1QNTA

X-ray structure of human o6alkylguanine-dna alkyltransferase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
171
structure length
166
Chain Sequence
b'EMKRTTLDSPLGKLELSGCEQGLHEIKLLGKDAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLATED-DNA--PROTEIN-CYSTEINE METHYLTRANSFERASE
publication title Crystal Structure of the Human O(6)-Alkylguanine-DNA Alkyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna repair
total genus 42
structure length 166
sequence length 171
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 1999-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1qntA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1qntA01
2XAJA 5E1WA 2RGVA 2KKOA 1BIBA 4ENMA 5DD8A 5LGTA 2HKXA 5CVVA 3GLXA 1XGMA 2D1VA 2VOPA 4A2UA 4MQVA 1USSA 3V8JA 2EB7A 1EV7A 3KP5A 3WTYC 1FNNA 3K1NA 2PFBA 2KJCA 2DQLA 3GZ6A 3E5UA 4KUMA 5H20A 2DBBA 1LDDA 2RNJA 3G73A 1HSJA 3HRUA 1XGNA 1QZZA 3M7GA 2IRFG 3P9KA 5LHIA 1ZG5A 1K78A 2C6YA 1R1VA 2CQKA 3E5QA 3LA2A 5A2QZ 1J7KA 3CUOA 4NQWA 2QENA 3MFKA 1STZA 3CO7C 2DW4A 2VT3A 2HZTA 3E6CC 2GQQA 5A2QK 1HKSA 2OBPA 2L3DA 3QPHA 2EK5A 1VTNC 1IN6A 5FO5A 4G6QA 3R61A 2P6TA 5CVIA 3U2RA 4HYEA 4CGZA 3TOAA 1V4RA 2XRNA 2LKPA 4EJWA 1Q1HA 1H0MA 2HGCA 2VC0A 1OYIA 4PGGA 1WSUA 3ZMVA 3MEXA 4K2EA 2YPRA 4G6DA 4Q47A 2PMUA 4R1HA 2VBZA 3HRMA 3BJOA 3HRSA 2DQRA 4KICA 2FMLA 4MTDA 4M9ZA 1BOAA 1QZYA 5JR3A 2QM3A 4ZYHA 2V9VA 4I01A 5BQTA 1D8JA 4LFUA 4KIBA 5CYVA 5K5OA 1W5SA 5ICFA 5K1YA 4A12A 3LFKA 3CDHA 2ZJ2A 2NNNA 2W84A 3GXOA 1XMKA 3LAJA 4IHSA 2OA4A 3KP7A 2QUFA 3EQLF 4G9YA 3RTRA 2PJPA 3LA3A 3RPUA 1BI2A 1IRFA 4ZH4F 2A68F 1FYLA 3ZMDA 4FHTA 3DFGA 4HLYA 4U0YA 2V1DA 4BXUA 2F2EA 4UVCA 3JSOA 5FGMA 4A6EA 4LJZF 5L3DA 1W7PD 2J5OA 3K69A 4KDPA 4ETSA 2K4JA 2O6GE 1JHHA 2MA3A 1F4KA 5D8LB 5ED4A 2IJLA 1SD6A 4I09A 1U2WA 3DPLC 5HLIA 2P6SA 1FWZA 3VOEA 4UHTA 2JPBA 3F21A 1B59A 5J6XA 1S7OA 1HQCA 3ZPLA 4XSZF 1B4AA 3HHHA 3WTWC 3FX3A 5ICEA 3VFZA 1BI0A 1SFXA 2Z3YA 2JTVA 5JFRA 2ISYA 3WTVC 5LRSA 1U3EM 2EFOA 4O5VA 4U7BA 3RKXA 2OQRA 3M8EA 4Q48A 2W25A 1EH7A 5HOOA 3BROA 5D6EA 1HBXG 2OZ6A 1FYKA 3PQKA 4HF1A 2AS5F 3P9IA 3T5XA 2GWRA 4A0YA 5DUKA 3E3VA 4OIQF 1IXCA 3GFMA 4BHCA 3T0YA 2VBYA 4IRIA 2BV6A 3S2WA 4G7HF 5ILUA 1IN8A 5DEQA 4IPAA 2VE9A 3GWZA 2AXLA 2P5KA 5LGUA 2XVCA 1D5VA 4XLNF 3WGGA 3I59B 2ADUA 3TO7A 1KYWA 1FY7A 3CUQB 2MLGA 3Q9SA 3FMQA 1YLFA 1KQ0A 2O3FA 1XSDA 3FXQA 2NNYA 2PBIA 1RNLA 3KP2A 2CSOA 1BIAA 5L3FA 1ZGJA 3C7JA 1KQ9A 2OZUA 3VEPA 1IN4A 3ZP5A 2GAUA 2B0LA 3K1MA 4L5JA 5E1ZB 4MTEA 2STTA 4IVNA 3T8RA 1IUYA 2XUBA 3ZN0A 2TDXA 1OMIA 2JSCA 2MLKA 4RB1A 4KA4A 3KP3A 3BPXA 3F8BA 1ZN2A 1Z7UA 3WTUC 3WG9A 2VBXA 3DQVC 3GF2A 2L54A 2LF8A 3FM3A 1P6RA 2V1XA 3J80Z 4JQFA 1TLHB 3EYIA 5LHGA 2FU4A 4A0ZA 2XHKA 3R4KA 5FD6A 3BOQA 4EJTA 3M1EA 1ULYA 4G94A 3J80K 1MDMB 4KIFA 4HZFA 2GA2A 3RKWA 1B1BA 5DDGA 5LGNA 1H9TA 4Y15A 4LB6B 3TDZC 1Z91A 2FNPA 4HW0A 4KNYA 3MZYA 1G3YA 1YYVA 5FB2A 2V79A 4R79A 4PCQA 5E1XA 4KMFA 5AIQA 3V7RA 4L0YB 3HTUA 2XV4S 1SMYF 2E7XA 3F3XA 4GXOA 2RQPA 2XIGA 1OR7A 4E70A 2YSRA 1HKQA 3MQ0A 1FBUA 1MD0A 3IWZA 3ZMSA 4EJOA 1R58A 5FFZA 4YIFA 2PI0A 4LLNA 4RGXA 1BM9A 3M8FA 4AIJA 2XASA 4B09A 3T1BA 3C1DA 3KZZA 1LVAA 4BHBA 2DK5A 4EJUA 2F5CA 2QVOA 5IT9Z 4EV0A 5LBQA 3H92A 3VB2A 2K7LA 3C3WA 4BH9A 4GCVA 2PMHA 3D5LA 4JK1X 1XSVA 1ZRFA 2MH2A 3DXJF 2W57A 1OYWA 3Q5FA 2MBFA 3ML6A 5DCFA 3I71A 4KT5C 2EA4A 1L3LA 2RDPA 3WU1B 1XDSA 3KP4A 1BC8C 3CLOA 3KEOA 2M45A 1UB9A 4ASNA 3I54A 3WTTC 2P5VA 1T6SA 2FSWA 2JPCA 2BYVE 2G9WA 2EV0A 2D1HA 5ICCA 4OMZA 3F72A 3WODF 1DP7P 2R3SA 2Q0OA 3SFZA 5CJ9A 4YFXF 4LMYA 2Z33A 4I0BA 1W5TA 4P9UA 2ZMEB 1BI1A 4ZYGA 4KMUX 2K4BA 2J5PA 3TGNA 2ZNZA 4ZZDA 2ACJA 1R36A 1QPMA 2IVMA 5CVUA 4MNUA 1BN5A 2IA1A 1GXPA 3EUHA 2PQ8A 2BEOA 2P7CB 5H6RA 3FWEA 4FX4A 3JTHA 4JBAA 3E5XA 4I02A 4ESFA 3ZMTA 1LDJA 3V4GA 4I0AA 4OU0A 3FXUA 2KJBA 3NRVA 3LQRA 3FF5A 2HYFA 1QO0D 1WWXA 1X3UA 2CG4A 1PP8F 1UHMA 2ZCWA 2F5EA 5J8FA 3HOSA 5LLQA 2HEOA 1G3TA 4I98B 1XGOA 3GFJA 4EQQA 1P4AA 3JAMK 1IN7A 2IW5A 1J9IA 4OIPF 1GVJA 2KIFA 5F64A 1YIOA 1YTYA 2JRTA 3P9CA 2FOKA 1FOKA 1KQ8A 2EA2A 5E17F 3F8CA 4Y17A 2HTSA 2COMA 1S7AA 2BBYA 1ZRDA 5HDGA 3E6DA 2V6CA 2DPUA 1IW7F 1YW9A 1G6NA 2H27A 5E8GA 2LNBA 4LK0F 1J2XA 3K0LA 1LDKB 2ZKZA 2HTJA 1ZARA 4P5OA 4BNCA 1A04A 4LG0B 3L9FA 1ZH5A 3BY6A 5LHHA 5ICGA 4G7ZF 3F6VA 1DPUA 2IA0A 1CF7B 5HVQC 3WTZA 1GXQA 4TV7A 4U0VA 2A3SA 2BE5F 3IRQA 5AIPA 2F5DA 5HS9A 3WTXC 2VN2A 2VBWA 2ZXJA 1R22A 2YX4A 5BOXA 1DPRA 3GZ5A 2EJRA 1S8NA 3QOPA 1ON2A 3H3UA 4B8XA 1KA8A 1TQMA 1TNSA 4UV9A 3IRRA 1OYYA 3HTSB 2CYYA 4M6XA 2D2WA 2P7VB 2FA5A 4RAZA 2Q8KA 4WF2A 1E17A 4NB5A 3I59A 4ZYEA 3R60A 1LJ9A 1Y0UA 1NHAA 2O03A 3E6MA 4O3MA 3CUQA 3KP6A 4L9NA 1TTYA 3FHZA 1Z6RA 1W7PB 1LEAA 1R00A 2JT1A 3SZTA 1OKRA 3IWFA 1KU2A 3F8FA 5CLSA 3B73A 1PUEE 2QLZA 5DD4A 2L02A 3I64A 3HHGA 1XSXA 1O57A 2VOOA 1MGTA 5D4SA 5TJJA 3OOPA 4UUVA 4YFNF 2QQ9A 2IA2A 2DI3A 2HOEA 2L01A 1FPQA 3BWGA 1ZG3A 1XGSA 1F1ZA 4PZJA 3QP6A 1UHWA 2FMYA 1J59A 1LNWA 2G7UA 4NHJA 5K5QA 3ZQ7A 1Z6TA 3TOBA 5BMZA 2M87A 2MD5A 2NRAC 4RS8A 4WX9A 3N4MA 4BQAA 3IC7A 4OOIA 1MDMA 4WXCA 2A69F 5HS7A 4N0BA 2VT2A 1XN7A 