1QNTA

X-ray structure of human o6alkylguanine-dna alkyltransferase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
171
structure length
166
Chain Sequence
EMKRTTLDSPLGKLELSGCEQGLHEIKLLGKDAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human O(6)-Alkylguanine-DNA Alkyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna repair
molecule keywords METHYLATED-DNA--PROTEIN-CYSTEINE METHYLTRANSFERASE
total genus 42
structure length 166
sequence length 171
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 1999-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1qntA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1qntA01
2Q8KA 1K79A 1XMAA 2HKXA 3CUQA 5D5VB 4Y13A 4LK1F 1OR7A 1ODDA 2AS5F 2EA4A 3HIFA 3E6CC 4G7OF 1O3QA 1FBUA 5KK1A 1ZG1A 2Y75A 5DEQA 2EFPA 4RGUA 3LQRA 3I54A 1FYMA 1QZZA 3GVAA 3GW2A 4AWXB 3TO9A 3WODF 4LK0F 3OOPA 2ADUA 1Z6TA 2P7VB 2DO7A 3V7CA 3BROA 2GAUA 4OU0A 3EDPA 1HSTA 4RAYA 1XCVA 1YW7A 1XGOA 2E1NA 4ZZDA 4M9XA 5AIPA 2CG4A 1KU7A 1IW7F 1RI7A 4MGRA 5ILVA 1BI1A 1MJ9A 3JSOA 3CDHA 1XSXA 3KETA 3FMQA 4I98B 1MDMA 5FLXK 5HLHA 2VE8A 1IN5A 5E20A 1D8JA 5H20A 2VBWA 5E1WA 3FXRA 1BC8C 2JTVA 4EJWA 1ZARA 1YYVA 1B59A 1U6GA 3K69A 4R1HA 4BQAA 4Y15A 1TQMA 5AONA 2X0LA 1K78A 2VC0A 4FX4A 1I27A 4P55A 2V1XA 2XAHA 2PMHA 1K78B 1YIOA 2A68F 4WK8F 4A12A 3WGIA 5HOOA 2CSOA 1U5TB 3HHGA 1U2WA 1TQPA 1QPMA 2QQAA 4L9VA 3QP5A 3SHFA 3HTUA 2BYVE 3I5UA 2ZMEB 4LG0B 5CVJA 1I5ZA 2HQNA 3KEOA 2M1BA 1BJAA 2CO5A 3FMRA 3WU0A 4AVPA 2FRHA 1VTNC 4HX8A 2G9WA 4I7HA 3RTRA 1IN6A 3F8FA 4GXOA 2CWEA 3GFMA 2ESNA 2XUBA 4EMSA 5JR3A 1GXPA 3Q9SA 2V79A 4WX9A 1H9GA 4U0VA 5A2QZ 2HEOA 3B73A 2HTSA 2FBKA 4FHTA 3RI4A 1T98A 2KIMA 4Q48A 2K02A 1P6RA 2HR3A 3N4MA 3ML6A 