1JT0A 2YS9A 2D5VA 2LBFB 3QYEA 2V86A 1IV8A 3KFWX 1ODDA 2H1LA 2J5PA 1I50J 4B3AA 1VQLI 2H6CA 2ZJ2A 2E34A 4F93B 2EOEA 5T6JA 1STZA 1G2HA 5E8IA 2DA3A 5E3LA 2PX9A 4J00A 2K02A 1QBJA 3X2QH 1WHQA 1YOVB 1LFBA 2Q2EB 4E7JA 3RDIA 3DLAA 2HKOA 3P9KA 2EN4A 5CVUA 5BQTA 2YU3A 4F54A 5IT9C 1XSXA 4GYIA 1V55H 1KU7A 3R0JA 1HXDA 4FETA 5J4VA 4LLLA 2Y9ZA 2RNGA 2EJ4A 3PQKA 4A2UA 1DUXC 4P7DA 1TF6A 5LGNA 3MWMA 4BJ6C 3CO7C 1TL8A 4OX9E 4H4KC 3FK6A 1Y6IA 4IJAA 2CQKA 3I3LA 1JHFA 1XTAA 1S9HA 4C9YA 5EGOB 1S8NA 1W36C 4EJWA 3S32A 1QGPA 1D3YA 4PGGA 1YI2I 4LJZF 1TW3A 4ABZA 4YFKF 1F5TA 1KYQA 1B69A 2QSFX 3LA3A 1RMDA 5BPIA 4HF0A 5J47A 3GFIA 3BTIA 3LSKA 4BU2A 1FTZA 2I5UA 1UG2A 4IHWA 3RCOA 2BW3A 1PKPA 2AO9A 3CD6I 5IPAA 3K6QA 1AWCA 4B47A 3GTKJ 2YU8A 3M8FA 1T4OA 4XK4A 5TRDA 2R92J 3L7WA 2DLQA 1YS7A 3M8EA 3BR5A 2KDZA 4DV4E 1ONVA 1BBYA 1R5ID 2FBIA 2GOMA 3MZ8A 2MBFA 2VBWA 3S3OA 3HOSA 1A5JA 2FOKA 3B73A 5CQGA 1BR4A 2FOWA 2EM6A 4XN3A 3L2WA 2E5ZA 4RA2A 2KOUA 2COBA 1X6EA 2HQNA 3CCRI 1YFHA 3S8PA 3J80C 2DA1A 2V6CA 2F5DA 2CPNA 2FRHA 3OS2A 4MLVA 1IUFA 3M07A 1QU6A 2LTRA 1HNXE 4RGRA 3L1PA 1R00A 1S7AA 3K4CA 3QU3A 4IS1C 5LMNE 1QVUA 3KEYA 4BL0B 2NUFA 3O8GA 1MZBA 1FLIA 2LOOA 4CCNA 1ZR2A 1XCBA 2R5ZB 1WHNA 1J09A 1H0MA 2ZXHA 1G59A 3GO5A 4HSTA 5HVQC 1MDMB 1MW7A 1KYWA 2LUPB 1RPWA 1VQ9I 3G2BA 2NYXA 3K6GA 1R6RA 1ULYA 2DMQA 3LSIA 4G7ZF 2MDGA 3EUKL 3J80Z 1FT9A 2EV5A 4A3EJ 3FXOA 3C2BA 2CGPA 3CDHA 3GF2A 2H6BA 1HSJA 1W0TA 3S93A 2C6YA 1L3LA 4MQ9F 1N25A 3K69A 4EGYA 2JP9A 1X58A 2JY9A 2AXTC 1Y39A 3WTYC 1BI2A 1UCRA 5A2QK 2HYFA 1RKWA 3LL7A 2HZTA 2NNYA 2Z9OA 1FWZA 1N75A 3DKWA 1DU6A 2DSYA 1J5EE 2EL5A 4AIJA 3KLOA 2J5OA 3IH4A 1IAWA 2JRMA 2L3JA 1F43A 3IRQA 1TP4A 4ZTJA 4ASNA 1TWHJ 1Z05A 3KZZA 3WODF 3F23A 1JKRC 4DV1E 3KYDB 4B3XA 2QLZA 3HSFA 3SFZA 3CUOA 2QQBA 1R4MB 5IYCJ 3K1PA 3QOPA 1FOKA 4L9TA 2PMZA 4M0VA 5EEGA 4M2ZA 2QWWA 1WJAA 3R61A 3THNA 2DT6A 5HS7A 5F1JA 1A1IA 3CJNA 4HPQA 2EJRA 2MSYA 4M3GA 3F72A 2K9MA 3JTHA 3WTUC 4M73A 1RESA 1HKSA 4XRSA 1HR0E 4AYBN 2EE8A 1Z0XA 3IKVA 5J4YA 1XGNA 4GRIA 5BNGA 4YRVA 2GLIA 3G1MA 3CCYA 4JP0A 4JX4A 4R2AA 1UELB 4EATA 1XD7A 4HDUA 2R7XA 2EWLA 4B43A 1TZLA 1P2FA 3IH2A 1XSDA 1AOYA 4ENJA 3J7AY 2JXPA 4II2A 1Z91A 4RDUA 1V3FA 2FQ3A 1B4AA 1OCPA 1MBGA 2TDXA 2R7OA 3WHCA 2Z1DA 2Z2SB 3OOUA 4Y4RA 3ZQ7A 5A2QZ 1G2FC 1EA3A 3HOXJ 4D0PA 2EPFA 3I71A 4A6DA 1WHUA 3BWGA 5F1RA 3CUQA 1YYVA 2Y2ZA 1YITI 4RLFA 3FMRA 1K78B 3CJTB 4EEFG 2QBYA 4U7BA 4ZZDA 5C3EJ 2EM9A 1GXQA 1Z6RA 3KE2A 4E6KG 4MLQA 3H36A 2P7CB 1FOXA 2OA4A 2NVYJ 4EV0A 2YTIA 1TWFJ 4CXFA 1IRFA 2EZHA 2EMFA 3JU0A 2I13A 2NUEA 3OL4A 1YX5A 3EETA 1T98A 2LDUA 5D8LB 2HXIA 1EV7A 1D1CA 3EPLA 5FKKA 2EM5A 4BMJA 3W6JB 3HJEA 4D7MA 2DA4A 2H27A 2EN7A 2UU9E 2LLKA 3L00A 3ABMH 3BTLA 5TGTA 2N8XA 1ZAOA 1S7EA 2CJJA 2XB0X 4CCOA 3CF5F 4LIVA 3H9JA 2Q8KA 2EP3A 4KIFA 3ABUA 3QQAA 3GTOJ 3C2HA 1D8JA 2N3HA 4KMFA 5FJ8J 3HOYJ 4LITA 3DP7A 3E7LA 3NQOA 4O5GA 1O3TA 1FNNA 3DTIA 1LJ9A 3U9GA 1W0UA 3NARA 2VOOA 3OYLA 4IX7A 3JCUC 5LBQA 2ME0A 1MSEC 4F7ZA 2ENHA 2KKOA 3V4GA 3RKQA 2JTVA 4OWRB 4R03A 1YUIA 2W00A 4LFAE 2H8WA 1OCCH 1YJNI 4ZDPA 2XVCA 1S29A 1HNZE 5K7HA 1BR2A 4DV5E 1S5LC 1HC8A 2GOXB 3HPGA 1BN5A 2IHR1 2XF5A 4KIBA 3BLYA 2DDAA 4N4OB 1F4KA 5EG0A 2DODA 1WJBA 2LF8A 3BJOA 3R0AA 2Z3YA 5E8GA 3ZMUA 1A1LA 2BV6A 1HDDC 3QP6A 2VC0A 5E20A 4JI4E 4JK1X 4IZZA 3IHUA 4UUSA 1RC7A 1U5TC 4Y33A 1D5VA 1XMKA 1MMDA 2KONA 1BBOA 3GZNB 2D1VA 4XLAA 1B72A 4I0AA 3NRVA 3VB2A 3I56I 1C0WA 4BE2A 4BE1A 2L9VA 3PSFA 4Y13A 4V19K 3TL4X 1ZRFA 2PJPA 4HW0A 2MG4A 5JLXA 2XKOA 3MFKA 5KNLA 2EPNA 3E97A 3FXRA 2V9PA 5M3MJ 2NVQJ 1NG6A 2RAEA 4ENKA 3I4NJ 2HOTA 2OQGA 3V8KA 3DFGA 2H8RA 2WBSA 1G3SA 1Y8RB 1Y8QB 2AQFA 3G1OA 4M9ZA 1W5SA 3E6BA 1BC8C 3BOQA 2ESHA 2R4GA 1VQOI 4XICA 2MC4A 2XPVA 3W6VA 4N9HA 2FJ1A 4AWXB 4HBLA 1U78A 5HS9A 2KHMA 1UBDC 2UUZA 1W1WE 5D4SA 2EOSA 4R2SA 3JRCA 1MBHA 2XUBA 