1QNTA

X-ray structure of human o6alkylguanine-dna alkyltransferase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
171
structure length
166
Chain Sequence
EMKRTTLDSPLGKLELSGCEQGLHEIKLLGKDAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna repair
molecule keywords METHYLATED-DNA--PROTEIN-CYSTEINE METHYLTRANSFERASE
publication title Crystal Structure of the Human O(6)-Alkylguanine-DNA Alkyltransferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 166
sequence length 171
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 1999-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1qntA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1qntA01
1YW9A 1PUEE 1ZG5A 5LEJA 4M6YA 2O3FA 3HHGA 3CO7C 2OU2A 2ESHA 3EQLF 3BJ6A 4EGYA 3ISPA 5FD6A 2ACJA 2CQKA 2EV0A 1ZH5A 1ZREA 4OIQF 1J9IA 4LGWA 3E5XA 4EGZA 2VC1A 2ZO4A 5CLSA 2L4MA 2P5KA 3J80K 4KMFA 4JBAA 3ULQB 3LQRA 3MAJA 1GHCA 3FZVA 3SXYA 1TNSA 4RB2C 1FLIA 2DO7A 4EQQA 3WGGA 1KQ0A 4IRIA 4KN4X 4UVCA 2TDXA 2QBYB 4WF2A 5LHGA 5TJJA 4CGZA 3ZMSA 2LF8A 3ZMZA 5EEHA 1FYLA 2UWMA 5BPIA 3JW4A 3BJOA 2CWEA 2W24A 2Z99A 3ZQ7A 5D4RA 3H3ZA 2WWYA 4RAYA 3ZPLA 4IHSA 5DYMA 4B09A 2FSWA 2DPUA 3WTWC 5ILSA 3O6BB 3LWFA 2FMLA 4IF4A 2LSOA 3FX3A 4OU0A 2WTEA 2X4HA 4U0VA 1QBJA 4FX4A 3BJAA 4I01A 2M30A 1HW2A 4ZYEA 1AOYA 3FWEA 3NRVA 4Y15A 2Z33A 4UVBA 1P4XA 4HX7A 1BI3A 5L3CA 3LA3A 2QZ8A 4HF0A 4Q4ZF 1O3SA 3MCZA 1U5TA 1BIAA 3EYIA 1O57A 1T98A 4RB3C 2RN7A 3TKYA 2Y75A 1LEAA 1RIOH 2CG4A 1IN4A 1O7FA 4D0PA 1B9NA 2HKOA 1ZLKA 1T6SA 3F8BA 2BYVE 2E7XA 4RB1A 1OYIA 2YU3A 4RGRA 1OYYA 1KYWA 3HSEA 3WE3A 4NQWA 2V1UA 3ROUA 1MKMA 5E8GA 3KEQA 4LLNA 3EETA 3V8LA 4G9YA 2V6CA 2P5LC 1IN6A 4ENNA 5E1ZB 3CO6C 2PMUA 2IJLA 3J81K 4LG0B 4ESBA 5D5WB 2PFBA 5LLQA 2QLZA 3I58A 4G94A 1QGPA 1T2KA 3O3KA 2PLYA 1R5GA 4UVAA 3FMSA 5ILVA 3W6JB 4PCQA 1IAWA 4ENJA 4EJTA 1R58A 1MGTA 3P7NA 4IXAA 4L0ZB 1G4DA 3I59B 3COAC 2YX4A 1MJAA 2COMA 2ESNA 5TRDA 3NEUA 3CUQA 3PQJA 3GO5A 4WXDA 3T5XA 1R23A 2KIMA 1K78A 1GXQA 3I54A 2DK8A 2YSRA 3R6SA 5LGTA 2F5DA 4E70A 2JT1A 5E1XA 2XVCA 3CLOA 3E6DA 1VTNC 4GO1A 4UV8A 4A5MA 1XGOA 1STZA 1R22A 4KN7X 1ZRCA 2Y0MA 2KJBA 2Q8KA 2NNYA 2MH2A 2E1NA 2VN2A 5DD8A 3T1BA 1DPUA 2PEXA 1HSTA 3E6CC 1TQMA 1FC3A 2FBIA 2M8EA 2D1HA 1TQIA 3KFWX 4L5JA 3F8NA 2QQ9A 3HRTA 2EV6A 1IW7F 4GGGA 3MZYA 3KZYA 3N4MA 4M72A 3FXRA 4HLXA 3ZMUA 1ZRFA 4KT5C 3SZTA 2FA5A 2F5EA 2JPCA 3MWMA 5D4SA 1U6GA 3DV8A 4LD5A 4YFKF 2J5PA 1D3YA 5CYVA 4ENMA 5HVQC 3IKVA 1YTYA 4LB6B 2IT0A 2P5VA 3TOAA 2JPBA 3DF8A 3LAJA 2VE9A 1BC8C 1S29A 4PZJA 2RQPA 4I98B 2UXNA 4BH9A 3MEXA 4U7BA 2IA1A 2KJCA 1OKRA 2J5OA 1CF7B 1Z1DA 3CJNA 2Q0OA 3RJPA 4KFCA 4XSZF 1DPRA 2PI0A 1LNWA 3LA7A 1QZYA 3QPTA 1FT9A 1EV7A 1G3SA 2XUBA 3F6OA 1R36A 1R7JA 1EH6A 1FX7A 4P96A 5E1WA 3GZ6A 4HF1A 3D5LA 4A0XA 5H6RA 1A04A 3E6BA 3IHUA 1DP7P 4P55A 2P7VB 3TO9A 1C0WA 2LNBA 1KYZA 3KEOA 3V7CA 4A6EA 2K86A 3L9FA 2FMYA 1F5TA 1XB4A 2QQBA 5J6XA 4B8XA 4HBLA 4ENKA 3QP6A 3HOSA 3U9GA 1O3QA 4KNYA 3KP3A 4O6JA 5L3EA 2R3SA 2EFQA 5DD4A 3E5UA 1P6RA 4ETSA 3ECOA 3RDIA 1SD6A 3JTGA 3K9TA 3ML6A 3ZN1A 1F9NA 4HV5A 2GAUA 1G3WA 5HDKA 1HXDA 1YS6A 4OMZA 2FEZA 2KIUA 2H27A 2GIVA 1IN7A 1S7AA 4PGGA 2KKOA 1U2WA 4G6DA 2KIFA 4ZYDA 1AWCA 2HZTA 1I6XA 3IWFA 1SD5A 2VC0A 2LF7A 3ABUA 3JAMK 1ZARA 1FYMA 1V3FA 4G7OF 3QOPA 4ZZLA 2STWA 4Q5SF 2EK5A 4IVNA 4XBFA 4A0ZA 1LQ1A 3V8KA 2OZUA 2A5YB 1B59A 1WSUA 2VE8A 2V79A 3KP2A 4GYIA 2MLKA 1K7AA 5LHHA 1IN5A 3Q9SA 1L3LA 1I1GA 1OPCA 5E17F 1FSHA 4EJOA 3GUDA 3T8RA 3GFMA 4BHPA 3SZPA 3TDUC 1Z91A 3KP6A 4CDGA 1B9MA 1W7PA 2IW5A 1SD7A 3GW2A 1I1SA 2MH9A 4KIBA 4AVPA 5HS9A 1JE8A 4HLYA 4UXNA 3C1DA 1D5VA 3HSRA 5DCMB 1SD4A 4HF2A 4L9TA 4R1HA 2VODA 3EUHA 1ZYRF 1Z9CA 1B1BA 3WG9A 5FD5A 4OINF 4U0YA 4A12A 1YFHA 5BPDA 1SFXA 4CICA 2K4BA 4L9JA 4LK1F 5AIPA 2XAJA 1IZ1A 1GVJA 3QU3A 3WGHA 1CGPA 4AWXB 1O3RA 5ILUA 4YIIA 4P9UA 4Y17A 4MTDA 3OOPA 2EA2A 4XRFA 1G6NA 1MJ9A 3ZP5A 1YG2A 4UV9A 3ZMDA 5CVVA 3E97A 3WTXC 3O2PE 3V7RA 4RAZA 4DQ2A 2YX7A 4IHTA 1ZGAA 1P4AA 2ZXJA 5K1YA 3WTSC 2ADUA 2ZBKA 5ICCA 1B4AA 4HYEA 3WTZA 1J0RA 1Z6TA 4L18B 5J8FA 1W5SA 2XAQA 4EM1A 3TGNA 4IJAA 1BOAA 2ZMEB 5JHUA 3WU1B 3Q9VA 3LAPA 2ZNZA 4HW0A 1IXRC 2F2EA 3CTAA 1EH8A 3M9AA 4LG0A 2HWVA 5LBQA 1I5ZA 3VB2A 1XDUA 3PQKA 2B0LA 4Q47A 3ZMTA 2OQRA 4I09A 4KIFA 3HIFA 1J2XA 1U5TC 4DNCA 3AAFA 1E17A 1XSVA 1R00A 4I2OA 1MDMB 3FMRA 1K79A 1XGMA 4P5OA 3FHZA 3ECHA 1XMAA 3PFIA 2HGCA 3I59A 5D8KB 4AD9A 2KRFA 3KLOA 4ESFA 2RVCA 3P9KA 5LRRA 5HS8A 2W25A 1KGSA 2WC2A 3CDHA 4S04A 1V4RA 3WGIA 3L00A 2HKXA 1OMIA 3BOQA 1H9TA 4RGSA 2NYXA 2HYGD 1ZAOA 3WTYC 4M9ZA 2VONA 2QM3A 4M73A 2BEOA 1L0OC 1ZLJA 4F7ZA 3K0LA 1IN8A 2XHKA 1XSDA 3F6VA 1JXSA 1T39A 5L3FA 1KU2A 2DT5A 3P9CA 5A2QK 3EDPA 1XN7A 2P8TA 2M5WA 3KZZA 1QQIA 3KCCA 4K2EA 5AONA 5D5VB 1BI2A 1P2FA 1BI1A 3J80Z 1YO5C 3M7GA 3DFGA 1SFEA 2IA0A 2D45A 2MLGA 4CO8A 2H6BA 4QWQA 3MZHA 3D0SA 2NNNA 1FP1D 1Q1HA 2QYOA 3GWZA 2JRTA 1QPMA 4YG2F 3BDDA 3KETA 1Z05A 3CUQC 3M1EA 1Z7UA 5CVJA 1JHHA 2FF4A 3HTUA 2MC3A 4XSXF 5E18F 2AS5F 3GFIA 2ZJ2A 3GFLA 1HKTA 2IP2A 3QPHA 1K6OA 2FQ3A 4CHUA 1XCBA 2R7DA 2BE5F 2ETHA 3L09A 2XKOA 3B02A 1CF7A 3I0TA 3ERED 1SFUA 