1QNTA

X-ray structure of human o6alkylguanine-dna alkyltransferase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
171
structure length
166
Chain Sequence
EMKRTTLDSPLGKLELSGCEQGLHEIKLLGKDAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLATED-DNA--PROTEIN-CYSTEINE METHYLTRANSFERASE
publication title Crystal Structure of the Human O(6)-Alkylguanine-DNA Alkyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna repair
total genus 42
structure length 166
sequence length 171
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 1999-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1qntA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1qntA01
1Z05A 4UVBA 4FX4A 3TDZC 2HFHA 1G4DA 4LLGF 4HX7A 1ZREA 4LK0F 1ZGJA 2JTVA 2FBKA 4G9YA 1FC3A 4NHJA 3WE3A 1TW2A 1F4KA 1G3WA 2R7FA 2QQ9A 1P92A 2Z5UA 4A2UA 3HUGA 4P55A 2RVCA 2G7HA 1YTYA 2M30A 1RUOA 5ICCA 5DYMA 4AVPA 1FZPB 3F3XA 3R0JA 3K0LA 3MQ0A 4O3MA 4EVIA 2HYFA 1CGPA 4EM0B 2VOPA 3DPLC 1BC8C 2KJCA 3ZQ7A 3F8MA 2GAUA 3KLOA 3BWGA 2XAJA 3GUDA 3SZPA 5K1YA 1IUYA 3AAFA 4HW0A 2COMA 3HOSA 1Q1HA 5CJ9A 4LLNA 3DV8A 3HYIA 2ISYA 3TOBA 1R1VA 4WWCA 2FOKA 3O3KA 3RTRA 5JFRA 3R60A 2M87A 4M9ZA 1KU7A 4G94A 1D3YA 3E5XA 4OMZA 5K5QA 2Q8KA 2XAHA 1R00A 2IW5A 2XGXA 2CFXA 4HZFA 5A2QK 1I6XA 3C18A 3U9GA 4LB6B 1ZHFA 3W6KB 3B73A 1HKTA 4MQVA 5D5WB 5LBQA 3KE2A 2GA1A 3D5LA 3CUOA 2WWYA 1T6SA 5CVRA 5D4RA 4EJOA 1WI9A 4UVCA 4ZYEA 1XMAA 2W84A 1ON1A 3N4MA 2DO7A 4AWXB 1LEAA 3QP5A 2EV6A 2XUBA 4HF1A 4F7ZA 4EMSA 3V7SA 3I5UA 1QNTA 2ESHA 4CXFA 3TOAA 3WTWC 2L01A 3RKXA 2L54A 5F64A 2PMUA 1W5SA 2EA4A 4I01A 5L3BA 1IF1A 1ZLJA 5CYVA 2HTSA 4GXOA 3GYHX 2CG4A 2VBZA 4OOIA 3GO5A 1TTYA 3JAMZ 3U2RA 2CW0F 2QM3A 4ETSA 3TDUC 2J5OA 2DK5A 1UFMA 1MZBA 3TO6A 2RN7A 1NHAA 3I58A 3MZYA 2DI3A 4IRGA 1R22A 2PN6A 3WGIA 1ZH5A 2PQ8A 4Q5SF 2WTEA 2STTA 5ICGA 4UVAA 3MCZA 4XBFA 2FNPA 5DV5A 5E1XA 2KIUA 2Y0MA 1D5VA 3HHHA 4M71A 1TQPA 4I09A 4YFKF 1BBYA 1KU3A 3GVAA 3J80Z 4YIIA 2VBWA 2IA2A 2DT5A 4KUMA 4LB5A 1O3TA 3T1BA 4BYYA 1FSHA 1K7AA 4PDKA 2A69F 2DAOA 1JE8A 2BEOA 3HSFA 1SFEA 2Q0OA 1IN5A 1TLHB 4G7HF 3LFKA 3BY6A 3GZ5A 1SMTA 4ESJA 2CSOA 4XSXF 2LKPA 2K27A 4MTDA 3IHUA 2A6EF 2Y48A 1KYWA 2PLYA 2VN2A 3I4PA 4IXAA 1R36A 5ICEA 2RNJA 4RS8A 4A0XA 2O3FA 1J59A 2OZ6A 5A2QZ 2RC4A 2XAGA 2VT3A 3R6SA 1T2KA 4KYWA 2H94A 3ABTA 5FFZA 4H0EA 1BN5A 4RAYA 4ENMA 4CGZA 1AOYA 4RB2C 2D45A 1BI2A 4IPAA 2J5PA 3M8FA 4N9HA 5E18F 3ZN1A 1H0MA 2ZXJA 3MFKA 2A07F 4DNCA 3I71A 2HEOA 5D6EA 2A61A 4N0BA 2AS5F 1FT9A 3CDHA 4EGZA 3L7WA 1BI1A 1RNLA 4BNCA 3KFWX 5BMZA 4MTEA 4GO1A 2ESNA 4L9NA 3PQKA 1P6RA 2HTJA 3QPTA 4JQFA 1MJ9A 2PBIA 4A0YA 5DCFA 3ELKA 4M6XA 3NEUA 1YIOA 1QPMA 2P5VA 1WKMA 3CLOA 4YG2F 1BI3A 4IVNA 1ZG5A 2ZBKA 4HDUA 1B6AA 1SFXA 4Q48A 2VC0A 4MEYF 4M6YA 4OMYA 5IT9K 5J8FA 4L9VA 3E5QA 1V4RA 3OV8A 5LLQA 1R23A 3R4KA 5TRDA 1TW3A 1J7KA 5AIQA 4XRFA 2A5YB 5J6XA 3RYPA 3WU0A 3O6BB 3ULQB 1DP7P 4EM2A 4HA8A 1YG2A 3TGNA 2BYVE 5LHHA 2JPBA 3MWMA 3GX4X 2MLKA 1KQ0A 4L9JA 2HKOA 4I7HA 2VT2A 1U78A 2CYYA 1BOAA 4HLYA 2K02A 4IRIA 2DLLA 2DW4A 5CLSA 3F8BA 3FHZA 1B9NA 1F5TA 2W57A 3KZZA 2E7WA 2ZMEB 1MDMB 2DU9A 2XIGA 2O8XA 1EH8A 3T5XA 4EJVA 3KP6A 5DDGA 2P5LC 4GCVA 1LDDA 4KDPA 1ZRDA 2VODA 1U6GA 3WU1B 1WSUA 3REOA 4KIGA 3WODF 2FE3A 4FX0A 5FD5A 4FT8A 2MA3A 2XASA 2ZJ2A 4KIFA 4NB5A 4KIBA 1HSJA 1U5TC 2Z33A 4BAYA 4RB1A 4I98B 3LQRA 1LJ9A 1H9TA 2V1UA 2FMLA 2DPDA 2M45A 1HXDA 2D1HA 3FZVA 2IT0A 3Q5FA 3KEOA 5DEQA 1OYYA 4RGSA 2ZMEA 1MDMA 2P4WA 1IXRC 2ZNZA 1XD7A 3WTUC 1BI0A 2YU3A 3H3ZA 2QLZA 1P4WA 2F5EA 1FYKA 1RIOH 3WTTC 1ZYRF 1KA8A 3RIRA 3TQNA 5HDKA 3LWFA 4RGRA 1YS6A 1RI7A 2XRNA 3P9KA 3ZMZA 4EM1A 1GVJA 3DP7A 2HZTA 2NS0A 1IW7F 1W5TA 1WWXA 2OQGA 1DDNA 5HVQC 3NRVA 1Y0UA 3CO7C 3HHGA 3DFGA 5D6FA 2V6CA 3KP5A 3ECHA 4P5OA 3IC7A 2LSOA 3WG9A 4ON0A 4CDGA 1TQIA 1S29A 2O61A 4UXNA 1R5GA 2VE8A 3BJ6A 2L4MA 1FP2A 2AXLA 3RKWA 1ZRCA 3COAC 1G3TA 5IT9Z 1E17A 1T39A 2DPUA 5IT3A 3C1DA 1SD5A 1IZ1A 5L3DA 5H20A 3DPTA 4ESFA 4XLNF 2PEXA 3Q9SA 3SFZA 1BC7C 4WXHA 3K1MA 4P96A 4O5VA 4MQ9F 3RJPA 3FMRA 1HBXG 1XGSA 4OIOF 4GYIA 1ZRFA 1VTNC 2JSCA 2ELHA 4MNUA 3I53A 1WRJA 3I64A 4WF2A 1S8NA 2RKHA 4EJUA 3GWZA 3RI4A 5LRRA 4CYDA 1OYWA 3BPXA 2A3SA 1U3EM 3LA3A 2H09A 2HGCA 4RB0A 5H6RA 4KMUX 1L0OC 3F22A 2FF4A 1XDUA 4MEXF 2XVCA 5HOOA 1XSDA 3JTGA 3MZHA 3WTVC 2HOEA 4BHPA 3F6OA 1FBSA 2IPQX 3PQJA 2A6HF 2HS5A 4DQ2A 5CVVA 2CWEA 2ZO4A 1S7OA 1D8KA 2DTRA 4TV7A 4MHGA 5ILSA 1XGMA 1IN7A 4KT5C 5D5VB 3ML6A 3MEXA 1T38A 4L9TA 5E8IA 3CTAA 1FNNA 2P6SA 1X3UA 1MJAA 1R1TA 2OU2A 3FXRA 2YPRA 1QQIA 4KICA 4G7OF 2EB7A 3E3VA 2MH2A 1HQCA 1ZLKA 1UHMA 2YSRA 3JSOA 1HKQA 1XDSA 1DPRA 5ERIA 1T0FA 2RV8A 1W7PD 2FEZA 2KJBA 2X0LA 4KN4X 1TQMA 3CO6C 1KQ9A 3H92A 3WTZA 5ICFA 3M8EA 2YX4A 2HQRA 4LG0B 5FFXA 4CICA 3CUQB 1PUEE 1ULYA 3EYIA 3T0YA 2W85A 1LQ1A 1IRGA 3BJAA 4EV0A 1PDNC 4HV5A 2DQLA 5D8LB 2FSWA 4IJAA 1J0RA 2LNBA 3E6MA 2XROA 5BQTA 3ZMTA 2BE5F 1SD7A 2UZKA 3G3ZA 3J81K 5F1RA 3I54A 3F8CA 4FHTA 1O3SA 1R7JA 4JBAA 3K1NA 3KLNA 4UUVA 3T8TA 3DXJF 1OR7A 2UWMA 3GLXA 2LF7A 2Z9OA 3SHFA 2PG4A 1Z6RA 3JSPA 4LG0A 3KP3A 3HTSB 4D0PA 3CUQA 3GFIA 4KMFA 4ENKA 2UXNA 3GFMA 5JHUA 