3E97A 4HX7A 1J75A 5EEHA 1ZGAA 1P92A 3J81K 1EH6A 1TQPA 2M30A 4Y13A 1P2FA 4QWQA 2LF7A 2H6BA 1EH8A 4M72A 1WI9A 2G7HA 5DUIA 2DO7A 1QQIA 3I4PA 4FT8A 1FBQA 3V8LA 1IF1A 4HQMA 5TRDA 1T39A 2STWA 1PDNC 2M5WA 5DYMA 1C0WA 4UV8A 1I6XA 4P55A 5EEGA 3T8TA 4ENNA 1T2KA 3K1PA 1MKMA 2DU9A 3WGHA 2IT0A 1ZLJA 5D6FA 2Q2EA 3KEQA 4FX0A 4DQ2A 3O6BB 1SFEA 4AVPA 4LD5A 5L3EA 1G4DA 5BPIA 4QLCU 2E1NA 2YX7A 2H6CA 2ZBKA 1YG2A 2FE3A 2PG4A 1P4WA 1FZPB 4LGWA 5FLXK 3SXYA 1JXSA 1E2XA 1REPC 5JVTA 2EFWA 3EETA 3HSEA 1XB4A 1BI3A 4HX4A 3E6BA 4IRGA 4AIHA 3H3ZA 4IJAA 4EM0B 3LWFA 3R0JA 2HS5A 4RGRA 3V7CA 4ZYDA 4MEYF 5DCMA 4MEXF 2DPDA 4Q5SF 4KN4X 3DV8A 2R7DA 3N97A 4EGZA 5D4RA 3I0TA 4EGYA 2BGCA 2QQAA 2NS0A 2VE8A 2FRHA 1HW2A 2ZMEA 4OIOF 1O7LA 4GGGA 3RJPA 1ODDA 1FSEA 3B02A 3KETA 2M8EA 1ZREA 4HDVA 3VODA 2GA1A 4EM1A 4IRHA 3V8KA 2NYXA 5JI6A 2FF4A 1T38A 4CICA 4A0XA 3FZVA 1XDUA 4IHTA 3M9AA 3TO9A 3HRTA 4D0PA 2FBHA 4AD9A 4ON0A 4N9HA 3CO6C 3ECHA 4M9XA 1FBSA 3F8NA 2GIVA 3GVAA 4M74A 4GO1A 4RGSA 4EM2A 4WCGA 1HSTA 3HUGA 5D5VB 1YO5C 5AONA 3F6OA 2Z5UA 4RB0A 1IRGA 4Z2YA 1H9GA 2JZYA 4YFKF 5ILVA 1P4XA 2A61A 2UWMA 2KRFA 5D5WB 3SZPA 5ERIA 3D0SA 2CO5A 2O61A 3HSRA 1B9NA 1YFHA 4ESJA 3K9TA 1HW1A 3LQQA 4PDKA 4S04A 4GYGA 2EFNA 1OPCA 2YU3A 4RAYA 3QP5A 4M9SA 3TDUC 3IHUA 1GHCA 1TW3A 4HLXA 3SHFA 2QBYB 1W4MA 4Q4ZF 1V3FA 1BJAA 5FD5A 2X0LA 1AOYA 1S29A 5CVJA 4DNCA 1UFMA 1O3RA 1SMTA 2WWYA 2XAGA 2FNAA 3MAJA 2ELHA 4OINF 4HAMA 4LG0A 2OAZA 4AWXB 2M1BA 3DPTA 2A5YB 2EV6A 1CF7A 4CXFA 2FXAA 4PGHA 5CVRA 3IL2A 3R0AA 1SD7A 4XLPF 2GXBA 1RUOA 4OIRF 4U88A 2H94A 4HDUA 1WQ2A 4ENJA 2D45A 3V7SA 1K79A 2ZO4A 3L09A 3NQOA 1FLIA 2CFXA 3TO6A 1K6OA 3GO5A 1XD7A 4H0EA 2XROA 1JHFA 3HYIA 3TQNA 2VXZA 1HXDA 3JAMZ 3LSTA 4CDGA 3F8MA 1Z9CA 1L0OC 2CWEA 4AIKA 3GFLA 1PP7U 3HIFA 5FFXA 1IXRC 3KZYA 1ZYRF 1W7PA 3EYYA 3I5UA 4U0WA 4RGUA 3DF8A 3DEUA 4UNOA 3C18A 1U5TB 2EFPA 5BPDA 2PN6A 4G7OF 3QRFF 1R23A 3RI4A 1RI7A 1RZ4A 2WC2A 2HDCA 1RUNA 1J5YA 2DK8A 3DP7A 1TW2A 1QBJA 2A07F 5F1RA 4LK1F 4CZZA 1YW7A 4I7HA 2Y48A 2XAHA 2W85A 2HWVA 5HLGA 2FQ3A 1U8RA 1I1GA 1SD5A 3ZMZA 3MWMA 4HX8A 4S05A 5KK1A 1MJAA 4A5NA 5HDKA 2Z99A 1RIOH 2CW0F 4O6JA 3W6JB 2RN7A 1XMAA 1YS6A 5HDNA 1HW5A 3CTAA 1BBYA 2DTRA 1FP1D 3ECOA 1AWCA 5ILSA 5F6FA 2ZNYA 1FC3A 2OU2A 3BJAA 3G3ZA 3ABTA 1R5HA 2IPQX 1KU7A 4BAYA 2XAQA 3TKYA 3KLNA 2VONA 3JSPA 2K86A 2QWWA 3ELKA 3GW2A 3RYRA 1LB2A 2HQNA 2XGXA 3IKTA 1JE8A 5L3GA 3DKWA 1ON1A 3KE2A 3KCCA 5HS8A 3BJ6A 4WXDA 4LLGF 2HQRA 1MJBA 4BHPA 1K7AA 1K78B 4M71A 2V1UA 1WKMA 4MQ9F 3R6SA 3Q9VA 1O3QA 5D5UB 1IN5A 3COAC 2HFHA 5LEJA 1O3TA 3REOA 1R7JA 1U6GA 4N9IA 4IXAA 2ESNA 3FMRA 3ERED 3RIRA 2GXGA 2VC1A 2ISZA 1FX7A 3ISPA 2E1CA 3J7AO 4L0ZB 1T0FA 2KIUA 1BC7C 2QQBA 3U9GA 2VODA 1U78A 4KIGA 4CO8A 2GZWA 3J81Z 3U1DA 1KU3A 3IKVA 2OQGA 5E18F 3ABUA 4UVAA 4RB2C 3O3KA 3AAFA 3WE3A 1CGPA 5K5RA 3MCZA 3L7WA 2A6HF 2EV5A 1YS7A 3CJNA 2OD5A 2Y0MA 1R5GA 1O3SA 1DUXC 2F5FA 3BDDA 1KU9A 3GFIA 2PLYA 5D5XB 4HF2A 1MZBA 4YG2F 1J0RA 1D3YA 4HBLA 4M6YA 2MH9A 3QU3A 6PAXA 4YIIA 3QAHA 2MC3A 5LRRA 4EVIA 1U5TC 4MHGA 2XAFA 2LDUA 2ZFWA 4XBFA 2DLLA 3L2CA 3O2PE 1T98A 1YW8A 3OV8A 2YR2A 3PFIA 2HR3A 2XKOA 4ZZLA 1B6AA 2KIMA 2LSOA 1XCVA 4UVBA 1SAXA 3JTGA 3JW4A 3HSFA 2O8XA 3RKYA 4L9TA 2RC4A 5FLXZ 1Z1DA 1JGSA 1QNTA 4RB3C 2QZ8A 5D8KB 1Z05A 5HLHA 4HA8A 3GEZA 3K2ZA 3QPTA 1I1SA 3BZ6A 1IXSB 4XSXF 4MGRA 4HF0A 1FYMA 5DV5A 1TNTA 3SQNA 2FBKA 4WXHA 1ZG1A 3RPQA 2XKPA 3NEUA 3P7NA 4P9FA 2R7FA 1USTA 1R1TA 1FT9A 2NAZA 3QU6A 3MZHA 3WGIA 2EFQA 4LB5A 1TQIA 3RYPA 1F5TA 3F22A 1IAWA 3GUDA 2HYGD 1XCBA 2K27A 1S6LA 1LEBA 2RV8A 2W24A 4ENKA 3W6KB 3RDIA 2HKOA 2E7WA 2QBYA 2RVCA 2P4WA 3PQJA 1O7FA 3ROUA 1ZAOA 3ZN1A 1WRJA 1SD4A 4F7ZA 1S3JA 2L4MA 1D8KA 2CGPA 2O0YA 5KVRA 3ZMUA 3EDPA 1SFUA 3BP8A 2EWNA 1FP2A 4EMSA 5JHUA 5IT3A 1ZHFA 5E8IA 2PEXA 2X4HA 4M73A 4CHUA 3FXRA 4G8XA 3BPVA 2WV0A 3LAPA 4HOBA 2H09A 4EJVA 3WU0A 3F23A 4WK8F 1ZRCA 1ZLKA 2UZKA 4UXNA 2Z9OA 1B9MA 4L9VA 2A6EF 1I27A 2P8TA 2FBIA 4LLLA 3I53A 4ESBA 4OMYA 1YQAA 3LA7A 4HV5A 3WE2A 1UCRA 2QYOA 4U7DA 1G3SA 1DDNA 4L9JA 4WWCA 4I2OA 2L4AA 1IZ1A 4A5MA 2Y75A 3WTSC 2FEZA 3FM5A 2P5LC 4P96A 1I5ZA 3I58A 4GYIA 4KN7X 4L5IA 2UXXA 3ULQB 1QGPA 5BS6A 1TBXA 4A6DA 1U5TA 1F9NA 4HQEA 3HOTA 3GYHX 3KLOA 5IT9K 4HV6A 1FSHA 2RKHA 2DFIA 2DAOA 2DT5A 1KGSA 3L00A 5J8CA 1R1UA 2WTEA 1ONVA 1KYZA 3KFWX 1HKTA 2ETHA 4IF4A 5E20A 4KYWA 1MJ9A 4XRFA 2UXNA 3GX4X 1LQ1A 3FMSA 2IP2A 5H6QA 5L3CA 4KFCA 4CYDA 5DCMB 5L3BA 2K02A 5LEKA 3CUQC 4BYYA 4L18B 4R8HA 1G3WA 2ESHA
chains in the Genus database with same CATH superfamily