2D1VA 2GA1A 3Q5FA 5L3BA 3F22A 1U78A 4M9SA 3I71A 1XD7A 3HOTA 1SMYF 2O8XA 2QWWA 3SFZA 3BZ6A 1BI0A 3I53A 4A2UA 3IKTA 2O6GE 2A6HF 5JVTA 1YQAA 2NRAC 2RV8A 3QP5A 4CYDA 3GYHX 3RKWA 4HV6A 3K1NA 1MJBA 4BYYA 2E7WA 5BMZA 2EFPA 3JSOA 2HEOA 1J5YA 2CFXA 1RUNA 4IRHA 3K69A 2HOEA 2F5FA 4ESJA 1SMTA 3GF2A 2DQLA 2PMHA 5K5QA 1R1VA 2VOOA 2EJRA 5ICEA 2UXXA 2A6EF 2GA2A 2C6YA 4JQFA 2P6TA 1KA8A 5F1RA 4YFNF 5FLXK 5CVIA 2XAHA 3ABTA 2DFIA 3BWGA 2DPDA 4LB5A 2A3SA 1REPC 1UCRA 3I5UA 2EB7A 1ULYA 4WXCA 1TW3A 2QQAA 3GX4X 3J81Z 4HOBA 2DTRA 2ELHA 2VXZA 5AIQA 4HAMA 1ZG3A 6PAXA 1OYWA 1ZHFA 1R1TA 4G7ZF 5JR3A 5JI6A 5D6EA 1S8NA 2HS5A 3TDZC 1LB2A 3K1MA 5ED4A 5ICFA 4N9IA 2IPQX 2VBXA 1ON1A 3QAHA 3MQ0A 1IRFA 3R61A 2PN6A 3FXQA 5CVRA 3WTVC 3S2WA 3RKXA 2RKHA 3V7SA 5CVUA 1XMKA 1HBXG 2K02A 2FXAA 1BIBA 3WODF 1W5TA 2XGXA 2K27A 2GZWA 1XGNA 2ZKZA 2PQ8A 2OZ6A 4L9VA 3RYPA 4NHJA 4EMSA 3F21A 4N9HA 3VOEA 5D5XB 3GEZA 2Z3YA 3R0AA 4MEXF 1YLFA 2A07F 2VOPA 2UZKA 3R60A 3VEPA 3TO7A 1DDNA 2V9VA 5BS6A 4OMYA 4I0BA 3TO6A 3ZN0A 3LQQA 2XIGA 2H09A 2HQNA 3FM5A 4XLNF 4OIPF 3TOBA 2VBWA 1S7OA 1UFMA 2FRHA 3HTSB 2IVMA 1RUOA 3FF5A 5KVRA 3IRQA 4QLCU 4I7HA 1S3JA 1J59A 1TTYA 2L02A 1Z6RA 3LSTA 1ZG1A 3HRSA 4HX8A 1KQ9A 5DUKA 1E2XA 2QBYA 4OIOF 1WKMA 4JK1X 2WV0A 4HZFA 3QRFF 2XASA 3WE2A 1R1UA 3DQVC 1X3UA 2RDPA 3HHHA 3RPQA 1W7PD 2G7UA 4EV0A 5L3DA 5IT3A 1RZ4A 2DI3A 5D8LB 1JGSA 3B73A 3E3VA 3HUGA 2DK5A 1T38A 3IL2A 5BOXA 2ZFWA 1IF1A 1IUYA 4MHGA 5HS7A 4G7HF 5DDGA 3RKYA 1H0MA 5H20A 2XV4S 2Z9OA 2ZMEA 4YIFA 2PJPA 2W57A 4OOIA 3SQNA 1PP7U 3I4PA 4O3MA 5LRSA 3RPUA 1D8KA 3REOA 4ZYGA 5DEQA 3ZMVA 3KP4A 4FT8A 2K7LA 4KICA 4BQAA 3F8FA 2XAGA 2R7FA 2MA3A 4EJVA 3M8EA 1FSEA 3T8TA 1TQPA 2DBBA 3JSPA 4OIRF 1MDMA 4YFXF 3W6KB 1IXSB 4A5NA 3SHFA 1U3EM 2JZYA 4U88A 1LDDA 3H3UA 1TBXA 5HLGA 2FNPA 2XRNA 1FBUA 3HRMA 4TV7A 3DP7A 3F8CA 5ICGA 2F5CA 2L54A 4MTEA 2CYYA 3IWZA 4U7DA 1ONVA 4MGRA 4G6QA 2QENA 1IXCA 1WI9A 5IT9K 1KU3A 2MBFA 1O7LA 5FFXA 5J8CA 2OQGA 4U0WA 1F4KA 4FX0A 2BBYA 4A0YA 4HX4A 4RB0A 1TNTA 4P9FA 1W7PB 3P9IA 4LMYA 5E20A 4EM2A 5FO5A 1HKSA 5L3GA 2RC4A 4KIGA 1XDSA 4ASNA 3JAMZ 2LDUA 2EA4A 2FE3A 4LK0F 3VODA 4LLLA 4HA8A 4CZZA 4WXHA 2ISZA 2BGCA 5D5UB 3CUOA 3M8FA 4L0YB 3LFKA 4KMUX 2A69F 4WK8F 2XKPA 4MQ9F 2DW4A 4O5VA 2EFNA 1G3TA 2NAZA 2AXLA 5K5OA 1LEBA 4BXUA 5F6FA 3ELKA 2P7CB 5F64A 4RGXA 2STTA 1UB9A 1ZN2A 3OV8A 5H6QA 2D2WA 1O3TA 2RGVA 2IRFG 1J75A 4HQEA 1G3YA 2YR2A 4KDPA 2M1BA 2GXBA 4LJZF 5D6FA 3F3XA 2OAZA 1PP8F 4S05A 2PBIA 3DEUA 3T0YA 4BHCA 1QNTA 3H92A 2EFOA 2K4JA 1HW1A 1FWZA 1HW5A 1F1ZA 4KA4A 5LEKA 1USSA 4IPAA 1YW8A 1MD0A 2L3DA 5FGMA 2BV6A 4LFUA 1P92A 1D8JA 5K5RA 2L4AA 5HDGA 4HQMA 2Z5UA 2IA2A 4RS8A 1P4WA 3KP5A 2P4WA 4HDUA 2Q2EA 3DKWA 2V1DA 5DUIA 2XAFA 3BROA 2RNJA 1PDNC 1FNNA 4GYGA 1XCVA 1U5TB 1KU7A 2M87A 1TLHB 3N97A 1MZBA 5HLIA 2HDCA 4IRGA 3F72A 1I27A 4WWCA 2P6SA 4R79A 1XGSA 1HQCA 5IT9Z 4AIJA 2X0LA 4M74A 2DLLA 2VT2A 4EM0B 1BBYA 1ON2A 4KYWA 2HTJA 3RTRA 4EVIA 1H9GA 1USTA 2FBHA 1KU9A 4LLGF 1RI7A 2ZNYA 1LVAA 3C3WA 2A61A 3HYIA 4A6DA 2ISYA 5EEGA 1NHAA 1S6LA 4BHBA 4BNCA 2LKPA 5JFRA 5DV5A 3K1PA 3WTUC 4ON0A 2GQQA 5BQTA 4ZH4F 5ERIA 2XROA 1U8RA 3F23A 1TW2A 1ZGJA 3FXUA 2QUFA 5CJ9A 1WWXA 4PGHA 1BN5A 3L7WA 1RNLA 2DQRA 2DAOA 4Q48A 4HDVA 2H6CA 1FP2A 5E8IA 2GXGA 3IC7A 1BJAA 2H94A 4G8XA 3CUQB 3E6MA 3RYRA 1FPQA 1UHMA 4Z2YA 1K78B 2QVOA 2OD5A 2VBZA 3IRRA 1FOKA 1LDJA 2CSOA 1B6AA 2VT3A 2O61A 4GXOA 1WQ2A 4R8HA 5A2QZ 2EV5A 4MQVA 1J7KA 4EJUA 3C18A 2OA4A 2CW0F 3RI4A 2O03A 1BM9A 2HTSA 4BAYA 2L01A 1FZPB 4H0EA 3BPXA 1DUXC 3KE2A 1WRJA 1YS7A 4N0BA 2JTVA 1FY7A 1FBSA 3G73A 3HSFA 1Y0UA 2G9WA 4ZZDA 2Y48A 4L9NA 1UHWA 2E1CA 5HDNA 5FB2A 3VFZA 2O0YA 1JHFA 1QZZA 2EFWA 5LHIA 5LGUA 3JTHA 2V1XA 3U1DA 1IRGA 3GZ5A 3U2RA 2G7HA 3KLNA 4AIHA 3I64A 1FBQA 3F8MA 4M71A 2DU9A 4Y13A 3GXOA 4FHTA 4RGUA 3WTTC 1R5HA 3GFJA 2FU4A 3QU6A 3HRUA 3DXJF 3KP7A 4ZYHA 4UNOA 4WCGA 2CO5A 1FYKA 4L5IA 3J7AO 1EH7A 4AIKA 3C7JA 3FMQA 2W84A 5KK1A 3V8JA 2OBPA 2HR3A 1GXPA 5DCMA 2FBKA 2EWNA 4PDKA 3FM3A 3BY6A 5HLHA 4XLPF 2CGPA 4MNUA 3MFKA 2M45A 3EYYA 4M9XA 4KUMA 4UUVA 1BC7C 4M6XA 3E5QA 5FFZA 1SAXA 3R4KA 2PG4A 4WX9A 2YPRA 1YW7A 1OR7A 1HKQA 1ODDA 3RIRA 1KQ8A 3K2ZA 2NS0A 3G3ZA 5LGNA 3LA2A 2HYFA 2GWRA 4GCVA 1LDKB 4EJWA 3L2CA 2ZCWA 5FLXZ 2MD5A 4UHTA 1YIOA 3BP8A 4MEYF 1XSXA 2FNAA 4I02A 3R0JA 1YYVA 4CXFA 3BPVA 3NQOA 5DCFA 2FOKA 1T0FA 1QO0D 1ZRDA 4I0AA 3DPTA 2VBYA 2JSCA 3TQNA 3V4GA 3DPLC 1LJ9A 1W4MA 2HQRA 2A68F 2W85A 2HFHA 3GVAA 3GLXA 1HSJA 5HOOA 3WU0A 4NB5A
chains in the Genus database with same CATH superfamily