1WQ2A 1W7PD 2OQRA 3P9CA 2EV0A 4LMYA 2VBZA 3MCZA 2LDUA 1SFUA 5A2QK 2Z5UA 4HZFA 1O3SA 1RNLA 1U5TA 2ZO4A 4M9SA 5IT9K 4WF2A 1H0MA 2H94A 3SQNA 1LDDA 1XN7A 3AAFA 2DQRA 2ZNYA 3NRVA 1ZRFA 4GYGA 1J7KA 2LF7A 2EWNA 1P4WA 2RVCA 5D5UB 2FQ3A 1GXQA 1W7PA 1FLIA 4M6XA 1BI3A 1ZLKA 3V8LA 4XRFA 2O8XA 1FSHA 2J5OA 4ZYGA 4CICA 2O6GE 2G7UA 4ZYHA 2O3FA 5LEKA 5LEJA 2NAZA 4MEXF 5TRDA 1HW1A 2CGPA 2P6TA 4LLGF 6PAXA 5LLQA 3KEQA 1KA8A 1V3FA 4CXFA 1V4RA 1TBXA 4JK1X 2EV6A 2QVOA 4WXHA 5LHHA 1S6LA 4KN4X 4RGRA 2PN6A 4MEYF 4GGGA 3R0AA 1ZGJA 2M8EA 2KJBA 3CLOA 1OPCA 3FX3A 4AD9A 4AIHA 2A6EF 4YFNF 2ZNZA 2HZTA 1K6OA 5DUIA 1TQIA 5L3CA 1SAXA 2YSRA 2LKPA 3WTXC 2XAQA 1FNNA 5BQTA 2IT0A 1U3EM 2M5WA 3J7AO 4G6QA 4PZJA 2OZ6A 3B02A 2A5YB 2OAZA 4U7BA 4HV5A 2IA0A 3KCCA 4HDVA 3IKVA 1Z6RA 4LD5A 4EJVA 3WTUC 1HKSA 1XDSA 2UXXA 2PG4A 4UHTA 4KFCA 4D0PA 1L0OC 2GWRA 1EH8A 3GEZA 1ZH5A 2XASA 1IN7A 4P96A 5L3BA 4WXCA 1KGSA 3TOAA 2ELHA 1JGSA 4MQ9F 1P4AA 1HW5A 1FY7A 3HRSA 2WTEA 2GIVA 5CVRA 2E7XA 3T0YA 1R5HA 2JSCA 3WG9A 5AIQA 1K7AA 3GWZA 4I0AA 4KICA 1P2FA 1G3YA 3WTZA 1TNSA 4G7HF 5ERIA 3GFJA 2ZJ2A 3V7SA 2FMYA 1XGNA 1MJBA 4HF1A 5K5OA 3H3ZA 4BHCA 3RKYA 1YS7A 5HDKA 3IHUA 2E7WA 4ENMA 1JE8A 5FD5A 2QQ9A 3FHZA 3EQLF 3FWEA 3K0LA 3I64A 3O6BB 1R5GA 3TDZC 1SD7A 1QO0D 1IXSB 3ZMTA 5JHUA 1DUXC 2KIUA 4IXAA 4OIQF 3LA3A 2H6BA 4JQFA 5DCMA 1G6NA 2F2EA 5E18F 2W24A 4R79A 2K86A 3CUQB 4RS8A 2OQGA 1S7OA 3H92A 2P5VA 3QU3A 1HSJA 3HRMA 1ON2A 3CUOA 4A5NA 1KU2A 1YTYA 2LSOA 2O03A 2VT2A 2R7DA 4HOBA 4XLNF 1MDMB 2MLKA 4HW0A 4G8XA 5J8FA 4U0WA 2D2WA 4LFUA 2UWMA 3DEUA 2ETHA 4LB5A 1KQ8A 4HAMA 1ZG5A 2DBBA 3QPHA 5D6FA 4OIRF 2ESHA 4F7ZA 4UXNA 1IRFA 3WGHA 3DF8A 3FXQA 2VOPA 4HF2A 4UVAA 3WE2A 3DV8A 2P4WA 3FF5A 5HS7A 1KQ9A 2NNYA 