4ZDPA 2XAJA 5E1WA 3OS2A 2CS3A 2RGVA 1WI3A 2GXAA 3K70D 1PVEA 5FLXC 3JRAA 4DUZE 3HGGA 1Y0NA 2M2EA 2KKOA 1BIBA 2ZC2A 4ENMA 2ZJRF 1TWFJ 3GTGJ 4JP0A 1PKPA 5DD8A 4V19K 2E5LE 4D7MA 4HNUA 5LGTA 2HKXA 5CVVA 3JR9A 1ETQA 2BHYA 2E1MA 3H35A 3PNTA 2Y30A 4FTHA 1WPKA 3GLXA 2A6TA 1Y1VJ 4KISA 1XGMA 2D1VA 2HZDA 2VOPA 4A2UA 1A1JA 4MQVA 1A1GA 1USSA 1KYQA 3V8JA 2EB7A 2XF5A 4BJ5C 1ETWA 5JVGF 1N78A 1ZELA 3RZDJ 5ADZA 1EV7A 3KP5A 4BY1J 3WTYC 4BQNA 4J00A 5IWAE 1FNNA 3K1NA 2PFBA 2F4OB 2KJCA 2DQLA 3GZ6A 2ME0A 3E5UA 1FMVA 4KUMA 1OLTA 4WPYA 3SZGA 5H20A 3MKYB 2DBBA 1LDDA 1IJWC 2RNJA 3G73A 1HSJA 1YI2I 3HRUA 2ICWG 1XGNA 2V1NA 1QZZA 3A1YA 4II2A 3M7GA 2IAIA 3OIPA 2IRFG 3P9KA 3T1HE 2EZIA 1YITI 5LHIA 1ZG5A 1K78A 1G8XA 5KAIC 2PJRB 2K3PA 1MMDA 2C6YA 3IH2A 3HPSA 3JRDA 2XGEA 1R1VA 3OYMA 4BCAA 4UUSB 4XRSA 2GHFA 2CQKA 3SDGA 3E5QA 1MSEC 1POGA 5DTDA 5KL6A 3LA2A 3A03A 1UG0A 3FKJA 1UAAA 5A2QZ 3IV5A 3CP8A 2HQAA 1X6HA 4RAFA 1J7KA 3CUOA 4NQWA 3UKGA 2QENA 1IG7A 3CLQA 1UILA 1MNDA 2HC5A 3VK6A 3MFKA 1STZA 2L9NA 2R5ZA 3CO7C 2EMGA 2ELYA 1FKAE 2DW4A 2VT3A 2HZTA 3E6CC 2GQQA 4HEIA 2VI6A 2VQLA 3A0BC 5A2QK 4DR6E 4DYRA 1HKSA 2OBPA 2UUAE 4DYQA 2H1KA 2L3DA 2DA1A 3QPHA 2EK5A 1VTNC 1IN6A 5FO5A 5M3FJ 2CH0A 1V5FA 2DOEA 1TP4A 4G6QA 3R61A 3ZR8X 2V86A 2P6TA 5CVIA 3GTPJ 3U2RA 4HYEA 5JHFA 4CGZA 5IV8B 2UUZA 3TOAA 1V4RA 3JRIA 2NA2A 2XRNA 5CFFE 2LKPA 4EJWA 4X64E 1Q1HA 1H0MA 4D1QA 2HGCA 5K7FA 1QA6A 1VQPI 2VC0A 1ERDA 1OYIA 4DV6E 4PGGA 1WSUA 1TT5B 2I9IA 3ZMVA 1FJGE 2EMWA 3CMEI 3MEXA 2WB1A 4K2EA 1JI8A 2YPRA 2M7QA 2B7TA 4G6DA 2ID6A 4Q47A 1GUUA 5M5WJ 2PMUA 3J7ZI 2JSPA 3S1RJ 4R1HA 1WHQA 2VBZA 3DU6A 3HRMA 5J1YA 2EE8A 1VQOI 3BJOA 3HRSA 2DQRA 1B8IA 2E5ZA 1YHQI 4KICA 2FMLA 3GLLA 4MTDA 2CV2A 3LL7A 3S15J 1R5ID 4M9ZA 3JRBA 3OMLA 2NOJB 3BT9A 1BOAA 1QZYA 3CMYA 2KIQA 2EMXA 3NARA 2ZSHB 2YSOA 3H5AA 1X5WA 1ITYA 5JR3A 2LOOA 2QM3A 1XG1A 2E35A 4ZYHA 2HQ5A 2A25A 2DOFA 2IS2A 3BR2A 2V9VA 4CH7A 4I01A 4XN3A 4R2RA 1FMWA 5BQTA 1D8JA 5LFAA 4LFUA 4KIBA 5CYVA 1W5SA 3HZJA 5ICFA 5K1YA 5K5OA 2XSDC 4A12A 3LFKA 1GV5A 2HXOA 5KCMA 4O43A 3BTCA 3CMMA 2H8RA 3CDHA 2FTXB 1DGCA 3FK7A 2ZJ2A 2NNNA 2W84A 3GXOA 5B66C 1IRZA 1X2NA 4MFEA 2NUEA 3ZOBA 2VJJA 4PJLA 1NG7A 3UNGC 1XMKA 3LAJA 4IHSA 2VLAA 1VQNI 2LO3A 2VF1A 3M99B 2EM8A 1J5EE 1TWGJ 2DN0A 2OA4A 2WZOA 4FISA 3KP7A 1W0TA 1IBLE 3L2VA 3EQ1A 1LFPA 2QUFA 3EQLF 3OYDA 1MSFC 1U0JA 2XPVA 2EM9A 2B9DA 2WBUA 4G9YA 4LU9A 4AYBN 4D7NA 2YU5A 3RTRA 2PJPA 3LA3A 5IOYA 3RPUA 1BI2A 1IRFA 4ZH4F 2A68F 2CTDA 4IQ4A 1FYLA 5GTHC 2Y9ZA 2IS6A 4G6TB 3ZMDA 4FHTA 3DFGA 4BXFA 2MGQA 2KMUA 3PIOF 1DP3A 5FROA 3BG7A 3LSMA 4U0YA 4HLYA 2P81A 2V1DA 1ETXA 2MG4A 2F2EA 3KEYA 4UVCA 4BXUA 5F0HA 3JSOA 3VHTB 2L9SA 5FGMA 4A6EA 3CF2A 2JA8J 4C3JJ 4YRVA 1S7EA 4LJZF 5J4YA 3HPZA 4I76A 3MVPA 5L3DA 1W7PD 2J5OA 3K69A 4KDPA 1HNWE 4ETSA 2DT6A 2K4JA 2EPXA 2O6GE 2L2NA 1JHHA 2MA3A 2EPOA 5IY5H 1F4KA 2L6MA 5D8LB 5ED4A 2YS9A 2I8DA 2M7BA 2E2JJ 2ZMEC 3BC8A 1RKWA 2IJLA 3KPHA 3LSGA 1SD6A 2CV1A 3NAUA 4I09A 3CC7I 4B3ME 1K83J 1U2WA 3DPLC 3IAM2 1WH7A 2IXSA 3Q0VA 5HLIA 4P7DA 2Y0SN 2KZVA 1ZR9A 2LBFB 2A5WA 2P6SA 1FWZA 2FQ4A 1N77A 1TN9A 3VOEA 4UHTA 1R9TJ 2JPBA 3F21A 4UUTA 1B59A 5J6XA 2EQ3A 1S7OA 2BW3A 3EPLA 2EPNA 1HQCA 3ZPLA 1OR7C 4A3BJ 4XSZF 1B4AA 3HHHA 3WTWC 1ENHA 2VRDA 5IYCJ 3FX3A 5ICEA 1MMAA 1I94E 3VFZA 2HPMA 3LFUA 4BJTA 1BI0A 3PIPF 1SFXA 1HDDC 5C44J 2Z3YA 2R5YB 2JTVA 5E3LA 5JFRA 2ISYA 3WTVC 9ANTA 5LRSA 1V55H 1U3EM 3VYXA 5C4XJ 2EFOA 4O5VA 4XKCA 4U7BA 1B72B 3RKXA 4B47A 4LF4E 2OQRA 4Q28A 3M8EA 2V8QB 4Q48A 2HNHA 4BU2A 5E3OA 2FOWA 2EMCA 2W25A 1EH7A 2KHMA 5HOOA 3BROA 4XIDA 4ZTJA 5D6EA 1HBXG 1UN6B 2OZ6A 2LVSA 2XC7A 1QRYA 4XLAA 1UELB 3PQKA 3CCUI 1FYKA 4HF1A 2EOXA 2AS5F 3P9IA 3T5XA 2GWRA 4A0YA 1JKQC 1NK3P 5DUKA 3F9KA 4HG2A 2VASA 1EF4A 3FIGA 3E3VA 4OIQF 4IQJA 1IXCA 2RNGA 3GFMA 3OSGA 1GV2A 2OTLI 4BHCA 4V2GA 2MKNA 3C2GA 5FKNA 3T0YA 2L33A 2VBYA 1VQ4I 1IV6A 5BR8E 3OYJA 2BV6A 4IRIA 1QHGA 3S2WA 4DOZA 5AE3A 1JTYA 1SVOA 2EOEA 2UU9E 1I3AA 4X62E 2EN1A 4G7HF 5ILUA 1IN8A 5DEQA 1YJNI 5AE1A 5A6AA 4IPAA 1SR9A 2R93J 2EN8A 1O0WA 1VQ6I 1Z7LA 1YRNB 2VE9A 2LUPB 3GWZA 2AXLA 2CFOA 4LFCE 3AG4H 3Q0WA 3D1NI 2P5KA 5LGUA 1NEIA 3VYYA 5A2QC 3ABKH 2XVCA 3V42A 3TW6A 1D5VA 4XLNF 2EM3A 2MC5A 3WGGA 2XGDA 3F6GA 3I59B 4NHRA 3HJEA 5JLXA 3VSKA 2VKHA 2DA6A 2ADUA 3TO7A 2GPIA 1V5GA 1KYWA 2YWQA 1ETYA 5F08A 4OAZA 1FY7A 5CPRB 2MABA 1IBME 3CUQB 4NC8A 1F43A 2MLGA 3JRFA 2K9LA 3Q9SA 4PJNA 3S3NA 3FMQA 4IEJA 4OAYA 4E6KG 1YLFA 1KQ0A 2EIMH 2O3FA 1XSDA 3FXQA 4OOGC 2NNYA 2PBIA 2CQQA 1RNLA 1X4OA 3KP2A 4B48A 2CSOA 5EJCA 4AQYE 1BIAA 2EH3A 1ZGJA 5L3FA 3C7JA 2JR1A 1ZTRA 3QG5C 1YUIA 2LY2A 4A3KJ 2DRPA 5F0CA 3BGHA 2JQ7A 1KQ9A 3DKYA 1Y8RB 2DMPA 2OZUA 3ERMA 3EUKL 2N8GA 4YELA 1IN4A 3VEPA 4BEHA 2GAUA 3ZP5A 2B9SA 2B0LA 3K1MA 2MW8A 2MD0A 4L5JA 1WJAA 1DU6A 2LFBA 5E1ZB 5E3MA 4MTEA 3DCFA 2STTA 2LMZA 4IVNA 3ZGKA 2EPCA 3PJRA 3T8RA 1IUYA 2XUBA 1L4SA 3ZN0A 2TDXA 1OMIA 3LMMA 2EN6A 2JSCA 5LL6R 4LF9E 2MLKA 2EZLA 1VF9A 4KITB 4RB1A 4KA4A 2EN4A 1WJFA 2WBTA 2EPFA 4II3A 4PUSA 3KP3A 1OISA 5IP6A 3BPXA 4BC7A 5EGOB 4DUYE 3F8BA 4C3IJ 1ZN2A 1U8BA 1Z7UA 4CYCB 3EUHC 3WTUC 3OYNA 1G59A 2UUBE 4YEJA 4C2MJ 4YHHE 3WG9A 2VBXA 3DQVC 3GF2A 2L54A 3HDDA 2LF8A 3FM3A 5F0FA 1JKOC 1APLC 5FRNA 3X2QH 2E34A 1P6RA 3PFYA 1X1DA 5IXMB 2V1XA 4AVZA 1UZCA 3J80Z 3CCQI 3IWDA 4JQFA 2KLOA 1TLHB 2DA3A 3PNYA 3EYIA 2LYCA 3EUAA 1Y8QB 5LHGA 5J4VA 2I10A 2EOIA 3S1NJ 4XICA 2FU4A 1PYVA 3KWRA 4A0ZA 2CW8A 4XOTA 2XHKA 2CMPA 1N25A 2Z1DA 4L8NA 3R4KA 5FD6A 3BOQA 4EJTA 3M1EA 1ULYA 4G94A 3J80K 1MDMB 4KIFA 3QPLA 4HZFA 1CQTA 1T95A 1GT0C 2CT1A 2GA2A 4TUIA 4F91B 3EPJA 4NNJA 1YIJI 2HVRA 3RKWA 1B1BA 2Y2ZA 3H1CA 2BOLA 5DDGA 1WVRA 4ABZA 3M07A 4XQFA 5LGNA 3I55I 1GDTA 2D9HA 1H9TA 4Y15A 