1IN4A 5K5OA 2KIFA 2LDUA 3FXQA 2MBFA 1F9NA 5HLGA 2F5DA 4R1HA 4L0ZB 1FPQA 3M7GA 3HOTA 2QZ8A 3FM3A 2FRHA 3JW4A 4S05A 4HQMA 1ZG3A 2IA0A 1S7AA 2L02A 3RPUA 2QVOA 1O7LA 4CO8A 2P7VB 2XHKA 2OA4A 3F23A 1JGSA 5ILUA 1FLIA 2OBPA 3M1EA 3QAHA 4P9FA 1JHFA 1ZAOA 1UCRA 1K79A 1QGPA 3U1DA 4U7BA 3QRFF 3H3UA 3ROUA 5J8CA 4EGYA 3EQLF 5DD8A 3RYRA 1GHCA 1FYLA 2Z99A 2OD5A 4HOBA 5DD4A 4A6DA 1LB2A 2BV6A 2FU4A 3VOEA 1XSVA 5CVJA 4JK1X 4AIKA 3HRUA 2O0YA 1OKRA 3F21A 3DF8A 2VC1A 4BQAA 3E6DA 5E1ZB 1ODDA 1J2XA 1MJBA 1TNTA 4HF0A 2ACJA 1A04A 1U2WA 5JVTA 3L2CA 2LF8A 4PGGA 6PAXA 2F5FA 4I02A 2NAZA 3IRQA 1Z6TA 3ZN0A 1YW9A 1LVAA 2QYOA 4IHTA 5FD6A 3HSRA 4R79A 4WX9A 5LGTA 5LGUA 2L3DA 3WTSC 2Q2EA 2E1CA 1STZA 4N9IA 1YO5C 1O3QA 5CVUA 2IJLA 1SFUA 4LMYA 1MKMA 3F6VA 3TKYA 2MD5A 2EV0A 3WTYC 2HQNA 5AONA 4I0BA 4Y15A 3FWEA 1I27A 1FSEA 3ZPLA 1K78B 3G73A 3IKTA 4I0AA 2DK8A 2VE9A 5E1WA 5ILVA 1JXSA 4ZYDA 4KA4A 2XV4S 2IRFG 2CO5A 3EUHA 1BJAA 4UV8A 2QQAA 2P7CB 3R0AA 1ONVA 2EK5A 2M1BA 4LJZF 4XSZF 1FP1D 4AIJA 4UV9A 1B1BA 3W6JB 3QOPA 2H27A 2HR3A 4ZZLA 4YIFA 3P7NA 1LDKB 4OIPF 1K78A 1EH6A 2XKPA 4HAMA 5HLHA 1Z7UA 4ESBA 1WQ2A 1GXPA 3O2PE 5BPIA 1PP7U 3ZMSA 4RGXA 4ZZDA 2NNYA 1FWZA 1W4MA 1MGTA 2JRTA 3C3WA 4Q4ZF 3V8LA 3VFZA 2GXGA 5HS8A 2HDCA 2V9VA 4RB3C 4PCQA 2NRAC 4BH9A 3V8KA 4LK1F 1Z91A 2M8EA 3J7AO 2CQKA 2ZFWA 3BOQA 2FBIA 5D8KB 4E70A 5TJJA 2CGPA 3HTUA 2FMYA 4QWQA 2O6GE 1DUXC 2OAZA 3JAMK 2GWRA 1I5ZA 4A12A 3BPVA 3TO7A 5DUIA 2STWA 2GIVA 2C6YA 3DKWA 1E2XA 2VBYA 4AD9A 1XCBA 5EEHA 3LSTA 2ZKZA 3L9FA 5HS9A 1YW7A 3IWZA 3N97A 4CHUA 3FM5A 5DCMB 1YS7A 4WXCA 2QWWA 5L3FA 3EYYA 4RAZA 1R58A 2VBXA 3C7JA 4K2EA 2D1VA 3S2WA 1USSA 2W24A 1J5YA 3KP7A 3EDPA 1P2FA 3CJNA 3IKVA 5FO5A 1D8JA 4HX8A 4KNYA 3J80K 4A5MA 5HDGA 5HLIA 5BS6A 4KN7X 5BPDA 2BGCA 1LDJA 1FY7A 1MD0A 4OIRF 3RDIA 1I1SA 5DUKA 3IL2A 3L00A 4GGGA 3F72A 3WGHA 3T8RA 4ZH4F 5LRSA 5DCMA 1HW1A 4R8HA 4L5JA 2MLGA 2FNAA 1K6OA 3E97A 4EJWA 2GA2A 1FYMA 3I59B 1YQAA 5D4SA 3LAJA 4G8XA 3E5UA 3GXOA 2JPCA 2ETHA 1YW8A 2NYXA 4B8XA 1OPCA 2VOOA 2WC2A 2OQRA 2M5WA 2RGVA 3VODA 3QP6A 2V79A 3TO9A 5HDNA 4U7DA 3HRMA 4HQEA 5E20A 4NQWA 1L3LA 4WXDA 1QZZA 1BIBA 2EFNA 4HLXA 3I59A 2P8TA 1QBJA 1PP8F 2K86A 3FF5A 2VXZA 2FBHA 1IRFA 3V8JA 5H6QA 4G6QA 2EWNA 1QO0D 5JR3A 3SXYA 2BBYA 4L18B 3LA7A 3NQOA 3E6CC 3BDDA 1C0WA 2HKXA 3OOPA 3ECOA 3K69A 4WK8F 1IN8A 4BXUA 3ERED 4Q47A 1UB9A 4O6JA 5L3GA 1I1GA 5D5UB 3WE2A 1SD6A 2G7UA 4I2OA 4LD5A 3FX3A 2WV0A 4IHSA 1HKSA 2DFIA 3IRRA 4LGWA 2GZWA 1AWCA 3QU6A 2H6BA 1Z1DA 1IAWA 5L3CA 4HDVA 3GFJA 3GZ6A 1H9GA 2NNNA 3SQNA 4PGHA 3ZP5A 3KEQA 2YR2A 3KCCA 1B4AA 1TBXA 2R3SA 4M73A 1YYVA 2GXBA 1G3YA 4HX4A 1ZN2A 2Z3YA 2YX7A 4OU0A 1HW5A 1HSTA 1U5TB 1T98A 3E6BA 1P4XA 2FA5A 1SMYF 4OIQF 2DQRA 1IXCA 1KU2A 3F8NA 4RGUA 2PMHA 3VEPA 1OYIA 4XLPF 3WGGA 2H6CA 2VONA 3RPQA 2PI0A 5E8GA 1YFHA 4BHBA 4L5IA 1ZARA 3FMSA 1KYZA 1FOKA 1YLFA 3KZYA 3BP8A 1FBQA 5LEKA 1S3JA 3Q9VA 1GXQA 4L0YB 4U88A 3K9TA 2MH9A 2V1XA 3PFIA 5HS7A 1B9MA 4A6EA 3HIFA 1QZYA 4HBLA 3V7CA 4U0VA 1V3FA 2ZNYA 5CVIA 1U5TA 3K1PA 4M9XA 3F8FA 1O7FA 2XKOA 4CZZA 3JTHA 1CF7B 2K4JA 3ABUA 4OINF 1XGNA 2IP2A 3HRTA 1J75A 5D5XB 4KFCA 5ED4A 1KQ8A 1KU9A 5EEGA 2L4AA 3P9CA 5F6FA 5KVRA 2V1DA 1HW2A 3RKYA 1IN6A 4P9UA 5LHIA 1B59A 3VB2A 5FB2A 3DEUA 1P4AA 4M74A 2XAQA 3LA2A 3IWFA 5FLXK 2DBBA 2QBYB 4HF2A 4S04A 3ISPA 2HYGD 3FXUA 5K5RA 1CF7A 2EA2A 2A68F 2K7LA 2X4HA 3V7RA 2IVMA 3BROA 4IF4A 1LEBA 3D0SA 3GW2A 1RZ4A 1JHHA 3HRSA 1USTA 4U0YA 4Y13A 1O3RA 3I0TA 1IXSB 1R1UA 2MC3A 4GYGA 1XGOA 4YFXF 2QUFA 3P9IA 2JT1A 3K2ZA 4AIHA 4G6DA 3FMQA 3BZ6A 1SAXA 2TDXA 1XB4A 4U0WA 2FQ3A 2F5CA 2KRFA 1KGSA 4UHTA 1EH7A 2QENA 1FBUA 4YFNF 2GQQA 3QPHA 2QBYA 3ZMDA 5KK1A 4EJTA 3KP4A 2RDPA 4MGRA 4UNOA 1OMIA 2ADUA 3ZMVA 4ZYGA 1J9IA 5JI6A 1G6NA 4Y17A 2PJPA 4M72A 2XAFA 2F2EA 1O57A 2E7XA 3LQQA 3B02A 2P6TA 2EFOA 4M9SA 1XN7A 4IRHA 1FX7A 4LLLA 4BHCA 2EJRA 1RUNA 2OZUA 1ZGAA 2JZYA 3HSEA 4WCGA 1ON2A 2Y75A 1SD4A 2UXXA 2EFWA 5LHGA 2P5KA 1W7PB 1XMKA 3LAPA 3J81Z 2W25A 2QQBA 3QU3A 1ZG1A 3MAJA 2KKOA 3EETA 1EV7A 4HYEA 2B0LA 4A0ZA 4EQQA 1UHWA 2EFPA 2KIMA 1REPC 4A5NA 1XSXA 4QLCU 1S6LA 2R7DA 1F1ZA 1LNWA 2G9WA 3L09A 4ZYHA 1Z9CA 2PFBA 3BJOA 1R5HA 2FXAA 2EFQA 4ENNA 1U8RA 5LEJA 2IA1A 3V4GA 3CUQC 4ENJA 5FGMA 3KETA 4B09A 1TNSA 1DPUA 5LGNA 1W7PA 5E17F 3GF2A 3SZTA 1G3SA 2O03A 2K4BA 3DQVC 3R61A 3ZMUA 4ASNA 1XCVA 5BOXA 2ISZA 4G7ZF 3GFLA 2ZCWA 2RQPA 4LFUA 1BM9A 2EV5A 2E1NA 5AIPA 3M9AA 2D2WA 3GEZA 1BIAA 4PZJA 3KP2A 5L3EA 4Z2YA 4HV6A 3WTXC 2HWVA 5FLXZ
chains in the Genus database with same CATH superfamily