1YW9A 1PUEE 1N32E 4GKJE 1ZG5A 5LEJA 2GHFA 1T4NA 3DCFA 2B9DA 2ZMEC 1V54H 4M6YA 3VHTB 2O3FA 4DR4E 1DQ3A 5B1BH 3RPUD 3HHGA 3CO7C 2OU2A 3OYIA 3LSJA 2ESHA 4B3XA 3EQLF 3ZOBA 3BJ6A 4A3LJ 4YHHE 4EGYA 4BEHB 3ISPA 5FD6A 2MGQA 2EIKH 2QA4I 2FV4B 1PUFB 4IQJA 2ACJA 2CQKA 4XONA 5J1RA 2VQFE 2EV0A 1ZH5A 3MKWB 1BR2A 4RBOA 2L9VA 2L9RA 2BW3A 2WA0A 4QTRA 4B3ME 1D0YA 1ZREA 4OIQF 3VSLA 4LGWA 1J9IA 3E5XA 4EGZA 2VC1A 2WB1N 4ZDLA 1KJKA 2ZO4A 3MD2A 5CLSA 2L4MA 3OYNA 1A1GA 2P5KA 3J80K 4MLVA 3S15J 4Q35B 1E3OC 1GQEA 5FLMJ 3AG4H 4KMFA 2R4GA 1WJBA 4JBAA 2E2IJ 3ULQB 3LQRA 3MAJA 1YI2I 1GHCA 3FZVA 3SXYA 4E4HA 3K2AA 1WJCA 3BR3A 4QSHA 1J09A 3CMEI 4BDYA 1TNSA 3H35A 2LH9A 5B3SH 4RB2C 5IXMB 4IEJA 3CJTB 3CP2A 3QODA 1FLIA 2E1MB 5EEAA 2DO7A 4JI4E 4EQQA 3H0DA 1LFBA 3WGGA 1EKZA 1N75A 2DMPA 5EGOB 3S3OA 1KQ0A 4DBRA 4IRIA 4KN4X 1G59A 4UVCA 1I50J 2NOGA 2XRLA 5J1UA 1HOMA 2TDXA 2RQLA 4J19A 4BE2A 2QBYB 4WF2A 5LHGA 3CESA 5TJJA 4CGZA 1QU6A 2EILH 3ZMSA 2LF8A 3CMMA 3ZMZA 2R0QC 5EEHA 3HPZA 1BR4A 1V5EA 4YRVA 2L0KA 1FYLA 2DFEA 3J7Yp 3H0GJ 3JU0A 2UWMA 4IL6C 5BPIA 4E6KG 3JW4A 3BJOA 3TMOA 2CWEA 2W24A 1I3AA 2VKDA 2Z99A 4BXXJ 2KHMA 3ZQ7A 5C44J 4MO7A 4KT6A 4BJ5C 2F4IA 1FOXA 5D4RA 2EBIA 2EMYA 2ENAA 3H3ZA 2WWYA 1SAUA 4RAYA 4BBRJ 3ZPLA 5DYMA 4IHSA 4B09A 2HJJA 4NXNE 3DF6A 2FSWA 2LMDA 1F43A 2DPUA 2RTXA 3WTWC 5ILSA 3O6BB 3LWFA 5IT9C 5TISC 4OWRB 3HUGB 3BT9A 2FMLA 4IF4A 3FISA 3UNGC 2V87A 2LSOA 3HBLA 3FX3A 2X51A 4OU0A 4D1QA 2YU9J 2WTEA 1WCMJ 2X4HA 1FJLA 1LPQA 4B3SE 3BQYA 1OCOH 1VQPI 4U0VA 1QBJA 1EA3A 4FX4A 2DOEA 3BJAA 4I01A 1R9TJ 5FKNA 1DI2A 4DMIA 1HNZE 1IDZA 2LC2A 2E36A 2M30A 1HW2A 2JY9A 3SEQA 4B44A 2O5RA 5A6KA 4ZYEA 1AOYA 3FWEA 3NRVA 4Y15A 4XICA 4X65E 2Z33A 3M07A 1MSEC 3OMLA 3BLYA 2VXDA 4UVBA 4HNTA 5HNHA 2DA5A 1UBDC 2RAEA 1P4XA 2CUZA 4HX7A 3SDBA 4GFBA 3BIDA 1X6EA 2LO3A 3LSRA 1BI3A 5L3CA 1TN9A 4LG3A 4HTGA 2H8RA 3LA3A 3M1CA 4I8OA 3P1XA 2QZ8A 2ZJPF 4DUZE 3IWCA 4HF0A 2VKVA 3OIPA 1UG0A 1T33A 1W5CC 4Q4ZF 1O3SA 3MCZA 1U5TA 4OOGC 1BIAA 3EYIA 1O57A 1T98A 3IH3A 4RB3C 2H36X 2Z1DA 3SEZA 2VASA 3AL0B 1RESA 1X4OA 4P78A 3E1SA 4OAYA 3S32A 2RN7A 2OUMA 3TKYA 2Y75A 3WU2C 5K7FA 5M3FJ 2MC5A 2DTZA 1LEAA 1RIOH 4JX4A 1YSAC 2HI3A 2CG4A 1RC9A 1JTXA 2J7JA 1IV6A 1IN4A 4LFBE 5F0CA 1O7FA 5FKLA 4D0PA 1JT0A 1B9NA 2HKOA 1ZLKA 1T6SA 3ADGA 3F8BA 2BYVE 2E7XA 4RB1A 1OYIA 4AQYE 1R4MB 2YU3A 3NARA 1KYQA 4RGRA 4KWYA 2UUZA 1OYYA 5A6BD 1KYWA 3HSEA 3WE3A 4NQWA 2V1UA 2DDBA 3ROUA 4DGWB 1MKMA 2ZXWH 2EWLA 2WBSA 3I3LA 2X6YA 3OYAA 5E8GA 2L2MA 5E3LA 1B8IB 1P9QC 5IY5H 1W36D 1Q1VA 3KEQA 2ICWG 1Y0NA 4LLNA 2F4OB 3EETA 3V8LA 4G9YA 2V6CA 3RQ4A 2EQRA 4P1WA 2P5LC 1IN6A 2UUBE 4ENNA 5A2QC 2HC5A 2ENCA 3BTLA 1PJSA 5E1ZB 3CO6C 2Y9ZA 2DA6A 1T08B 3Q3SA 1ETQA 4DUYE 2PMUA 2IJLA 4DV5E 3J81K 1S5LC 4LG0B 4ESBA 4FETA 5D5WB 3S1NJ 2V86A 4DV7E 2PFBA 5LLQA 3FXMA 4W97A 4BBYA 3ZQFA 2QLZA 1W0TA 3I58A 4G94A 2ZJRF 1QGPA 4DJAA 3FXOA 4DKKA 1T2KA 5IV8B 2V8QB 3O3KA 3DKXA 1IBLE 1POGA 2PLYA 1R5GA 1NEIA 4UVAA 3FMSA 5ILVA 4IX7A 5AASA 3AG3H 3W6JB 4PCQA 1LFPA 1TWCJ 4ENJA 1IAWA 4EJTA 2V26A 2QSFX 2KP6A 4E7SA 1K6YA 1R58A 1MGTA 3P7NA 1TL8A 2M2EA 4IXAA 2EN4A 4L0ZB 4X6AJ 1PJTA 2EIMH 1G4DA 3I59B 2EMHA 3COAC 2YX4A 2NVQJ 1MJAA 2ZSHB 2CUFA 5LD2C 2COMA 4AC0A 2ESNA 2FD5A 3BCAA 2X1CA 2M8GX 2XGDA 5TRDA 3NEUA 3IP4B 3CUQA 3PQJA 1YX3A 3GO5A 4JV5E 4XOTA 3KX2A 4WXDA 3T5XA 1R23A 4B1RA 2R5YB 3IWDA 2KIMA 1K78A 4WFTA 1GXQA 2EJ4A 2DFFA 4ZJZA 1TP4A 3I54A 1IV8A 2W4SA 2DK8A 3CZ6A 2YSRA 3R6SA 1SEUA 5LGTA 2D5VA 2F5DA 2HDDA 2LBFA 4NZVA 4E70A 2R5ZA 3C2HA 3K70C 4A3DJ 3FIWA 1DQUA 2JT1A 3FXKA 4IHXA 2EOZA 1R49A 3PIPF 5E1XA 2XVCA 2CV0A 3CLOA 1AKHA 2UUCE 3E6DA 1VTNC 1VQKI 1WI3A 2F4VE 2KT0A 4GO1A 4UV8A 3CDIA 5E3MA 5E3NA 4A5MA 3OS2A 4UUTA 3PJRA 5LMUE 3FIGA 1BOBA 3ZQGA 1XGOA 2HXIA 1STZA 1TWHJ 1R4NB 5KAFC 1R22A 4KJZA 4KN7X 1ZRCA 5CQGA 4Y3OA 1VQ7I 1G8XA 1IMUA 2NUEA 4D5CA 3VK6A 3CP8A 2VPLA 1A31A 3BQZA 2Y0MA 5F0HA 5EDNA 3GTQJ 2FQ4A 5AC5A 2KJBA 2JRMA 2Q8KA 2NNYA 2VQLA 3FKIJ 2MH2A 2E1NA 2VN2A 5DD8A 4Y52J 2N3HA 2VJJA 3A0BC 2E35A 3MSWA 1YYWA 4NNJA 3T1BA 1DPUA 2EOQA 2PEXA 1HSTA 3E6CC 3C4TA 1Y39A 1TQMA 1WVRA 4F91B 1FC3A 3CCRI 5AE1A 2FBIA 2BB8A 2WBUA 2M8EA 2D1HA 1TQIA 3KFWX 1T4LB 4L5JA 5F1JA 3F8NA 3SJMA 2WY8Q 2QQ9A 1TWGJ 4JI8E 3HRTA 3DTEA 2EV6A 1IW7F 4GGGA 2Q8UA 3HGGA 3MZYA 4BJTA 1HNWE 2UXBE 3KZYA 1HNXE 3BTCA 3N4MA 2A05A 4M72A 3FXRA 4HLXA 1MMNA 4MLQA 4CZCA 3S2HJ 3ZMUA 2Y0SA 2IBDA 2EM4A 2NUGA 1ZRFA 3FKJA 4KT5C 3SZTA 1BW6A 2FA5A 4A3JJ 2F5EA 3OR2C 2JPCA 3MWMA 1X19A 2EOHA 5D4SA 1U6GA 2XF6A 2OTJI 3DV8A 2EOSA 4LD5A 4YFKF 3L1PA 2J5PA 5GTIC 1D3YA 2M0MA 1ORKA 2K4VA 1A1IA 5CYVA 4ENMA 2XPWA 2COBA 5HVQC 3G1OA 3IKVA 3W2VA 1YTYA 1EF4A 1DP3A 4LB6B 2LOOA 5FLXC 2IT0A 2P5VA 3TOAA 2JPBA 3DF8A 2GOMA 3LAJA 2VE9A 3BG5A 1VQNI 5FRMA 3RSNA 1S29A 1BC8C 4R2QA 1E0EA 4PZJA 4Y4RA 3AV0A 2RQPA 2MFZA 2Y9YA 4I98B 4H4KC 2UXNA 4OAZA 1N78A 3LSIA 1WJPA 5GPAA 3MEXA 4BH9A 2NVYJ 5FJ8J 2IA1A 2KJCA 3H5RA 4U7BA 5F3WA 4C3HJ 5F27A 1OKRA 2J5OA 4HSRA 1CF7B 2RNGA 1Z1DA 2LVHA 3CJNA 2HGHA 4HNUA 2WV1A 4LF9E 3S16J 4V2FA 2Q0OA 2LJUA 4AIDA 3RJPA 4KFCA 4XSZF 5JVGF 1XMXA 1QU3A 1DPRA 2LBSB 4CYCB 1WJAA 2PI0A 1LNWA 1U9NA 3LA7A 1QZYA 3OIOA 3QPTA 4A3IJ 2EZLA 1FT9A 3AG1H 2M7QA 3EPKA 5KL2A 3QYEA 2XC7A 1EV7A 3CJQB 1G3SA 2XUBA 3F6OA 2UXDE 1R36A 3CMYA 1R7JA 1JJ8C 2NVUB 4M6VA 1EH6A 1VQ5I 1FX7A 4XKBA 4P96A 5E1WA 3GZ6A 2VI6A 1WZ2A 2LTRA 1V5GA 4HF1A 3D5LA 1VQ4I 4A0XA 3CCSI 1JI8A 4BKXA 1FOYA 3K4KA 1A6QA 5H6RA 5J40A 1YUJA 1A04A 3E6BA 3IHUA 4E7IA 2K9QA 3FK7A 4P55A 1DP7P 3ERMA 1IRZA 2VKEA 2CQQA 1RPWA 2P7VB 1P47A 3TO9A 1DGRM 3ONQA 1C0WA 1UHSA 1YPNA 2JJ7A 2LNBA 1KYZA 3CF2A 3OYLA 1GV5A 2ZM6E 3KEOA 2MC6A 3V7CA 2Y69H 2K86A 4A6EA 4DBQA 3L9FA 3PNTA 1FEXA 2L7MP 2FMYA 1F5TA 1XB4A 