1FBSA 3HOSA 4ENKA 3W6KB 2C6YA 2FBIA 3U9GA 4IF4A 2FA5A 2HFHA 1KQ0A 1YS6A 2DLLA 4RB3C 3VODA 3KZZA 4U7DA 2HTJA 5K5QA 1ZHFA 3HSRA 1IXCA 3F8NA 2HQRA 2RN7A 1BN5A 3E5QA 5L3GA 2OZUA 4A6DA 2P5KA 3V8KA 2BE5F 4EVIA 1GHCA 4N9HA 2MBFA 4ESJA 4PGGA 4NB5A 5IT9Z 2PFBA 2QM3A 1R58A 4I0BA 3DXJF 4OMZA 2WV0A 2JPBA 3F8BA 3FXUA 2F5DA 1LDJA 2FE3A 3I59A 1QGPA 5JVTA 3L7WA 5FB2A 1U8RA 1QNTA 1Z1DA 2WC2A 4L9JA 4L5JA 4M73A 2K7LA 4XSZF 1TTYA 2G7HA 2L01A 4L9TA 1HKQA 1BIAA 2VXZA 4RB2C 3E6BA 3FM5A 3KFWX 2ZBKA 1B9MA 3GFIA 3K1PA 3BJ6A 4EJUA 3HHHA 4GYIA 5FGMA 5HLIA 3ZMSA 4EGZA 1FP2A 1X3UA 3EETA 3TO6A 3F72A 2XV4S 2IA1A 2IP2A 3REOA 4MHGA 2M45A 2DK8A 2HWVA 2O61A 2OA4A 4A0YA 3P9IA 2FF4A 3O3KA 4M74A 5TJJA 5D4SA 4CZZA 1UCRA 1S29A 3RJPA 3R60A 1BC7C 3MQ0A 1T0FA 4OIPF 2ZXJA 4IHTA 3WTYC 4EQQA 4KIGA 2V9VA 1HXDA 3BZ6A 1F1ZA 4IHSA 1BIBA 2RC4A 3KP5A 2JZYA 4N0BA 4BAYA 3IKTA 2PLYA 5D5XB 2GA1A 2QZ8A 4JBAA 2JRTA 4HDUA 3CJNA 2GXBA 2Q2EA 3P9KA 4CDGA 3BWGA 1DPRA 4AIKA 4UUVA 4DQ2A 1IAWA 1FBQA 4CYDA 1AOYA 5LGTA 5E1XA 4Q5SF 3ABTA 2FSWA 4P9UA 2YR2A 4EM1A 2VN2A 1UHWA 3E5XA 1PDNC 4U88A 2ACJA 3C3WA 3L9FA 2STWA 2A6HF 3IC7A 4KMFA 1PP7U 1MKMA 4RB1A 4HYEA 4KUMA 4I02A 1RZ4A 4HX7A 1PP8F 3ZMZA 4EM0B 3CUQC 3LA7A 4ZYEA 1T38A 4YG2F 4OINF 5LGUA 1XB4A 2DQLA 1ZN2A 5ICCA 5LRRA 1TW3A 3DKWA 1S3JA 1SFXA 2P7CB 2FOKA 5ILUA 5H6QA 2FNPA 4B8XA 1R23A 3ECHA 1CF7B 3HSFA 4G94A 1ZG3A 4IPAA 2KIFA 2Q0OA 5F1RA 2P5LC 3U2RA 2YPRA 2D1HA 3H3UA 3R6SA 2F5FA 4I09A 2ISYA 4PGHA 5IT3A 2FXAA 1ON1A 1QQIA 4KT5C 3Q9VA 1LEAA 3LSTA 1J2XA 2VOOA 4IJAA 1W5TA 4EJOA 4KYWA 1EH7A 4UVBA 2W57A 1J0RA 3KZYA 4XSXF 4IRGA 2FU4A 2MH9A 1EH6A 1SFEA 3N97A 3S2WA 1U5TC 3MEXA 2HYFA 1BI2A 3L00A 2Z9OA 2YX7A 4XBFA 1RUOA 2ZMEA 1MJAA 2STTA 4OOIA 3RPUA 1SMTA 