5EG0A 1X1CA 2AXTC 2M9HA 4LB6B 3TDZC 1Z91A 4NBQA 2FNPA 3M1CA 4HW0A 4FE4A 4KNYA 1IQSA 2KT0A 3VYTB 3MZYA 1G3YA 1YYVA 4GRIA 5FB2A 4CCOA 2V79A 2ENCA 2OCCH 2EPMX 5T6JA 4A93J 1ETKA 1D0YA 4R79A 3TW7A 2K9MA 1B69A 4LG3A 1T4LB 4PCQA 5E1XA 1BA5A 3HOWJ 1IGNA 4KMFA 5AIQA 4B3AA 2GBYA 2R7ZJ 1SANA 5AC5A 2MDGA 3V7RA 4L0YB 3D5SC 3AG2H 3ASOH 2W00A 3HTUA 2XV4S 1DU0A 3J7YJ 1SMYF 2KP6A 2E7XA 2LR8A 2CQXA 3F3XA 2YRMA 4J8ZA 4GXOA 3JRHA 1MBEA 2RQPA 1MBGA 2XIGA 1OR7A 4E70A 2YSRA 1N34E 3K7AJ 1HKQA 4XRMA 2DMIA 4JI3E 2ELZA 3MQ0A 1FBUA 1MD0A 2MC4A 3IWZA 2EOQA 3ZMSA 4EJOA 1R58A 5FFZA 4RH8A 4ITVA 2Q2EB 4YIFA 2X6YA 1M1EB 2X51A 3K4BA 1TC3C 3OYEA 3ASNH 1LE8B 2PI0A 2X9DA 4LLNA 4XLHA 3BBGA 4RGXA 1BM9A 3M8FA 5M3MJ 4AIJA 2XASA 1YUJA 4B09A 2L7ZA 3T1BA 5IYDJ 3C1DA 3H09A 3KZZA 4WSGA 4DZPA 1HNXE 1LVAA 4BHBA 2DK5A 4DW6A 4EJUA 1MMSA 4B44A 2F5CA 1R71A 2JUGA 2QVOA 4EV0A 5LBQA 4IL6C 3H92A 3VB2A 5JLWA 5IT9Z 2K7LA 2JVGA 2PJRA 3HQ1A 1T56A 3C3WA 2DJNA 4BH9A 4GCVA 2PMHA 3SEZA 5B1AH 3L2QA 3D5LA 4JK1X 4UUSA 1XSVA 3HKZN 1ZRFA 3THOB 2EOYA 2HVQA 2MH2A 1OCRH 3DXJF 2W57A 3HOZJ 2FGGA 1OYWA 3Q5FA 2YSPA 2MBFA 3ML6A 5BNGA 5DCFA 4DR2E 3I71A 4KT5C 4IOCF 2AQEA 2EA4A 1L3LA 2RDPA 2CUFA 3WU1B 1XDSA 3PO3J 3KP4A 4JOMA 1BC8C 3CLOA 2JYAA 3H3VK 3KEOA 2M45A 1OCPA 5HNHA 5FRMA 1UB9A 4ASNA 4BUPA 3I54A 4M3GA 4XLFA 3WTTC 2OV7A 1T6SA 2P5VA 2Y31A 4N4OB 2FSWA 4FETA 2JPCA 3UK3C 4L5EA 2VB6A 2BYVE 2G9WA 4NXNE 3PUFA 2EV0A 4F6NA 2D1HA 5GP9A 5ICCA 2H8WA 5EF6A 1XMXA 3ADLA 4OMZA 2DA7A 3F72A 3CC2I 2LKSA 3I56I 3TQMA 4M30A 3WODF 1WXRA 1DP7P 5TGTA 2IGNA 3RKQA 2R3SA 2Q0OA 1OCOH 3SFZA 2YU9J 3CP2A 5CJ9A 4YFXF 2GLOA 5B5EC 4UB6C 5GAHJ 3CQZJ 2QEXI 2AHQA 4BJ6C 3BR5A 4NUBA 4LMYA 2Z33A 5TISC 1GZ6A 4I0BA 1YJWI 1W5TA 2R7QA 4LF7E 4P9UA 2X6WA 4P1WA 2WAEA 3QWLA 3BCBA 1X3CA 2EOOA 2OF7A 3JTZA 2ZMEB 1BI1A 4ZYGA 3DBHB 4DV5E 2NS8A 2UV1A 1JT6A 2VKVA 4WYQB 2R7TA 1X6EA 1U9OA 4KMUX 4EEFG 2K4BA 2J5PA 2K9NA 4ZTFA 3TGNA 2R7UA 2ZNZA 1HA8A 3K2AA 2NVXJ 4ZZDA 3GTLJ 2YTGA 2ACJA 1YE9A 2EJ4A 1GVDA 1R36A 2L9RA 2DLKA 2IBDA 1QPMA 1WFXA 1E3PA 2IVMA 2RTXA 5CVUA 1PJRA 3KX2A 2YRKA 4MNUA 2DT7B 3Q0UA 1BN5A 3FBNB 4KJZA 2IA1A 1GXPA 2V9PA 5CQEA 3EUHA 2EMIA 3GTMJ 3EPHA 2PQ8A 4R2EA 2ZSIB 2BEOA 2P7CB 5H6RA 3FWEA 4FE7A 4FX4A 3AL0B 3JTHA 4JBAA 3M4OJ 3E5XA 4HEA2 4I02A 5EZGA 4E7KA 4ESFA 3ZMTA 2VQHA 3BCAA 1LDJA 3VYRB 3V4GA 1NK2P 2GOMA 2EPZA 4Z6YA 4I0AA 3K4JA 3FXUA 4OU0A 2MDRA 2RQLA 3HL2A 2K85A 2KJBA 3NRVA 3SJMA 1WCMJ 3LQRA 3VYSB 1D1AA 1Z77A 3FF5A 3OYAA 2HYFA 1QO0D 2JN6A 1GLNA 1WWXA 1X3UA 2CG4A 1PP8F 3PO2J 2F48A 1X3ZB 1UHMA 2ZCWA 3ZQHA 2F5EA 3HUGB 5J8FA 3HOSA 4RHBB 1UHSA 5LLQA 2F4VE 2HEOA 4DV4E 1G3TA 2PRTA 2YTDA 4I98B 1XGOA 2ZJPF 1SAUA 3CF5F 3J80C 3GFJA 1FIPA 1P4AA 4EQQA 3JAMK 1IN7A 3PSIA 2IW5A 3JCUC 1J9IA 4OIPF 3HEFA 1GVJA 2KIFA 4M3FA 5F64A 1YIOA 1YTYA 3BR1A 1JJ8C 2JRTA 2K9QA 3P9CA 2WY8Q 3OL3A 2FOKA 1FOKA 1KQ8A 2EA2A 2LG4A 2JJ7A 5GPCA 5E17F 3F8CA 4Y17A 4NZVA 3IH4A 2HJJA 4ZYAA 4HSRA 2HTSA 2COMA 2JK3A 1OJLA 5FKMA 2KDOA 2L2MA 2V85A 1X2MA 2WV1A 4IHXA 1S7AA 1X3WB 2BBYA 2R1FA 3LLHA 1ZRDA 2LY9A 5HDGA 3OIOA 3E6DA 2V6CA 2DPUA 1IW7F 2F4IA 1YW9A 5KL5A 4YIRX 2DTZA 1G6NA 2KL4A 2LBFA 2H27A 5E8GA 2M1SA 2LNBA 4LK0F 1UBDC 2UXBE 1J2XA 4RM2A 3DBLB 3K0LA 1LDKB 2ZKZA 3MD2A 2HTJA 1W36D 3CCEI 4R2SA 3OYBA 1ZARA 1DI2A 4P5OA 4H4KC 3HOUJ 4BNCA 2RQQA 4M3DA 2XB5A 1HC8A 3C6KA 4R2CA 2X6XA 2LJUA 2BVLA 1WJEA 3S93A 2L7FP 4M0VA 1A04A 3IH3A 4JI6E 3C4TA 4LG0B 4UY8I 2K3FA 4LIUA 5CQGA 3L9FA 4F3QA 4CZCA 1QPIA 1ZH5A 2LY1A 3BY6A 1YPNA 1XMQE 5LHHA 2M4GA 2R5YA 2EINH 5ICGA 4W97A 1MIJA 3PUBA 4G7ZF 3F6VA 1DPUA 1SVLA 2IA0A 1CF7B 3BR0A 3S32A 1JUSA 5HVQC 3WTZA 1GXQA 2M4IA 4TV7A 4U0VA 1MBHA 1WJCA 3HPHA 2EIKH 2RREA 2LMDA 3BR3A 3HM5A 2BVMA 1YSAC 4AU7A 4XR6A 5DNYA 1YX3A 4DGWB 4BE1A 2A3SA 4XORA 1BB8A 2BE5F 1K61A 3IRQA 2DMTA 3QYFA 1A36A 2M3AA 5AIPA 2F5DA 1D0XA 5HS9A 3WTXC 2IS1A 2VN2A 1HNZE 2VBWA 4CSWA 2ZXJA 1R22A 2HI3A 2YX4A 4DJAA 4A3IJ 5BOXA 1DPRA 3GZ5A 2NXNB 2EJRA 1AU7A 1S8NA 5IT9C 1JK1A 4E4HA 2KOUA 3RCOA 3QOPA 3OS0A 1ON2A 3H3UA 4B8XA 5FKKA 1KA8A 2KZGA 1WJ5A 2R7VA 1TQMA 1TNSA 3ONQA 4UV9A 3IRRA 1OYYA 4R8OA 2ODRD 1KONA 2E19A 3HTSB 1A1LA 2UUCE 2CYYA 4IO9F 2VKDA 1YRNA 1W5CC 4M6XA 2EN3A 2Z2SB 2D2WA 2P7VB 2EL4A 2EOJA 2FA5A 1D0ZA 2EQRA 4RAZA 2Q8KA 4WF2A 1E3HA 2V89A 1E17A 4M6VA 4NB5A 3I59A 2V87A 1K6YA 1XC5A 2E71A 4ZYEA 1PJTA 1MMGA 3R60A 4XNFA 3H9GA 1LJ9A 1NTCA 2X1CA 5F3WA 1Y0UA 4N4RB 2L2OA 1NHAA 2O03A 4R2PA 3E6MA 3RSNA 2VJIA 3CCLI 2QGUA 4O3MA 3A4CA 3OYFA 3CUQA 1ZBQA 3KIOA 3C4BA 3KP6A 4L9NA 1TTYA 1A6IA 3FHZA 1Z6RA 1W7PB 3H5RA 5AE2A 4DR4E 3LOCA 2LE2A 1LEAA 1IRXA 1R00A 2JT1A 5GPAA 3SZTA 1OKRA 2DMYA 3S3MA 3IWFA 1OCCH 1LLMC 1KU2A 4LFBE 4Y3OA 3F8FA 3K70C 3O8HA 5CLSA 2E5NA 3B73A 3O8GA 4F52A 1KJKA 1PUEE 2LVHA 2LC2A 1V54H 2PMZN 2QLZA 3KYLA 1IO2A 2K7IA 3LMLA 2HGHA 5DD4A 2L02A 3G1MA 3I64A 3OS1A 1E3OC 5A6KA 3HHGA 2YTPA 1XSXA 4F2JC 1O57A 2VOOA 1RC7A 4XRSG 3S3OA 1MGTA 5D4SA 5TJJA 3OOPA 1RESA 3TP3A 4YFNF 4UUVA 2QQ9A 1SFOJ 2WBSA 4DV2E 4A3MJ 5EGOA 3CC4I 5IYBJ 2IA2A 2DA5A 2LRDA 2DI3A 2HOEA 2L01A 4CYCA 4KZSA 4WFTA 1FPQA 3BWGA 1ZG3A 1H88C 2IHR1 1XGSA 4MO7A 1F1ZA 1MMNA 3AL0C 