2K9MA 2DLQA 3HC7A 2YSPA 4YY3E 2QQBA 5J6XA 4B8XA 4HBLA 5GADJ 4ENKA 4JX5A 3QP6A 2LREA 3HOSA 2YZTA 2V89A 4LOCA 3U9GA 1O3QA 1APLC 1RRJA 4KNYA 3D5SC 2JUCA 3KP3A 1O0WA 4GEQB 4O6JA 4FE4A 4V2GA 4M3GA 5L3EA 3CCEI 2R3SA 2EFQA 3H5NA 3RKQA 5DD4A 2DMNA 3ASNH 3ZQIA 2B7VA 3E5UA 2BXYA 1P6RA 2PJRA 4ETSA 3ECOA 4X66E 2ODRC 3RDIA 1SD6A 3JTGA 3K9TA 3ML6A 2M9HA 1FMVA 3ZN1A 5M5WJ 1F9NA 4HV5A 1P7JA 1ZBQA 3HOYJ 2EZKA 4LU9A 2GAUA 1G3WA 3BGHA 1SFOJ 2M34A 5HDKA 1X49A 2IEKA 5F04A 3S93A 1HXDA 1YS6A 4KISA 1ETYA 5KL4A 1RQ0A 1R6RA 2X6XA 1MMSA 4OMZA 2FEZA 2HU9A 2KIUA 5HLTA 3BZCA 2H27A 2OTLI 2GIVA 2QSGX 1IN7A 1S7AA 4XORA 4PGGA 1IDYA 5AC4A 4IS1C 2KKOA 1U2WA 2FX0A 4G6DA 2LR8A 1VI0A 2MYSA 2KIFA 5B66C 4ZYDA 1ZBTA 2YTJA 1AWCA 2AQFA 1GDTA 2HZTA 2EM7A 4IQ4A 1TZLA 1I6XA 3AUZA 3IWFA 1SD5A 2VC0A 3X2QH 2R92J 1YX5A 2OCCH 2XB5A 4RHBB 3L2UA 2CV2A 1OR7C 2LRDA 2LF7A 3WHCA 3ABUA 1XMOE 4IHYA 3JAMK 1G2HA 3CCVI 2DA3A 1ZARA 3BR5A 1FYMA 1A5JA 5C4JJ 1OFCX 1V3FA 3JRDA 2LTPA 1UAAA 1UILA 2FTXB 4G7OF 3QOPA 3OSFA 2OJED 4ZZLA 2STWA 4Q5SF 1ZU1A 3HPSA 2EK5A 4IVNA 4XBFA 2YU8A 1OCZH 1X1CA 1VQOI 4A0ZA 5FRNA 2L7ZA 1LQ1A 2HVSA 3V8KA 1GUUA 2OZUA 4NBQA 2JA8J 2ELZA 2A5YB 2VPRA 4O4KA 1B59A 1WSUA 4F54A 2VE8A 2V79A 3KP2A 4YEJA 3F6HA 4GYIA 2XSDC 3EUAA 5EGOA 2MLKA 2LUPB 1L4SA 1K7AA 4PFPA 4R2EA 5LHHA 1D1BA 3HJEA 1IN5A 3Q9SA 3JR9A 1L3LA 1I1GA 1OPCA 5E17F 1FSHA 1T0FC 1H89C 4EJOA 3OYCA 4N4RB 1JT6A 3GUDA 4FTHA 3T8RA 5J47A 1YRNA 3GFMA 4BE0A 3IH4A 1VQ6I 1PDAA 4A3FJ 4XLAA 2LFBA 4BHPA 3SZPA 3TDUC 5M3MJ 1T95A 2W1OA 1Z91A 3KP6A 1XNQE 3ABKH 2GIZA 1B9MA 4CDGA 1VQ9I 2ENHA 1W7PA 2DJNA 1OCCH 2IW5A 1SD7A 4CA0A 3GW2A 1X1AA 1I1SA 2MH9A 2BVMA 3HGYA 2EQ1A 2VIXA 4KIBA 1BW5A 4AVPA 2EMIA 4NDLA 2LY1A 3OYFA 4F9BB 1YUIA 2KHXA 5HS9A 1JE8A 2XSJC 2M0CA 4HLYA 2H1LA 4UXNA 2PRTA 3C1DA 2JA5J 1ETVA 4FQGA 1D5VA 3HSRA 2GLOA 2V1NA 2XPVA 3KWRA 5DCMB 4RDUA 4IOCF 4NB5A 1SD4A 1XNRE 4A3BJ 1X4PA 2L5QA 1A35A 4HF2A 1U9OA 4L9TA 4XLHA 1Y8QB 4R1HA 2VODA 3HOZJ 3EUHA 1TF3A 5KNLA 2L92A 1ZYRF 4BXFA 4UY8I 2VJ4A 1Z9CA 1B1BA 3CCLI 3WG9A 1IBME 5FD5A 1T8IA 4OINF 4BQOA 3ESWB 4U0YA 2ECBA 2ELKA 4E7LA 4A12A 2EL6A 1YFHA 4PFOA 1KZHA 3HOVJ 4R2DA 3HZJA 1MBHA 2B63J 5BPDA 1WGXA 2R7XA 1SFXA 4YIRX 4CICA 2K4BA 2EM9A 2EMKA 2AO9A 1X47A 2CW7A 2HOAA 4L9JA 4LK1F 1Y1VJ 4HEIA 4O5GA 3KEYA 5AIPA 2XAJA 1BJZA 1IZ1A 2KPMA 1GVJA 4LTYA 3QU3A 4AVZA 3HKZN 3WGHA 1D1CA 4NC8A 1CGPA 2O9LA 3PSFA 4AWXB 1O3RA 3P5JA 4JI1E 5ILUA 2K3FA 2QSHX 1GVDA 3K4BA 4YIIA 3LMMA 4P9UA 4Y17A 3V42A 4MTDA 2EM2A 3OOPA 2EA2A 4XRFA 1G6NA 2PX9A 1MJ9A 5H2FC 3C2BA 3ZP5A 2LT7A 1N25A 1N3GA 2L2KB 3SZGA 3VWBA 1YG2A 1GT0C 1U0JA 4UV9A 4Y33A 4L5EA 3H1CA 5CVVA 3E97A 3ZMDA 3WTXC 4PJMA 2WCC3 3H3VK 3O2PE 3F9KA 3V7RA 4RAZA 5LFAA 5E3OA 5BR8E 2UXCE 2X6WA 4DQ2A 2YX7A 4IHTA 2FJ1A 2DA1A 1ZGAA 1FIPA 4PSWA 4JI3E 2BHZA 3I4MJ 4RM2A 5KCMA 1P4AA 2ZXJA 5K1YA 3WTSC 2I9IA 3MHSC 3NWSA 4X0GA 4F2JC 2ADUA 2ZBKA 5ICCA 1B4AA 1IBKE 1GV2A 1XTAA 3OY9A 3DBRB 4HYEA 2EZHA 3WTZA 4HNVA 4BDZA 2CW8A 3OYEA 1J0RA 1Z6TA 4L18B 4IHVA 3S1QJ 4WSGA 4HG2A 5J8FA 1B8IA 1W5SA 5E79C 1JKPC 2XAQA 4EM1A 2LY9A 4XLFA 3TGNA 4IJAA 5FKKA 1BOAA 2ZMEB 5JHUA 4KZSA 3WU1B 3Q9VA 3M99B 2K9SA 3S2DJ 3H5AA 3MVPA 3LAPA 4WSPA 2ZNZA 1YYKA 4HW0A 1HDDC 2WB1A 3LNQA 3HG9A 4J8ZA 1WXRA 2L8TA 2LRSA 1IXRC 2M1SA 1RC7A 2F2EA 3CTAA 2IS1A 4M3EA 1EH8A 3M9AA 2B3TB 4LG0A 1FKAE 2VJ5A 3OOUA 2HWVA 5LBQA 1UELB 2BW3B 1EKEA 1I5ZA 3VB2A 3M8JA 4DV0E 2XDVA 1XDUA 5EG0B 2WBMA 2WAQN 3K4CA 3PQKA 4LIUA 4XM3A 2QCOA 4XLEA 1ACIA 2B0LA 2IGOA 4E7ZA 4Q47A 2OQRA 4I09A 4KIFA 3ZMTA 3HIFA 3PUBA 1J2XA 3MZ8A 1U5TC 4PJ0C 4DNCA 3AAFA 3PM1A 1E17A 1PVEA 1XSVA 3CD6I 1S7EA 1K61A 1R00A 1H88C 4Q28A 4ZTJA 4I2OA 1MDMB 3FMRA 1K79A 1VNDA 3JRAA 1XGMA 4P5OA 3FHZA 3ECHA 1XMAA 1Z21A 1P7IA 3PFIA 1Y8RB 2EMAA 2HGCA 3I59A 1SVOA 5D8KB 2L9SA 4LF5E 4AD9A 2KRFA 3KLOA 4ESFA 2RVCA 3P9KA 5LRRA 5HS8A 4DR1E 2W25A 1U8BA 4HEA2 4DZJA 1KGSA 3BG6A 2R5YA 2WC2A 3CDHA 4S04A 1V4RA 3WGIA 2CQXA 3L00A 3BOQA 1OMIA 2HKXA 1X1DA 2YRKA 2I13A 3H9JA 2ID6A 4RGSA 1H9TA 3SFIA 3LSHA 1I94E 2NYXA 2EL4A 5LL6R 5C3EJ 4PJLA 2HYGD 1RKTA 4JYAE 1ZAOA 3HQ1A 2VLAA 3G6EI 2CS3A 2DMQA 3QQAA 3WTYC 4M9ZA 5GAEJ 2QM3A 4M73A 2VONA 2BEOA 4PSXA 2AXTC 1L0OC 2OV7A 1ZLJA 4F7ZA 2DMIA 1AH5A 2PMZA 3K0LA 2VF1A 3VDXA 2LKXA 1IN8A 2XHKA 3A01B 1XSDA 3F6VA 1JXSA 2EMXA 2YS9A 1T39A 3LFUA 5L3FA 3E0JB 2EPLX 3CC2I 1IG7A 3HPHA 4PJJA 1KU2A 4BU2A 3I56I 3J7YJ 3L2QA 5J4YA 1JKRC 1XS9A 2DT5A 4DR7E 3P9CA 1LE8B 5A6BA 4QPQA 5A2QK 3EDPA 1XN7A 2EMBA 2P8TA 2M5WA 3KZZA 1QQIA 3KCCA 1OLTA 3GBGA 4K2EA 5AONA 5D5VB 2EPNA 1BI2A 1P2FA 1BI1A 5JLXA 3J80Z 4UB6C 2UU9E 1YO5C 3A03A 3GLLA 3M7GA 3DFGA 2EOFA 1SFEA 4NC7A 4G12A 5CQEA 2IGKA 2NABA 2IA0A 2D45A 2EE8A 1WJDA 3DTIA 2MLGA 1NH3A 4X64E 4CO8A 3OTOE 1RR7A 1ZK8A 3G1MA 2H6BA 3DKYA 4QWQA 1SANA 2EM6A 1VQ8I 2RQQA 4DR5E 3GCMA 3MZHA 3D0SA 2NNNA 1MMAA 4RM3A 1PJRA 2HOSA 2IS4A 1FP1D 1Q1HA 2QYOA 3GWZA 4XMYA 2QQ8A 2JRTA 1SC7A 3IH2A 4RLFA 2H1KA 2EM3A 1QPMA 4YG2F 3BDDA 2I10A 5IOYA 1Z05A 3CUQC 3KETA 3M1EA 1Z7UA 5CVJA 1JHHA 2FF4A 3HTUA 2MC3A 2WADA 3H9QA 2VUMJ 3OYDA 1X1PA 4XSXF 5E18F 2EPUA 2AS5F 3GFIA 3FDYA 2CQ7A 2ZJ2A 2HVQA 4ZDOA 4M30A 