3E5UA 4WWCA 2IGNA 1OPCA 4D9JA 3CCJI 3K4JA 4DR4E 4X65E 2BVLA 4EJTA 3ZQFA 1VQ5I 1WJDA 3WHBA 5KL5A 3P9CA 4HTGA 4Y15A 2A6HF 4I6ZA 3ZN0A 1MNEA 4MLOA 3VYSB 3BQYA 4A3BJ 4FISA 4XLFA 6PAXA 2L4AA 1PUEE 1OR7A 2WZOA 2P4WA 1ZRCA 2QQ8A 3Q0UA 1RI7A 1H9GA 3L9FA 3MKLA 2GIVA 4M71A 2WV0A 3K7AJ 2LK2A 3ZXSA 2EBIA 4GGGA 1NH3A 1GUUA 2DIXA 2ZXJA 2EQ0A 5KHDA 2DMUA 3OYCA 5LGTA 4GKKE 1IW7F 3MN2A 4F52A 1WQ2A 1AHDP 1IXCA 1OCTC 4JX5A 3L2QA 5DCMB 5LLQA 2L9RA 1G3YA 4HYEA 2A61A 3A0BC 3GUDA 4M6YA 1HW5A 4XONA 5GAEJ 1A1JA 2IGMA 1T6SA 1GLNA 2XAQA 2EQ3A 4DW6A 1W5TA 4OOGC 4PCQA 1TLHB 2EOHA 4BBRJ 1IO2A 5AE1A 1BIBA 1FIPA 4L5IA 2L3CA 5A69A 4HEA2 5HNHA 4G8XA 3P5JA 1ZK8A 1VNDA 2M0MA 3PFYA 3OL3A 4LFBE 1BR1A 4OIQF 2HFHA 2RREA 3BC8A 3K1NA 4JYAE 3FKJA 2VKDA 4HSRA 2OZUA 4AM3A 2YTFA 2ISZA 1RZ4A 1V5FA 3V7RA 5D5XB 2EK5A 2KIUA 2GZWA 1WJPA 4PJJA 1GDTA 4UNOA 2W84A 3K4LA 4NQWB 2M4GA 2HVRA 1EJ9A 2X4HA 1YO5C 2V1XA 2EQ1A 5E18F 2IW5A 4IJDA 2YR2A 2ACJA 4B3TE 3ABKH 4HX8A 2Y0SA 4X62E 1RIOH 2XAUA 4Q28A 3BY6A 3S1MJ 4G7HF 2XIGA 2E5LE 5IV8B 2EN8A 3HPSA 5CYVA 1BIAA 2V1NA 4KICA 1U8BA 2ZMEB 3LQRA 1WRJA 2DMTA 2LFBA 3BG7A 4N9IA 5EF6A 3FISA 4PGHA 5KL3A 5BR8E 1YW7A 3VYTB 1ZU1A 4RBOA 1FOYA 4BEHB 2WCC3 2VBZA 2HC5A 5CPRB 1Q1VA 1XNQE 1ERDA 3HG9A 1QU3A 2M87A 2JA6J 2D1HA 5L3FA 4A3MJ 2VONA 4PK4A 3JRIA 1IN6A 1KQ0A 3CLOA 3F21A 2EPAA 3G73A 4XR6A 1YYWA 4M6VA 3ZPLA 2B7EA 3BT9A 4DBQA 3BZ6A 2HDCA 1JI8A 1I94E 3TO7A 1OYIA 1FTTA 1X2NA 5D5WB 1D5YA 1I39A 3T1YE 4ZYAA 3H3ZA 5KL4A 2NNNA 3AKZA 3H0DA 4M9VC 4X0GA 1RR7A 1DP7P 3S2DJ 3A4CA 1QPMA 2CW8A 5KK1A 3QPTA 2HOEA 3V7CA 4B3SE 2OTJI 1JGSA 3K1MA 2RSIA 2YTQA 1ON2A 2KL4A 2RV8A 2CUFA 2FA5A 2PEXA 2W82A 3EUAA 3QODA 4PJ0C 4ZYGA 4W1UA 2DA7A 3ECHA 3OS0A 4V2FA 1Z21A 3MKWB 1R71A 4IHXA 3ASOH 1JKQC 1FBQA 2ZNYA 3QWLA 4M3EA 2EMYA 3H35A 2E1CA 2EN1A 1AA7A 2QSHX 3KX2A 2O9LA 4U7DA 2FE3A 2PFBA 4LMYA 5H20A 3VWBA 2BY2A 2JPBA 2V9KA 5IYBJ 3SYTA 3P1XA 3Q9SA 2M8GX 1IN5A 3BR3A 5KL7A 4CH7A 2EORA 2NVXJ 1ETXA 1FMWA 2QVOA 3I53A 1N3GA 2LREA 4WX9A 3WTVC 2CS3A 3H5RA 5J1UA 2BY3A 4HNTA 2AS5F 1FIAA 1XCVA 3DPLC 4FX4A 2J7JA 2WBMA 3VDXA 3VSKA 3VHTB 2JVGA 3RPQA 1STUA 4AC0A 4MHGA 2F5CA 1ZR9A 3SFIA 2ADRA 2V89A 4R2RA 4Y52J 3WTZA 1T33A 4RAZA 2W24A 2DDBA 4RM3A 1ETYA 2DJNA 1HCRA 5BMZA 2V83A 3OS1A 3OSGA 1MMAA 1YYKA 3HRSA 4XM3A 4P96A 2IBDA 3F0CA 1Y1WJ 4HF1A 4CDGA 3RJPA 1H88C 4R8HA 1W4MA 2L01A 4L18B 4BDZA 3ABTA 4NC8A 2EPRA 4YIFA 2ELJA 2XSJC 4BBSJ 1IG7A 5HODA 4MEXF 5FKOA 1OCOH 4BY7J 1QRYA 1YX3A 2DFFA 3O6BB 3TO9A 1XMAA 1YJWI 3LMMA 3GTQJ 3QAHA 1O3SA 3QOEA 4NHRA 3LFKA 4BC9A 2DB2A 3B6CA 4U0WA 1X1AA 5FRNA 1U5TA 2DA6A 4TUIA 4BHBA 5L3DA 1X1BA 1X3CA 1B1BA 2CWEA 1WCMJ 4O3MA 4NXNE 3HQ1A 2K7IA 4WYQB 2AQEA 2RN7A 1PJRA 2GBYA 5F04A 1YZ9A 2UZKA 4PZJA 4ZDOA 1MBJA 2NOJB 3I64A 2FF4A 1VQMI 3NEUA 1OLTA 1AU7A 1U9OA 5HLGA 4A12A 3GZ5A 2HZDA 1VF9A 3BZKA 4GFBA 2IS2A 4X9JA 3KP3A 3CMEI 1HKTA 3ZQQA 5GP9A 2V7FA 3LSGA 3LA7A 2BGCA 3HXLA 4XQFA 4CCLA 2JZYA 4PFOA 1ZBQA 2GXBA 2YWQA 2BHYA 3W6KB 3OYJA 4IRGA 1IJWC 5GADJ 3IP4B 3WGIA 2IS4A 2VIXA 2P5VA 2E1MA 2B63J 1WJEA 2GLOA 1G8XA 3LQQA 3HSRA 4PUSA 3JRBA 2KPMA 5L3GA 3HHGA 2HQ5A 2NABA 4DR1E 4KA4A 1JJ6C 1DP3A 1J9IA 4BQOA 2A25A 2X6YA 2WAQA 4YIIA 3CC2I 2Y30A 2VB6A 2WBUA 4HNUA 2CG4A 3GVAA 2PN6A 1SAUA 2JRTA 3H0GJ 4EM1A 4Q48A 3MZYA 3BG6A 4C2UA 4LOCA 2L9SA 5B66C 2L4MA 2VI6A 4QPOA 1W5CC 3ADJA 2E7WA 5F64A 2MD0A 5DCMA 3PIPF 1PP7U 5FLXZ 3RSNA 4P9FA 2B0LA 4NQWA 3M7GA 4X8WA 2VPLA 4XLCA 5J3LA 1KYZA 1N32E 5C44J 4OIRF 2BEOA 1IBME 4YFNF 5FB2A 1E2XA 2L7MP 1PVEA 2VJIA 3DPUA 5BPDA 2MC6A 1OCRH 1QNTA 1TC3C 3SEQA 1F1ZA 3O8HA 5DM6F 3SDGA 1LE8A 1VQ7I 2CUEA 2V85A 1PJQA 1T38A 5L3CA 1G3WA 2L54A 4MTEA 2NRAC 2RQLA 1ZGAA 4CUGA 1NK3P 2LY9A 2R7FA 2EPPA 3OTOE 1SC7A 3K10A 3SXYA 1MJBA 2DPUA 5CFFE 3D5LA 2V79A 4XKCA 4DYQA 2RC4A 4I99C 4UVBA 3RQIA 1X47A 4RM2A 4YEJA 1MNMC 1MH3A 1UJ8A 4BE0A 2YTPA 