1Z05A 4UVBA 4FX4A 4A3LJ 3CESA 4NC6A 2LBSB 2XRLA 3TDZC 2HFHA 3HM5A 1G4DA 1MSFC 4H4KC 2EQRA 2D5VA 1I3QJ 2VQLA 4LLGF 2LR8A 3H36A 2MG4A 4HX7A 1ZREA 2YSPA 4L5EA 4LK0F 1WXRA 1OCTC 1ZGJA 1TL8A 2JTVA 1RR7A 4C2MJ 2FBKA 1Y8QB 3DJWA 4G9YA 1DQUA 1FC3A 4NHJA 4DYCA 3WE3A 3EQ1A 1X2NA 2EMZA 3GMEA 4JX5A 1TW2A 2O8KA 1GDTA 3BC8A 3ZQGA 4D7NA 4Q28A 2E19A 1F4KA 1G3WA 3MKWB 2R7FA 5J47A 1GTKA 2QQ9A 4DV6E 1P92A 2ID6A 2Z5UA 3LMMA 2DA2A 2N3GA 2V86A 4A2UA 2GIZA 3HUGA 3MD2A 3HC7A 5IXMB 3BTLA 3CLQA 3W3CA 4P55A 2RVCA 2G7HA 1JUSA 5IYCJ 3OYIA 1V5EA 3DPUA 3HOUJ 1YTYA 2YS9A 2M30A 4XKBA 4J01A 1RUOA 5ICCA 4DV7E 5IYBJ 3TEDA 5DYMA 3VYSB 1PKPA 4B3RE 4AVPA 2M34A 2EM9A 1FZPB 3CMMA 2DJIA 2WZOA 3AG1H 4X0GA 2YTEA 2DFHA 3F3XA 3R0JA 4V2GA 1SFOJ 4CCLA 1KJKA 3BQYA 3K0LA 1JTYA 5IOZA 3MQ0A 4O3MA 4EVIA 1IG7A 2HYFA 3GTJJ 2YU8A 1CGPA 3EPKA 4EM0B 2VOPA 3DPLC 1TWGJ 3VYRB 1BC8C 1YRNB 2KJCA 3ADIA 3ZQ7A 5AE3A 4NNJA 3OYDA 2ME0A 1IV6A 3F8MA 3BGHA 2EN2A 2GAUA 3PL8A 2JVGA 3KLOA 2NABA 2Y9ZA 3BWGA 1XPXA 2XAJA 2H36X 2M9HA 3GUDA 2V8QB 1MNMC 2CSHA 3SZPA 2KISA 1NG7A 2XPWA 5K1YA 2DOEA 4IZZA 1IUYA 3AAFA 1OJLA 5CQGA 1OISA 4HW0A 2COMA 5E3OA 3ZQHA 2JWTA 3HOSA 5LD2C 2DMTA 2YTFA 1Q1HA 3CJTB 4RAFA 5CJ9A 4LLNA 2ZB9A 3DV8A 3BR2A 3HYIA 1LFPA 2ISYA 2X6YA 3TOBA 3K2AA 1R1VA 4WWCA 2FOKA 3O3KA 3M3YJ 3RTRA 5EG0A 5JFRA 3R60A 2M87A 4M9ZA 3ZOBA 1BR1A 1X2MA 4XLAA 2E1MB 3Q0VA 3VYXA 1KU7A 3PO3J 4G94A 1D3YA 3E5XA 4OMZA 5K5QA 2Q8KA 2EPNA 2XAHA 2RAEA 3MZ8A 3SJMA 2EMGA 1R00A 3ADLA 2IW5A 3C4TA 1VQPI 1VQ9I 2XGXA 3I4MJ 2CFXA 4HZFA 3FKIJ 5A2QK 1WHUA 3RKQA 3J7AG 1I6XA 3C18A 4IO9F 1YRNA 4ITVA 2V1NA 3U9GA 4LB6B 3PIPF 3ADJA 1ZHFA 5A6BD 2M4IA 1LFBA 3B73A 3W6KB 1HKTA 2JWOA 2RTXA 1G2DC 4MQVA 1SANA 4LF7E 2AXTC 3H09A 1X47A 5D5WB 2VJ4A 4JI3E 5LBQA 3KE2A 4G6TB 3CJQB 4BKXA 1WJCA 3MHSC 4BGDA 3O8GA 3AL0C 2BY2A 2QSHX 2GA1A 2UUZA 3D5LA 2DT7B 3ABKH 2VJ5A 3HQ1A 1ORKA 1JGGA 2EM7A 3CUOA 2EM2A 2WWYA 1T6SA 2VQGA 1HDPA 5CVRA 2EILH 3J7AY 5D4RA 4DV3E 4IHVA 4EJOA 1WI9A 3H5RA 3PNTA 4UVCA 4ZYEA 1NEIA 1XMAA 2W84A 3BG6A 1ON1A 2E1MA 5KL5A 3N4MA 2DO7A 2CFOA 5C44J 4AWXB 2L7MP 1YX3A 1LEAA 3QP5A 2EV6A 2XUBA 4JP0A 4HF1A 2YTOA 2MGQA 4F7ZA 1IUFA 1YITI 3HZJA 2DFFA 1UN6B 4X9JA 2OCEA 4EMSA 3V7SA 3I5UA 2EPZA 1QNTA 2ESHA 2EMHA 1LVKA 4AU7A 4CXFA 3TOAA 2IS6A 1IQOA 1HNXE 1MBJA 2KLOA 3WTWC 1RMDA 2BB8A 2V87A 1Y56A 2L01A 1U0JA 3JRHA 2KFDA 3RKXA 4ABZA 1IBLE 2L54A 1UELB 2DA5A 2YWQA 2LK2A 3OMYA 5F64A 5DNYA 2PMUA 3H9QA 1W5SA 2EA4A 4I01A 5L3BA 2EQ1A 2N8XA 1IF1A 1ZLJA 2ELJA 5CYVA 1J5EE 2HTSA 2CQXA 2YRHA 3OL3A 3OY9A 5M3MJ 4GXOA 3GYHX 2EM0A 4JI1E 2JJ7A 2CG4A 2L0KA 3EPLA 2VBZA 2M8GX 4F52A 4OOIA 3GO5A 4IHYA 1TTYA 4GDFA 1ZTRA 1EKEA 2K40A 3U2RA 3JAMZ 1V5GA 2CW0F 2K9QA 1K83J 2BHZA 2QM3A 2EOIA 2JY9A 3S1NJ 4LU9A 4ETSA 1F36A 2L33A 2MC4A 3TDUC 2AHQA 2I13A 2AQEA 2J5OA 2EOQA 2XPVA 3TP0A 3K4KA 1XMXA 2KT0A 4KITB 2DK5A 4A3EJ 1UFMA 3LSPA 2EMCA 1JUPA 1MZBA 5B1BH 3TO6A 2JA7J 4E7HA 1IBKE 2RN7A 1NHAA 3I58A 3MZYA 2DI3A 3BR3A 4IRGA 1R22A 2PN6A 3GTGJ 3F0CA 1N25A 3WGIA 1FOYA 5F27A 1ZH5A 5E79C 2PQ8A 4BJ6C 4Q5SF 2PJRB 2EN7A 2WTEA 2STTA 2MDGA 2ZJPF 4JOMA 5ICGA 4W97A 4UVAA 3MCZA 4BE0A 1YIJI 2X1DA 4XR6A 3DBRB 4S0HB 2B63J 2RSMA 4XBFA 4NUBA 2FNPA 5DV5A 3FBNB 2M4GA 1QVTA 1Y1VJ 4NXME 5E1XA 2KIUA 4ZDPA 2HGHA 2EIJH 2QQ8A 2Y0MA 4M6VA 3HHHA 1D5VA 4M71A 1TQPA 1YJNI 3FXJA 2RNGA 1VQMI 4I09A 4GEQB 4YFKF 3K4NA 1BBYA 1KU3A 3GVAA 3J80Z 1N78A 4YIIA 1YI2I 3HEFA 2VBWA 2VJIA 2HVRA 2IA2A 1MBHA 4BJTA 2DT5A 4KUMA 1PJSA 4LB5A 1O3TA 3T1BA 4YY3E 4BYYA 1FSHA 1K7AA 4PDKA 2A69F 2DAOA 1JE8A 2BEOA 5KL4A 2MDRA 3HSFA 2TCTA 1SFEA 2Q0OA 3JRBA 1QPIA 2VKVA 4LF6E 1I50J 4CCMA 1MNDA 1IN5A 1TLHB 4G7HF 5A69A 5F04A 1ZU1A 2VI6A 2Y30A 3LFKA 1IC8A 3BY6A 3GZ5A 2E2JJ 5A6JA 1YZ9A 4KISA 4M3GA 1SMTA 4ESJA 2CSOA 2EPPA 3ZRGA 1IRXA 1P7IA 4XSXF 2Y9YA 1NH3A 4JI6E 2LKPA 2PJRA 1HA8A 2MC6A 2HI3A 3RQIA 3THOB 2K27A 4MTDA 4D5FA 3IHUA 2LFBA 4AC0A 1XTAA 3L2QA 3FISA 2A6EF 2Y48A 4B47A 1KYWA 4R2RA 2PLYA 2VN2A 5E3LA 3I4PA 4PJ0C 4DR4E 4IXAA 1R36A 2Y2ZA 5M5XJ 2VL8A 2RNJA 3K4JA 5ICEA 2EZHA 1W1WE 3RMPA 2UU9E 4RS8A 2KDOA 4A0XA 2O3FA 4IL6C 3HDDA 2E5NA 1ERDA 2EP3A 2O5RA 2LVSA 4M3DA 3J7ZI 1J59A 2OZ6A 1IDZA 5A2QZ 2RC4A 2I5UA 2R5ZB 2XAGA 2VT3A 3DBHB 3OIOA 3R6SA 1ZR9A 1T2KA 4AQYE 3EPHA 3MKZA 2ZXHA 4MO7A 4ZTJA 1N33E 3TW6A 4KYWA 5J1UA 1ETVA 3OYJA 2H94A 3ABTA 3G6EI 1VQ6I 5FFZA 3L2UA 4I99C 4H0EA 1Q1VA 1BN5A 1YUIA 3E7LA 4RAYA 4DJAA 1N75A 2EM3A 1UBDC 4ENMA 4CGZA 1YJ9I 5GAGJ 3I4NJ 1AOYA 4RB2C 2EMFA 2D45A 1BI2A 4IPAA 2J5PA 1WVRA 3HG9A 3M8FA 3ONQA 4N9HA 5E18F 3VSLA 3ZN1A 1HF0A 4X6AJ 1H0MA 2ZXJA 3FDYA 2ZSIB 3MFKA 2A07F 1YX5A 3H0GJ 4LIVA 4DNCA 3SDGA 2VASA 3H9JA 3HOWJ 2EIMH 2JP9A 4DUYE 3I71A 3EPZA 5J3LA 3KEYA 2A25A 1BBOA 1SAUA 1JT0A 2HEOA 5D6EA 2A61A 3W2WA 2VQEE 4N0BA 2AS5F 3CF5F 1Y1WJ 1FT9A 3QPSA 3CDHA 3NAUA 2OJED 2EMYA 5LMNE 4EGZA 5J1RA 4F91B 3L7WA 2KQRA 1LKXA 1BI1A 1Z7LA 2DIXA 1OCCH 2BW3B 1RNLA 4BNCA 1P47A 3KFWX 1ZKGA 2R5ZA 5BMZA 1VZ0A 2DCEA 2DYSH 2ESNA 4GO1A 4MTEA 2R7SA 4F2JC 4WSGA 3VHTB 4L9NA 2OUMA 4HSRA 4XL9A 3SFIA 1AHDP 5F1JA 2MABA 3PQKA 1P6RA 5ADZA 3A01B 4A3JJ 1I94E 2HTJA 3IWBA 4BBYA 3QPTA 4JQFA 4UUTA 4JI4E 2OCCH 3E1SA 1MJ9A 2PBIA 4A0YA 5DCFA 3K4CA 1X49A 3ELKA 4B43A 3UR3C 4M6XA 2EMLA 4RH8A 1FIAA 3KZIC 2R7UA 3NEUA 1YIOA 1QPMA 1X1BA 2EPRA 1FKAE 2V7FA 2LD5A 2P5VA 1A1KA 2Z1DA 1WKMA 4P1WA 3RCOA 5FLVA 3CLOA 4YG2F 3JR9A 5CPRB 1BI3A 5J1YA 4IVNA 3L2RA 2XB5A 2ENHA 3S8PA 1B72B 1G8XA 1ZG5A 2Z2SB 2ZBKA 1MMAA 4HDUA 3MKYB 2LTPA 1B6AA 4XM3A 1K4SA 1SFXA 4Q48A 3BTJA 2VC0A 4F6MA 4MEYF 4M6YA 2R92J 2V89A 1TWAJ 4OMYA 5IT9K 5J8FA 1SVLA 1IRZA 5IP9J 2BW3A 3E5QA 4L9VA 1V4RA 1MBEA 2CV1A 3ZCOA 3OV8A 2L9VA 2JK3A 5LLQA 4Y52J 2EMAA 2VQFE 1R23A 3FXKA 2F4OB 3R4KA 5TRDA 2VF1A 1B69A 