2Y0MA 3CO7C 5LHIA 3BJOA 4HLYA 3W6JB 1R36A 3RYPA 1O7LA 3I0TA 5LBQA 2VONA 2MC3A 3ERED 1LVAA 5F6FA 2H27A 1UFMA 3ZMVA 2WWYA 2DK5A 4ESFA 2D1VA 1T39A 2KKOA 4M72A 1Z9CA 4ESBA 5KVRA 5ICEA 5DD8A 3ABUA 3EUHA 1MZBA 1J9IA 3DQVC 3GUDA 1P92A 2W25A 2QLZA 4HQEA 3E6MA 3WTSC 3GX4X 1IN4A 4KMUX 3ZMDA 3WU1B 1IUYA 5K5RA 5L3EA 5DDGA 4UV9A 5JFRA 2HOEA 2K4BA 4P5OA 1T2KA 3VB2A 2XVCA 3BPVA 4BYYA 4BNCA 3KLOA 4XLPF 4EJTA 4A0ZA 2XAFA 2DTRA 4ASNA 2OBPA 2EFNA 3BJAA 3TQNA 3D5LA 3J81Z 3LWFA 4L18B 5BPDA 2IW5A 1YW9A 1B9NA 3MZHA 1GVJA 1LEBA 2FMLA 3U1DA 3TKYA 5LGNA 1XDUA 4B09A 3QOPA 1UHMA 1EV7A 4L0YB 2RNJA 3RDIA 1KYZA 2JPCA 5LRSA 3QP6A 4ZZLA 4RB0A 4MTDA 1HW2A 4IRIA 2X4HA 2RV8A 3BY6A 1Z91A 3IWZA 1J75A 1JXSA 5DUKA 2HGCA 5D4RA 1LQ1A 2GXGA 1YLFA 1R1VA 2QBYA 1ZAOA 3F6OA 3HRUA 2YX4A 5EEHA 2GZWA 4YFXF 1YFHA 3WTVC 3COAC 5BMZA 5FFZA 1FYKA 4A5MA 1FWZA 4YIFA 1BBYA 4Q47A 2P8TA 5HLGA 3ZN1A 1IZ1A 4UVCA 3ZQ7A 4MTEA 1R22A 3C18A 4KIBA 5CLSA 1CGPA 4LB6B 3J80K 4Q4ZF 1IRGA 4P9FA 5E1ZB 1J5YA 4L9NA 3IWFA 4U0YA 3DFGA 2PJPA 1F4KA 2A07F 1LB2A 1Q1HA 2PMUA 4LGWA 4M71A 1F5TA 3TO7A 5CVIA 1TW2A 1O3TA 1F9NA 3M8FA 2B0LA 2IA2A 4EGYA 2XAJA 3WE3A 2J5PA 4CHUA 3O2PE 3LQQA 3GFLA 3F23A 1OYIA 3NQOA 3I53A 3GZ6A 3ECOA 4BHPA 1R00A 1B6AA 2R7FA 4KN7X 1DP7P 3IRRA 2BBYA 2O0YA 3MAJA 3HUGA 3F8MA 4CGZA 2MLGA 2XKOA 4QWQA 2H09A 3P7NA 2DT5A 3LA2A 3ELKA 2PI0A 1USTA 1PUEE 2MH2A 2XROA 2Y48A 4A2UA 2CQKA 3TGNA 1ONVA 2GQQA 3HTSB 3KLNA 3M1EA 4HA8A 3KP7A 4O3MA 1USSA 4UNOA 3LAPA 3HYIA 3RYRA 3FMSA 1HQCA 4PDKA 5HDGA 4YIIA 4NQWA 2EFWA 1QBJA 2MD5A 3VEPA 5BPIA 2A61A 3MFKA 3V8JA 5DYMA 3K1NA 4ENJA 5DCFA 1YQAA 3DPLC 3ULQB 3L2CA 2DAOA 2ISZA 1ZGAA 2H6CA 3TOBA 2NS0A 1T6SA 5FFXA 2LF8A 1UB9A 2K27A 1W5SA 3PQJA 2XIGA 3QPTA 5HDNA 