2EIMH 3V8JA 3PFIA 1UHZA 3ZOBA 2W7NA 2EL6A 4S04A 2X6OA 4BXXJ 1MBKA 2EM3A 2LF7A 3R60A 3I9V2 3I0TA 2R3SA 1FZPB 4CO8A 2EILH 1P92A 3QPHA 2LTSA 2M7QA 2ZSHB 4NNJA 2L33A 1X3UA 1WGXA 1YQAA 3TP0A 1R23A 2EWNA 2IS6A 2CFXA 4L9NA 3BQZA 2LUQA 1VI0A 2FSWA 2R7SA 2KHXA 4AIHA 3HTUA 3OV8A 1DU0A 4PSXA 1XPXA 4ZC3A 2A6TA 2LD5A 4CCMA 4P9UA 2YTJA 2JR1A 5IY5H 5DD8A 1FSHA 3VFZA 1WVRA 3QYBA 3OYNA 3EYIA 2EN6A 5AASA 2DPDA 1YTYA 1YG2A 2P5KA 3ZCOA 2LV2A 1U3EM 1BJZA 1FYKA 3TP3A 1P9QC 4I7HA 5LHIA 2EFQA 4ZJZA 2EL4A 2MDRA 5EG0B 2ZJQF 4CYDA 2JWOA 1KQ9A 4IF4A 2M7BA 4BHCA 2Y9YA 5ERIA 4DZPA 3J81Z 1DDNA 4AIKA 3HRUA 3VEPA 1PDNC 4P78A 1P47A 2GQQA 4L5JA 2EPZA 3HHHA 1AH5A 2O0YA 2Q0OA 4MO7A 1A1GA 1LDKB 1ETQA 1HLVA 1GVDA 3F8MA 1BB8A 2ELKA 3AG4H 4KN7X 1BW5A 2K27A 4OIPF 2W85A 4G12A 2EOXA 2DQRA 3M99B 2MC5A 5FD5A 4BQQA 1FJLA 5A6BD 4PJNA 1LLMC 4AD9A 1S72I 1RNLA 2V88A 3PUFA 2HGHA 2Y0SN 3QRFF 1PDAA 1ZARA 2BBGA 1SMTA 3CLQA 4PSWA 2X9DA 4Z6YA 1JKPC 1ZH5A 3RZOJ 4UUSB 3DCFA 2MD5A 2YRHA 1A35A 3K9TA 3ZQCA 3B6AA 3GWZA 5A6AA 3CC4I 4FASD 3GEZA 1ZREA 4F91B 4DV2E 4IPAA 3PJRA 4FK5C 5M5WJ 2A3SA 5IXMB 3PL8A 2HVQA 4FE4A 1WKMA 1IRGA 2YTDA 4UY8I 5IT9K 2F4MB 5AE2A 5EZGA 1HF0A 1DPRA 2R7UA 2JOBA 1HW2A 2F4VE 2O6GE 4R2EA 2X1DA 3ZMZA 2NVTJ 1LVKA 3I55I 4XLNF 2NXNB 2VXDA 5DS9A 3BR6A 2EM8A 2MKDA 1OYYA 3MQ0A 4LLGF 4UUVA 3NWSA 3HEFA 2HWVA 2GA2A 2KLOA 3H5AA 2PBIA 2PRTA 1B6AA 2BOLA 4A0ZA 1HOMA 5GPAA 4OAZA 1U9NA 4ON0A 1SR9A 4KUMA 2TRTA 1VFCA 2HI3A 2DYSH 4B3ME 4JI2E 4DR7E 3CQZJ 2A5YB 3L09A 4LFCE 3HSEA 1WJFA 4R2PA 3ADLA 3DPTA 3KWRA 4JI0E 1SVLA 3FM5A 2DT7B 4MEYF 2LMDA 4RB1A 2XAHA 4F55A 3T1HE 5F0FA 4R2DA 1JE8A 3A03A 3CDLA 3C18A 5A6JA 1CF7B 1LEAA 2E19A 2HQAA 5ILVA 3IKTA 4HQMA 4D1QA 1R1UA 3DTKA 4E7ZA 4FCYA 3CF2A 5JVGF 4HLYA 3KPHA 1RR8C 5DUIA 3F8CA 4YG2F 1PJTA 5AC5A 1MMNA 1FKAE 4FTHA 4EVIA 2EOFA 2BZTA 2HS5A 3JW4A 2EOZA 3BCAA 4HF2A 3S2HJ 2AXLA 3QU6A 4NUBA 3KP4A 2MABA 4D7NA 2LP0A 2KP6A 1J75A 1XNRE 4RGUA 2L92A 3MSWA 3ZQGA 2BHZA 4AQYE 4BYYA 3ECOA 1R1TA 2EOIA 2DK8A 3DJWA 4GZNC 2RQQA 4M72A 1ZKGA 4F3QA 4XNFA 2IA1A 2HDWA 3LSMA 2BYVE 4A3KJ 1UG0A 3TQMA 2LBSB 4IHTA 1DI2A 1XMOE 1Z3YA 4LF7E 4G94A 4N4RB 5CQEA 3V8LA 2X6XA 2CW7A 2ADUA 5DYMA 4IVNA 1Y0NA 4HRIA 3KP7A 4ZH4F 3VODA 1BL0A 5FLMJ 1X49A 3FDYA 3K4KA 3Q3SA 2VQCA 1ENHA 2O7OA 4OINF 2ZJPF 2NOGA 1UILA 4LU9A 3UK3C 5IOZA 2I9IA 4IQ4A 1O7LA 4MGRA 2ME6A 4C3IJ 2M9AA 4BEHA 2MYSA 2EZ6A 2PMHA 4BHPA 1I3AA 4BXFA 4AUXA 3WE2A 3LLHA 3ZGKA 4IHYA 5LRRA 5EYRA 5ILSA 3R6SA 3CCLI 2GXAA 3KCCA 2PJRA 2DTZA 4LF9E 3S16J 2IP2A 3EPHA 2LG4A 1EH6A 1WH7A 1JK1A 2H09A 2QKMB 2EM7A 1ZBTA 2XDVA 2CH0A 3W2VA 2JT1A 4G6QA 2LMZA 4XN0A 1N33E 3OYHA 1IBLE 2QF7A 2JQ7A 5KVRA 3A1YA 5D5VB 2HDDA 3HTXA 5JLWA 2WY7Q 1T8IA 4DR2E 4TV7A 1ZTRA 3I59A 3EYYA 2LE2A 2E1OA 2V1UA 1XDUA 2COMA 3TDZC 2VQGA 1X4PA 4A93J 3FMSA 1ZG1A 5IP9J 3ZQLA 1U6GA 1F2IG 3FBNB 1IRXA 1ZHFA 4RAGA 4ZZLA 3BJAA 1U8RA 3ZMTA 3CZ6A 4YELA 2LCEA 3JREA 3OIPA 1MSFC 4E70A 4LK1F 4LB5A 1R7JA 2I10A 5IYDJ 2OZ6A 2R7TA 2JYAA 2VXZA 1OQYA 1D0YA 2IVMA 5CVJA 4LD5A 5EDNA 2F2EA 1G4DA 5HLIA 3FIGA 3JTZA 2CQQA 1KQ8A 3F6HA 2LVSA 5JI6A 2PQ8A 3IAS2 3JSPA 1R5GA 4QLCU 2LC2A 1N36E 2UUBE 3JAMK 3SZGA 1NHAA 3JRDA 1USSA 2HPMA 1YIJI 1NEIA 3M1EA 1VQKI 1VQPI 3OSFA 4X66E 2XF7A 2HPIA 3FM3A 3GMEA 3HRMA 4PDKA 3BJ6A 4LK0F 1JUPA 5CVVA 1LDDA 2ID3A 4BC7A 1S7OA 3K4NA 4RGSA 2YTGA 3E3VA 4BH9A 2CUJA 2HYJA 3E0JB 2F6CA 1USTA 3SHFA 4IL6C 1VTNC 2R0QC 3C7JA 1OYWA 3V42A 1FYLA 3MD2A 5D4RA 1JHHA 1V5EA 2MW8A 2HXOA 4B09A 3D1NI 1Y0UA 1TBXA 1H89C 2M7AA 3WTTC 2L6MA 4ESJA 3MMYB 5D6EA 1IXSB 2I8DA 5DD4A 2ZO4A 3GW2A 3I58A 2VN2A 3GFJA 4GEQB 3ZQIA 3HUGB 2ID6A 3DEUA 5H6RA 3CMAI 4DZJA 2MLKA 4S0HB 5DDGA 4XOTA 5HOOA 4QPQA 2JA5J 3TQNA 2VL8A 2IGOA 4DV0E 2CMPA 1BOAA 3JRGA 1IN4A 3BTCA 3OMYA 5DCFA 4X6AJ 2E60A 5FD6A 2VKVA 3UKGA 4V2GA 1HW1A 3PSIA 2QGUA 4LF6E 1KU3A 3HDDA 4XMYA 4I0BA 