2LTPA 4PZJA 2JPAA 4Y4RA 3QP6A 2N8XA 1UHWA 2FMYA 1J59A 1LNWA 2G7UA 3FBIB 4NHJA 3LSPA 5K5QA 2V9KA 1XNRE 4AIDA 3ZQ7A 3QYBA 3VSLA 3CDIA 3DTIA 4RLQA 1JK2A 2EM0A 2V26A 2CRGA 1Z6TA 2L7KA 3TOBA 5BMZA 1EKZA 2EL5A 1JUPA 2M87A 2MD5A 4K0KE 2NRAC 1STUA 4RS8A 4WX9A 1LUJB 3G1LA 4KHPE 3N4MA 4BQAA 3IC7A 4OOIA 1MDMA 4WXCA 2A69F 5HS7A 4N0BA 2EOSA 2VT2A 1XN7A 4IJDA 3E97A 4HX7A 4RLFA 3CCRI 1ORKA 1TL8A 1FOXA 1J75A 5EEHA 2NVYJ 4LIVA 1VQLI 3BG6A 1ZGAA 4BMJA 1P92A 3J81K 4UB8C 4XOPA 4C2TA 1EH6A 1TQPA 1AKHB 2M30A 4Y13A 1P2FA 3BQYA 5FKLA 1LKXA 1ZR2A 4QWQA 1YZ9A 2LF7A 2H6BA 1EH8A 2BY2A 4M72A 1MH3A 1WI9A 2KDZA 2LD5A 2G7HA 5DUIA 2DO7A 1HCRA 1QQIA 3I4PA 4FT8A 1FBQA 3TBIA 3V8LA 1IF1A 2Q8UA 1AHDP 1U9NA 4HQMA 1Y56A 3U21A 5TRDA 1AAYA 1T39A 1DGRM 2STWA 1PDNC 2M5WA 4PSWA 5DYMA 4W1UA 2EM2A 1C0WA 3SYTA 4UV8A 1I6XA 1HOMA 2NOGA 1J09A 4P55A 3HTXA 5EEGA 2NABA 3T8TA 4ENNA 1FTTA 1T2KA 3K1PA 1MKMA 3HBLA 4A3GJ 4GEQB 4BQOA 2EMLA 2DU9A 2LV2A 2M7AA 4BC9A 2CQ7A 2LTSA 2JOBA 2ME6A 3WGHA 2IT0A 2O8KA 1ZLJA 5D6FA 2Q2EA 2W7NA 3KEQA 4FX0A 5F27A 1LE8A 4DQ2A 2L8TA 3O6BB 4AYBA 1SFEA 4AVPA 4LD5A 5L3EA 3I4MJ 1G4DA 5BPIA 2EMYA 3RPUD 4QLCU 2J7JA 4JI0E 2MFZA 2E1NA 5IP7J 2YX7A 2BY3A 2H6CA 2ZBKA 3MKWB 4DKKA 3W6VA 4LF6E 4ZJZA 1YG2A 3C2BA 1IDYA 1Q1VA 2IGKA 4IZZA 2IEKA 3DWLE 1N32E 3HG9A 3S8PA 2BY1A 2FE3A 2PG4A 3B6CA 3H5NA 1P4WA 1FZPB 4LGWA 4E7ZA 5FLXK 1WJBA 2L7MP 4X65E 4IS1C 2EQ1A 4DR5E 2BZTA 3SXYA 2F6CA 1JXSA 1E2XA 1REPC 1X19A 3K4CA 1Z0XA 5JVTA 3OY9A 2YTJA 2R7WA 2EFWA 3SDBA 2TRTA 3VDXA 3EETA 1IQOA 3HSEA 1XB4A 3ADIA 2E60A 1X4PA 2JWTA 3L2WA 1BI3A 2Y0SA 4R03A 4HX4A 3BG5A 2DIXA 5M5YJ 3E6BA 2RSMA 4DMIA 4IRGA 4RM3A 3K4MA 2NS7A 1MNEA 2WAQN 4AIHA 3H3ZA 4IJAA 2YRHA 3ADJA 1TF6A 4EM0B 2DYSH 3LWFA 3TEDA 1S5LC 4DR3E 3R0JA 3RQIA 1A6QA 2HS5A 1IUFA 4RGRA 2DSYA 2DB2A 3H36A 3V7CA 1T8IA 3KYCB 3A02A 3RQ4A 2M34A 4ZYDA 2VQFE 1BJZA 3IP4B 4MEYF 1EJ9A 2EP3A 4F55A 2W48A 5DCMA 1XS9A 4BBYA 4MEXF 1TWHJ 2DPDA 1Z1BA 3ADGA 1FOYA 1OCTC 4KN4X 4Q5SF 3DV8A 2R7DA 3N97A 2R7OA 5EYRA 1Z67A 3VPRA 5D4RA 4EGZA 1OCZH 3I0TA 4EGYA 5HLTA 3HOVJ 2BGCA 2QQAA 2NS0A 2VE8A 5AC4A 2FRHA 1HW2A 1SEUA 2ZMEA 3HB9A 4BY7J 4OIOF 1O7LA 2KRCA 4GGGA 3RJPA 4DV1E 1ODDA 2JUCA 4BGDA 2QCOA 1FSEA 2V6EA 3B02A 3GMEA 3KETA 2EN2A 2M8EA 2JA2A 1ZREA 4HDVA 4EATA 3VODA 3WHBA 2GA1A 4EM1A 3A01B 4E7LA 4IRHA 2IGOA 3V8KA 4D9JA 4RMNA 2CUZA 2DFFA 3LSRA 1BOBA 2NYXA 5JI6A 3MSWA 2E36A 2FF4A 1T38A 4CICA 4U87A 3D5RC 4RDUA 2L5QA 4A0XA 2ZXHA 1GQEA 3FZVA 2R76A 1XDUA 1IC8A 4IHTA 2K9SA 2FJ1A 3M9AA 3W2AA 2W82A 2HOSA 3WG7H 3LSHA 3LNQA 3TO9A 3HRTA 4D0PA 2EMKA 2FBHA 4AD9A 4ON0A 3ZQLA 4BXXJ 4X8WA 4N9HA 4JX6A 3CO6C 1WH5A 2DFHA 4JI4E 3J7AY 2E2IJ 3ECHA 4CCKA 4M9XA 2NVUB 4GFBA 1YYKA 1FBSA 1FJLA 2EM4A 4FCYA 1ZK8A 3F8NA 4Y7NJ 1D1BA 2V4JC 2GIVA 3GVAA 4DBRA 3G6EI 3THNA 1IBKE 4M74A 4GO1A 2EILH 4RGSA 4EM2A 4WCGA 1HSTA 1WGXA 3HUGA 5IP9J 2EM6A 5D5VB 1YO5C 3DF6A 5AONA 3QOEA 2CUEA 3F6OA 2GOXB 1JT0A 4ANJA 1MBFA 2Z5UA 3ZQFA 2OTJI 4RB0A 4PFOA 1X6FA 2MSYA 1IRGA 4R2QA 4Z2YA 1H9GA 1RKTA 4JI8E 2JZYA 4YFKF 2QA4I 4F9BB 1IMUA 3GBGA 5A6BA 5GAEJ 1P4XA 5ILVA 2RS7A 2A61A 3DEWA 1NG6A 2UWMA 2KRFA 2HU9A 1DGWY 5D5WB 4F9AB 2XPWA 3SZPA 3T1YE 3A2KA 5ERIA 4CA0A 2ZJQF 2VQEE 3D0SA 3ZXSA 2CO5A 2O61A 3HSRA 1B9NA 1YFHA 4ESJA 1RETA 3K9TA 1HW1A 1ZKGA 2R92J 2K4VA 4WSPA 3OYKA 3S1MJ 1ZQ3P 3LQQA 3SFIA 1RR8C 4PDKA 1N3GA 4S04A 4X66E 4GYGA 1A1FA 2I5UA 2EFNA 2QSFX 2VXDA 4S0HB 1YYWA 4HSTA 3CESA 1OPCA 3CD6I 2YU3A 4RAYA 3QP5A 4M9SA 3TDUC 2L92A 2YTFA 3IHUA 2KFDA 4HRIA 4QPQA 1GHCA 1SVMA 1TW3A 1W1WE 5CKTA 4HLXA 3SHFA 2QBYB 1W4MA 2VPLA 4Q4ZF 4B1RA 3K4NA 2RPCA 4RA2A 1V3FA 5GAGJ 1BJAA 5FD5A 2X0LA 4R2DA 2QKMB 1AOYA 1S29A 5CVJA 4DNCA 1UFMA 1O3RA 3CCSI 5F1JA 3CCJI 1ACIA 2KQRA 1SMTA 1VQ5I 2WB1N 2WWYA 4CUGA 5LMNE 2XAGA 3K4KA 1PUFB 3ABMH 2DLQA 2FNAA 3BF2A 3MAJA 2ELHA 4OINF 2LK2A 3H9JA 4HAMA 2OAZA 2ELJA 2Q1ZB 4LG0A 4MLQA 3VYUB 2AQFA 4AWXB 2M1BA 5C4JJ 3DPTA 2A5YB 1XX5A 2L3JA 3G4SI 5K7HA 2EV6A 1CF7A 3OWTA 4CXFA 4I99C 4DR7E 2VJ5A 4XONA 2FXAA 3S2HJ 1TWCJ 4PGHA 5CVRA 3IL2A 2V88A 4R2AA 3R0AA 3CCMI 2V83A 2DCEA 1A5JA 1X1AA 1SD7A 4XLPF 3KZIC 1A35A 2GXBA 5M5XJ 1RUOA 3S16J 1R6RA 3E1SA 4I8OA 3BG3A 4OIRF 4U88A 2H94A 4DBQA 2N3GA 4HDUA 3P5JA 1WQ2A 4ENJA 2F8BA 2D45A 3V7SA 1K79A 4PSXA 2R7XA 2ZO4A 3L09A 3NQOA 5KHDA 1FLIA 2CFXA 3TO6A 5KAFC 1K6OA 3DTKA 2DA2A 1ETOA 4C30A 4BKXA 3OSFA 2EPAA 2LREA 3OIQA 3FXJA 3GO5A 2HVSA 1XD7A 1JTXA 1T0FC 2YTIA 4B3RE 2VL8A 4H0EA 5KL4A 1Z3XA 2XROA 1JHFA 3KYDB 2F4MB 3HYIA 3FKIJ 3TQNA 3CDLA 3CZ6A 4F92B 2VXZA 1HXDA 3JAMZ 1PDAA 1X49A 1HDPA 2L3CA 2MYSA 3AUZA 2X1EA 3K10A 3LSTA 4XN0A 3OYCA 1I39A 4MIMA 4MLVA 4CDGA 3F8MA 2EOFA 1Z9CA 3ZOQB 5J47A 1L0OC 1MNMC 5F04A 2NUGA 1I3QJ 1VZ0A 2CWEA 4AIKA 4XLEA 5IPAA 3GFLA 3AKZA 4AM3A 2KONA 4C2UA 2ECCA 1PP7U 3HIFA 1S9HA 2JY9A 4XL9A 1MEYC 5FFXA 1RR7A 4NDLA 5B1BH 1IXRC 3KZYA 5HODA 3PL8A 2VQCA 4B3SE 4GKJE 1ZYRF 2ZB9A 1QVUA 1UHZA 4LOCA 1W7PA 3EYYA 2V7FA 3I5UA 3JRCA 3IWBA 2EOMA 2XGCA 3I4NJ 2EIJH 4U0WA 3P1XA 4RGUA 3DF8A 3DEUA 2VE7C 4A3EJ 3ECRA 1Z21A 1A1IA 3DTEA 3AFHA 4UNOA 3HKZA 1X1BA 2K5CA 2YTEA 2EZ6A 3C18A 2KPMA 3C6MA 3GCMA 1U5TB 4BL0B 1K4SA 