1TW3A 1J7KA 4M30A 5AIQA 3VDXA 3AL0B 1JKPC 2QCOA 5KAFC 4XRFA 2A5YB 1X58A 2LYCA 3RYPA 5J6XA 5CFFE 3WU0A 3F6GA 1W0TA 2H8WA 2OC6A 3O6BB 3VYUB 2MFZA 4Y3OA 3ULQB 3KYLA 3A01A 2MW8A 1WH7A 1DP7P 3S2DJ 4EM2A 4HA8A 4PFPA 4DR3E 3S93A 1YG2A 3D5SC 3BCAA 2NOJB 3TGNA 1TF3A 2BYVE 2EOXA 5LHHA 3IWCA 2JPBA 1AH5A 1U9OA 3H5NA 1GV5A 3SEQA 3MWMA 3GX4X 1MMNA 2LJUA 1WJDA 2MLKA 2X51A 1WPKA 1KQ0A 2HXOA 4L9JA 4BQOA 2A5WA 2HKOA 4I7HA 2CRGA 2VT2A 1U78A 5AE2A 1B72A 2CYYA 1BOAA 4HLYA 2K02A 2WAFA 4DZPA 1VQ8I 4IRIA 2R7OA 2DLLA 3TP3A 4CSWA 4D1QA 2DW4A 5CLSA 3F8BA 3FHZA 1B9NA 2ZC2A 1V55H 4X66E 4U87A 4A93J 2DLKA 5GAEJ 1QZEA 4ZJZA 2EOEA 1ZK8A 2F4VE 1F5TA 1SFKA 2W57A 3KZZA 2E7WA 1F2IG 5TSEA 2ZMEB 1MDMB 2DU9A 4BS9A 3ZQCA 2M7QA 2HVQA 2XIGA 3S2HJ 2E36A 2O8XA 1EH8A 3T5XA 4EJVA 2ENCA 2KOUA 3KP6A 4J8ZA 5DDGA 2B7TA 4B48A 2VKHA 2P5LC 4GCVA 1LDDA 2DT6A 3ESWB 4KDPA 2LRDA 1P9QC 1ZRDA 2VODA 2CT1A 4DIQA 3BIDA 1R71A 1U6GA 2L9SA 2LBFB 2Y31A 3WU1B 1D0XA 1WSUA 3REOA 4KIGA 1ETYA 1XG1A 3WODF 4NC8A 2FE3A 4FX0A 1HLVA 5FD5A 2NVUB 4X64E 4FT8A 2MA3A 2JUGA 2XASA 3BG9A 1MSEC 1D1AA 2ZJ2A 4KIFA 1APLC 4JX6A 4NB5A 4KT6A 3U21A 4KIBA 1HSJA 1U5TC 1SR9A 2Z33A 4BAYA 4RB1A 3I9V2 4I98B 4DZJA 3LQRA 2LY9A 1LJ9A 1H9TA 4UY8I 3BZCA 4BDYA 2V1UA 2FMLA 4MIMA 2DPDA 2M45A 2CW7A 4PSXA 1HXDA 2D1HA 2DB2A 3FZVA 4PJNA 2IT0A 2XF7A 5B5EC 3Q5FA 5F0FA 4V2FA 3KEOA 4FISA 1A1LA 3QYFA 5DEQA 1OYYA 4RGSA 2ZMEA 4ZYAA 1MDMA 1G2FC 2XDVA 2XF6A 1MBGA 1BR2A 1YYWA 2P4WA 4D9JA 3F6HA 4DV1E 1J09A 1IXRC 2ZNZA 1XD7A 3FKJA 3DEEA 4HNTA 3CQZJ 3WTUC 1BI0A 3LSMA 4BDZA 4HG2A 5F3WA 5LMUE 4A3KJ 2ZXIA 2LBFA 2R4GA 2YU3A 3AG3H 3H3ZA 5DTDA 1A5JA 1TF6A 5GADJ 4XK4A 2QLZA 2I9IA 2NUFA 1RC7A 1P4WA 2F5EA 2DMUA 5DS9A 1FYKA 1RIOH 1X4PA 2JYAA 3WTTC 1ZYRF 5CKTA 2JR1A 4X8WA 1KA8A 3E0JB 3RIRA 2EZ6A 3TQNA 1QHGA 4DBRA 2KIQA 2GOMA 3CCLI 5E3MA 5HDKA 3C2GA 4FASD 3LWFA 4JI5E 4RGRA 1YS6A 1RI7A 2XRNA 2X1CA 3OS2A 3P9KA 1AU7A 3RPUD 3ZMZA 3S32A 2EQ0A 2DRPA 2KPMA 4EM1A 2LCEA 3NWTA 2JOBA 4I8OA 2DA1A 1GVJA 2ADRA 4MLQA 3DP7A 2RS6A 2HZTA 2MYSA 5LFAA 3M1CA 4IQJA 1KZHA 4JYAE 3NARA 3CCYA 2NS0A 1IW7F 2FD5A 1W5TA 1V54H 1QHHD 1WWXA 2V9KA 3JTZA 4XONA 4MLVA 1A6IA 2EMBA 1A1GA 2R93J 2OQGA 1DDNA 4BJ5C 2LV2A 5HVQC 3CC2I 1T8IA 3NRVA 1Y0UA 2E35A 3KYDB 5FKKA 3CO7C 3HHGA 3DFGA 5D6FA 1WHNA 1A31A 2V6CA 1HR0E 2NVTJ 3ZQFA 3KP5A 2IGNA 3ECHA 4P5OA 2FJ1A 4PUSA 3IC7A 3M4OJ 2LSOA 3WG9A 2HPMA 2YPNA 4ON0A 2DJNA 3ZQIA 4CDGA 1TQIA 1S29A 1Z21A 2R5YB 2O61A 4UXNA 1XC5A 1VQOI 3BT9A 2L2MA 1R5GA 2VE8A 3BJ6A 3BCBA 1Y0NA 1PVEA 2IS4A 3AV0A 1R9TJ 3SDBA 2DSYA 2L4MA 1FP2A 2AXLA 1ETQA 3RKWA 3M8JA 3ZXSA 1ZRCA 1TWCJ 1MW7A 2NUEA 3COAC 1G3TA 2VB6A 3GTKJ 5IV8B 2W1OA 2CUEA 5IT9Z 1E17A 2M4KA 2EPCA 1GVDA 1T39A 2DPUA 3QODA 4JI2E 5IT3A 2JRMA 1SD5A 3C1DA 4OOGC 1IZ1A 4XKWA 5L3DA 2UXBE 5H20A 3DPTA 4LFAE 4ESFA 4XLNF 2NVYJ 4CA0A 1ETOA 2PEXA 3Q9SA 3SFZA 1BC7C 4RAGA 1STUA 4WXHA 3BBGA 3K1MA 1X3WB 2K7IA 4P96A 4LFCE 4O5VA 4MQ9F 3J81C 1TT5B 2EPKX 3RJPA 3FMRA 1HBXG 1CQTA 5IWAE 2PRTA 1XGSA 4OIOF 4FK5C 4G12A 4GYIA 5EGOB 1ZRFA 1VTNC 2JSCA 2ELHA 4MNUA 3I53A 1WRJA 3I64A 4WF2A 1S8NA 2JOXA 2JA8J 2RKHA 2HOTA 3VYYA 4EJUA 3GWZA 3OYNA 1VF9A 3RI4A 3LFUA 2E1OA 5LRRA 3WHCA 1JKOC 4IOAF 1N3GA 4CYDA 2R5YA 5BNGA 2JUCA 3DCFA 1D1CA 1OYWA 1Z3XA 3BPXA 2HVSA 2A3SA 1U3EM 3LA3A 2H09A 3EUHC 1SC7A 2HGCA 3SZGA 3T1HE 5F0CA 1VI0A 4RB0A 1A1JA 2IAIA 5H6RA 4KMUX 1L0OC 3DTEA 3JRDA 2R7QA 3PM1A 3F22A 4ZTFA 2FF4A 3WHBA 1XDUA 1GZ6A 4CYCB 4MEXF 2XVCA 5HOOA 2ELZA 1XSDA 2OTLI 2NXNB 4KZSA 2YTJA 3HB9A 3JTGA 5HLTA 3MZHA 2L92A 3WTVC 2HOAA 2VPRA 2QKLB 2HOEA 3CDLA 1LLMC 3OYCA 2EZKA 1WJ5A 2EPAA 4BHPA 3F6OA 1IV8A 3PJRA 3AFHA 4DV4E 4B3ME 1FBSA 2IPQX 4J19A 4NXNE 3D1NI 3PQJA 4LF4E 2A6HF 1ZAAC 2BXZA 4KJZA 2HS5A 4DQ2A 5EGOA 5CVVA 4BE2A 2IS2A 2R7ZJ 2CWEA 2LTRA 2ZO4A 1S7OA 2CQ7A 4CCNA 3ABMH 1D8KA 2DTRA 3OYLA 2GM4A 2AO9A 2W00A 3IH3A 4TV7A 1A35A 3A02A 4MHGA 2M1SA 2DDBA 2YU9J 1RQ0A 3DTIA 5ILSA 3OS0A 1XGMA 4NC7A 1IN7A 2BY1A 4KT5C 5IOYA 3HPZA 4B4CA 5D5VB 3PUBA 3ML6A 3MEXA 1T38A 3ZOQB 4YELA 4L9TA 3PFYA 5E8IA 2K9MA 9ANTA 5EEAA 3CTAA 1FNNA 2CS3A 4DMIA 1YUJA 2P6SA 4L5NC 2LOOA 3S3NA 1RKTA 3HJEA 1NK2P 4HNVA 1X3UA 1JJ6C 5J40A 1MJAA 2A05A 3S3MA 3MMYB 1R1TA 2YTIA 2OU2A 4CYCA 3FXRA 2YPRA 2KHMA 5FLXC 4PJJA 3GBGA 1QQIA 4KICA 2MKDA 3LLHA 2DGCA 1SVOA 1YPNA 4F92B 4JV5E 2EOHA 4DR1E 4G7OF 5FLMJ 1DGWY 2EB7A 2Y0SN 5CQEA 3E3VA 2MH2A 1Z77A 2ELYA 3G2BA 1HQCA 2DMQA 1ZLKA 3P1XA 1UHMA 2R7VA 3MVPA 2YSRA 4XRSA 1QU3A 5A6AA 4DV5E 4F9CB 4D7MA 3JSOA 1HKQA 1M1EB 1XDSA 1DPRA 1MMSA 2XSDC 5ERIA 3BR0A 1T0FA 2RV8A 1W7PD 2KZVA 2FEZA 2KJBA 2X0LA 4KN4X 5TISC 1TQMA 1FTTA 2MKNA 3ASOH 3DKXA 2FTXB 3IV5A 3LL7A 3CO6C 1KQ9A 1OCRH 3H92A 4IHWA 3C6KA 3WTZA 2GLIA 5ICFA 5EJCA 3M8EA 2ZFUA 3HKZN 3FBIB 4OAZA 2YX4A 4DBQA 3W6VA 4BUPA 5T6JA 2HQRA 4LG0B 1PJQA 3HOXJ 5FFXA 4CICA 4CZCA 4J00A 3ZQLA 3W2AA 3CUQB 4UB8C 1PUEE 1L4SA 4CUGA 5IP6A 2DODA 1ULYA 3EYIA 1TWHJ 4B3XA 3T0YA 1XMOE 2GPIA 1OCPA 2W85A 3W2VA 1BOBA 1LQ1A 1IRGA 1WJEA 5JLWA 2ECBA 3BJAA 3PNYA 4EV0A 1PDNC 2NUGA 2EL6A 4HV5A 4O43A 4DW6A 4C3JJ 2DQLA 5D8LB 4E7LA 2EM6A 2FSWA 3A1YA 5B1AH 2DA3A 4IJAA 1J0RA 2BVLA 2LNBA 4PJMA 2QF7A 