4IOAF 4QTRA 1IC8A 3BTJA 1KONA 3W3CA 4ENMA 5AONA 2KFDA 1E3OC 1OJLA 1JT6A 2P7VB 4RGXA 4EJUA 5E1WA 2PMZN 1JKOC 3ZMDA 3GLLA 2KJCA 4CCJA 3D0SA 2L3DA 4A0XA 1PUFB 2EOQA 3RKXA 1Z7UA 4BQAA 2STTA 1OFCX 2JVHA 3J80K 1LFPA 4JX6A 3K2ZA 3N97A 2K3PA 1VQ8I 4DR6E 3CUQC 1T56A 1CQTA 3LWFA 4L8NA 3MKZA 3F9KA 5B3SH 1KGSA 5LD2C 3RKWA 3VYXA 3DKYA 2JSCA 2CT1A 5FROA 3CUQB 3FWEA 2RTXA 3E5QA 2F48A 4LG0A 2DT5A 3WTWC 4B3RE 1L0OC 5EEHA 3TOBA 2JPAA 4JI1E 2KDOA 2K4BA 5FFZA 4EQQA 5E3OA 2EA4A 1I1GA 5B1BH 4B4CA 3A01A 2B9SA 3J81C 3S15J 4E7SA 4HLXA 2VJ5A 4MFEA 1Z67A 3LSPA 3O3KA 2KQRA 2EMBA 4IHVA 1BBGA 2QUFA 3QPSA 2CSOA 2JUCA 4CGZA 3BPVA 3HM5A 5F08A 4Q35B 1FP1D 3Q9VA 2LJHA 1ZR4A 3TOAA 3IWBA 2IXSA 1FBSA 2EINH 2L02A 3K4BA 2B3TB 2BBYA 3C1DA 5BOXA 1FYMA 3H09A 2FNAA 2W57A 4DV3E 1SEUA 3TEDA 1AKHB 1IDZA 4MTDA 3AG1H 3T8TA 5K1YA 1TN9A 3DV8A 1I3QJ 3M1CA 2HHHE 2EPXA 1BI3A 2EFPA 2XKPA 1K4TA 3HRTA 4DOZA 2E1NA 1L4SA 2K4JA 2OQRA 3IL2A 3C2GA 2B7TA 2V1DA 3WE3A 2WTEA 1K6YA 2E2JJ 3E6CC 2EV6A 2LH9A 1GHCA 2PMUA 3GFMA 2FX0A 1J2XA 2XRNA 2CU7A 3Q0WA 1YW8A 3PIOF 5AIQA 2DAOA 4CYCB 2WAFA 1SAXA 2K9SA 2VJJA 2L0KA 3VSLA 2QKLB 3A01B 4DQ2A 2JA8J 1Z1BA 1YSAC 3WU1B 1XG1A 1DGRM 5HLTA 4OIOF 1RQ0A 2HU9A 4DNCA 5IOYA 1G3TA 3TDUC 2UUCE 3JRFA 2DYRH 5LRSA 1B72B 4GYGA 2A6EF 3IC7A 2Y48A 1XSVA 1QZEA 2R1FA 2NUGA 3IWFA 5L3EA 2DMYA 1ZAAC 3DU6A 4IXAA 4Y7NJ 1FP2A 1WJ5A 1ZQ3P 4BKXA 5D6FA 1D1BA 3ZMSA 3G71I 3GFLA 2O3FA 4LF8E 4CA0A 4I01A 3OIOA 4Q5SF 3E1SA 1E0EA 2QENA 4IQJA 4KN4X 1F36A 2V9VA 1TWCJ 2R76A 1YHQI 4F9AB 1X6FA 1K83J 4M3DA 4ESFA 2Q8UA 1T4LB 3PQJA 4G7OF 4JI3E 3ZRGA 1X1CA 3CCVI 2K85A 3K2AA 1FC3A 2VT3A 3D5SC 5FFXA 1XC5A 1TT5B 3BR0A 5GTIC 1DGCA 4CZZA 2VJ4A 4QIWN 1FY7A 1T4NA 3OYGA 4XRFA 2UXDE 3KETA 1GV5A 5ICEA 4CHUA 3V7SA 3E6MA 3ONQA 1A31A 2FMYA 4M6XA 2EMLA 3BR2A 1Z1DA 4HG2A 1R49A 1UMQA 2FUG2 2IAIA 1IQSA 2GIZA 2DTRA 4DGWB 2JN6A 1T08B 2UWMA 2L8TA 5K5OA 2DFHA 2F4IA 1PJSA 2XSDC 2O8XA 4HDVA 1X19A 3HBLA 3HYIA 5KAFC 2DFEA 3H3UA 2XAJA 2F4OB 4L0YB 3FIWA 2EMHA 2KMUA 1J26A 3HB9A 2VBXA 4B1RA 3I4MJ 4IEJA 5GAGJ 4LIUA 4AVZA 2QSGX 1E3HA 1IBKE 1ETVA 3A02A 2XC7A 1WSUA 4JI7E 1ZGWA 3WU2C 1REPC 3J7AO 2EFOA 2WC2A 2XGXA 5F0CA 2EMGA 1SANA 2P6TA 2K3FA 4BJTA 2DK5A 3VYRB 5HDGA 3VYUB 4LFUA 1QVTA 4GO1A 2BXYA 4OOIA 2CRGA 1P7JA 2CW0F 3KP2A 3NWTA 3OYEA 3W2AA 3FXUA 2B7VA 1X4OA 3PNYA 1T39A 4L9VA 1MMSA 1GVJA 1SD7A 2VODA 5JHFA 4A3IJ 2XB5A 1P7IA 2JMWA 2M30A 3ZOQB 1FBUA 1FSEA 5J6XA 1J0RA 1O3QA 4A0YA 1XMQE 1WXRA 4RAYA 2VASA 3ZQHA 3HOWJ 2M34A 3S14J 2FMLA 1R22A 4N4NB 3IH3A 4UHTA 2F5FA 3MHSC 3MEXA 2LYCA 3P7NA 4E7IA 2VE7C 3RKYA 4P5OA 5LL6R 2EIJH 1XGOA 4WXHA 2IRFG 3SZTA 2DCEA 1LEBA 1R5HA 5D5UB 5A6BA 4L5EA 1TF3A 1LFUP 3ZMVA 2PG4A 5DNYA 2CTDA 4M30A 3CO6C 2ZM6E 5B1AH 2F8BA 2ZXWH 3RPUA 1T0FA 2LTPA 3OYBA 4HA8A 4GXOA 3BR1A 4BNCA 2X48A 2ZSIB 2VQFE 2R5YA 5J40A 2M1SA 2K9NA 2IJLA 3IUOA 3OWTA 2XGEA 5KL2A 3FMQA 1D1AA 1V4RA 2YX4A 1Z3XA 2ZBKA 3GYHX 1KJKA 2JA2A 5L3BA 3B02A 5FLXK 2YU5A 3ADIA 2GAUA 4BCAA 2ZC2A 2OD5A 1LE8B 5FGMA 5EEAA 1R1VA 2WWYA 3VPRA 5E3NA 2FGGA 1VZ0A 1MEYC 4LF4E 3KZYA 2OF7A 4UB6C 4EMSA 1P6RA 3RYPA 5F3WA 2LY1A 2M4KA 2YT4A 5LEJA 1W7PD 2R7RA 3HOVJ 2KRFA 2M5WA 3LFUA 1WFXA 3I5UA 4QSHA 5CLSA 2IA0A 5DUKA 3LNQA 2VQEE 2STWA 2NS7A 4A69C 2ETHA 4UV9A 3U2RA 2OV7A 3GXOA 1A6IA 2QQ9A 3EPZA 4KISA 2F5VA 2OC6A 4G6TB 1IXRC 5AIPA 5GPCA 2R7VA 2OTLI 1NTCA 5FLVA 3BCBA 4M74A 4R79A 2IT0A 4Y17A 1LB2A 2E2IJ 2KZGA 1TNTA 3FKIJ 1U0JA 2P5LC 1JUMA 1WJCA 3CP2A 1ETWA 2R7QA 1RRJA 2FD5A 3DEWA 2EPMX 1EKEA 5KL6A 1HBXG 3HOUJ 2YU9J 2JSPA 1YLFA 2MLGA 2ENCA 1HKQA 4OAYA 1X1DA 3CP8A 1Q1HA 4OMZA 1B9MA 3GTPJ 5GAHJ 1U5TB 2G7UA 4BGDA 3REOA 5KAIC 1JTYA 1OISA 4R2CA 4AYBA 2WBTA 2X51A 4XSXF 2R7WA 4Z2YA 2E71A 3ML6A 2DQLA 1B8IB 3JAMC 2IEKA 3BROA 3HOTA 3H5NA 2MA3A 1IDYA 2JWTA 1ORKA 2EB7A 3BGHA 1W7PB 2HR3A 2W25A 1ZRDA 2L7FP 5LGUA 3T5XA 4KITB 1O57A 