2EFPA 2BXYA 4L5NC 4CCNA 5BPDA 2PN6A 5IOZA 5A6BD 1MH4A 5J3LA 2O9LA 4G7OF 3QRFF 5K7ZA 1R23A 1SFKA 4GDFA 3RI4A 3LSKA 1RRJA 1RI7A 3OYGA 1RZ4A 2WC2A 2HDCA 4LF5E 1RUNA 1J5YA 2JRMA 2JWOA 3G2BA 2DK8A 1MBJA 3CCYA 1TW2A 2L0KA 3DP7A 3G71I 1QBJA 2A07F 2EN7A 5A69A 4FQGA 2KISA 5F1RA 3DLLF 4LK1F 3TL4X 2WAFA 1FTZA 4CZZA 1YW7A 2E1OA 4I7HA 2Y48A 2XAHA 2JVAA 2W85A 2HWVA 4JI5E 4PK4A 1F36A 3PM1A 5HLGA 4GKKE 2L9VA 3MHSC 2DMQA 3S14J 2XDVA 2FQ3A 2VPRA 1U8RA 1I1GA 3JREA 1SD5A 3ZMZA 2DMNA 3MWMA 2CV0A 2CU7A 4HX8A 2ID3A 5J1RA 2I13A 5TSEA 4O24A 3BZCA 5KK1A 1MJAA 4A5NA 4S05A 1QZEA 4DZJA 5HDKA 1B72A 3TMOA 4XMYA 2EORA 2HPIA 2Z99A 1RIOH 2EM7A 1X58A 2BHZA 3L2RA 2CW0F 1MW7A 2LP0A 4O6JA 5LMUE 3FK6A 4Y33A 1XPXA 3W6JB 2B7VA 2RN7A 1XMAA 1YS6A 1LFBA 1HW5A 5HDNA 4LFAE 2M0CA 3GZNB 2LTRA 3CTAA 1BBYA 2DTRA 3DJWA 3FHNA 2HDWA 1I6HJ 1FP1D 3LSIA 4BE0A 1JJ6C 1D5YA 1DQ3A 4OX9E 4A3JJ 3ECOA 1O4XA 1AWCA 5ILSA 1AKHA 4IX7A 5F6FA 2ZNYA 1FC3A 2OU2A 3BJAA 2H36X 3GTQJ 3G3ZA 2E1MB 5KL2A 2ZXIA 1R4MB 3DLAA 2R7SA 1X1PA 3ABTA 1R5HA 2IPQX 3MKZA 1KU7A 1RMDA 4DV3E 4BAYA 1A1HA 1JUMA 2XAQA 3TKYA 4X1EA 1F2IG 2OC6A 3KLNA 1VFCA 4A69C 2VONA 3F0CA 3JSPA 4LTYA 2K86A 2QWWA 3ELKA 3GW2A 2VIXA 3RYRA 4C3HJ 1T4OA 5KL3A 1LB2A 2HQNA 2XGXA 3B6AA 3IKTA 1JE8A 1AA7A 4HNVA 5L3GA 1BL0A 1R4NB 2LKXA 3DKWA 3GTKJ 2WCC3 1ON1A 3KE2A 4IHYA 3KCCA 5HS8A 1WHUA 3BJ6A 1TF3A 2A05A 4WXDA 4LLGF 2EPPA 2HQRA 4IOAF 2TCTA 2EQ0A 1N36E 1MJBA 1YYOA 2ZXWH 2KHXA 3W2VA 4BHPA 2M8GX 1K7AA 1K78B 2OJED 4DV0E 4KT6A 2FUG2 3VWBA 4M71A 4J19A 2V1UA 1WKMA 4MQ9F 3OYLA 2EMHA 1D1CA 3R6SA 2N3HA 5J40A 5DM6F 3OYHA 5HNFA 3Q9VA 1O3QA 1P9QC 5D5UB 1WZ2A 2R7RA 3BTJA 2FV4B 4XKWA 1TWAJ 2DMUA 4PJMA 3K6QA 1IN5A 3AV0A 3QQAA 2DOAA 2OPTA 4LITA 3COAC 1VI0A 2HFHA 5LEJA 1O3TA 2EPLX 2EPRA 3REOA 1R7JA 5FLVA 1U6GA 4N9IA 2IGMA 4IXAA 2ESNA 2CQNA 3FMRA 4NQWB 1BW5A 3ERED 3Q3SA 4BQQA 3QPSA 2BXZA 1JKRC 2MKDA 3RIRA 3BR6A 3H9QA 2GXGA 2R5ZB 4DV7E 1ZBTA 1IDZA 2JMWA 2VC1A 4XKVA 2ISZA 1JKPC 3J7Yp 3BLYA 1FX7A 3CJQB 1PJSA 3ISPA 3HC7A 3IUOA 1QVTA 2E1CA 3J7AO 1G2DC 2YT4A 4L0ZB 1T0FA 2XRLA 4F6MA 5AASA 5EDNA 2KIUA 1W0UA 1BC7C 1RC9A 2QQBA 2NVTJ 3DPUA 4AUXA 2DDAA 1HLVA 1P7JA 3U9GA 2VODA 1U78A 4KIGA 4CO8A 1QU6A 5H2FC 1FIAA 1J26A 2GZWA 3J81Z 3U1DA 2X6OA 3AG3H 2JA6J 3GTOJ 1KU3A 3IKVA 2CPNA 2OQGA 5E18F 1P7IA 3ABUA 4X9JA 2LT7A 2DJIA 4PFPA 5FLMJ 4UVAA 4RB2C 2EMAA 3O3KA 3BIDA 3AAFA 2JVHA 3SEQA 2NVQJ 1TZLA 4DYCA 1JGGA 3WE3A 1P47A 2VJ4A 1CGPA 5K5RA 3MCZA 4DR1E 3L7WA 4HTGA 2A6HF 2EV5A 2BBGA 1OFCX 3L2UA 1B8IB 2GIZA 1YS7A 3CJNA 4O4KA 1T08B 2OD5A 2Y0MA 1R5GA 1IV8A 2HHHE 1BR2A 4V2FA 1O3SA 1DUXC 3JAMC 4A3LJ 2F5FA 4M3BA 4XLCA 3BDDA 5E79C 1KU9A 3GFIA 2OUMA 2PLYA 5D5XB 4BDYA 4HF2A 2X85A 1MZBA 3ABLH 4YG2F 1LFUP 2DODA 2IS4A 1J0RA 2HDDA 5FJ8J 4DIQA 3HPGA 1HR0E 1HF0A 2DFEA 1D3YA 4BBRJ 2VKEA 1I50J 4HBLA 3WU2C 1SC7A 4M6YA 5J1UA 3IWCA 2MH9A 2G0EA 3QU3A 4AC0A 3MKLA 5C3EJ 6PAXA 3BZKA 2PX9A 4YIIA 5GADJ 3QAHA 2MC3A 3L1PA 1VQ8I 5LRRA 4EVIA 3NWSA 1U5TC 2WA0A 3C2HA 3A01A 4MHGA 1R49A 2XAFA 2LDUA 2ZFWA 3K4LA 1X47A 4XBFA 4Y52J 2L2KB 2UXDE 2DLLA 2DDBA 3O2PE 1T98A 1YW8A 3DU5A 3OV8A 5GTIC 3L2CA 1A31A 2B3TB 2DXIA 2YR2A 3PFIA 3U1KA 2RS6A 1W36C 2BB8A 2HR3A 3AG1H 2XKOA 4ZZLA 3CCVI 1B6AA 3W2WA 1ZAAC 2ENHA 1Z3YA 2YUSA 3CMAI 1UG2A 2KIMA 2LSOA 1XCVA 4UVBA 4HPQA 1SAXA 2HOTA 4JX5A 3JTGA 3MMYB 4YY3E 3JW4A 3HSFA 3RMPA 2O8XA 2W4SA 3RKYA 3WHCA 2JP9A 4L9TA 2RC4A 5FLXZ 2EZHA 1Z1DA 1JGSA 3MHHC 2DYRH 3JRGA 4QTRA 1QNTA 5B3SH 4RB3C 2QZ8A 3DBRB 5D8KB 1Z05A 5HLHA 4HA8A 3BTLA 3GEZA 3K2ZA 2COBA 3ZQGA 1VNDA 3QPTA 4FK5C 2W1OA 1I1SA 1T4NA 4X6AJ 3BZ6A 5DM7F 2RSIA 2Y69H 1KZHA 3IAS2 1IXSB 3BQZA 2CUJA 4XSXF 2E72A 2LH9A 4MGRA 4KWYA 1DQUA 4HF0A 4N4NB 5DV5A 4J01A 1TNTA 1FYMA 3SQNA 4MFDA 2FBKA 2QKLB 4WXHA 1ZG1A 1ZGWA 4PJ0C 4O5GA 2Z16A 3PSFA 3RPQA 1T33A 2DA4A 2XKPA 3DEEA 3G1OA 3NEUA 2EPUA 4QPOA 3P7NA 4P9FA 2PMZA 4XKBA 4E7IA 4LF8E 4F9CB 2R7FA 3H0GJ 5LD2C 4QSHA 1USTA 2HOAA 2R0QC 2ZM6E 2OCEA 4A3FJ 1QHHD 2WADA 2E1MC 1R1TA 1FT9A 2ELKA 2NAZA 3QU6A 4G12A 4HNTA 3MZHA 2WY7Q 2EFQA 1UJ8A 3WGIA 4LB5A 1TQIA 3BTIA 3DKXA 3RYPA 4BE2A 1F5TA 3F22A 2ODRC 2BW3B 1IAWA 1RQ0A 2XB0X 3GUDA 2HYGD 1XCBA 1TT0A 2K27A 1S6LA 1LEBA 2KRHA 2RV8A 2W24A 4ENKA 3W6KB 3RDIA 2CJJA 2E7WA 2HKOA 2EZKA 2QBYA 3CJTB 2RVCA 2P4WA 3PQJA 1O7FA 3ROUA 1N75A 2QF7A 2B63J 1ZAOA 2EPKX 3ZN1A 2FX0A 2EOHA 1WRJA 3OTOE 1UMQA 1SD4A 2LLKA 1EKEA 4F7ZA 1S3JA 2EBIA 2L4MA 1D8KA 3ZRGA 1OQYA 3MZ8A 2CGPA 2CW7A 2O0YA 1LPQA 5KVRA 5EEAA 4FASD 1H89C 3ZMUA 3EDPA 1SFUA 2UXCE 3BP8A 1BW6A 2EWNA 1FP2A 4X0GA 2GM4A 1PUFA 2P0WA 1NCSA 1VQMI 3PNVA 4NC7A 4EMSA 5JHUA 2YTQA 2M9AA 4P78A 5IT3A 1ZHFA 1RPWA 5E8IA 5EZHA 2PEXA 2X4HA 2XAUA 4M73A 4CHUA 4JI7E 1Y6IA 4D5FA 1G2HA 2LCEA 3FXRA 1XNQE 1WJPA 4QIWN 2EL6A 4G8XA 3OMYA 3BPVA 2XSJC 4E7SA 1NH3A 2WV0A 3HGYA 3LAPA 4PJJA 3FISA 4JYAE 4HOBA 1H8AC 4F93B 2H09A 1VQ7I 1ZU1A 4EJVA 2XF6A 4E7HA 2DGCA 3WU0A 1XMOE 3F23A 4NC6A 4WK8F 1ZRCA 1WJDA 1ZLKA 3EPZA 2UZKA 4CCLA 3GTJJ 4UXNA 3QODA 2Z9OA 1AH5A 2H1LA 2YZTA 4JV5E 1B9MA 4M2ZA 1ETVA 4L9VA 4JX4A 3M3YJ 4BACA 2A6EF 1WHNA 2VQGA 1I27A 3ZQQA 1BR4A 2P8TA 4XM3A 1GTKA 2LBSB 2B7EA 2O7OA 1PJQA 1BBOA 