3ABLH 3E6MA 4HSTA 5FJ8J 2XROA 3JREA 3HPSA 5BQTA 4BXFA 4QTRA 3ZMTA 2BE5F 2X9DA 3L1PA 2X6OA 3LMLA 1SD7A 2UZKA 2FOWA 3G3ZA 3J81K 5F1RA 2EPOA 3I54A 3F8CA 3OSFA 4FHTA 3GTOJ 1WJBA 3JRGA 3CJRB 4II3A 3K6QA 1O3SA 3ECRA 1RPWA 1ACIA 1R7JA 4JBAA 4CH7A 4RA2A 2E34A 4A3DJ 2ENAA 2NA2A 3K1NA 1DGCA 3KLNA 4UUVA 2EH3A 3FIGA 2UXDE 3T8TA 2VKEA 1RC9A 3DXJF 4O5GA 2P81A 1A1IA 1OR7A 2UWMA 3GLXA 3ZGKA 2LF7A 2Z9OA 3SHFA 2PG4A 2X48A 1Z6RA 2HDWA 1K4TA 3JSPA 3CCEI 4GRIA 4FTHA 4LG0A 4YHHE 1TT0A 3KP3A 1ETWA 3HTSB 4PK4A 1VQ7I 2EN1A 4D0PA 3CUQA 3GFIA 3L2VA 4KMFA 4ENKA 1I3AA 2UXNA 2EM8A 2BOLA 1KYQA 4V19K 2QKMB 3BLYA 3GFMA 5JHUA 2IHR1 3OTOE 1IN4A 4E7ZA 5K5OA 2KIFA 1FMWA 1X4OA 2LDUA 2KP6A 3FXQA 5C3EJ 2MBFA 3CCUI 2YTDA 1F9NA 3OYFA 5HLGA 2F5DA 4R1HA 1UAAA 4L0ZB 1B8IB 5KL6A 1FPQA 2XGDA 1FTZA 3DWLE 2EZLA 3M7GA 1VQNI 3HOTA 2QZ8A 4XLHA 3FM3A 2FRHA 3JW4A 1X5WA 3CP2A 2UXCE 3KX2A 4S05A 2BBGA 5FKNA 4HQMA 1ZG3A 2IA0A 2Y0SA 3X2QH 1S7AA 2L02A 3MKLA 4RMNA 1D0YA 2BXYA 3RPUA 1X6EA 2QVOA 1O7LA 3J7YJ 4BU2A 3OYMA 1WFXA 2KONA 1FOWA 3AUZA 4GFBA 2CMPA 1GT0C 4CO8A 1W0UA 2HJJA 3OYEA 2P7VB 2XHKA 2OA4A 4E6KG 4XRMA 3F23A 3QG5C 1JGSA 3WU2C 5ILUA 2EL5A 1FLIA 2OBPA 1N32E 3M1EA 3QAHA 4P9FA 3K4BA 4BBRJ 4BY1J 2DA6A 4R03A 1JHFA 3UKGA 2LUQA 1ZAOA 1Z1BA 1UCRA 1MIJA 1K79A 3IWDA 2CQNA 1QGPA 3U1DA 2IEKA 3HPHA 4U7BA 3QRFF 3H3UA 4LTYA 3ROUA 4F55A 5J8CA 4EGYA 3EQLF 5DD8A 3D5RC 2L5QA 3RYRA 2LT7A 1OFCX 4JX4A 3HL2A 1FYLA 4C2UA 1GHCA 2EOFA 2EPFA 2Z99A 4II2A 2OD5A 4BXXJ 2WBTA 1WI3A 4HOBA 4M9VC 1MNEA 3HKZA 5DD4A 4A6DA 2B7EA 1LE8B 3PIOF 1LB2A 2TRTA 2BV6A 1HNZE 4K0KE 5FRNA 2FU4A 1B8IA 3ERMA 4YEJA 4XICA 3VOEA 1R49A 2LY1A 2HOSA 2CPNA 1R5ID 1XSVA 5CVJA 1EKZA 4JK1X 1H88C 4AIKA 2UUBE 4LF5E 2E1MC 2Q2EB 3HRUA 2O0YA 2IGKA 1OKRA 3I55I 3F21A 1A1FA 3DF8A 2V9PA 1R4NB 3N05A 4BE1A 4UUSB 3S15J 2VC1A 3FXMA 4BQAA 3E6DA 4BMJA 5E1ZB 1ODDA 1J2XA 2FQ4A 1Z3YA 1XS9A 1MJBA 1TNTA 3JAMC 2LVHA 3OYGA 4HF0A 2ACJA 1F43A 4GKJE 4BQNA 1A04A 4XN3A 1U2WA 1JK2A 1UMQA 5JVTA 3L2CA 2L6MA 4RLQA 2H1KA 2LF8A 4PGGA 2WBUA 2EOOA 4YRVA 2FV4B 6PAXA 2F5FA 2KHXA 2K3PA 4QSHA 4I02A 2NAZA 3G1MA 4KHPE 1PJRA 4XKVA 5B3SH 3IRQA 1Z6TA 3L2WA 2ZM6E 3ZN0A 1YW9A 3EUAA 4BEHB 2UV1A 1WH5A 4BCAA 2KRCA 3A0BC 1LVAA 1LE8A 4F93B 2CUJA 2QYOA 4IHTA 1E3PA 2DMYA 5FD6A 1GLNA 3HSRA 4R79A 4WX9A 4BC9A 5M5YJ 2O7OA 2WAEA 4AYBN 4RHBB 5LGTA 5LGUA 1XMQE 2L3DA 2W48A 3WTSC 5A6BA 1MMGA 4L8NA 2Q2EA 1Y6IA 2WAQN 4BY7J 1STZA 2E1CA 2W82A 5C4JJ 1NG6A 4N9IA 3SYTA 2R7TA 1YO5C 1O3QA 5CVUA 2IJLA 5JLXA 2CH0A 2LMZA 4UUSA 1SFUA 3B6CA 4LMYA 1MKMA 3F6VA 5HNFA 4P78A 3TKYA 1GUUA 2MD5A 2XGEA 1EA3A 1R4MB 4W1UA 2V85A 2N8GA 3J80C 2EV0A 3WTYC 2HQNA 3BZKA 5AONA 4GKKE 1RKWA 4I0BA 2E5LE 2KL4A 4Y15A 3FWEA 1FSEA 1I27A 1TZLA 2OV7A 1HCRA 4B3SE 4IX7A 2CTDA 4A3GJ 3ZPLA 2NVQJ 3THNA 3QWLA 3HBLA 1K78B 2Q1ZB 5M5WJ 4RM3A 3G73A 4XRSG 2IGOA 3IKTA 3CC7I 2WBMA 4E7JA 5JHFA 3I3LA 3BTIA 4I0AA 2DK8A 2VE9A 5E1WA 2PMZA 4BEHA 1IQSA 5ILVA 4ZDLA 1JXSA 2BHYA 4DR2E 3VK6A 4IEJA 2JXPA 4CCKA 4ZYDA 3Q0UA 4KA4A 2EWLA 2XV4S 2VQHA 3QYBA 2CO5A 3EUHA 2IRFG 1DI2A 1BJAA 4NBQA 4UV8A 2QA4I 2QQAA 2ZJRF 2EL4A 1UG0A 2P7CB 3R0AA 3OWTA 1ONVA 1Z67A 2EK5A 2F6CA 2XPUA 2M1BA 2CV2A 2B9SA 4IKFA 1W5CC 4LJZF 1O4XA 2EOJA 2YU5A 4XSZF 2KZGA 2XC7A 4MFEA 2RQQA 4LOCA 3JRAA 1FP1D 4C9YA 3TL4X 1VQLI 1JK1A 2CU7A 4X62E 4AIJA 4XQFA 1MH3A 4UV9A 4HEIA 1B1BA 3W6JB 1JKQC 2QSFX 2EJ4A 3QOPA 2H27A 2HR3A 3DTKA 4ZZLA 1G59A 4DYRA 1U9NA 4YIFA 2DOFA 1ZBTA 3S1QJ 2M7BA 3P7NA 4BC7A 3MHHC 1LDKB 2F8BA 3K6GA 4PJLA 2LC2A 2L7ZA 2WA0A 4OIPF 5BR8E 1G2HA 5A2QC 1VQ4I 2HU9A 5EYRA 2V83A 1K78A 1EH6A 2XKPA 4HAMA 5HLHA 1Z7UA 3LSIA 3BQZA 4ESBA 1WQ2A 3HOVJ 2IXSA 5KL2A 3CCMI 5C4XJ 5F0HA 1GXPA 3BG3A 4LFBE 2L3CA 3O2PE 2WY8Q 5BPIA 2LP0A 5GAHJ 1PP7U 3H3VK 3JCUC 4AM3A 3M99B 3ZMSA 1Y39A 4RGXA 4X65E 4ZZDA 2NNYA 1FMVA 1FWZA 4HTGA 3S1MJ 2OTJI 2BY0A 3OYAA 1W4MA 1MGTA 2JRTA 2L9NA 3JRIA 1A1HA 3C3WA 4E4HA 4R2EA 2NS7A 3K4LA 3V8LA 4Q4ZF 3VFZA 4ZDOA 2GXGA 5HS8A 3GCMA 4XN0A 2HDCA 2V9VA 4F9BB 5K7FA 4A3BJ 4RB3C 4PCQA 2NRAC 4BH9A 3V8KA 2JA2A 4LK1F 5LL6R 2RREA 4AYBA 1Z91A 2M8EA 2X6WA 3J7AO 2CQKA 2ZFWA 2WAQA 2YZTA 4DR6E 2ZXWH 3BOQA 1QRYA 3C2BA 2FBIA 4D5CA 1FIPA 3CCJI 1EJ9A 5D8KB 2EORA 4KWYA 2EM5A 4E70A 1UJ8A 2HNHA 1OCZH 5TJJA 2CGPA 4E7KA 4DKKA 3HTUA 2FMYA 4QWQA 4ZC3A 5KL7A 2O6GE 1DUXC 2O9LA 2OAZA 3JAMK 3HGGA 1X1DA 2GOXB 2GWRA 1I5ZA 4A12A 3BPVA 5J4VA 4Y33A 4WSPA 2WCC3 4R8OA 4BQQA 2EOMA 1RESA 3TO7A 5KAIC 5DUIA 2STWA 2GIVA 3BTCA 2C6YA 4RDUA 2L9RA 3DKWA 2HHHE 1E2XA 2VBYA 4AD9A 1XCBA 4AVZA 5EEHA 1YJWI 2DTZA 3LSTA 1EF4A 3BR5A 2ZKZA 3L9FA 2DA4A 5HS9A 4FETA 1YW7A 3IWZA 3N97A 4N4RB 3OL4A 2M9AA 4CHUA 2EN8A 3FM5A 4E7SA 3HOYJ 1D5YA 5DCMB 4QIWN 1YS7A 4WXCA 2QWWA 1DGRM 1X3ZB 2Z16A 2J7JA 2Y69H 5L3FA 5AE1A 3EYYA 4RAZA 1JUMA 1R58A 2VBXA 4R2SA 3C7JA 4K2EA 2R7RA 2IGMA 1TC3C 1UILA 3NWSA 3S1RJ 3F9KA 2IS1A 2D1VA 3S2WA 1USSA 2W24A 2VLAA 2LUPB 3TW7A 1J5YA 4XNFA 2W7NA 1RRJA 1GV2A 2L2OA 3KP7A 3M07A 2JQ7A 2QSGX 3EDPA 2HYJA 1P2FA 3CJNA 3IKVA 5EG0B 1ITYA 3H9GA 5EZGA 2LG4A 3PUFA 5FO5A 1D8JA 3C4BA 2JPAA 2K4VA 4HX8A 2LE2A 4FE7A 4KNYA 4XLCA 3J80K 1X6FA 2K9LA 4A5MA 5HDGA 3BG5A 5HLIA 