1JXSA 4F92B 3EDPA 2HKXA 1TQMA 1M1EB 2Q2EA 3MAJA 1SD5A 2H94A 2YUSA 2CV0A 1JTXA 2ZCWA 1Z77A 2OJED 4HV6A 4NB5A 1LNWA 2H1KA 2JVAA 3DBRB 4Q47A 1XMXA 3TGNA 5F27A 1X1PA 5J8CA 2YTNA 2YPNA 1X3WB 4U87A 2M3AA 2JUGA 2CV1A 2XF6A 4H0EA 3IWDA 1QZZA 4A3GJ 2LY2A 1LUJB 1BC7C 4F6NA 1A1HA 2EMKA 1MMGA 5JFRA 5K5QA 3CCUI 2MC3A 3KYCB 4RB3C 4AU7A 2Y0MA 1D8KA 3G1LA 5LMUE 2HEOA 2ENAA 3U21A 1BJAA 4KIGA 3CMYA 2BW3B 5HDKA 1RUOA 4HEIA 4IOCF 4XKWA 1XN7A 4FQGA 5IP7J 4WSGA 2YSOA 4EGZA 2V6EA 3ECRA 1TQPA 3KZIC 3JR9A 2EM0A 3C6KA 2KJBA 4ZYHA 4C30A 2EMWA 1QZYA 4WSPA 1YYOA 2VBYA 4UXNA 2XGDA 3IWCA 3FXLA 1K79A 1ETKA 4ANJA 3ERMA 1W7PA 3E6DA 1D0ZA 2E1MC 2VT2A 3DTEA 2XPWA 1IV6A 1IZ1A 5B5EC 3F6GA 4JYKA 2OCEA 2E7XA 2FU4A 3H9QA 4DMIA 2YTEA 1R36A 1R58A 3HUGA 5M5XJ 2O5RA 3I4PA 1YRNB 2K9QA 5DTDA 3Q5FA 2KRHA 5J8FA 2RQPA 3WGGA 4EJVA 2E1MB 2ODRC 3LSJA 4N0BA 1G2DC 5A6KA 2R5ZA 5LEKA 4BUPA 5CVRA 4BACA 4JQFA 4MNUA 4O6JA 2XHKA 2O8KA 2PLYA 2HOSA 2EIKH 3J7YJ 2GA1A 1X2MA 3M3YJ 2YX7A 3QP5A 2VRDA 1SFKA 2VKEA 4J01A 3BP8A 3HOZJ 2RS7A 2M2EA 5ICGA 4XBFA 1PP8F 2ZMEA 5J1RA 1F9NA 1MBFA 4BAYA 1XGSA 3JRHA 4RMNA 4I2OA 2A5WA 1R4NB 4EJOA 4W97A 1XS9A 3OY9A 1GZ6A 3L2RA 4K0KE 2L2MA 2ECCA 1QA6A 1UAAA 2FTXB 2LO3A 5FO5A 3EPKA 1NG7A 4NXME 3GBGA 2UXCE 2UXNA 2DA2A 2QQAA 2OUMA 1IN8A 3EQ1A 3H9GA 5F0HA 3CCMI 2HTJA 3SJMA 4NDLA 3CJQB 3GZ6A 3RZDJ 1Y1VJ 2V87A 2AHQA 5CKTA 1UN6B 1PYVA 2W4SA 2FBHA 2XV4S 5HLHA 1EF4A 1DPUA 2V8QB 1IQOA 2GXGA 1MJ9A 2H36X 3IV5A 1LKXA 4DR5E 3LSTA 1MBEA 1T2KA 1K6OA 3T8RA 2N3GA 2HOAA 1A6QA 1I1SA 4R1HA 4X64E 3WTXC 1BI1A 3H1CA 1GT0C 1CF7A 4KZSA 3HKZN 1YPNA 3N4MA 5JHUA 3OOPA 4RB2C 1Y56A 2EA2A 5E1XA 2FBKA 4BS9A 5LHGA 3LAJA 5ADZA 3ISPA 2VC1A 1YE9A 2EZIA 3BG5A 3K0LA 4XKVA 4IRIA 2NA2A 3O2PE 1APLC 1N34E 1VQ4I 4A3CJ 3W2WA 3GX4X 1QPIA 3T1BA 1UB9A 2XRLA 4XSZF 3DQVC 3FF5A 3LSHA 3OIQA 2QCOA 5CVIA 3QPLA 3PNVA 3AL0B 2GHFA 5GTHC 4XL9A 2D45A 4RHBB 3DU5A 2K9LA 4ENNA 2QZ8A 3NAUA 4FE7A 5HNFA 4LLNA 3RI4A 1AKHA 2NS0A 2L2NA 2VQLA 3BIDA 2G9WA 4CYCA 2M0CA 3BZCA 1SFUA 2L7KA 5E79C 3FXKA 5CJ9A 4LGWA 1A1KA 3J7AG 4JV5E 2P6SA 2EZKA 2TCTA 2BY0A 2E2HJ 2LRDA 3FX3A 4XKBA 2PJRB 2FNPA 2LR8A 3GTGJ 4NC6A 2ZB9A 3ADGA 3HL2A 2KISA 3THOB 3MZHA 3HTSB 4XIDA 2NVUB 9ANTA 4NBQA 2A07F 2YTOA 2X1EA 2P0WA 3DF6A 1K7AA 4JI6E 3FXMA 4FX0A 3OYAA 1H8AC 4RLQA 3S3NA 1KU2A 3AFHA 4A5MA 2EMIA 3J81K 2EFWA 1J5YA 1HNWE 2A05A 3F8BA 2KRCA 1OKRA 4QWQA 1MJAA 3IWZA 5C4XJ 4RAFA 1P4XA 4GCVA 1TWAJ 4MIMA 5AE3A 1BW6A 3EUHC 1NK2P 2OCCH 3AUZA 2WA0A 1IN7A 2LSOA 5E1ZB 2UXXA 5F6FA 1HSTA 1RKTA 3CCQI 3J7ZI 1SFOJ 2KIFA 1OMIA 3JRAA 3ZP5A 3RMPA 1LVAA 4C3HJ 3DKXA 2BY1A 2EZLA 2V26A 1ACIA 3OMLA 2GWRA 4BQNA 5ILUA 1SFEA 2EQRA 4B48A 4IHSA 1I27A 5HS8A 2EM2A 1V54H 4RS8A 1MGTA 4ZYDA 4E4HA 3CCEI 1FPQA 5ED4A 3WU0A 3RPUD 5K5RA 2Z33A 3I59B 3PM1A 1O4XA 1T95A 1YJ9I 2E35A 3ERED 3BG3A 1JJ8C 1LQ1A 1IF1A 2G0EA 1TQIA 4Q4ZF 4HX7A 4OU0A 4AIDA 2WV1A 1IRZA 2BB8A 1ZG3A 1X48A 4I8OA 5EGOA 4D5FA 4X1EA 4J19A 2IA2A 3ZR8X 1BI0A 2KIQA 1OCZH 1UFMA 3ELKA 1IUYA 4I98B 4JOMA 2CSHA 3TO6A 3CDIA 5JVTA 4BDYA 3BF2A 1VQNI 2L5QA 4DYRA 2DJIA 3G3ZA 2CQ7A 2IGKA 1QHGA 2K7LA 4KT5C 4C2MJ 4WPYA 3F8FA 1D0XA 2JJ7A 1OR7C 3DXJF 1O0WA 2XAFA 2EPOA 2JPCA 2ZKZA 4P1WA 5DM7F 3GTMJ 1TTYA 4II3A 3P9IA 3RIRA 1S3JA 1O7FA 2FXAA 4E7LA 3DEEA 4A6EA 3S1RJ 2XPUA 5K7FA 4WF2A 2LNBA 3OYKA 1BOBA 1Z9CA 5E17F 2ZMEC 3MKYB 2EH3A 3K4MA 4FT8A 2QEXI 3U1DA 4BBYA 1RUNA 3HKZA 3DBHB 4CZCA 3T0YA 3S2WA 1ZG5A 4M9SA 4JI5E 1TWGJ 2VKHA 3RTRA 3HIFA 3FBIB 5HDNA 1Z7LA 2ZJRF 4OMYA 4UVCA 3VOEA 1ZLJA 2ICWG 3KEOA 2DOFA 2VE8A 2ISYA 4M9XA 2YPRA 3K70C 2YRKA 3BBGA 1FOWA 1SD4A 1POGA 2DA5A 4IO9F 1PUFA 1H9TA 2OPTA 2RSMA 3SQNA 4TUGA 2M1BA 1IMUA 2ELYA 1WI9A 4UVAA 4RB0A 3CCSI 2JA7J 4M3FA 3PNTA 5TJJA 2QM3A 1FJGE 5A2QC 2DXIA 5H2FC 3KP5A 3FZVA 5FKLA 4S05A 2EMXA 5H6QA 1SVMA 3GTJJ 1A36A 4YFXF 2L2KB 3QYFA 4F9CB 4I02A 4LG0B 2K4VA 3AG2H 