2CSHA 4EATA 4PJNA 2DMUA 3GFLA 2EOIA 1HKTA 2IP2A 3K4NA 2EN7A 5FROA 3QPHA 1K6OA 3H36A 2FQ3A 3OIQA 1MH3A 3QOEA 1JGGA 4CHUA 2CRGA 2DFHA 2V7FA 4F55A 2TRTA 1XCBA 2JQ7A 2R7DA 3FBNB 2D9HA 2BE5F 2EMFA 1DGCA 1ZR2A 2ETHA 4BY7J 3F6GA 3L09A 3LSGA 3HXLA 3LSKA 3Q0WA 5DTDA 2XKOA 4HRIA 1K4SA 3B02A 1CF7A 3I0TA 3ERED 2KL4A 1SFUA 2KRCA 2D1VA 4NQWB 3ZQHA 2GA1A 5B1AH 5L3BA 3F22A 2X9DA 3Q5FA 2VE7C 3ADLA 1U78A 2MSYA 1MBGA 2DOAA 2ME0A 4M9SA 3K7AJ 1UG2A 3I71A 4WYQB 1XD7A 2Y31A 3O8HA 4CYCA 1PKPA 3HOTA 1BBOA 9ANTA 1SMYF 2O8XA 2QWWA 3SFZA 1ZTRA 4B4CA 3BZ6A 1BI0A 3I53A 4A2UA 4I76A 3IKTA 3I9V2 2A6HF 5JVTA 2O6GE 1QRYA 3S17J 4A3KJ 1YQAA 2NRAC 1ZQ3P 4OX9E 2RV8A 3QP5A 2WZOA 4CYDA 3GYHX 3EPZA 3RKWA 4HV6A 3K1NA 2DMTA 2CU7A 1MJBA 2JOXA 5FLVA 4BYYA 2E7WA 2I5UA 5BMZA 2EFPA 2ID3A 3JSOA 2DLKA 1JK1A 1QA6A 2HEOA 4BY1J 2R7ZJ 2I8DA 2Q2EB 2LMZA 3K6QA 1J5YA 2CFXA 1RUNA 2YTEA 2MKNA 4IRHA 3K69A 2HOEA 1NCSA 3DBHB 2F5FA 4ESJA 1MMGA 1SMTA 2IXSA 3GF2A 4ZDPA 3DU6A 2A25A 2DQLA 3GTKJ 2PMHA 1Z7LA 3HOXJ 4A3EJ 2RPCA 3AKZA 3HTXA 4ZTFA 3WG7H 5K5QA 1FOWA 1R1VA 1WJEA 2BY3A 3BR6A 4LITA 1XPXA 1OCRH 1WJFA 5J3LA 1D0XA 1JUPA 4UUSB 2EN1A 2VOOA 2EJRA 4DR3E 3G2BA 2L33A 1UN6B 4JOMA 3VSKA 3GZNB 5ICEA 2E5ZA 5CPRB 2UXXA 1WFXA 2A6EF 4DIQA 1AU7A 1Z0XA 1H8AC 3S3NA 2GA2A 1OCTC 2VQEE 2C6YA 2JR1A 2EIJH 4JQFA 2P6TA 1KA8A 5F1RA 5F08A 4FE7A 4YFNF 1FTZA 5FLXK 3S3MA 3IWBA 3QWLA 5CVIA 2XAHA 4JI2E 3ABTA 1IUFA 2A5WA 3JRCA 3EPJA 2DFIA 3BWGA 3K4JA 2DPDA 4RAFA 4LB5A 2A3SA 3SDGA 3MHHC 2LBFB 2WBTA 2YTFA 2K9NA 1REPC 1UCRA 3I5UA 2ELJA 5TGTA 2F6CA 1YIJI 1AKHB 2XB0X 5B5EC 3DPUA 4IZZA 1HA8A 2MC4A 2NS8A 1ULYA 2EB7A 4WXCA 2EMGA 1A1KA 2YTIA 2V9PA 1E3PA 4E7JA 3PO3J 1TW3A 4J01A 1A6IA 3D1NI 2HYJA 2QQAA 3BZKA 3ADIA 1VFCA 3GX4X 4Z6YA 3J81Z 4HOBA 3OS1A 2DTRA 5A6JA 2ELHA 2VXZA 5AIQA 4HAMA 1ZG3A 6PAXA 1OYWA 2E19A 3N05A 2YU5A 2L9NA 3IV5A 3GTOJ 1ZHFA 2DSYA 5J1YA 1R1TA 1F36A 2LYCA 4G7ZF 3TEDA 3BC8A 2EPZA 5JR3A 2KQRA 1UJ8A 3FHNA 2VQHA 4JX6A 5JI6A 1B72A 5IYCJ 3QPSA 5D6EA 4PUSA 3RMPA 1S8NA 4AYBN 1YE9A 2F5VA 2HS5A 3TDZC 5IP9J 3K1MA 2LLKA 1LB2A 5ED4A 4B3TE 3ABLH 2X85A 4CCJA 5ICFA 4N9IA 2DN0A 2IPQX 2VBXA 3TL4X 2E2HJ 1ON1A 2WAEA 4F3QA 3ZOQB 3QAHA 1ERDA 3MQ0A 1IRFA 1A1HA 3R61A 4QIWN 4U87A 2PN6A 3FXQA 5CVRA 3WTVC 4M3BA 3S2WA 3TW7A 2V83A 3RKXA 3FK6A 2RKHA 3V7SA 5CVUA 1XMKA 1HBXG 3BR1A 2K02A 5KL5A 2FXAA 4DZPA 1BIBA 1ETWA 2ECCA 5EYRA 3WODF 1W5TA 2XGXA 1X1BA 3W6VA 2GZWA 1XGNA 2ODRD 2IAIA 2ZKZA 4BQQA 2W7NA 2QEXI 2YSOA 2PQ8A 2OZ6A 1ZR4A 4L9VA 3RYPA 4NHJA 2QKLB 4EMSA 3F21A 2R7VA 4N9HA 3VOEA 5D5XB 1STUA 5AE3A 3GEZA 2Z3YA 2RSMA 3LLHA 4P7DA 4X8WA 2DOFA 3R0AA 3WHBA 2LK2A 4MEXF 1YLFA 2A07F 4F6NA 2LUQA 2VOPA 3C4BA 4C9YA 1M1EB 3DLAA 2UZKA 3R60A 2XF7A 3VEPA 3TO7A 2EM0A 1DDNA 3PFYA 3T1YE 2V9VA 4JP0A 5BS6A 2R7WA 4OMYA 2N8GA 4AUXA 4I0BA 3TO6A 3JRFA 2EOJA 3ZN0A 3LQQA 2XIGA 4JI7E 2JWTA 4KHPE 3CLQA 2N3GA 2H09A 4BEHA 2HQNA 1Z1BA 2LTSA 2ADRA 1PUFA 2RS6A 1BB8A 3TP0A 2UUAE 3UKGA 2MABA 4RLQA 3VPRA 4BQNA 1CQTA 3DU5A 5GP9A 3FM5A 3VYYA 4XLNF 2DGCA 3K4MA 5IP7J 4OIPF 1A1LA 3TOBA 2VBWA 1S7OA 1Z77A 2DYRH 1UFMA 2E1OA 2FRHA 3HTSB 3UK3C 1YYOA 2IVMA 3CCQI 3C6MA 1SFKA 1D1AA 1RUOA 4TUGA 3FF5A 5KVRA 2JA6J 1T4OA 3ZR8X 3J7AG 2EPRA 3OR1C 1VQLI 1UMQA 4F52A 2GPIA 3IRQA 1ZELA 4QLCU 2ZB9A 4DV2E 2LVSA 1F2IG 4I7HA 4MLOA 1S3JA 2Q1ZB 2NXNB 1MMDA 2E1MC 1J59A 2V85A 2GXAA 1TTYA 2E1MA 2L02A 2EQ3A 3H9GA 1Z6RA 3J7AY 4WPYA 3LSTA 2EN2A 1ZG1A 4DV6E 2K85A 3HRSA 3VYSB 4HX8A 4IOAF 4R03A 1KQ9A 5DUKA 2R7RA 1E2XA 2QBYA 2JSPA 4OIOF 1WKMA 2YWQA 4JK1X 4CCLA 1XMQE 2WV0A 2EP3A 2BOLA 4HZFA 3QRFF 2XASA 3MMYB 4BCAA 3MKLA 3WE2A 1QHGA 4CCNA 4M9VC 2M4GA 1R1UA 3TP3A 1TT5B 3DQVC 1X3UA 1IQSA 4BL0B 2RDPA 3AFHA 3HHHA 1HLVA 2OPTA 3RPQA 1W7PD 2G7UA 4EV0A 2B7EA 3AG2H 1FTTA 4FISA 1G2FC 5L3DA 5IT3A 1VZ0A 1QVUA 1RZ4A 5GAHJ 3BR0A 1MIJA 2PJRB 4XR6A 5KHDA 2VQCA 1LUJB 2HOTA 1WHUA 2DI3A 2CUEA 2K3PA 2TCTA 5D8LB 1JGSA 3B73A 3E3VA 3HUGA 2DK5A 4L5NC 1T38A 3PIOF 3IL2A 1SVLA 1BR1A 3OWTA 5BOXA 2ZFWA 2HQAA 3PNYA 1IF1A 4IKFA 2E5NA 5HS7A 4G6TB 4MHGA 5GPCA 3A0HC 1IUYA 2YRMA 1XG1A 2EPFA 3BG7A 4R2SA 4ANJA 2RREA 4G7HF 1EJ9A 2W82A 3ZRGA 2IS2A 2EN6A 5DDGA 1Z3YA 2ZSIB 5LMNE 5HODA 2M4KA 3RKYA 1H0MA 3I55I 1N36E 5H20A 2XV4S 3EUHC 3KIOA 4RMNA 2KLOA 2ZMEA 2Z9OA 4YIFA 3A1YA 2PJPA 2W57A 4OOIA 3MKZA 3SQNA 1MBKA 2CMPA 1PP7U 2KFDA 4C3JJ 2M4IA 3I4PA 4O3MA 2JYAA 5LRSA 2EOMA 2YPNA 2JA7J 4XQFA 2EM8A 3RPUA 3JTZA 5IPAA 3EQ1A 1D8KA 2YTOA 1TC3C 5IWAE 3C2GA 3HB9A 2HDWA 1MBEA 5M5YJ 1QVTA 3REOA 4BGDA 2OF7A 2CH0A 4ZYGA 5DEQA 3ZMVA 3KP4A 4FT8A 2K7LA 4KICA 3W3CA 3RCOA 5EG0A 4BQAA 4BBSJ 3J80C 3F8FA 2L2NA 4NUBA 4D5FA 2XAGA 2R7FA 2MA3A 4EJVA 2YT4A 1X2MA 3M8EA 2ZXHA 1FSEA 3IAS2 3G1LA 1QHHD 3T8TA 4XRSA 2FGGA 1TQPA 2DBBA 3BTJA 3JSPA 3HEFA 4FK5C 4XL9A 3AL0C 4OIRF 3MKYB 2LJHA 1MDMA 4YFXF 2HPMA 4M3DA 3W6KB 2MW8A 1GLNA 4LF6E 1IXSB 2CUJA 1RMDA 4A5NA 2JVAA 3SHFA 2V6EA 3LL7A 1N33E 1IO2A 1U3EM 1JUMA 2JZYA 3EUKL 4U88A 1LDDA 3H3UA 3TW6A 3VYXA 4GDFA 1TBXA 5HLGA 3S1MJ 2FNPA 2XRNA 3E7LA 1JKQC 1FBUA 3HRMA 2DIXA 4TV7A 4ABZA 2DA4A 3DP7A 3F8CA 2JMWA 5ICGA 3L2VA 3DJWA 3ABMH 2F5CA 4BUPA 2L54A 2HHHE 2YTQA 1OCPA 1MBJA 