1KONA 5BS6A 1T4NA 2X1EA 4KN7X 5BPDA 4EEFG 3LSRA 1BL0A 2VPLA 1VNDA 2BGCA 2JMWA 3IAM2 2EQ3A 1LDJA 2E71A 1FY7A 1MD0A 4OIRF 3RDIA 1I1SA 2VRDA 5DUKA 2EM4A 4XOPA 5FKLA 3J7Yp 4DR7E 3IL2A 2HDDA 3L00A 3S17J 2FGGA 3A4CA 2GHFA 4GGGA 3F72A 2DDAA 3WGHA 3T8RA 1V5FA 4ZH4F 1IBME 5LRSA 2M2EA 3QQAA 5DCMA 3Q3SA 4NQWB 4LIUA 1HW1A 2BZTA 4R8HA 4XLFA 3QOEA 1DU0A 1MBFA 3DLLF 4L5JA 2R76A 2MLGA 2M7AA 3EPJA 5IPAA 2FNAA 3OS1A 1QU6A 1K6OA 3E97A 4OAYA 4EJWA 2GA2A 3VYTB 1FYMA 1TWFJ 1JJ8C 3QYEA 2L7KA 4E7IA 4C3IJ 2E5ZA 3I59B 3AG4H 1YQAA 2DMIA 5D4SA 2V88A 3LAJA 4IHXA 1BBGA 3RZDJ 2HQAA 3JRFA 2DFEA 2YRKA 4G8XA 3E5UA 2HPIA 3GXOA 4HRIA 3GTPJ 4F6NA 4HEA2 2COBA 2JPCA 4M3BA 1RR8C 2QGUA 3IAS2 2ETHA 2XB0X 1HC8A 1AA7A 1YW8A 2NYXA 4B8XA 1OPCA 3FHNA 2IBDA 4F3QA 3KIOA 2VOOA 2WC2A 2EN6A 2OQRA 1X19A 2M5WA 1QA6A 5AC5A 2V26A 2RGVA 5FROA 3VODA 3QP6A 2V79A 2L8TA 3TO9A 5HDNA 4U7DA 3HRMA 4AUXA 4RBOA 3LNQA 2EN3A 4LF8E 4C3HJ 4YIRX 4HQEA 5E20A 3OMLA 5K7HA 3BR1A 3G1OA 4NQWA 1L3LA 4WXDA 2EMXA 1X1CA 2YRMA 1PDAA 4PFOA 2EOSA 3FK7A 5KL3A 2M3AA 1QZZA 4R2AA 3HXLA 1HDDC 1BIBA 3B6AA 2NOGA 2EFNA 4JI0E 4IQ4A 1UZCA 3JRCA 2RQLA 4HLXA 3I59A 1Z0XA 2P8TA 5GPAA 2ZSHB 1QBJA 1PP8F 1N36E 1ZR4A 1AKHB 3RZOJ 2ICWG 3SEZA 1DU6A 2DLQA 2EPLX 3PSIA 2M0CA 1BW6A 2K86A 3FF5A 2VXZA 4QPQA 4A3IJ 3H0DA 2FBHA 4DR5E 1IRFA 3V8JA 5H6QA 1BB8A 4DUZE 4G6QA 2EWNA 1QO0D 5DM7F 5JR3A 4XLEA 3SXYA 2BBYA 1VQ5I 4L18B 3LA7A 3NQOA 3E6CC 3BDDA 2LKXA 1T08B 2F4MB 1E0EA 1ZELA 3ADGA 1C0WA 2HKXA 5AASA 1BW5A 3OOUA 3OYHA 3OOPA 2E2HJ 2K85A 3ECOA 3K69A 4WK8F 1IN8A 4BXUA 4XKCA 4Y4RA 3ERED 4Q47A 2NVXJ 2YTNA 1K6YA 1UB9A 1WHQA 2ZMEC 4O6JA 5L3GA 5E3NA 2YTPA 3K10A 1I1GA 3CCQI 5D5UB 2CQQA 1DP3A 3LSKA 2DYRH 2K9NA 3WE2A 5K7ZA 3OR2C 1ETXA 4FQGA 1QVUA 1SD6A 5F08A 2L3JA 2G7UA 4I2OA 2WB1N 4LD5A 3PSFA 3FX3A 2W4SA 2WV0A 4XIDA 4IHSA 5A6KA 4NZVA 1HKSA 2DFIA 3IRRA 1U8BA 3S16J 1FOXA 4WPYA 5HNHA 3FIWA 4LGWA 2GZWA 1AWCA 3QU6A 2H6BA 2CW8A 2WADA 3PNVA 3CCVI 1Z1DA 1IAWA 4P7DA 5L3CA 4HDVA 2LJHA 2JA5J 1AKHA 3LOCA 1WJFA 2F48A 3GFJA 4A3CJ 3GZ6A 2X85A 1T4OA 2DMNA 2QEXI 4LF9E 1H9GA 1X3CA 4XMYA 2NNNA 4N4NB 2EZIA 3G4SI 3SQNA 3C2HA 1JT6A 4PGHA 2RPCA 4X1EA 2E72A 3ZP5A 3CD6I 3T1YE 3KEQA 2KDZA 2YR2A 1RETA 2I10A 3KCCA 2B9DA 1B4AA 1TBXA 2ZJQF 2R3SA 4M73A 1YYVA 2PX9A 3DU5A 4AIDA 2YTGA 3DEWA 4MFDA 2GXBA 4JYKA 1G3YA 1WZ2A 3FK6A 4HX4A 4N4OB 3U1KA 1S5LC 1ZN2A 2Z3YA 2YX7A 5IYDJ 4OU0A 2LRSA 1HW5A 1HSTA 1U5TB 4HNUA 5GTHC 1FJLA 3KWRA 4M0VA 1T98A 3E6BA 1P4XA 2M0MA 3TMOA 2FA5A 2ME6A 2JN6A 2LMDA 2MD0A 1SEUA 1SMYF 4OIQF 2P0WA 2VIXA 2I8DA 2X6XA 3OIQA 3HTXA 5HODA 2DQRA 1I6HJ 3DKYA 5IT9C 1XX5A 1IXCA 1KU2A 3F8NA 4RGUA 2PMHA 3VEPA 1OYIA 4B3TE 4XLPF 1VQKI 2XF5A 3WGGA 2H6CA 3A03A 1TP4A 2VONA 4NDLA 3RPQA 1H89C 2PI0A 5E8GA 1YFHA 4BHBA 3PO2J 4L5IA 5H2FC 1ZARA 3FMSA 1KYZA 1FOKA 2HC5A 1YLFA 4B44A 3KZYA 2GXAA 3K4MA 3BP8A 2DN0A 3LSGA 2LH9A 3OYKA 1IGNA 1FBQA 1S7EA 4B3AA 1S3JA 3CP8A 5LEKA 2BY3A 3Q9VA 1ZR2A 1GXQA 4L0YB 2R7WA 4U88A 4DV2E 3K9TA 3AKZA 2MH9A 2V1XA 2VXDA 3BR6A 3PFIA 1LUJB 5HS7A 1AAYA 1B9MA 2JA6J 1BA5A 2V4JC 3DU6A 2EMIA 5IY5H 1N34E 2L2KB 4A6EA 3HIFA 1A6QA 1QZYA 4HBLA 3V7CA 2EPXA 4JI8E 1WJPA 3OIPA 1V3FA 4U0VA 5B66C 3BF2A 2ZNYA 5GPCA 3GTLJ 1JI8A 1X6HA 5CVIA 3OSGA 5KHDA 1U5TA 2EN4A 2F4IA 3K1PA 2WV1A 3DBLB 1T56A 3F8FA 4M9XA 1YE9A 1E3OC 1O7FA 2XKOA 4CZZA 3IH4A 3JTHA 1CF7B 3G1LA 2K4JA 3ABUA 3C6MA 4OINF 1X48A 3CDIA 1XGNA 5EF6A 3Q0WA 4R2DA 2CUFA 2IP2A 2UUCE 2DXIA 3HRTA 4M3FA 1GQEA 1J75A 3VSKA 5D5XB 2G0EA 4KFCA 5ED4A 2LKSA 3VWBA 1KQ8A 1KU9A 5EEGA 2L4AA 3P9CA 1ZBQA 1YOVB 2WB1A 3ZQQA 2F5VA 2NS8A 5F6FA 5KVRA 2V1DA 1HW2A 3RKYA 1BJZA 2HXIA 5EDNA 4IJDA 1Y8RB 2EOZA 2PMZN 1IN6A 2GBYA 3MN2A 4P9UA 1PJTA 2EPUA 5LHIA 1FEXA 1PYVA 4IOCF 1B59A 3VB2A 5FB2A 2V6EA 5FRMA 3DEUA 3FXOA 2UUAE 1P4AA 4M74A 2AQFA 3CCSI 1WGXA 2XAQA 3LA2A 3IWFA 2DOAA 5FLXK 2ODRC 1UHSA 1IO2A 2VQCA 2DBBA 3WG7H 2VE7C 2QBYB 3HGYA 1A36A 4HF2A 4S04A 2YUSA 3ISPA 3ZR8X 2HYGD 3FXUA 5K5RA 1CF7A 2EA2A 4O4KA 4CCOA 1S9HA 3G71I 2WY7Q 2A68F 2K7LA 2FUG2 2X4HA 2N3HA 3V7RA 1ENHA 2E60A 2IVMA 3BROA 3O8HA 4IF4A 5DM6F 1LEBA 4WYQB 3FXLA 3D0SA 2JVAA 3RSNA 3GW2A 1RZ4A 4OWRB 4RM2A 5AC4A 1K61A 1JHHA 3HRSA 2JVHA 1USTA 4U0YA 1J26A 4C30A 1DQ3A 4BBSJ 5FKOA 4M2ZA 3H1CA 4Y13A 4F9AB 1X1AA 4UB6C 1O3RA 3I0TA 1P7JA 1IXSB 1R1UA 2LREA 2HQ5A 2ELKA 2E2IJ 2MC3A 4GYGA 4OX9E 3UK3C 1OQYA 2H8RA 1XGOA 4YFXF 1ZQ3P 4DV0E 4PSWA 2EBIA 2VJJA 2QUFA 3P9IA 4TUGA 1NK3P 4R2CA 2ODRD 2JT1A 3K2ZA 4AIHA 1OLTA 3FMQA 4G6DA 1LPQA 1SVMA 2A6TA 2TDXA 3BZ6A 1SAXA 4F54A 1XB4A 3LSJA 2FQ3A 4U0WA 1UG2A 4Z6YA 2F5CA 2DA7A 2JSPA 1NTCA 1YHQI 2XSJC 1R6RA 2KRFA 1KGSA 4UHTA 4BACA 1EH7A 1MH4A 1FBUA 2QENA 4A3MJ 2XAUA 2LLKA 4YFNF 2GQQA 3QPHA 3TBIA 2QBYA 5M3FJ 3ZMDA 2LTSA 3CCRI 5KK1A 2KRHA 1PUFB 1NCSA 5TGTA 1VFCA 1XNRE 3ASNH 4EJTA 3KP4A 2EMWA 2RDPA 4MGRA 4I6ZA 4UNOA 1OMIA 3I56I 2ADUA 4Q35B 3K7AJ 3ZMVA 4ZYGA 2R7XA 1J9IA 4R2QA 4EATA 1WJAA 1OCOH 4CCJA 1D0ZA 4WFTA 5JI6A 1G6NA 1TN9A 2K3FA 4Y17A 2K9SA 2PJPA 3CMAI 1ZGWA 1T0FC 2BVMA 2EIKH 4LITA 2EOYA 3IUOA 4NHRA 1N77A 3QPLA 4M72A 4TUIA 2XAFA 2F2EA 2LY2A 5JVGF 1XNQE 2FX0A 1O57A 2E7XA 3LQQA 3B02A 5EZHA 1I39A 2EFOA 