4XLPF 2VF1A 3CMMA 1TT0A 2BXZA 3WG7H 1XX5A 4XORA 2EOYA 5BS6A 1YRNA 3HC7A 4FHTA 1DQ3A 4GKJE 5IT9Z 3DF8A 3JAMZ 1ZN2A 2ECBA 4DBRA 2M9HA 2EPKX 1Z6TA 5LFAA 2VUMJ 1S6LA 2Z5UA 3F22A 2EFNA 2WAEA 5DV5A 4LG3A 3C6MA 2DRPA 4XRSG 1R9TJ 3CJRB 2X6WA 1HQCA 2Z99A 3KP6A 4DYCA 2ZNZA 4YY3E 1WWXA 1LDJA 4WCGA 4C3JJ 4A3JJ 3S1QJ 5ICFA 1XDSA 2OBPA 1P4WA 2Z16A 1K78A 2QBYB 3COAC 3D5RC 5IP6A 4KYWA 2L7ZA 2NS8A 1X5WA 4NHJA 1UHWA 2WADA 2E72A 1EKZA 1BA5A 2M4IA 2VQHA 2KZVA 3AG3H 4KJZA 1WZ2A 3AL0C 3I54A 3UR3C 5KCMA 2DN0A 5E3MA 2EPLX 2R5YB 1SVOA 2CO5A 2XAGA 3TW6A 4U0YA 2CYYA 3A2KA 4R8OA 1ETOA 1QQIA 3BPXA 4GDFA 3KLNA 2DW4A 3C4BA 3F8NA 2WAQN 4PJMA 3M8JA 4G6DA 4CICA 2P8TA 1JGGA 2EN2A 5TSEA 5FRMA 1SMYF 5M5YJ 2HTSA 4WFTA 4U0VA 3L2VA 2QYOA 2KT0A 2ZFWA 1U2WA 4UV8A 4EM0B 4Y3OA 2HNHA 2LBFA 4I76A 1I6HJ 3OR2C 2JK3A 2X1CA 4BY1J 2LKSA 4PFPA 2GPIA 3WGHA 5FKMA 2MH9A 2HQRA 4HOBA 5K7ZA 4KDPA 3VK6A 4ZDLA 3AAFA 3PO3J 3TBIA 1E3PA 4LB6B 2DLKA 2RPCA 3SDBA 3ULQB 2D2WA 2R93J 1MD0A 3C3WA 3ZN1A 3IAM2 1O3RA 5M3FJ 2K40A 2DU9A 1HA8A 4EM2A 4PJLA 4HV5A 3U1KA 2WB1A 4A5NA 4ITVA 4L9JA 1BM9A 2K5CA 3E5XA 3F6VA 3SEZA 1FX7A 3EQLF 1CGPA 2Q1ZB 1A1FA 4E7HA 4L5NC 1ZYRF 2LJUA 1X3ZB 2A68F 1MDMA 4O43A 2EN3A 3G4SI 1UHSA 2EV0A 2CQNA 5C4JJ 3VYYA 2EMZA 1ZGJA 1QHHD 4KHPE 2EOMA 3R4KA 4BXUA 2ELZA 4WK8F 4YIRX 2EOOA 1FMVA 1QO0D 2RKHA 1V5GA 1JUSA 2B9DA 1YS6A 4DV7E 4NZVA 2VLAA 3AV0A 2DMNA 4B8XA 3EPJA 4K2EA 1DGWY 1TNSA 3IRRA 2LKXA 3CTAA 3M4OJ 2E5NA 2Y31A 2DO7A 2OAZA 4R2QA 4F9BB 1YUJA 2X85A 2CUZA 3OYFA 1WI3A 2FV4B 2HVSA 2M45A 2DI3A 3TMOA 2M8EA 2ESNA 2F5EA 4NC7A 5ICCA 2EOJA 2R7DA 2RGVA 4HAMA 4WXDA 2RNJA 4A3DJ 2ODRD 4DKKA 2UXBE 4RH8A 1MKMA 2W48A 4O5VA 4J8ZA 3SZPA 5FLXC 1DQUA 2N8GA 3DLLF 4DIQA 2G7HA 2ZFUA 3H92A 4MFDA 3RQ4A 3S17J 4DV6E 2CFOA 1E17A 3LSRA 1B8IA 3M9AA 2RS6A 3F6OA 1MH4A 1RC9A 3WTSC 2MKNA 3Q0VA 1K61A 2GM4A 2FQ4A 3K70D 3CC7I 5IWAE 4A3LJ 5EJCA 3S1NJ 1YW9A 5DEQA 2FEZA 4I09A 3FXQA 4F6MA 2VPRA 3L2UA 2MFZA 3HZJA 4F2JC 2EMAA 4JBAA 3ASNH 2P81A 1VQ6I 4XRMA 2IPQX 3J7Yp 4WXCA 1TW2A 1J7KA 4CCKA 4ETSA 3A0HC 3BDDA 1KA8A 2WY8Q 2HJJA 3MHHC 4M3BA 1HDPA 2NAZA 2EPCA 1SD6A 3LAPA 2DLLA 1ITYA 2EM4A 1ZELA 1EH8A 2UV1A 4KT6A 5AC4A 1XB4A 4O24A 2EPUA 3FXJA 1GV2A 4BJ5C 2IS1A 2YRMA 4HNVA 2CV2A 1GQEA 1ON1A 2VE9A 2HYGD 3ABLH 2YZTA 2MGQA 4XLHA 1KZHA 4DUZE 4LF5E 1P4AA 4UB8C 3OYMA 2LRSA 4P55A 3C4TA 3F3XA 1EH7A 2CQXA 3TW7A 1J59A 1KU9A 1SFXA 4HZFA 4O4KA 2BE5F 2XROA 3FHZA 2DBBA 2K86A 3GCMA 3BG9A 3HGYA 2DOEA 3OR1C 5TISC 2UUAE 5JR3A 5EZHA 2Y69H 2DMPA 3DWLE 1MNDA 2MH2A 2ZXIA 1K4SA 2R7ZJ 3CESA 1NCSA 4KWYA 3WG9A 1WH5A 3QG5C 2HGCA 2DOAA 3OYIA 1W36D 1FEXA 2O03A 4U88A 4AVPA 2QA4I 4ZTFA 2LT7A 1UHMA 1AAYA 4DUYE 2DGCA 4L0ZB 4B44A 1N77A 2OU2A 2V4JC 4DJAA 4MQVA 1XGMA 2E36A 5LHHA 4KNYA 2D9HA 1ZLKA 4A3FJ 3GTLJ 1GTKA 4C2TA 5D8KB 3OYDA 1B59A 3L2CA 4HQEA 1MIJA 2XGCA 2LKPA 3LOCA 3FHNA 2KIMA 2PI0A 3S3MA
chains in the Genus database with same CATH topology
3KEQA 2DFIA 3ROUA 1GXPA 3LA2A 2X0LA 4G9YA 3TKYA 2YSRA 1G6NA 4HX4A 1YIOA 2RDPA 4KMUX 4ESBA 1I5ZA 2VOPA 3JTGA 3MCZA 2RVCA 3EUHA 2Y75A 2A69F 3JSOA 2O61A 5IT3A 3RYRA 4IRHA 4KFCA 2ELHA 2XASA 1B9NA 1I6XA 4ZYEA 3GLXA 1A04A 3KFWX 1ODDA 2J5PA 2H6CA 2ZJ2A 1STZA 5E8IA 2K02A 1QBJA 3RDIA 2HKOA 3P9KA 5CVUA 5BQTA 2YU3A 1XSXA 4GYIA 1KU7A 3R0JA 1HXDA 4LLLA 3PQKA 4A2UA 1DUXC 5LGNA 3MWMA 3CO7C 4IJAA 2CQKA 1JHFA 1S8NA 4EJWA 1QGPA 1D3YA 4PGGA 4LJZF 1TW3A 4YFKF 1F5TA 3LA3A 5BPIA 4HF0A 3GFIA 1AWCA 3M8FA 5TRDA 3L7WA 1YS7A 3M8EA 1ONVA 1BBYA 2FBIA 2MBFA 2VBWA 3HOSA 2FOKA 3B73A 2HQNA 1YFHA 2V6CA 2F5DA 2FRHA 4RGRA 1R00A 1S7AA 3QU3A 1MZBA 1FLIA 1XCBA 1H0MA 3GO5A 5HVQC 1MDMB 1KYWA 2NYXA 1ULYA 4G7ZF 3J80Z 1FT9A 2EV5A 2CGPA 3CDHA 2H6BA 3GF2A 1HSJA 2C6YA 1L3LA 4MQ9F 3K69A 4EGYA 3WTYC 1BI2A 1UCRA 5A2QK 2HYFA 2HZTA 2NNYA 2Z9OA 1FWZA 3DKWA 4AIJA 3KLOA 2J5OA 1IAWA 3IRQA 4ASNA 1Z05A 3WODF 