2FBIA 4LLLA 1K4TA 3OR1C 5KNLA 2XF7A 3I53A 2K40A 3I3LA 4ESBA 4OMYA 3RZOJ 2VUMJ 1YQAA 3OOUA 4M9VC 3LA7A 4HV5A 3WE2A 3CJRB 1UCRA 2QYOA 2NUFA 4U7DA 1G3SA 2HYJA 3HOXJ 3N05A 4A3CJ 2MC6A 4ZDLA 3BG9A 2YTNA 4BS9A 1DDNA 4L9JA 5DS9A 3MN2A 2FD5A 1Y1WJ 3E0JB 1V5EA 3OR2C 4WWCA 4I2OA 3HXLA 2JA5J 5A6JA 2QSHX 4NXME 4BEHB 2EOZA 2L4AA 1IZ1A 4CCJA 4A5MA 5FKOA 1N33E 4OWRB 1X48A 2Y75A 3J81C 3WTSC 4B3TE 3UR3C 4IHWA 1ZR4A 3FIWA 2EMBA 4IHVA 2FEZA 3FM5A 2P5LC 1S72I 2CSHA 2X1DA 2M0MA 4D5CA 4RBOA 4P96A 2ADRA 1I5ZA 4TUGA 3FXKA 3I58A 1YOVB 4GYIA 4KN7X 4L5IA 2UXXA 1VQ9I 3ULQB 4BBSJ 1QGPA 4RAGA 4MLOA 2XPUA 5BS6A 3ZQCA 2JOXA 2LJHA 1TBXA 4Q35B 4A6DA 2ECBA 2RAEA 2QSGX 1U5TA 1F9NA 2F5VA 4CCMA 4HQEA 2YTOA 3HOTA 4I6ZA 2QQ8A 3GYHX 3KLOA 3ZQIA 3H0DA 5IT9K 4HV6A 4BDZA 3ESWB 3S17J 4XK4A 2AO9A 5E3NA 2R4GA 3J7AG 5KL7A 3NWTA 4JI2E 1QU3A 1FSHA 4GZNC 4E7JA 2RKHA 2DFIA 3M8JA 2HXIA 2DAOA 1E0EA 2DT5A 1BBGA 4JYKA 1KGSA 2LUQA 3F6HA 1FOWA 3L00A 5J8CA 1R1UA 3E7LA 4M3EA 2WTEA 1ONVA 2BY0A 3FXOA 1KYZA 3KFWX 1G2FC 2JXPA 2YPNA 1HKTA 3ZCOA 2ETHA 3QYEA 4IF4A 2WAQA 4ZC3A 5E20A 4B4CA 4KYWA 1MJ9A 1YJ9I 1BR1A 3FXLA 4XRFA 4A3DJ 1EA3A 2UXNA 2ZFUA 3W3CA 3GX4X 2YU8A 2WBMA 3FDYA 3S1QJ 4F54A 1XTAA 3A0HC 1LQ1A 2GLIA 1FEXA 3FMSA 2EM5A 2IP2A 3K6GA 5H6QA 5L3CA 3FXMA 4KFCA 4CYDA 5DCMB 5L3BA 1YX5A 1LVKA 4C9YA 3OL4A 3OYIA 2E2HJ 2K02A 2M4KA 1Y39A 2X48A 2JA7J 5EG0B 4B3XA 4B43A 2D5VA 2EMZA 3LSJA 3EPKA 4JI1E 2EWLA 2LRSA 5LEKA 3S2DJ 3CUQC 4BYYA 3HOYJ 2O5RA 2Y9YA 4L18B 1A1KA 1MBKA 4ZDOA 4R8HA 2EMFA 4IKFA 3I9V2 1VQKI 2ENAA 1G3WA 3TP0A 2ESHA 3JU0A
chains in the Genus database with same CATH topology
2XAJA 5E1WA 2RGVA 2KKOA 1BIBA 4ENMA 5DD8A 5LGTA 2HKXA 5CVVA 3GLXA 1XGMA 2D1VA 2VOPA 4A2UA 4MQVA 1USSA 3V8JA 2EB7A 1EV7A 3KP5A 3WTYC 1FNNA 3K1NA 2PFBA 2KJCA 2DQLA 3GZ6A 3E5UA 4KUMA 5H20A 2DBBA 1LDDA 2RNJA 3G73A 1HSJA 3HRUA 1XGNA 1QZZA 3M7GA 2IRFG 3P9KA 5LHIA 1ZG5A 1K78A 2C6YA 1R1VA 2CQKA 3E5QA 3LA2A 5A2QZ 1J7KA 3CUOA 4NQWA 2QENA 3MFKA 1STZA 3CO7C 2DW4A 2VT3A 2HZTA 3E6CC 2GQQA 5A2QK 1HKSA 2OBPA 2L3DA 3QPHA 2EK5A 1VTNC 1IN6A 5FO5A 4G6QA 3R61A 2P6TA 5CVIA 3U2RA 4HYEA 4CGZA 3TOAA 1V4RA 2XRNA 2LKPA 4EJWA 1Q1HA 1H0MA 2HGCA 2VC0A 1OYIA 4PGGA 1WSUA 3ZMVA 3MEXA 4K2EA 2YPRA 4G6DA 4Q47A 2PMUA 4R1HA 2VBZA 3HRMA 3BJOA 3HRSA 2DQRA 4KICA 2FMLA 4MTDA 4M9ZA 1BOAA 1QZYA 5JR3A 2QM3A 4ZYHA 2V9VA 4I01A 5BQTA 1D8JA 4LFUA 4KIBA 5CYVA 5K5OA 1W5SA 5ICFA 5K1YA 4A12A 3LFKA 3CDHA 2ZJ2A 2NNNA 2W84A 3GXOA 1XMKA 3LAJA 4IHSA 2OA4A 3KP7A 2QUFA 3EQLF 4G9YA 3RTRA 2PJPA 3LA3A 3RPUA 1BI2A 1IRFA 4ZH4F 2A68F 1FYLA 3ZMDA 4FHTA 3DFGA 4HLYA 4U0YA 2V1DA 4BXUA 2F2EA 4UVCA 3JSOA 5FGMA 4A6EA 4LJZF 5L3DA 1W7PD 2J5OA 3K69A 4KDPA 4ETSA 2K4JA 2O6GE 1JHHA 2MA3A 1F4KA 5D8LB 5ED4A 2IJLA 1SD6A 4I09A 1U2WA 3DPLC 5HLIA 2P6SA 1FWZA 3VOEA 4UHTA 2JPBA 3F21A 1B59A 5J6XA 1S7OA 1HQCA 3ZPLA 4XSZF 1B4AA 3HHHA 3WTWC 3FX3A 5ICEA 3VFZA 1BI0A 1SFXA 2Z3YA 2JTVA 5JFRA 2ISYA 3WTVC 5LRSA 1U3EM 2EFOA 4O5VA 4U7BA 3RKXA 2OQRA 3M8EA 4Q48A 2W25A 1EH7A 5HOOA 3BROA 5D6EA 1HBXG 2OZ6A 1FYKA 3PQKA 4HF1A 2AS5F 3P9IA 3T5XA 2GWRA 4A0YA 5DUKA 3E3VA 4OIQF 1IXCA 3GFMA 4BHCA 3T0YA 2VBYA 4IRIA 2BV6A 3S2WA 4G7HF 5ILUA 1IN8A 5DEQA 4IPAA 2VE9A 3GWZA 2AXLA 2P5KA 5LGUA 2XVCA 1D5VA 4XLNF 3WGGA 3I59B 2ADUA 3TO7A 1KYWA 1FY7A 3CUQB 2MLGA 3Q9SA 3FMQA 1YLFA 1KQ0A 2O3FA 1XSDA 3FXQA 2NNYA 2PBIA 1RNLA 3KP2A 2CSOA 1BIAA 5L3FA 1ZGJA 3C7JA 1KQ9A 2OZUA 3VEPA 1IN4A 3ZP5A 2GAUA 2B0LA 3K1MA 4L5JA 5E1ZB 4MTEA 2STTA 4IVNA 3T8RA 1IUYA 2XUBA 3ZN0A 2TDXA 1OMIA 2JSCA 2MLKA 4RB1A 4KA4A 3KP3A 3BPXA 3F8BA 1ZN2A 1Z7UA 3WTUC 3WG9A 2VBXA 3DQVC 3GF2A 2L54A 2LF8A 3FM3A 1P6RA 2V1XA 3J80Z 4JQFA 1TLHB 3EYIA 5LHGA 2FU4A 4A0ZA 2XHKA 3R4KA 5FD6A 3BOQA 4EJTA 3M1EA 1ULYA 4G94A 3J80K 1MDMB 4KIFA 4HZFA 2GA2A 3RKWA 1B1BA 5DDGA 5LGNA 1H9TA 4Y15A 4LB6B 3TDZC 1Z91A 2FNPA 4HW0A 4KNYA 3MZYA 1G3YA 1YYVA 5FB2A 2V79A 4R79A 4PCQA 5E1XA 4KMFA 5AIQA 3V7RA 4L0YB 3HTUA 2XV4S 1SMYF 2E7XA 3F3XA 4GXOA 2RQPA 2XIGA 1OR7A 4E70A 2YSRA 1HKQA 3MQ0A 1FBUA 1MD0A 3IWZA 3ZMSA 4EJOA 1R58A 5FFZA 4YIFA 2PI0A 4LLNA 4RGXA 1BM9A 3M8FA 4AIJA 2XASA 4B09A 3T1BA 3C1DA 3KZZA 1LVAA 4BHBA 2DK5A 4EJUA 2F5CA 2QVOA 5IT9Z 4EV0A 5LBQA 3H92A 3VB2A 2K7LA 3C3WA 4BH9A 4GCVA 2PMHA 3D5LA 4JK1X 1XSVA 1ZRFA 2MH2A 3DXJF 2W57A 1OYWA 3Q5FA 2MBFA 3ML6A 5DCFA 3I71A 4KT5C 2EA4A 1L3LA 2RDPA 3WU1B 1XDSA 3KP4A 1BC8C 3CLOA 3KEOA 2M45A 1UB9A 4ASNA 3I54A 3WTTC 2P5VA 1T6SA 2FSWA 2JPCA 2BYVE 2G9WA 2EV0A 2D1HA 5ICCA 4OMZA 3F72A 3WODF 1DP7P 2R3SA 2Q0OA 3SFZA 5CJ9A 4YFXF 4LMYA 2Z33A 4I0BA 1W5TA 4P9UA 2ZMEB 1BI1A 4ZYGA 4KMUX 2K4BA 2J5PA 3TGNA 2ZNZA 4ZZDA 2ACJA 1R36A 1QPMA 2IVMA 5CVUA 4MNUA 1BN5A 2IA1A 1GXPA 3EUHA 2PQ8A 2BEOA 2P7CB 5H6RA 3FWEA 4FX4A 3JTHA 4JBAA 3E5XA 4I02A 4ESFA 3ZMTA 1LDJA 3V4GA 4I0AA 4OU0A 3FXUA 2KJBA 3NRVA 3LQRA 3FF5A 2HYFA 1QO0D 1WWXA 1X3UA 2CG4A 1PP8F 1UHMA 2ZCWA 2F5EA 5J8FA 3HOSA 5LLQA 2HEOA 1G3TA 4I98B 1XGOA 3GFJA 4EQQA 1P4AA 3JAMK 1IN7A 2IW5A 1J9IA 4OIPF 1GVJA 2KIFA 5F64A 1YIOA 1YTYA 2JRTA 3P9CA 2FOKA 1FOKA 1KQ8A 2EA2A 5E17F 3F8CA 4Y17A 2HTSA 2COMA 1S7AA 2BBYA 1ZRDA 5HDGA 3E6DA 2V6CA 2DPUA 1IW7F 1YW9A 1G6NA 2H27A 