2P6TA 4HPQA 4M9SA 1XN7A 4IRHA 5J4YA 1MBKA 1FX7A 4LLLA 2ECCA 4BHCA 2EJRA 3KYCB 3K70C 1RUNA 2OZUA 1E3HA 2WBSA 1ZGAA 4A3FJ 2RS7A 1JKRC 4RLFA 2JZYA 3CF2A 4DOZA 4C2TA 3CZ6A 3JU0A 1X1PA 3KPHA 3HSEA 4M3EA 1ON2A 2Y75A 4WCGA 4FCYA 2MSYA 3CC4I 3LSHA 4A69C 3CMEI 1SD4A 1UHZA 2UXXA 1W36C 1FJGE 1YYOA 1D1BA 2EFWA 1H8AC 3VPRA 5LHGA 2P5KA 3A2KA 3IP4B 1W7PB 3S3OA 1XMKA 3LAPA 3J81Z 2W25A 2B3TB 2QQBA 1PUFA 3QU3A 1ZG1A 2XGCA 3GLLA 3MAJA 2KKOA 3EETA 3MSWA 3OYBA 2B7VA 5FKMA 1EV7A 1WCMJ 4HYEA 2B0LA 4A0ZA 4EQQA 2YSOA 4R2PA 1UHWA 4FE4A 1HOMA 2EFPA 2H1LA 2KIMA 4QPOA 1REPC 1T33A 2HZDA 2EPMX 4A5NA 1XSXA 4ANJA 2CV0A 2DMPA 2RSIA 3GZNB 4I76A 2CUZA 1S6LA 3H35A 2R7DA 1F1ZA 4QLCU 3S14J 1LNWA 4IS1C 2G9WA 4XORA 3L09A 4ZYHA 3K70D 1Z9CA 1S72I 2KMUA 2PFBA 3GTMJ 3BJOA 1R5HA 2OPTA 2R0QC 2YTQA 1JTXA 2FXAA 1O0WA 3H5AA 1OR7C 2GLOA 4MLOA 3UNGC 2OF7A 2EFQA 4DYQA 1LFUP 1IMUA 3EUKL 4ENNA 1MMDA 1W36D 4XOTA 1IDYA 1U8RA 2EE8A 3OR1C 5LEJA 3AG2H 2IA1A 2LO3A 3V4GA 3CUQC 2EMKA 4LG3A 5FGMA 4ENJA 3KETA 1YSAC 4B09A 1TNSA 2L7FP 1DPUA 5LGNA 3DLAA 4Y7NJ 1W7PA 3IH2A 4DGWB 5E17F 3GF2A 2K5CA 3SZTA 1G3SA 3TQMA 2O03A 2Q8UA 3DF6A 1BR4A 2K4BA 3DQVC 3R61A 3ZMUA 3GTQJ 4ASNA 1XCVA 4GZNC 3BG7A 5BOXA 3RQ4A 4JI7E 3CMYA 3HPGA 2ISZA 3A0HC 4G7ZF 3V42A 3GFLA 1ETKA 2ZCWA 2RQPA 4LFUA 1BM9A 3HUGB 3P5JA 1MEYC 5GP9A 3HOZJ 1HNWE 2EV5A 2E1NA 5AIPA 3M9AA 2D2WA 3GEZA 5IP7J 1T95A 1BIAA 4PZJA 1IJWC 2EINH 4O24A 1YYKA 5GTIC 2D9HA 5KCMA 2MC5A 2L2NA 2VUMJ 3KP2A 4B1RA 5L3EA 5KNLA 1POGA 2VKDA 4Z2YA 4HV6A 2CJJA 4BL0B 2R1FA 1T4LB 2ID3A 3WTXC 2HWVA 2YT4A 5FLXZ
chains in the Genus database with same CATH topology
1Z05A 4UVBA 4FX4A 3TDZC 2HFHA 1G4DA 4LLGF 4HX7A 1ZREA 4LK0F 1ZGJA 2JTVA 2FBKA 4G9YA 1FC3A 4NHJA 3WE3A 1TW2A 1F4KA 1G3WA 2R7FA 2QQ9A 1P92A 2Z5UA 4A2UA 3HUGA 4P55A 2RVCA 2G7HA 1YTYA 2M30A 1RUOA 5ICCA 5DYMA 4AVPA 1FZPB 3F3XA 3R0JA 3K0LA 3MQ0A 4O3MA 4EVIA 2HYFA 1CGPA 4EM0B 2VOPA 3DPLC 1BC8C 2KJCA 3ZQ7A 3F8MA 2GAUA 3KLOA 3BWGA 2XAJA 3GUDA 3SZPA 5K1YA 1IUYA 3AAFA 4HW0A 2COMA 3HOSA 1Q1HA 5CJ9A 4LLNA 3DV8A 3HYIA 2ISYA 3TOBA 1R1VA 4WWCA 2FOKA 3O3KA 3RTRA 5JFRA 3R60A 2M87A 4M9ZA 1KU7A 4G94A 1D3YA 3E5XA 4OMZA 5K5QA 2Q8KA 2XAHA 1R00A 2IW5A 2XGXA 2CFXA 4HZFA 5A2QK 1I6XA 3C18A 3U9GA 4LB6B 1ZHFA 3W6KB 3B73A 1HKTA 4MQVA 5D5WB 5LBQA 3KE2A 2GA1A 3D5LA 3CUOA 2WWYA 1T6SA 5CVRA 5D4RA 4EJOA 1WI9A 4UVCA 4ZYEA 1XMAA 2W84A 1ON1A 3N4MA 2DO7A 4AWXB 1LEAA 3QP5A 2EV6A 2XUBA 4HF1A 4F7ZA 4EMSA 3V7SA 3I5UA 1QNTA 2ESHA 4CXFA 3TOAA 3WTWC 2L01A 3RKXA 2L54A 5F64A 2PMUA 1W5SA 2EA4A 4I01A 5L3BA 1IF1A 1ZLJA 5CYVA 2HTSA 4GXOA 3GYHX 2CG4A 2VBZA 4OOIA 3GO5A 1TTYA 3JAMZ 3U2RA 2CW0F 2QM3A 4ETSA 3TDUC 2J5OA 2DK5A 1UFMA 1MZBA 3TO6A 2RN7A 1NHAA 3I58A 3MZYA 2DI3A 4IRGA 1R22A 2PN6A 3WGIA 1ZH5A 2PQ8A 4Q5SF 2WTEA 2STTA 5ICGA 4UVAA 3MCZA 4XBFA 2FNPA 5DV5A 5E1XA 2KIUA 2Y0MA 1D5VA 3HHHA 4M71A 1TQPA 4I09A 4YFKF 1BBYA 1KU3A 3GVAA 3J80Z 4YIIA 2VBWA 2IA2A 2DT5A 4KUMA 4LB5A 1O3TA 3T1BA 4BYYA 1FSHA 1K7AA 4PDKA 2A69F 2DAOA 1JE8A 2BEOA 3HSFA 1SFEA 2Q0OA 1IN5A 1TLHB 4G7HF 3LFKA 3BY6A 3GZ5A 1SMTA 4ESJA 2CSOA 4XSXF 2LKPA 2K27A 4MTDA 3IHUA 2A6EF 2Y48A 1KYWA 2PLYA 2VN2A 3I4PA 4IXAA 1R36A 5ICEA 2RNJA 4RS8A 4A0XA 2O3FA 1J59A 2OZ6A 5A2QZ 2RC4A 2XAGA 2VT3A 3R6SA 1T2KA 4KYWA 2H94A 3ABTA 5FFZA 4H0EA 1BN5A 4RAYA 4ENMA 4CGZA 1AOYA 4RB2C 2D45A 1BI2A 4IPAA 2J5PA 3M8FA 4N9HA 5E18F 3ZN1A 1H0MA 2ZXJA 3MFKA 2A07F 4DNCA 3I71A 2HEOA 5D6EA 2A61A 4N0BA 2AS5F 1FT9A 3CDHA 4EGZA 3L7WA 1BI1A 1RNLA 4BNCA 3KFWX 5BMZA 4MTEA 4GO1A 2ESNA 4L9NA 3PQKA 1P6RA 2HTJA 3QPTA 4JQFA 1MJ9A 2PBIA 4A0YA 5DCFA 3ELKA 4M6XA 3NEUA 1YIOA 1QPMA 2P5VA 1WKMA 3CLOA 4YG2F 1BI3A 4IVNA 1ZG5A 2ZBKA 4HDUA 1B6AA 1SFXA 4Q48A 2VC0A 4MEYF 4M6YA 4OMYA 5IT9K 5J8FA 4L9VA 3E5QA 1V4RA 3OV8A 5LLQA 1R23A 3R4KA 5TRDA 1TW3A 1J7KA 5AIQA 4XRFA 2A5YB 5J6XA 3RYPA 3WU0A 3O6BB 3ULQB 1DP7P 4EM2A 4HA8A 1YG2A 3TGNA 2BYVE 5LHHA 2JPBA 3MWMA 3GX4X 2MLKA 1KQ0A 4L9JA 2HKOA 4I7HA 2VT2A 1U78A 2CYYA 1BOAA 4HLYA 2K02A 4IRIA 2DLLA 2DW4A 5CLSA 3F8BA 3FHZA 1B9NA 1F5TA 2W57A 3KZZA 2E7WA 2ZMEB 1MDMB 2DU9A 2XIGA 2O8XA 1EH8A 3T5XA 4EJVA 3KP6A 5DDGA 2P5LC 4GCVA 1LDDA 4KDPA 1ZRDA 2VODA 1U6GA 3WU1B 1WSUA 3REOA 4KIGA 3WODF 2FE3A 4FX0A 5FD5A 4FT8A 2MA3A 2XASA 2ZJ2A 4KIFA 4NB5A 4KIBA 1HSJA 1U5TC 2Z33A 4BAYA 4RB1A 4I98B 3LQRA 1LJ9A 1H9TA 2V1UA 2FMLA 2DPDA 2M45A 1HXDA 2D1HA 3FZVA 2IT0A 3Q5FA 3KEOA 5DEQA 1OYYA 4RGSA 2ZMEA 1MDMA 2P4WA 1IXRC 2ZNZA 1XD7A 3WTUC 1BI0A 2YU3A 3H3ZA 2QLZA 1P4WA 2F5EA 1FYKA 1RIOH 3WTTC 1ZYRF 1KA8A 3RIRA 3TQNA 5HDKA 3LWFA 4RGRA 1YS6A 1RI7A 2XRNA 3P9KA 3ZMZA 4EM1A 1GVJA 3DP7A 2HZTA 2NS0A 1IW7F 1W5TA 1WWXA 2OQGA 1DDNA 5HVQC 3NRVA 1Y0UA 3CO7C 3HHGA 3DFGA 5D6FA 2V6CA 3KP5A 3ECHA 4P5OA 3IC7A 2LSOA 3WG9A 4ON0A 4CDGA 1TQIA 1S29A 2O61A 4UXNA 1R5GA 2VE8A 3BJ6A 2L4MA 1FP2A 2AXLA 3RKWA 1ZRCA 3COAC 1G3TA 5IT9Z 1E17A 1T39A 2DPUA 5IT3A 3C1DA 1SD5A 1IZ1A 5L3DA 5H20A 3DPTA 4ESFA 4XLNF 2PEXA 3Q9SA 3SFZA 1BC7C 4WXHA 3K1MA 4P96A 4O5VA 4MQ9F 3RJPA 3FMRA 1HBXG 1XGSA 4OIOF 4GYIA 1ZRFA 1VTNC 2JSCA 2ELHA 4MNUA 3I53A 1WRJA 3I64A 4WF2A 1S8NA 2RKHA 4EJUA 3GWZA 3RI4A 5LRRA 4CYDA 1OYWA 3BPXA 2A3SA 1U3EM 