3KZZA 3F23A 2QLZA 3HSFA 3SFZA 3CUOA 2QQBA 3K1PA 3QOPA 1FOKA 4L9TA 5EEGA 2QWWA 3R61A 5HS7A 3CJNA 2EJRA 3F72A 3JTHA 3WTUC 4M73A 1HKSA 3IKVA 1XGNA 1XD7A 4HDUA 1P2FA 1XSDA 1AOYA 4ENJA 1Z91A 1V3FA 2FQ3A 1B4AA 2TDXA 3ZQ7A 5A2QZ 4D0PA 3I71A 4A6DA 3BWGA 5F1RA 3CUQA 1YYVA 3FMRA 1K78B 2QBYA 4U7BA 4ZZDA 1GXQA 1Z6RA 3KE2A 2P7CB 2OA4A 4EV0A 4CXFA 1IRFA 3EETA 1T98A 2LDUA 5D8LB 1EV7A 3W6JB 2H27A 3L00A 1ZAOA 2Q8KA 4KIFA 3ABUA 1D8JA 4KMFA 3DP7A 3NQOA 1O3TA 1FNNA 1LJ9A 3U9GA 2VOOA 5LBQA 4F7ZA 2KKOA 3V4GA 2JTVA 2XVCA 1S29A 1BN5A 4KIBA 1F4KA 2LF8A 3BJOA 3R0AA 5E8GA 2Z3YA 3ZMUA 2BV6A 3QP6A 2VC0A 5E20A 4JK1X 3IHUA 1U5TC 1D5VA 1XMKA 2D1VA 4I0AA 3NRVA 3VB2A 1C0WA 4Y13A 1ZRFA 2PJPA 4HW0A 2XKOA 3MFKA 3E97A 3FXRA 4ENKA 2OQGA 3V8KA 3DFGA 1G3SA 4M9ZA 1W5SA 3E6BA 1BC8C 2ESHA 3BOQA 4N9HA 4AWXB 4HBLA 1U78A 5HS9A 5D4SA 2XUBA 3E5UA 4WWCA 1OPCA 4EJTA 3P9CA 4Y15A 2A6HF 3ZN0A 6PAXA 2L4AA 1PUEE 1OR7A 2P4WA 1ZRCA 1RI7A 1H9GA 3L9FA 2GIVA 4M71A 2WV0A 4GGGA 2ZXJA 5LGTA 1IW7F 1WQ2A 1IXCA 5DCMB 5LLQA 1G3YA 4HYEA 2A61A 3GUDA 4M6YA 1HW5A 1T6SA 2XAQA 1W5TA 4PCQA 1TLHB 1BIBA 4L5IA 4G8XA 4OIQF 2HFHA 3K1NA 2OZUA 2ISZA 1RZ4A 3V7RA 5D5XB 2EK5A 2KIUA 2GZWA 4UNOA 2W84A 2X4HA 1YO5C 2V1XA 5E18F 2IW5A 2YR2A 2ACJA 4HX8A 1RIOH 3BY6A 4G7HF 2XIGA 5CYVA 1BIAA 4KICA 2ZMEB 3LQRA 1WRJA 4N9IA 4PGHA 1YW7A 2VBZA 2M87A 2D1HA 5L3FA 2VONA 1IN6A 1KQ0A 3CLOA 3F21A 3G73A 3ZPLA 3BZ6A 2HDCA 3TO7A 1OYIA 5D5WB 3H3ZA 2NNNA 1DP7P 1QPMA 5KK1A 3QPTA 2HOEA 3V7CA 1JGSA 3K1MA 1ON2A 2RV8A 2FA5A 2PEXA 4ZYGA 3ECHA 1FBQA 2ZNYA 2E1CA 4U7DA 2FE3A 2PFBA 4LMYA 5H20A 2JPBA 3Q9SA 1IN5A 2QVOA 3I53A 4WX9A 3WTVC 2AS5F 1XCVA 3DPLC 4FX4A 3RPQA 4MHGA 2F5CA 3WTZA 4RAZA 2W24A 5BMZA 3HRSA 4P96A 4HF1A 4CDGA 3RJPA 4R8HA 1W4MA 2L01A 4L18B 3ABTA 4YIFA 4MEXF 3TO9A 3O6BB 1XMAA 3QAHA 1O3SA 3LFKA 4U0WA 1U5TA 4BHBA 5L3DA 1B1BA 2CWEA 4O3MA 2RN7A 2UZKA 4PZJA 3I64A 2FF4A 3NEUA 5HLGA 4A12A 3GZ5A 3KP3A 1HKTA 3LA7A 2BGCA 2JZYA 2GXBA 3W6KB 4IRGA 3WGIA 2P5VA 3LQQA 3HSRA 5L3GA 3HHGA 4KA4A 1J9IA 4YIIA 2CG4A 3GVAA 2PN6A 2JRTA 4EM1A 4Q48A 3MZYA 2L4MA 2E7WA 5F64A 5DCMA 1PP7U 5FLXZ 4P9FA 2B0LA 4NQWA 3M7GA 1KYZA 4OIRF 2BEOA 4YFNF 5FB2A 1E2XA 5BPDA 1QNTA 1F1ZA 1T38A 5L3CA 1G3WA 2L54A 4MTEA 2NRAC 1ZGAA 2R7FA 3SXYA 1MJBA 2DPUA 3D5LA 2V79A 2RC4A 4UVBA 3V8JA 3PFIA 4S04A 2LF7A 3R60A 3I0TA 2R3SA 1FZPB 4CO8A 1P92A 3QPHA 1X3UA 1YQAA 1R23A 2EWNA 2CFXA 4L9NA 2FSWA 4AIHA 3HTUA 3OV8A 4P9UA 5DD8A 1FSHA 3VFZA 3EYIA 2DPDA 1YTYA 1YG2A 2P5KA 1U3EM 1FYKA 5LHIA 4I7HA 2EFQA 4CYDA 1KQ9A 4IF4A 4BHCA 5ERIA 3J81Z 1DDNA 4AIKA 3HRUA 3VEPA 1PDNC 2GQQA 4L5JA 3HHHA 2O0YA 2Q0OA 1LDKB 3F8MA 4KN7X 2K27A 4OIPF 2W85A 2DQRA 5FD5A 4AD9A 1RNLA 3QRFF 1ZARA 1SMTA 1ZH5A 2MD5A 3K9TA 3GWZA 1ZREA 3GEZA 4IPAA 2A3SA 1WKMA 1IRGA 5IT9K 1DPRA 1HW2A 2O6GE 3ZMZA 4XLNF 1OYYA 3MQ0A 4LLGF 4UUVA 2HWVA 2GA2A 2PBIA 1B6AA 4A0ZA 4ON0A 4KUMA 2A5YB 3L09A 3HSEA 3DPTA 3FM5A 4MEYF 4RB1A 2XAHA 1JE8A 3C18A 1CF7B 1LEAA 5ILVA 3IKTA 4HQMA 1R1UA 4HLYA 5DUIA 3F8CA 4YG2F 4EVIA 2HS5A 3JW4A 4HF2A 2AXLA 3QU6A 3KP4A 1J75A 4RGUA 4BYYA 3ECOA 1R1TA 2DK8A 4M72A 2IA1A 2BYVE 4IHTA 4G94A 3V8LA 2ADUA 5DYMA 4IVNA 3KP7A 4ZH4F 3VODA 4OINF 1O7LA 4MGRA 2PMHA 4BHPA 3WE2A 5LRRA 5ILSA 3R6SA 3KCCA 2IP2A 1EH6A 2H09A 2JT1A 4G6QA 5KVRA 5D5VB 4TV7A 3I59A 3EYYA 2V1UA 1XDUA 2COMA 3TDZC 3FMSA 1ZG1A 1U6GA 1U8RA 1ZHFA 4ZZLA 3BJAA 3ZMTA 4E70A 4LK1F 4LB5A 1R7JA 2OZ6A 2VXZA 2IVMA 5CVJA 4LD5A 2F2EA 1G4DA 5HLIA 1KQ8A 5JI6A 2PQ8A 3JSPA 1R5GA 4QLCU 3JAMK 1NHAA 1USSA 3M1EA 3FM3A 3HRMA 4PDKA 3BJ6A 4LK0F 5CVVA 1LDDA 1S7OA 4RGSA 3E3VA 4BH9A 1USTA 3SHFA 1VTNC 3C7JA 1OYWA 1FYLA 5D4RA 1JHHA 4B09A 1Y0UA 1TBXA 3WTTC 4ESJA 5D6EA 1IXSB 5DD4A 2ZO4A 3GW2A 3I58A 2VN2A 3GFJA 3DEUA 5H6RA 2MLKA 5DDGA 5HOOA 3TQNA 1BOAA 1IN4A 5DCFA 5FD6A 1HW1A 1KU3A 4I0BA 4ENMA 5AONA 2P7VB 4RGXA 4EJUA 5E1WA 3ZMDA 2KJCA 3D0SA 2L3DA 4A0XA 