5E8GA 2LNBA 4LK0F 1J2XA 3K0LA 1LDKB 2ZKZA 2HTJA 1ZARA 4P5OA 4BNCA 1A04A 4LG0B 3L9FA 1ZH5A 3BY6A 5LHHA 5ICGA 4G7ZF 3F6VA 1DPUA 2IA0A 1CF7B 5HVQC 3WTZA 1GXQA 4TV7A 4U0VA 2A3SA 2BE5F 3IRQA 5AIPA 2F5DA 5HS9A 3WTXC 2VN2A 2VBWA 2ZXJA 1R22A 2YX4A 5BOXA 1DPRA 3GZ5A 2EJRA 1S8NA 3QOPA 1ON2A 3H3UA 4B8XA 1KA8A 1TQMA 1TNSA 4UV9A 3IRRA 1OYYA 3HTSB 2CYYA 4M6XA 2D2WA 2P7VB 2FA5A 4RAZA 2Q8KA 4WF2A 1E17A 4NB5A 3I59A 4ZYEA 3R60A 1LJ9A 1Y0UA 1NHAA 2O03A 3E6MA 4O3MA 3CUQA 3KP6A 4L9NA 1TTYA 3FHZA 1Z6RA 1W7PB 1LEAA 1R00A 2JT1A 3SZTA 1OKRA 3IWFA 1KU2A 3F8FA 5CLSA 3B73A 1PUEE 2QLZA 5DD4A 2L02A 3I64A 3HHGA 1XSXA 1O57A 2VOOA 1MGTA 5D4SA 5TJJA 3OOPA 4UUVA 4YFNF 2QQ9A 2IA2A 2DI3A 2HOEA 2L01A 1FPQA 3BWGA 1ZG3A 1XGSA 1F1ZA 4PZJA 3QP6A 1UHWA 2FMYA 1J59A 1LNWA 2G7UA 4NHJA 5K5QA 3ZQ7A 1Z6TA 3TOBA 5BMZA 2M87A 2MD5A 2NRAC 4RS8A 4WX9A 3N4MA 4BQAA 3IC7A 4OOIA 1MDMA 4WXCA 2A69F 5HS7A 4N0BA 2VT2A 1XN7A 3E97A 4HX7A 1J75A 5EEHA 1ZGAA 1P92A 3J81K 1EH6A 1TQPA 2M30A 4Y13A 1P2FA 4QWQA 2LF7A 2H6BA 1EH8A 4M72A 1WI9A 2G7HA 5DUIA 2DO7A 1QQIA 3I4PA 4FT8A 1FBQA 3V8LA 1IF1A 4HQMA 5TRDA 1T39A 2STWA 1PDNC 2M5WA 5DYMA 1C0WA 4UV8A 1I6XA 4P55A 5EEGA 3T8TA 4ENNA 1T2KA 3K1PA 1MKMA 2DU9A 3WGHA 2IT0A 1ZLJA 5D6FA 2Q2EA 3KEQA 4FX0A 4DQ2A 3O6BB 1SFEA 4AVPA 4LD5A 5L3EA 1G4DA 5BPIA 4QLCU 2E1NA 2YX7A 2H6CA 2ZBKA 1YG2A 2FE3A 2PG4A 1P4WA 1FZPB 4LGWA 5FLXK 3SXYA 1JXSA 1E2XA 1REPC 5JVTA 2EFWA 3EETA 3HSEA 1XB4A 1BI3A 4HX4A 3E6BA 4IRGA 4AIHA 3H3ZA 4IJAA 4EM0B 3LWFA 3R0JA 2HS5A 4RGRA 3V7CA 4ZYDA 4MEYF 5DCMA 4MEXF 2DPDA 4Q5SF 4KN4X 3DV8A 2R7DA 3N97A 4EGZA 5D4RA 3I0TA 4EGYA 2BGCA 2QQAA 2NS0A 2VE8A 2FRHA 1HW2A 2ZMEA 4OIOF 1O7LA 4GGGA 3RJPA 1ODDA 1FSEA 3B02A 3KETA 2M8EA 1ZREA 4HDVA 3VODA 2GA1A 4EM1A 4IRHA 3V8KA 2NYXA 5JI6A 2FF4A 1T38A 4CICA 4A0XA 3FZVA 1XDUA 4IHTA 3M9AA 3TO9A 3HRTA 4D0PA 2FBHA 4AD9A 4ON0A 4N9HA 3CO6C 3ECHA 4M9XA 1FBSA 3F8NA 2GIVA 3GVAA 4M74A 4GO1A 4RGSA 4EM2A 4WCGA 1HSTA 3HUGA 5D5VB 1YO5C 5AONA 3F6OA 2Z5UA 4RB0A 1IRGA 4Z2YA 1H9GA 2JZYA 4YFKF 5ILVA 1P4XA 2A61A 2UWMA 2KRFA 5D5WB 3SZPA 5ERIA 3D0SA 2CO5A 2O61A 3HSRA 1B9NA 1YFHA 4ESJA 3K9TA 1HW1A 3LQQA 4PDKA 4S04A 4GYGA 2EFNA 1OPCA 2YU3A 4RAYA 3QP5A 4M9SA 3TDUC 3IHUA 1GHCA 1TW3A 4HLXA 3SHFA 2QBYB 1W4MA 4Q4ZF 1V3FA 1BJAA 5FD5A 2X0LA 1AOYA 1S29A 5CVJA 4DNCA 1UFMA 1O3RA 1SMTA 2WWYA 2XAGA 2FNAA 3MAJA 2ELHA 4OINF 4HAMA 4LG0A 2OAZA 4AWXB 2M1BA 3DPTA 2A5YB 2EV6A 1CF7A 4CXFA 2FXAA 4PGHA 5CVRA 3IL2A 3R0AA 1SD7A 4XLPF 2GXBA 1RUOA 4OIRF 4U88A 2H94A 4HDUA 1WQ2A 4ENJA 2D45A 3V7SA 1K79A 2ZO4A 3L09A 3NQOA 1FLIA 2CFXA 3TO6A 1K6OA 3GO5A 1XD7A 4H0EA 2XROA 1JHFA 3HYIA 3TQNA 2VXZA 1HXDA 3JAMZ 3LSTA 4CDGA 3F8MA 1Z9CA 1L0OC 2CWEA 4AIKA 3GFLA 1PP7U 3HIFA 5FFXA 1IXRC 3KZYA 1ZYRF 1W7PA 3EYYA 3I5UA 4U0WA 4RGUA 3DF8A 3DEUA 4UNOA 3C18A 1U5TB 2EFPA 5BPDA 2PN6A 4G7OF 3QRFF 1R23A 3RI4A 1RI7A 1RZ4A 2WC2A 2HDCA 1RUNA 1J5YA 2DK8A 3DP7A 1TW2A 1QBJA 2A07F 5F1RA 4LK1F 4CZZA 1YW7A 4I7HA 2Y48A 2XAHA 2W85A 2HWVA 5HLGA 2FQ3A 1U8RA 1I1GA 1SD5A 3ZMZA 3MWMA 4HX8A 4S05A 5KK1A 1MJAA 4A5NA 5HDKA 2Z99A 1RIOH 2CW0F 4O6JA 3W6JB 2RN7A 1XMAA 1YS6A 5HDNA 1HW5A 3CTAA 1BBYA 2DTRA 1FP1D 3ECOA 1AWCA 5ILSA 5F6FA 2ZNYA 1FC3A 2OU2A 3BJAA 3G3ZA 3ABTA 1R5HA 2IPQX 1KU7A 4BAYA 2XAQA 3TKYA 3KLNA 2VONA 3JSPA 2K86A 2QWWA 3ELKA 3GW2A 3RYRA 1LB2A 2HQNA 2XGXA 3IKTA 1JE8A 5L3GA 3DKWA 1ON1A 3KE2A 3KCCA 5HS8A 3BJ6A 4WXDA 4LLGF 2HQRA 1MJBA 4BHPA 1K7AA 1K78B 4M71A 2V1UA 1WKMA 4MQ9F 3R6SA 3Q9VA 1O3QA 5D5UB 1IN5A 3COAC 2HFHA 5LEJA 1O3TA 3REOA 1R7JA 1U6GA 4N9IA 4IXAA 2ESNA 3FMRA 3ERED 3RIRA 2GXGA 2VC1A 2ISZA 1FX7A 3ISPA 2E1CA 3J7AO 4L0ZB 1T0FA 2KIUA 1BC7C 2QQBA 3U9GA 2VODA 1U78A 4KIGA 4CO8A 2GZWA 3J81Z 3U1DA 1KU3A 3IKVA 2OQGA 5E18F 3ABUA 4UVAA 4RB2C 3O3KA 3AAFA 3WE3A 1CGPA 5K5RA 3MCZA 3L7WA 2A6HF 2EV5A 1YS7A 3CJNA 2OD5A 2Y0MA 1R5GA 1O3SA 1DUXC 2F5FA 3BDDA 1KU9A 3GFIA 2PLYA 5D5XB 4HF2A 1MZBA 4YG2F 1J0RA 1D3YA 4HBLA 4M6YA 2MH9A 3QU3A 6PAXA 4YIIA 3QAHA 2MC3A 5LRRA 4EVIA 1U5TC 4MHGA 2XAFA 2LDUA 2ZFWA 4XBFA 2DLLA 3L2CA 3O2PE 1T98A 1YW8A 3OV8A 2YR2A 3PFIA 2HR3A 2XKOA 4ZZLA 1B6AA 2KIMA 2LSOA 1XCVA 4UVBA 1SAXA 3JTGA 3JW4A 3HSFA 2O8XA 3RKYA 4L9TA 2RC4A 5FLXZ 1Z1DA 1JGSA 1QNTA 4RB3C 2QZ8A 5D8KB 1Z05A 5HLHA 4HA8A 3GEZA 3K2ZA 3QPTA 1I1SA 3BZ6A 1IXSB 4XSXF 4MGRA 4HF0A 1FYMA 5DV5A 1TNTA 3SQNA 2FBKA 4WXHA 1ZG1A 3RPQA 2XKPA 3NEUA 3P7NA 4P9FA 2R7FA 1USTA 1R1TA 1FT9A 2NAZA 3QU6A 3MZHA 3WGIA 2EFQA 4LB5A 1TQIA 3RYPA 1F5TA 3F22A 1IAWA 3GUDA 2HYGD 1XCBA 2K27A 1S6LA 1LEBA 2RV8A 2W24A 4ENKA 3W6KB 3RDIA 2HKOA 2E7WA 2QBYA 2RVCA 2P4WA 3PQJA 1O7FA 3ROUA 1ZAOA 3ZN1A 1WRJA 1SD4A 4F7ZA 1S3JA 2L4MA 1D8KA 2CGPA 2O0YA 5KVRA 3ZMUA 3EDPA 1SFUA 3BP8A 2EWNA 1FP2A 4EMSA 5JHUA 5IT3A 1ZHFA 5E8IA 2PEXA 2X4HA 4M73A 4CHUA 3FXRA 4G8XA 3BPVA 2WV0A 3LAPA 4HOBA 2H09A 4EJVA 3WU0A 3F23A 4WK8F 1ZRCA 1ZLKA 2UZKA 4UXNA 2Z9OA 1B9MA 4L9VA 2A6EF 1I27A 2P8TA 2FBIA 4LLLA 3I53A 4ESBA 4OMYA 1YQAA 3LA7A 4HV5A 3WE2A 1UCRA 2QYOA 4U7DA 1G3SA 1DDNA 4L9JA 4WWCA 4I2OA 2L4AA 1IZ1A 4A5MA 2Y75A 3WTSC 2FEZA 3FM5A 2P5LC 4P96A 1I5ZA 3I58A 4GYIA 4KN7X 4L5IA 2UXXA 3ULQB 1QGPA 5BS6A 1TBXA 4A6DA 1U5TA 1F9NA 4HQEA