3LA3A 2H09A 2HGCA 4RB0A 5H6RA 4KMUX 1L0OC 3F22A 2FF4A 1XDUA 4MEXF 2XVCA 5HOOA 1XSDA 3JTGA 3MZHA 3WTVC 2HOEA 4BHPA 3F6OA 1FBSA 2IPQX 3PQJA 2A6HF 2HS5A 4DQ2A 5CVVA 2CWEA 2ZO4A 1S7OA 1D8KA 2DTRA 4TV7A 4MHGA 5ILSA 1XGMA 1IN7A 4KT5C 5D5VB 3ML6A 3MEXA 1T38A 4L9TA 5E8IA 3CTAA 1FNNA 2P6SA 1X3UA 1MJAA 1R1TA 2OU2A 3FXRA 2YPRA 1QQIA 4KICA 4G7OF 2EB7A 3E3VA 2MH2A 1HQCA 1ZLKA 1UHMA 2YSRA 3JSOA 1HKQA 1XDSA 1DPRA 5ERIA 1T0FA 2RV8A 1W7PD 2FEZA 2KJBA 2X0LA 4KN4X 1TQMA 3CO6C 1KQ9A 3H92A 3WTZA 5ICFA 3M8EA 2YX4A 2HQRA 4LG0B 5FFXA 4CICA 3CUQB 1PUEE 1ULYA 3EYIA 3T0YA 2W85A 1LQ1A 1IRGA 3BJAA 4EV0A 1PDNC 4HV5A 2DQLA 5D8LB 2FSWA 4IJAA 1J0RA 2LNBA 3E6MA 2XROA 5BQTA 3ZMTA 2BE5F 1SD7A 2UZKA 3G3ZA 3J81K 5F1RA 3I54A 3F8CA 4FHTA 1O3SA 1R7JA 4JBAA 3K1NA 3KLNA 4UUVA 3T8TA 3DXJF 1OR7A 2UWMA 3GLXA 2LF7A 2Z9OA 3SHFA 2PG4A 1Z6RA 3JSPA 4LG0A 3KP3A 3HTSB 4D0PA 3CUQA 3GFIA 4KMFA 4ENKA 2UXNA 3GFMA 5JHUA 1IN4A 5K5OA 2KIFA 2LDUA 3FXQA 2MBFA 1F9NA 5HLGA 2F5DA 4R1HA 4L0ZB 1FPQA 3M7GA 3HOTA 2QZ8A 3FM3A 2FRHA 3JW4A 4S05A 4HQMA 1ZG3A 2IA0A 1S7AA 2L02A 3RPUA 2QVOA 1O7LA 4CO8A 2P7VB 2XHKA 2OA4A 3F23A 1JGSA 5ILUA 1FLIA 2OBPA 3M1EA 3QAHA 4P9FA 1JHFA 1ZAOA 1UCRA 1K79A 1QGPA 3U1DA 4U7BA 3QRFF 3H3UA 3ROUA 5J8CA 4EGYA 3EQLF 5DD8A 3RYRA 1GHCA 1FYLA 2Z99A 2OD5A 4HOBA 5DD4A 4A6DA 1LB2A 2BV6A 2FU4A 3VOEA 1XSVA 5CVJA 4JK1X 4AIKA 3HRUA 2O0YA 1OKRA 3F21A 3DF8A 2VC1A 4BQAA 3E6DA 5E1ZB 1ODDA 1J2XA 1MJBA 1TNTA 4HF0A 2ACJA 1A04A 1U2WA 5JVTA 3L2CA 2LF8A 4PGGA 6PAXA 2F5FA 4I02A 2NAZA 3IRQA 1Z6TA 3ZN0A 1YW9A 1LVAA 2QYOA 4IHTA 5FD6A 3HSRA 4R79A 4WX9A 5LGTA 5LGUA 2L3DA 3WTSC 2Q2EA 2E1CA 1STZA 4N9IA 1YO5C 1O3QA 5CVUA 2IJLA 1SFUA 4LMYA 1MKMA 3F6VA 3TKYA 2MD5A 2EV0A 3WTYC 2HQNA 5AONA 4I0BA 4Y15A 3FWEA 1I27A 1FSEA 3ZPLA 1K78B 3G73A 3IKTA 4I0AA 2DK8A 2VE9A 5E1WA 5ILVA 1JXSA 4ZYDA 4KA4A 2XV4S 2IRFG 2CO5A 3EUHA 1BJAA 4UV8A 2QQAA 2P7CB 3R0AA 1ONVA 2EK5A 2M1BA 4LJZF 4XSZF 1FP1D 4AIJA 4UV9A 1B1BA 3W6JB 3QOPA 2H27A 2HR3A 4ZZLA 4YIFA 3P7NA 1LDKB 4OIPF 1K78A 1EH6A 2XKPA 4HAMA 5HLHA 1Z7UA 4ESBA 1WQ2A 1GXPA 3O2PE 5BPIA 1PP7U 3ZMSA 4RGXA 4ZZDA 2NNYA 1FWZA 1W4MA 1MGTA 2JRTA 3C3WA 4Q4ZF 3V8LA 3VFZA 2GXGA 5HS8A 2HDCA 2V9VA 4RB3C 4PCQA 2NRAC 4BH9A 3V8KA 4LK1F 1Z91A 2M8EA 3J7AO 2CQKA 2ZFWA 3BOQA 2FBIA 5D8KB 4E70A 5TJJA 2CGPA 3HTUA 2FMYA 4QWQA 2O6GE 1DUXC 2OAZA 3JAMK 2GWRA 1I5ZA 4A12A 3BPVA 3TO7A 5DUIA 2STWA 2GIVA 2C6YA 3DKWA 1E2XA 2VBYA 4AD9A 1XCBA 5EEHA 3LSTA 2ZKZA 3L9FA 5HS9A 1YW7A 3IWZA 3N97A 4CHUA 3FM5A 5DCMB 1YS7A 4WXCA 2QWWA 5L3FA 3EYYA 4RAZA 1R58A 2VBXA 3C7JA 4K2EA 2D1VA 3S2WA 1USSA 2W24A 1J5YA 3KP7A 3EDPA 1P2FA 3CJNA 3IKVA 5FO5A 1D8JA 4HX8A 4KNYA 3J80K 4A5MA 5HDGA 5HLIA 5BS6A 4KN7X 5BPDA 2BGCA 1LDJA 1FY7A 1MD0A 4OIRF 3RDIA 1I1SA 5DUKA 3IL2A 3L00A 4GGGA 3F72A 3WGHA 3T8RA 4ZH4F 5LRSA 5DCMA 1HW1A 4R8HA 4L5JA 2MLGA 2FNAA 1K6OA 3E97A 4EJWA 2GA2A 1FYMA 3I59B 1YQAA 5D4SA 3LAJA 4G8XA 3E5UA 3GXOA 2JPCA 2ETHA 1YW8A 2NYXA 4B8XA 1OPCA 2VOOA 2WC2A 2OQRA 2M5WA 2RGVA 3VODA 3QP6A 2V79A 3TO9A 5HDNA 4U7DA 3HRMA 4HQEA 5E20A 4NQWA 1L3LA 4WXDA 1QZZA 1BIBA 2EFNA 4HLXA 3I59A 2P8TA 1QBJA 1PP8F 2K86A 3FF5A 2VXZA 2FBHA 1IRFA 3V8JA 5H6QA 4G6QA 2EWNA 1QO0D 5JR3A 3SXYA 2BBYA 4L18B 3LA7A 3NQOA 3E6CC 3BDDA 1C0WA 2HKXA 3OOPA 3ECOA 3K69A 4WK8F 1IN8A 4BXUA 3ERED 4Q47A 1UB9A 4O6JA 5L3GA 1I1GA 5D5UB 3WE2A 1SD6A 2G7UA 4I2OA 4LD5A 3FX3A 2WV0A 4IHSA 1HKSA 2DFIA 3IRRA 4LGWA 2GZWA 1AWCA 3QU6A 2H6BA 1Z1DA 1IAWA 5L3CA 4HDVA 3GFJA 3GZ6A 1H9GA 2NNNA 3SQNA 4PGHA 3ZP5A 3KEQA 2YR2A 3KCCA 1B4AA 1TBXA 2R3SA 4M73A 1YYVA 2GXBA 1G3YA 4HX4A 1ZN2A 2Z3YA 2YX7A 4OU0A 1HW5A 1HSTA 1U5TB 1T98A 3E6BA 1P4XA 2FA5A 1SMYF 4OIQF 2DQRA 1IXCA 1KU2A 3F8NA 4RGUA 2PMHA 3VEPA 1OYIA 4XLPF 3WGGA 2H6CA 2VONA 3RPQA 2PI0A 5E8GA 1YFHA 4BHBA 4L5IA 1ZARA 3FMSA 1KYZA 1FOKA 1YLFA 3KZYA 3BP8A 1FBQA 5LEKA 1S3JA 3Q9VA 1GXQA 4L0YB 4U88A 3K9TA 2MH9A 2V1XA 3PFIA 5HS7A 1B9MA 4A6EA 3HIFA 1QZYA 4HBLA 3V7CA 4U0VA 1V3FA 2ZNYA 5CVIA 1U5TA 3K1PA 4M9XA 3F8FA 1O7FA 2XKOA 4CZZA 3JTHA 1CF7B 2K4JA 3ABUA 4OINF 1XGNA 2IP2A 3HRTA 1J75A 5D5XB 4KFCA 5ED4A 1KQ8A 1KU9A 5EEGA 2L4AA 3P9CA 5F6FA 5KVRA 2V1DA 1HW2A 3RKYA 1IN6A 4P9UA 5LHIA 1B59A 3VB2A 5FB2A 3DEUA 1P4AA 4M74A 2XAQA 3LA2A 3IWFA 5FLXK 2DBBA 2QBYB 4HF2A 4S04A 3ISPA 2HYGD 3FXUA 5K5RA 1CF7A 2EA2A 2A68F 2K7LA 2X4HA 3V7RA 2IVMA 3BROA 4IF4A 1LEBA 3D0SA 3GW2A 1RZ4A 1JHHA 3HRSA 1USTA 4U0YA 4Y13A 1O3RA 3I0TA 1IXSB 1R1UA 2MC3A 4GYGA 1XGOA 4YFXF 2QUFA 3P9IA 2JT1A 3K2ZA 4AIHA 4G6DA 3FMQA 3BZ6A 1SAXA 2TDXA 1XB4A 4U0WA 2FQ3A 2F5CA 2KRFA 1KGSA 4UHTA 1EH7A 2QENA 1FBUA 4YFNF 2GQQA 3QPHA 2QBYA 3ZMDA 5KK1A 4EJTA 3KP4A 2RDPA 4MGRA 4UNOA 1OMIA 2ADUA 3ZMVA 4ZYGA 1J9IA 5JI6A 1G6NA 4Y17A 2PJPA 4M72A 2XAFA 2F2EA 1O57A 2E7XA 3LQQA 3B02A 2P6TA 2EFOA 4M9SA 1XN7A 4IRHA 1FX7A 4LLLA 4BHCA 2EJRA 1RUNA 2OZUA 1ZGAA 2JZYA 3HSEA 4WCGA 1ON2A 2Y75A 1SD4A 2UXXA 2EFWA 5LHGA 2P5KA 1W7PB 1XMKA 3LAPA 3J81Z 2W25A 2QQBA 3QU3A 1ZG1A 3MAJA 2KKOA 3EETA 1EV7A 4HYEA 2B0LA 4A0ZA 4EQQA 1UHWA 2EFPA 2KIMA 1REPC 4A5NA 1XSXA 4QLCU 1S6LA 2R7DA 1F1ZA 1LNWA 2G9WA 3L09A 4ZYHA 1Z9CA 2PFBA 3BJOA 1R5HA 2FXAA 2EFQA 4ENNA 1U8RA 5LEJA 2IA1A