3RKXA 1Z7UA 4BQAA 2STTA 3J80K 3K2ZA 3N97A 3CUQC 3LWFA 1KGSA 3RKWA 2JSCA 3CUQB 3FWEA 3E5QA 4LG0A 2DT5A 3WTWC 1L0OC 5EEHA 3TOBA 2K4BA 5FFZA 4EQQA 2EA4A 1I1GA 4HLXA 3O3KA 2QUFA 2CSOA 4CGZA 3BPVA 1FP1D 3Q9VA 3TOAA 1FBSA 2L02A 2BBYA 3C1DA 5BOXA 1FYMA 2FNAA 2W57A 4MTDA 3T8TA 5K1YA 3DV8A 1BI3A 2EFPA 2XKPA 3HRTA 2E1NA 2K4JA 2OQRA 3IL2A 2V1DA 3WE3A 2WTEA 3E6CC 2EV6A 1GHCA 2PMUA 3GFMA 1J2XA 2XRNA 1YW8A 5AIQA 2DAOA 1SAXA 4DQ2A 3WU1B 4OIOF 4DNCA 1G3TA 3TDUC 5LRSA 4GYGA 2A6EF 3IC7A 2Y48A 1XSVA 3IWFA 5L3EA 4IXAA 1FP2A 5D6FA 3ZMSA 3GFLA 2O3FA 4I01A 4Q5SF 2QENA 4KN4X 2V9VA 4ESFA 3PQJA 4G7OF 1FC3A 2VT3A 5FFXA 4CZZA 1FY7A 4XRFA 3KETA 5ICEA 4CHUA 3V7SA 3E6MA 2FMYA 4M6XA 1Z1DA 2DTRA 2UWMA 5K5OA 2O8XA 4HDVA 3HYIA 3H3UA 2XAJA 4L0YB 2VBXA 1WSUA 1REPC 3J7AO 2EFOA 2WC2A 2XGXA 2P6TA 2DK5A 5HDGA 4LFUA 4GO1A 4OOIA 2CW0F 3KP2A 3FXUA 1T39A 4L9VA 1GVJA 1SD7A 2VODA 2M30A 1FBUA 1FSEA 5J6XA 1O3QA 1J0RA 4A0YA 4RAYA 2FMLA 1R22A 4UHTA 2F5FA 3MEXA 3P7NA 3RKYA 4P5OA 1XGOA 4WXHA 2IRFG 3SZTA 1LEBA 1R5HA 5D5UB 3ZMVA 2PG4A 3CO6C 3RPUA 1T0FA 4HA8A 4GXOA 4BNCA 2IJLA 3FMQA 1V4RA 2YX4A 2ZBKA 3GYHX 5L3BA 3B02A 5FLXK 2GAUA 2OD5A 5FGMA 2WWYA 1R1VA 3KZYA 4EMSA 1P6RA 3RYPA 5LEJA 1W7PD 2KRFA 2M5WA 5CLSA 3I5UA 2IA0A 5DUKA 2STWA 2ETHA 4UV9A 3U2RA 3GXOA 2QQ9A 5AIPA 1IXRC 4M74A 4R79A 2IT0A 4Y17A 1LB2A 1TNTA 2P5LC 1HBXG 1YLFA 2MLGA 1HKQA 1Q1HA 4OMZA 1B9MA 1U5TB 2G7UA 3REOA 4XSXF 4Z2YA 3ML6A 2DQLA 3BROA 3HOTA 2MA3A 2EB7A 1W7PB 2HR3A 2W25A 1ZRDA 5LGUA 3T5XA 1JXSA 1O57A 3EDPA 2HKXA 1TQMA 2Q2EA 3MAJA 1SD5A 2H94A 2ZCWA 4HV6A 4NB5A 1LNWA 4Q47A 3TGNA 5J8CA 4H0EA 1QZZA 1BC7C 5JFRA 5K5QA 2MC3A 4RB3C 2Y0MA 1D8KA 2HEOA 1BJAA 4KIGA 1RUOA 5HDKA 1XN7A 4EGZA 1TQPA 2KJBA 4ZYHA 1QZYA 2VBYA 4UXNA 1K79A 1W7PA 3E6DA 2VT2A 1IZ1A 2E7XA 2FU4A 1R36A 1R58A 3HUGA 3I4PA 3Q5FA 5J8FA 2RQPA 3WGGA 4EJVA 4N0BA 5LEKA 5CVRA 4JQFA 4MNUA 4O6JA 2XHKA 2PLYA 2GA1A 2YX7A 3QP5A 3BP8A 5ICGA 4XBFA 1PP8F 2ZMEA 1F9NA 4BAYA 1XGSA 4I2OA 4EJOA 5FO5A 2UXNA 2QQAA 1IN8A 2HTJA 3GZ6A 2FBHA 2XV4S 5HLHA 1DPUA 2GXGA 1MJ9A 3LSTA 1T2KA 1K6OA 3T8RA 1I1SA 4R1HA 3WTXC 1BI1A 1CF7A 3N4MA 5JHUA 3OOPA 4RB2C 2EA2A 5E1XA 2FBKA 5LHGA 3LAJA 3ISPA 2VC1A 3K0LA 4IRIA 3O2PE 3GX4X 3T1BA 1UB9A 4XSZF 3DQVC 3FF5A 5CVIA 2D45A 4ENNA 2QZ8A 4LLNA 3RI4A 2NS0A 2G9WA 1SFUA 5CJ9A 4LGWA 2P6SA 3FX3A 2FNPA 3MZHA 3HTSB 2A07F 1K7AA 4FX0A 1KU2A 4A5MA 3J81K 2EFWA 1J5YA 3F8BA 1OKRA 4QWQA 1MJAA 3IWZA 1P4XA 4GCVA 1IN7A 2LSOA 5E1ZB 2UXXA 5F6FA 1HSTA 2KIFA 1OMIA 3ZP5A 1LVAA 2GWRA 5ILUA 1SFEA 4IHSA 1I27A 5HS8A 4RS8A 1MGTA 4ZYDA 1FPQA 5ED4A 3WU0A 5K5RA 2Z33A 3I59B 3ERED 1LQ1A 1IF1A 1TQIA 4Q4ZF 4HX7A 4OU0A 1ZG3A 2IA2A 1BI0A 1UFMA 3ELKA 1IUYA 4I98B 3TO6A 5JVTA 3G3ZA 2K7LA 4KT5C 3F8FA 3DXJF 2XAFA 2JPCA 2ZKZA 1TTYA 3P9IA 3RIRA 1S3JA 1O7FA 2FXAA 4A6EA 4WF2A 2LNBA 1Z9CA 5E17F 4FT8A 3U1DA 1RUNA 3T0YA 3S2WA 1ZG5A 4M9SA 5HDNA 3RTRA 3HIFA 4OMYA 4UVCA 3VOEA 1ZLJA 3KEOA 2VE8A 2ISYA 4M9XA 2YPRA 1SD4A 1H9TA 3SQNA 2M1BA 1WI9A 4UVAA 4RB0A 5TJJA 2QM3A 3KP5A 3FZVA 4S05A 5H6QA 4YFXF 4I02A 4LG0B 4XLPF 5BS6A 4FHTA 5IT9Z 3DF8A 3JAMZ 1ZN2A 1Z6TA 1S6LA 2Z5UA 3F22A 2EFNA 5DV5A 1HQCA 2Z99A 3KP6A 2ZNZA 4WCGA 1WWXA 1LDJA 5ICFA 1XDSA 2OBPA 1P4WA 1K78A 2QBYB 3COAC 4KYWA 4NHJA 1UHWA 3I54A 4U0YA 2CO5A 2XAGA 2CYYA 1QQIA 3BPXA 3KLNA 2DW4A 3F8NA 4G6DA 4CICA 2P8TA 1SMYF 2HTSA 4U0VA 2QYOA 2ZFWA 1U2WA 4UV8A 4EM0B 3WGHA 2MH9A 2HQRA 4HOBA 4KDPA 3AAFA 4LB6B 3ULQB 2D2WA 1MD0A 3C3WA 3ZN1A 1O3RA 2DU9A 4EM2A 4HV5A 4A5NA 4L9JA 1BM9A 1CGPA 3E5XA 3F6VA 1FX7A 3EQLF 1ZYRF 2A68F 1MDMA 2EV0A 1ZGJA 3R4KA 4BXUA 4WK8F 1QO0D 2RKHA 1YS6A 4B8XA 4K2EA 1TNSA 3IRRA 3CTAA 2DO7A 2OAZA 2M45A 2DI3A 2M8EA 2ESNA 2F5EA 5ICCA 2R7DA 2RGVA 4HAMA 4WXDA 2RNJA 1MKMA 4O5VA 3SZPA 2G7HA 3H92A 1E17A 3M9AA 3F6OA 3WTSC 1YW9A 5DEQA 2FEZA 4I09A 3FXQA 4JBAA 2IPQX 4WXCA 1TW2A 1J7KA 4ETSA 3BDDA 1KA8A <