4MTEA 3GTLJ 4XOPA 2CYYA 3IWZA 4AU7A 1YRNB 3CCYA 4U7DA 1ONVA 3RZOJ 4MGRA 1Y6IA 4G6QA 2QENA 2L3CA 1IXCA 3ADJA 3LOCA 1WI9A 5IT9K 1KU3A 2R7OA 3C6KA 2MBFA 2EPMX 1O7LA 2EINH 5FFXA 5J8CA 2OQGA 3QYBA 4U0WA 1F4KA 4FX0A 1MEYC 2BBYA 2X1DA 4A0YA 2ZFUA 4HX4A 4RB0A 1AHDP 1TNTA 4GKKE 4P9FA 1W7PB 3P9IA 3ASOH 1MW7A 5IP6A 4LMYA 3BTIA 5E20A 4EM2A 3A01A 5FO5A 1HKSA 5KAIC 5GAGJ 2B9SA 2NVXJ 2DCEA 3OMYA 5T6JA 5L3GA 3QG5C 2RC4A 4KIGA 4S0HB 2VRDA 3EPHA 1XDSA 4GZNC 3BF2A 4ASNA 3JAMZ 4Y7NJ 2LDUA 2PMZN 1LE8A 2EA4A 2FE3A 4DYRA 2NOJB 4LK0F 5A69A 1XC5A 2MD0A 3VODA 4LLLA 4HA8A 3F0CA 1MNMC 1PYVA 3BBGA 4DV1E 4CZZA 4WXHA 4DOZA 3A02A 2ISZA 2BGCA 5D5UB 3CUOA 3M8FA 3VYRB 4L0YB 5AE2A 3LFKA 4XRSG 3CDLA 4C2MJ 2DA2A 4XRMA 3CMAI 4KMUX 1MSFC 2A69F 3HDDA 4WK8F 2XKPA 4R2CA 3JRBA 4MQ9F 4K0KE 3K6GA 4AM3A 2DW4A 2EFNA 3FXLA 4O5VA 3J7ZI 3OYMA 3PUFA 1G3TA 2NAZA 2AXLA 4CCKA 3HKZA 4XKVA 5K5OA 3S1RJ 1LEBA 2GOXB 2Z16A 2HNHA 4BXUA 4DV4E 1X58A 4L8NA 2ME6A 1LLMC 3NAUA 1LKXA 5F6FA 2LP0A 3ELKA 2P7CB 5F64A 4O43A 1W1WE 4A3GJ 4RGXA 2STTA 1J5EE 1UB9A 3CCJI 4F9CB 1ZN2A 2ZC2A 3HM5A 3OV8A 1QZEA 4CCMA 1X3WB 4RAGA 5H6QA 3CC4I 4TUIA 2D2WA 1O3TA 2AQEA 3KZIC 2RGVA 5HNFA 2IRFG 3LMLA 3QYFA 1J75A 4HQEA 1YJ9I 3RQIA 1G3YA 2YR2A 4A3CJ 1X6HA 4KDPA 2M1BA 2CT1A 2GXBA 4LJZF 2HVRA 3FXJA 5D6FA 3Q0VA 1WH7A 3F3XA 2OAZA 5CFFE 3HL2A 1T56A 4DYCA 1PP8F 4S05A 2PBIA 3DEUA 3T0YA 1RETA 4XN0A 2XAUA 3GTGJ 2MDGA 4BHCA 2XF5A 3GTPJ 1QNTA 3H92A 2DDAA 2EFOA 3CQZJ 4KITB 2EMWA 2HPIA 1Y1WJ 2K4JA 1HW1A 5IYDJ 3CJRB 2F4MB 4LF7E 1FWZA 2ZJQF 2K40A 2QKMB 1HW5A 1S9HA 3RZDJ 4FASD 1F1ZA 1I6HJ 3O8GA 1HC8A 5DNYA 4KA4A 5LEKA 1USSA 1YZ9A 2IGMA 4IPAA 1DU6A 2EPPA 2RS7A 1YJNI 2VB6A 2KOUA 1YW8A 1MD0A 2L3DA 5FGMA 3KYCB 2K9LA 2BV6A 4UB8C 4LFUA 1P92A 4C30A 4A69C 1D8JA 3W2WA 5K5RA 3LSMA 1BA5A 1S72I 1NK3P 2L4AA 2YUSA 5HDGA 1W36C 2R7SA 1N77A 4C2TA 2KZGA 4HQMA 3U1KA 4C2UA 1X6FA 2K5CA 2QF7A 2WAQA 2DRPA 2Z5UA 2IA2A 2KDZA 3DEEA 3J81C 1OQYA 2BY0A 4RS8A 5DM7F 3OYBA 4LFCE 1P4WA 3DWLE 2JPAA 3KP5A 2P4WA 4HDUA 2NVTJ 1B69A 2Q2EA 3DKWA 3D5RC 2V1DA 5DUIA 2L6MA 1ETXA 2XAFA 3BROA 2MKDA 3VYTB 3BG3A 2V4JC 2RNJA 1ZKGA 3GTJJ 4A3MJ 1PDNC 3M4OJ 2VJIA 1FNNA 2LG4A 4GYGA 5IYBJ 1BBGA 4B3AA 4E7HA 1ETOA 1K4TA 2O8KA 1DU0A 1XCVA 2YRHA 4F6MA 2EOXA 2M7AA 3M3YJ 1U5TB 1KU7A 1ZR9A 2M87A 3BR2A 1TLHB 3N97A 4N4OB 4UUSA 2Y0SN 1MZBA 4X9JA 2EMCA 1Z67A 5HLIA 3K70D 1YOVB 2HDCA 3PNVA 4XKWA 4IRGA 1X2NA 3ZGKA 2R7UA 3F72A 1Y56A 3JRIA 1I27A 4WWCA 2P6SA 4M2ZA 4JYKA 3VYUB 2EORA 3HOWJ 2EOYA 4XN3A 1PJQA 2EN3A 4R79A 1XGSA 1HQCA 4X1EA 5IT9Z 3L2WA 1WJ5A 4NC6A 2VKHA 2XGEA 4AIJA 2X0LA 2R76A 3S8PA 1I39A 3OYJA 4M74A 5DS9A 2DLLA 4MFDA 2LE2A 4EEFG 2VT2A 1WHNA 4EM0B 1IGNA 4D7NA 4F93B 1BBYA 1TWAJ 1ON2A 4KYWA 1Z3XA 2E34A 2HTJA 3RTRA 4EVIA 2DA7A 2EMLA 1H9GA 1USTA 2FBHA 2P0WA 1KU9A 3EPLA 4LLGF 3CCUI 3CC7I 1AAYA 1DGWY 2YTPA 2EZIA 3BCBA 1A36A 2L7KA 1RI7A 2ZNYA 2KRHA 4I99C 3A2KA 1LVAA 3U21A 3C3WA 2K7IA 2EH3A 2A61A 2DB2A 3HYIA 5EZHA 5K7ZA 2JXPA 4LF4E 2R7QA 4A6DA 1IRXA 2ISYA 4D9JA 1WPKA 1E3HA 4RA2A 5EEGA 2MDRA 1NHAA 2E72A 2X1EA 3TQMA 1S6LA 2H8WA 4BHBA 4BNCA 1RKWA 2CFOA 2LKPA 1NG7A 1XX5A 5JHFA 5DV5A 5JFRA 3ZQCA 1G2DC 1FJGE 3K1PA 2EPCA 5EJCA 2M3AA 3WTUC 4FCYA 4ON0A 2EOEA 3KPHA 2GQQA 5BQTA 3JREA 4JI6E 4ZH4F 4R2RA 2JP9A 5ERIA 2XROA 2LY2A 4D7MA 3OL3A 1U8RA 3F23A 2DODA 1TW2A 2OCEA 1ZGJA 1VQMI 3FXUA 5A6AA 4JI0E 1NK2P 2QUFA 2EZ6A 5M5XJ 5CJ9A 1WWXA 1X3CA 4PGHA 3GMEA 4HPQA 1BN5A 1I3QJ 1V55H 2IGNA 1UHZA 3L7WA 1RNLA 2DQRA 2DAOA 4Q48A 1D0ZA 2H6CA 1FP2A 5E8IA 4HDVA 2GXGA 1JUSA 3IC7A 1BJAA 2R1FA 2H94A 3K10A 4G8XA 3CUQB 1SVMA 2OC6A 3OYGA 2LKSA 1JJ6C 3E6MA 3RYRA 2LV2A 1FPQA 1UHMA 4Z2YA 1K78B 2V9KA 4NXME 2L7FP 2EPXA 3GTMJ 3KYDB 2QVOA 2OD5A 2EQ0A 2VBZA 1OISA 4XNFA 4ZC3A 2BZTA 4BC7A 2R5ZB 4W1UA 1JK2A 2AHQA 2HQ5A 2EN8A 2JK3A 3MN2A 3IRRA 3W2AA 1FOKA 2L2OA 1LDJA 1QPIA 3ECRA 1UZCA 2CSOA 1B6AA 3SYTA 3UR3C 2VT3A 2KONA 3DTKA 1JTYA 2E71A 2O61A 1N34E 1X5WA 1FMWA 4GXOA 1WQ2A 4R8HA 5A2QZ 2KDOA 2IHR1 4V19K 2HZDA 2EV5A 3HPGA 3IUOA 1J7KA 4MQVA 3C18A 4EJUA 4MIMA 2BXZA 2F48A 2OA4A 4BE1A 2P81A 2CW0F 4CH7A 1X48A 3RI4A 2GLIA 5K7HA 2O03A 3OL4A 1BM9A 4F92B 4DV3E 1NTCA 2NS7A 2YTNA 3H09A 5DM6F 1HCRA 2W48A 4DR6E 2HTSA 1ENHA 2JN6A 3OS0A 4BAYA 2KZVA 1WHQA 2VL8A 2LD5A 2L3JA 2WY7Q 4DR2E 2L01A 2VQGA 3JRGA 1FZPB 4DW6A 2HXOA 4H0EA 3BPXA 1HR0E 4B3RE 2G0EA 1DUXC 3L2RA 2X48A 1MH4A 3KE2A 3DLLF 4N4NB 1YITI 1WRJA 2M9AA 1J26A 4C3IJ 2NUFA 1YS7A 4BJ6C 2UV1A 3B6CA 4HSTA 1SR9A 4N0BA 3BG9A 2JTVA 4XLCA 1FY7A 1FBSA 3G73A 4A93J 3HSFA 1Y0UA 1GTKA 4XIDA 5BNGA 2G9WA 4MFEA 1MNEA 2DT7B 1LFUP 2FOWA 1JKOC 2O7OA 2JA2A 1IJWC 5TSEA 5ADZA 3PO2J 4ZZDA 4II2A 5JLWA 3I4NJ 2Y48A 2ZXIA 4CUGA 4L9NA 1UHWA 1HF0A 2E1CA 2EMZA 5HDNA 4X62E 5FB2A 3VFZA 2DMYA 2O0YA 3DEWA 2RSIA 3ZQQA 1TWFJ 4LFAE 1JHFA 1QZZA 2EFWA 5LHIA 1MBFA 4GRIA 1AA7A 2JVHA 2Y2ZA 2JUGA 2Y30A 3JTHA 2V1XA 3U1DA 5LGUA 1BL0A 5C4XJ 1K83J 2BY1A 2E2JJ 1IRGA 3GZ5A 2KIQA 3CCMI 3U2RA 1D5YA 4PK4A 2G7HA 3KLNA 3TBIA 2V88A 4AIHA 4R8OA 4XK4A 4DYQA 3I64A 1FBQA 3F8MA 3S14J 3HOUJ 2EPOA 2GBYA 5EZGA 4M71A 3KYLA 2DU9A 2Z2SB 2M7BA 4Y13A 3OYHA 3GXOA 4BS9A 1GZ6A 4FHTA 3IAM2 4RGUA 2X6OA 4QPOA 3WTTC 1R5HA 2GM4A 2EM5A 3GFJA 2FU4A 3QU6A 3HRUA 1A1FA 1WH5A 2IS6A 4E7KA 2DYSH 4XKCA 3K4LA 3DXJF 3KP7A 4F9AB 4ZYHA 4I6ZA 4UNOA 4WCGA 4BACA 2JOBA 2A6TA 2CO5A 1FYKA 4L5IA 2NA2A 3J7AO 1EH7A 2JVGA 4AIKA 3THNA 3C7JA 4II3A 3A4CA 2MG4A 3FMQA 2XPUA 2W84A 4IJDA 4BMJA 5KK1A 1RR8C 4CSWA 1HDPA 3V8JA 2N8XA 2OBPA 5FKOA 2HR3A 1ZGWA 1GXPA 5DCMA 2FBKA 2EWNA 2KISA 3DBLB 4BC9A 2WAFA 4PDKA 3JRHA 2E60A 3FM3A 3BY6A 4YELA 5KL7A 2JWOA 4R2PA 3B6AA 2YTDA 1KONA 3G4SI 2R7TA 2DXIA 4B47A 5HLHA 4XLPF 1R71A 2CGPA 4MNUA 1R5ID 2M45A 5F0FA 3MFKA 3EYYA 4M9XA 2LCEA 3ZXSA 4KUMA 5FKMA 4JI5E 1MNDA 4UUVA 1V5FA 4AYBA 4LIVA 1BC7C 4O24A 4J00A 2R93J 4M6XA 3E5QA 5FFZA 1SAXA 2CV1A 2EPAA 3JAMC 1X3ZB 1TT0A 3R4KA 2PG4A 5IOZA 5CKTA 2CQNA 5EF6A 4WX9A 2BBGA 2YPRA 2CTDA 1ETKA 1OR7A 1YW7A 2BVLA 1B72B 1HKQA 1ODDA 4IO9F 3RIRA 2EL5A 3G71I 2BHYA 1KQ8A 2F8BA 2QGUA 3K2ZA 2NS0A 2EPKX 2FUG2 3THOB 3G3ZA 5LGNA 3LA2A 3PSIA 4IHWA 2ELYA 2HYFA 2GWRA 4GCVA 1LDKB 4EJWA 3JCUC 3PL8A 3L2CA 2DT6A 4B48A 4ITVA 3CF5F 4M0VA 5KL6A 2ZCWA 5FLXZ 3OSGA 1YHQI 4RH8A 4M3FA 1TF6A 5GTHC 2DJIA 2MD5A 2W00A 4UHTA 1YIOA 3BP8A 1W0UA 2EOOA 4MEYF 3ZQLA 1XSXA 2FNAA 1VF9A 4ZYAA 3ZCOA 1A1JA 4I02A 3R0JA 1YJWI 1YYVA 1IQOA 2XGCA 3Q0UA 3BPVA 4CXFA 3NQOA 1IC8A 5DCFA 2KMUA 2FOKA 3FBIB 1T0FA 1QO0D 5J4VA 1ITYA 2CJJA 1ZRDA 1O4XA 4I0AA 3DPTA 2CPNA 2E5LE 2BY2A 2VBYA 1OJLA 1FIAA 4NHRA 2JSCA 4R2AA 1LVKA 4LF8E 3TQNA 3V4GA 3DPLC 1LJ9A 1W4MA 2HQRA 2A68F 1NG6A 2W85A 3OYKA 2YTGA 2HFHA 3GVAA 2B7TA 3GLXA 3LSPA 4B43A 3QPLA 1HSJA 5HOOA 4CCOA 5KL3A 1ZAAC 3T1HE 3NWTA 3WU0A 2K27A
chains in the Genus database with same CATH topology
1YW9A 1PUEE 1ZG5A 5LEJA 4M6YA 2O3FA 3HHGA 3CO7C 2OU2A 2ESHA 3EQLF 3BJ6A 4EGYA 3ISPA 5FD6A 2ACJA 2CQKA 2EV0A 1ZH5A 1ZREA 4OIQF 1J9IA 4LGWA 3E5XA 4EGZA 2VC1A 2ZO4A 5CLSA 2L4MA 2P5KA 3J80K 4KMFA 4JBAA 3ULQB 3LQRA 3MAJA 1GHCA 3FZVA 3SXYA 1TNSA 4RB2C 1FLIA 2DO7A 4EQQA 3WGGA 1KQ0A 4IRIA 4KN4X 4UVCA 2TDXA 2QBYB 4WF2A 5LHGA 5TJJA 4CGZA 3ZMSA 2LF8A 3ZMZA 5EEHA 1FYLA 2UWMA 5BPIA 3JW4A 3BJOA 2CWEA 2W24A 2Z99A 3ZQ7A 5D4RA 3H3ZA 2WWYA 4RAYA 3ZPLA 4IHSA 5DYMA 4B09A 2FSWA 2DPUA 3WTWC 5ILSA 3O6BB 3LWFA 2FMLA 4IF4A 2LSOA 3FX3A 4OU0A 2WTEA 2X4HA 4U0VA 1QBJA 4FX4A 3BJAA 4I01A 2M30A 1HW2A 4ZYEA 1AOYA 3FWEA 3NRVA 4Y15A 2Z33A 4UVBA 1P4XA 4HX7A 1BI3A 5L3CA 3LA3A 2QZ8A 4HF0A 4Q4ZF 1O3SA 3MCZA 1U5TA 1BIAA 3EYIA 1O57A 1T98A 4RB3C 2RN7A 3TKYA 2Y75A 1LEAA 1RIOH 2CG4A 1IN4A 1O7FA 4D0PA 1B9NA 2HKOA 1ZLKA 1T6SA 3F8BA 2BYVE 2E7XA 4RB1A 1OYIA 2YU3A 4RGRA 1OYYA 1KYWA 3HSEA 3WE3A 4NQWA 2V1UA 3ROUA 1MKMA 5E8GA 3KEQA 4LLNA 3EETA 3V8LA 4G9YA 2V6CA 2P5LC 1IN6A 4ENNA 5E1ZB 3CO6C 2PMUA 2IJLA 3J81K 4LG0B 4ESBA 5D5WB 2PFBA 5LLQA 2QLZA 3I58A 4G94A 1QGPA 1T2KA 3O3KA 2PLYA 1R5GA 4UVAA 3FMSA 5ILVA 3W6JB 4PCQA 1IAWA 4ENJA 4EJTA 1R58A 1MGTA 3P7NA 4IXAA 4L0ZB 1G4DA 3I59B 3COAC 2YX4A 1MJAA 2COMA 2ESNA 5TRDA 3NEUA 3CUQA 3PQJA 3GO5A 4WXDA 3T5XA 1R23A 2KIMA 1K78A 1GXQA 3I54A 2DK8A 2YSRA 3R6SA 5LGTA 2F5DA 4E70A 2JT1A 5E1XA 2XVCA 3CLOA 3E6DA 1VTNC 4GO1A 4UV8A 4A5MA 1XGOA 1STZA 1R22A 4KN7X 1ZRCA 2Y0MA 2KJBA 2Q8KA 2NNYA 2MH2A 2E1NA 2VN2A 5DD8A 3T1BA 1DPUA 2PEXA 1HSTA 3E6CC 1TQMA 1FC3A 2FBIA 2M8EA 2D1HA 1TQIA 3KFWX 4L5JA 3F8NA 2QQ9A 3HRTA 2EV6A 1IW7F 4GGGA 3MZYA 3KZYA 3N4MA 4M72A 3FXRA 4HLXA 3ZMUA 1ZRFA 4KT5C 3SZTA 2FA5A 2F5EA 2JPCA 3MWMA 5D4SA 1U6GA 3DV8A 4LD5A 4YFKF 2J5PA 1D3YA 5CYVA 4ENMA 5HVQC 3IKVA 1YTYA 4LB6B 2IT0A 2P5VA 3TOAA 2JPBA 3DF8A 3LAJA 2VE9A 1BC8C 1S29A 4PZJA 2RQPA 4I98B 2UXNA 4BH9A 3MEXA 4U7BA 2IA1A 2KJCA 1OKRA 2J5OA 1CF7B 1Z1DA 3CJNA 2Q0OA 3RJPA 4KFCA 4XSZF 1DPRA 2PI0A 1LNWA 3LA7A 1QZYA 3QPTA 1FT9A 1EV7A 1G3SA 2XUBA 3F6OA 1R36A 1R7JA 1EH6A 1FX7A 4P96A 5E1WA 3GZ6A 4HF1A 3D5LA 4A0XA 5H6RA 1A04A 3E6BA 3IHUA 1DP7P 4P55A 2P7VB 3TO9A 1C0WA 2LNBA 1KYZA 3KEOA 3V7CA 4A6EA 2K86A 3L9FA 2FMYA 1F5TA 1XB4A 2QQBA 5J6XA 4B8XA 4HBLA 4ENKA 3QP6A 3HOSA 3U9GA 1O3QA 4KNYA 3KP3A 4O6JA 5L3EA 2R3SA 2EFQA 5DD4A 3E5UA 1P6RA 4ETSA 3ECOA 3RDIA 1SD6A 3JTGA 3K9TA 3ML6A 3ZN1A 1F9NA 4HV5A 2GAUA 1G3WA 5HDKA 1HXDA 1YS6A 4OMZA 2FEZA 2KIUA 2H27A 2GIVA 1IN7A 1S7AA 4PGGA 2KKOA 1U2WA 4G6DA 2KIFA 4ZYDA 1AWCA 2HZTA 1I6XA 3IWFA 1SD5A 2VC0A 2LF7A 3ABUA 3JAMK 1ZARA 1FYMA 1V3FA 4G7OF 3QOPA 4ZZLA 2STWA 4Q5SF 2EK5A 4IVNA 4XBFA 4A0ZA 1LQ1A 3V8KA 2OZUA 2A5YB 1B59A 1WSUA 2VE8A 2V79A 3KP2A 4GYIA 2MLKA 1K7AA 5LHHA 1IN5A 3Q9SA 1L3LA 1I1GA 1OPCA 5E17F 1FSHA 4EJOA 3GUDA 3T8RA 3GFMA 4BHPA 3SZPA 3TDUC 1Z91A 3KP6A 4CDGA 1B9MA 1W7PA 2IW5A 1SD7A 3GW2A 1I1SA 2MH9A 4KIBA 4AVPA 5HS9A 1JE8A 4HLYA 4UXNA 3C1DA 1D5VA 3HSRA 5DCMB 1SD4A 4HF2A 4L9TA 4R1HA 2VODA 3EUHA 1ZYRF 1Z9CA 1B1BA 3WG9A 5FD5A 4OINF 4U0YA 4A12A 1YFHA 5BPDA 1SFXA 4CICA 2K4BA 4L9JA 4LK1F 5AIPA 2XAJA 1IZ1A 1GVJA 3QU3A 3WGHA 1CGPA 4AWXB 1O3RA 5ILUA 4YIIA 4P9UA 4Y17A 4MTDA 3OOPA 2EA2A 4XRFA 1G6NA 1MJ9A 3ZP5A 1YG2A 4UV9A 3ZMDA 5CVVA 3E97A 3WTXC 3O2PE 3V7RA 4RAZA 4DQ2A 2YX7A 4IHTA 1ZGAA 1P4AA 2ZXJA 5K1YA 3WTSC 2ADUA 2ZBKA 5ICCA 1B4AA 4HYEA 3WTZA 1J0RA 1Z6TA 4L18B 5J8FA 1W5SA 2XAQA 4EM1A 3TGNA 4IJAA 1BOAA 2ZMEB 5JHUA 3WU1B 3Q9VA 3LAPA 2ZNZA 4HW0A 1IXRC 2F2EA 3CTAA 1EH8A 3M9AA 4LG0A 2HWVA 5LBQA 1I5ZA 3VB2A 1XDUA 3PQKA 2B0LA 4Q47A 3ZMTA 2OQRA 4I09A 4KIFA 3HIFA 1J2XA 1U5TC 4DNCA 3AAFA 1E17A 1XSVA 1R00A 4I2OA 1MDMB 3FMRA 1K79A 1XGMA 4P5OA 3FHZA 3ECHA 1XMAA 3PFIA 2HGCA 3I59A 5D8KB 4AD9A 2KRFA 3KLOA 4ESFA 2RVCA 3P9KA 5LRRA 5HS8A 2W25A 1KGSA 2WC2A 3CDHA 4S04A 1V4RA 3WGIA 3L00A 2HKXA 1OMIA 3BOQA 1H9TA 4RGSA 2NYXA 2HYGD 1ZAOA 3WTYC 4M9ZA 2VONA 2QM3A 4M73A 2BEOA 1L0OC 1ZLJA 4F7ZA 3K0LA 1IN8A 2XHKA 1XSDA 3F6VA 1JXSA 1T39A 5L3FA 1KU2A 2DT5A 3P9CA 5A2QK 3EDPA 1XN7A 2P8TA 2M5WA 3KZZA 1QQIA 3KCCA 4K2EA 5AONA 5D5VB 1BI2A 1P2FA 1BI1A 3J80Z 1YO5C 3M7GA 3DFGA 1SFEA 2IA0A 2D45A 2MLGA 4CO8A 2H6BA 4QWQA 3MZHA 3D0SA 2NNNA 1FP1D 1Q1HA 2QYOA 3GWZA 2JRTA 1QPMA 4YG2F 3BDDA 3KETA 1Z05A 3CUQC 3M1EA 1Z7UA 5CVJA 1JHHA 2FF4A 3HTUA 2MC3A 4XSXF 5E18F 2AS5F 3GFIA 2ZJ2A 3GFLA 1HKTA 2IP2A 3QPHA 1K6OA 2FQ3A 4CHUA 1XCBA 2R7DA 2BE5F 2ETHA 3L09A 2XKOA 3B02A 1CF7A 3I0TA 3ERED 1SFUA 2D1VA 2GA1A 3Q5FA 5L3BA 3F22A 1U78A 4M9SA 3I71A 1XD7A 3HOTA 1SMYF 2O8XA 2QWWA 3SFZA 3BZ6A 1BI0A 3I53A 4A2UA 3IKTA 2O6GE 2A6HF 5JVTA 1YQAA 2NRAC 2RV8A 3QP5A 4CYDA 3GYHX 3RKWA 4HV6A 3K1NA 1MJBA 4BYYA 2E7WA 5BMZA 2EFPA 3JSOA 2HEOA 1J5YA 2CFXA 1RUNA 4IRHA 3K69A 2HOEA 2F5FA 4ESJA 1SMTA 3GF2A 2DQLA 2PMHA 5K5QA 1R1VA 2VOOA 2EJRA 5ICEA 2UXXA 2A6EF 2GA2A 2C6YA 4JQFA 2P6TA 1KA8A 5F1RA 4YFNF 5FLXK 5CVIA 2XAHA 3ABTA 2DFIA 3BWGA 2DPDA 4LB5A 2A3SA 1REPC 1UCRA 3I5UA 2EB7A 1ULYA 4WXCA 1TW3A 2QQAA 3GX4X 3J81Z 4HOBA 2DTRA 2ELHA 2VXZA 5AIQA 4HAMA 1ZG3A 6PAXA 1OYWA 1ZHFA 1R1TA 4G7ZF 5JR3A 5JI6A 5D6EA 1S8NA 2HS5A 3TDZC 1LB2A 3K1MA 5ED4A 5ICFA 4N9IA 2IPQX 2VBXA 1ON1A 3QAHA 3MQ0A 1IRFA 3R61A 2PN6A 3FXQA 5CVRA 3WTVC 3S2WA 3RKXA 2RKHA 3V7SA 5CVUA 1XMKA 1HBXG 2K02A 2FXAA 1BIBA 3WODF 1W5TA 2XGXA 2K27A 2GZWA 1XGNA 2ZKZA 2PQ8A 2OZ6A 4L9VA 3RYPA 4NHJA 4EMSA 3F21A 4N9HA 3VOEA 5D5XB 3GEZA 2Z3YA 3R0AA 4MEXF 1YLFA 2A07F 2VOPA 2UZKA 3R60A 3VEPA 3TO7A 1DDNA 2V9VA 5BS6A 4OMYA 4I0BA 3TO6A 3ZN0A 3LQQA 2XIGA 2H09A 2HQNA 3FM5A 4XLNF 4OIPF 3TOBA 2VBWA 1S7OA 1UFMA 2FRHA 3HTSB 2IVMA 1RUOA 3FF5A 5KVRA 3IRQA 4QLCU 4I7HA 1S3JA 1J59A 1TTYA 2L02A 1Z6RA 3LSTA 1ZG1A 3HRSA 4HX8A 1KQ9A 5DUKA 1E2XA 2QBYA 4OIOF 1WKMA 4JK1X 2WV0A 4HZFA 3QRFF 2XASA 3WE2A 1R1UA 3DQVC 1X3UA 2RDPA 3HHHA 3RPQA 1W7PD 2G7UA 4EV0A 5L3DA 5IT3A 1RZ4A 2DI3A 5D8LB 1JGSA 3B73A 3E3VA 3HUGA 2DK5A 1T38A 3IL2A 5BOXA 2ZFWA 1IF1A 1IUYA 4MHGA 5HS7A 4G7HF 5DDGA 3RKYA 1H0MA 5H20A 2XV4S 2Z9OA 2ZMEA 4YIFA 2PJPA 2W57A 4OOIA 3SQNA 1PP7U 3I4PA 4O3MA 5LRSA 3RPUA 1D8KA 3REOA 4ZYGA 5DEQA 3ZMVA 3KP4A 4FT8A 2K7LA 4KICA 4BQAA 3F8FA 2XAGA 2R7FA 2MA3A 4EJVA 3M8EA 1FSEA 3T8TA 1TQPA 2DBBA 3JSPA 4OIRF 1MDMA 4YFXF 3W6KB 1IXSB 4A5NA 3SHFA 1U3EM 2JZYA 4U88A 1LDDA 3H3UA 1TBXA 5HLGA 2FNPA 2XRNA 1FBUA 3HRMA 4TV7A 3DP7A 3F8CA 5ICGA 2F5CA 2L54A 4MTEA 2CYYA 3IWZA 4U7DA 1ONVA 4MGRA 4G6QA 2QENA 1IXCA 1WI9A 5IT9K 1KU3A 2MBFA 1O7LA 5FFXA 5J8CA 2OQGA 4U0WA 1F4KA 4FX0A 2BBYA 4A0YA 4HX4A 4RB0A 1TNTA 4P9FA 1W7PB 3P9IA 4LMYA 5E20A 4EM2A 5FO5A 1HKSA 5L3GA 2RC4A 4KIGA 1XDSA 4ASNA 3JAMZ 2LDUA 2EA4A 2FE3A 4LK0F 3VODA 4LLLA 4HA8A 4CZZA 4WXHA 2ISZA 2BGCA 5D5UB 3CUOA 3M8FA 4L0YB 3LFKA 4KMUX 2A69F 4WK8F 2XKPA 4MQ9F 2DW4A 4O5VA 2EFNA 1G3TA 2NAZA 2AXLA 5K5OA 1LEBA 4BXUA 5F6FA 3ELKA 2P7CB 5F64A 4RGXA 2STTA 1UB9A 1ZN2A 3OV8A 5H6QA 2D2WA 1O3TA 2RGVA 2IRFG 1J75A 4HQEA 1G3YA 2YR2A 4KDPA 2M1BA 2GXBA 4LJZF 5D6FA 3F3XA 2OAZA 1PP8F 4S05A 2PBIA 3DEUA 3T0YA 4BHCA 1QNTA 3H92A 2EFOA 2K4JA 1HW1A 1FWZA 1HW5A 1F1ZA 4KA4A 5LEKA 1USSA 4IPAA 1YW8A 1MD0A 2L3DA 5FGMA 2BV6A 4LFUA 1P92A 1D8JA 5K5RA 2L4AA 5HDGA 4HQMA 2Z5UA 2IA2A 4RS8A 1P4WA 3KP5A 2P4WA 4HDUA 2Q2EA 3DKWA 2V1DA 5DUIA 2XAFA 3BROA 2RNJA 1PDNC 1FNNA 4GYGA 1XCVA 1U5TB 1KU7A 2M87A 1TLHB 3N97A 1MZBA 5HLIA 2HDCA 4IRGA 3F72A 1I27A 4WWCA 2P6SA 4R79A 1XGSA 1HQCA 5IT9Z 4AIJA 2X0LA 4M74A 2DLLA 2VT2A 4EM0B 1BBYA 1ON2A 4KYWA 2HTJA 3RTRA 4EVIA 1H9GA 1USTA 2FBHA 1KU9A 4LLGF 1RI7A 2ZNYA 1LVAA 3C3WA 2A61A 3HYIA 4A6DA 2ISYA 5EEGA 1NHAA 1S6LA 4BHBA 4BNCA 2LKPA 5JFRA 5DV5A 3K1PA 3WTUC 4ON0A 2GQQA 5BQTA 4ZH4F 5ERIA 2XROA 1U8RA 3F23A 1TW2A 1ZGJA 3FXUA 2QUFA 5CJ9A 1WWXA 4PGHA 1BN5A 3L7WA 1RNLA 2DQRA 2DAOA 4Q48A 4HDVA 2H6CA 1FP2A 5E8IA 2GXGA 3IC7A 1BJAA 2H94A 4G8XA 3CUQB 3E6MA 3RYRA 1FPQA 1UHMA 4Z2YA 1K78B 2QVOA 2OD5A 2VBZA 3IRRA 1FOKA 1LDJA 2CSOA 1B6AA 2VT3A 2O61A 4GXOA 1WQ2A 4R8HA 5A2QZ 2EV5A 4MQVA 1J7KA 4EJUA 3C18A 2OA4A 2CW0F 3RI4A 2O03A 1BM9A 2HTSA 4BAYA 2L01A 1FZPB 4H0EA 3BPXA 1DUXC 3KE2A 1WRJA 1YS7A 4N0BA 2JTVA 1FY7A 1FBSA 3G73A 3HSFA 1Y0UA 2G9WA 4ZZDA 2Y48A 4L9NA 1UHWA 2E1CA 5HDNA 5FB2A 3VFZA 2O0YA 1JHFA 1QZZA 2EFWA 5LHIA 5LGUA 3JTHA 2V1XA 3U1DA 1IRGA 3GZ5A 3U2RA 2G7HA 3KLNA 4AIHA 3I64A 1FBQA 3F8MA 4M71A 2DU9A 4Y13A 3GXOA 4FHTA 4RGUA 3WTTC 1R5HA 3GFJA 2FU4A 3QU6A 3HRUA 3DXJF 3KP7A 4ZYHA 4UNOA 4WCGA 2CO5A 1FYKA 4L5IA 3J7AO 1EH7A 4AIKA 3C7JA 3FMQA 2W84A 5KK1A 3V8JA 2OBPA 2HR3A 1GXPA 5DCMA 2FBKA 2EWNA 4PDKA 3FM3A 3BY6A 5HLHA 4XLPF 2CGPA 4MNUA 3MFKA 2M45A 3EYYA 4M9XA 4KUMA 4UUVA 1BC7C 4M6XA 3E5QA 5FFZA 1SAXA 3R4KA 2PG4A 4WX9A 2YPRA 1YW7A 1OR7A 1HKQA 1ODDA 3RIRA 1KQ8A 3K2ZA 2NS0A 3G3ZA 5LGNA 3LA2A 2HYFA