3ZP5A 2OD5A 1D3YA 3MZYA 3R61A 5HVQC 1ZRCA 4KNYA 3PFIA 2QWWA 4ZH4F 1OYWA 4AIJA 2DFIA 2IPQX 3M7GA 4BHBA 3DPTA 4DNCA 1Z05A 1I1GA 1I1SA 2QENA 3ROUA 3T8TA 4G7ZF 1XSVA 5DCMB 2D45A 3HOTA 3QRFF 1E17A 3Q5FA 5FD6A 2QUFA 3K2ZA 3KP4A 1JHHA 1IF1A 3CO6C 1O3RA 2DPUA 2RDPA 5HS9A 2M30A 2HYGD 4OMYA 1FZPB 4HBLA 3GLXA 3LAJA 5ICGA 5K1YA 3V7RA 2XGXA 2XKPA 5DV5A 4ENNA 5D5WB 3RIRA 3F22A 2Z3YA 4G9YA 2V1UA 3WGGA 3KP6A 3D0SA 2QBYB 1LDKB 1C0WA 1KYWA 4LJZF 2NNNA 5D6EA 3T8RA 5BS6A 4M6YA 2CFXA 3C1DA 3J81K 1H9TA 2UXNA 5E8GA 3ZPLA 1S7AA 1DPUA 3GYHX 3JW4A 3I4PA 2CW0F 4K2EA 3BPXA 3F3XA 2BGCA 4MQVA 3SFZA 3JSPA 5ILSA 2NRAC 2YU3A 4LG0A 3E3VA 1Z7UA 1W4MA 2DU9A 2PBIA 1IN8A 4I2OA 1D8KA 2L4AA 2BV6A 3LFKA 1HKTA 2IVMA 2FNAA 5D8KB 4G6DA 2TDXA 4WWCA 1HBXG 1TNTA 2EV5A 1A04A 4GO1A 3F21A 1O57A 4ETSA 5F64A 2A69F 3BP8A 1XMKA 2L02A 1FC3A 1XD7A 3T5XA 4OIOF 1FSEA 3K1MA 5FO5A 2VBXA 4RGSA 2W85A 1SD5A 1MGTA 3T1BA 3SZPA 3HRTA 1TLHB 1FX7A 3KE2A 5CVUA 5D8LB 2F5CA 1R7JA 1WI9A 4ZYDA 4O5VA 3ZN0A 5L3FA 1FP1D 2KJCA 2PEXA 2EJRA 3J80Z 1ZRDA 3RKXA 2L4MA 2UZKA 3JAMZ 3E97A 1ZYRF 1SMYF 3FZVA 4EM2A 2PQ8A 4LLNA 2EA2A 1D5VA 2XRNA 2EFQA 1FT9A 5ICFA 3VFZA 5CVVA 1STZA 2KRFA 3SXYA 4FT8A 4R8HA 3GF2A 1R1TA 2OU2A 3OV8A 2Z33A 1QZYA 3G73A 1KU9A 3EYYA 2RGVA 3PQKA 1ZREA 4HLXA 2LNBA 3IRQA 1RUNA 1XCBA 1LNWA 1DDNA 5DD4A 3TDUC 2VODA 1FOKA 1KU3A 1R1UA 2COMA 1OMIA 5E17F 3VOEA 2K4JA 3JTHA 4HQMA 5CYVA 2DPDA 1FYLA 5ED4A 1XGMA 4Z2YA 1Y0UA 2M87A 3V4GA 3K9TA 2EFOA 2VT3A 3GO5A 1ZLJA 3RKWA 2XHKA 2MA3A 3M8EA 2FBHA 1WWXA 2HKOA 1YO5C 3F6VA 2L54A 2VBYA 4RGXA 5J6XA 2EB7A 4EV0A 4QLCU 5E8IA 1AWCA 3MWMA 2IJLA 1MD0A 4A0XA 4ON0A 1BI0A 3F8CA 1RIOH 1IXRC 2RQPA 1LJ9A 4CO8A 1SD4A 1G3TA 4YFKF 1YG2A 1U78A 5BOXA 2BEOA 1SD6A 3QU6A 5L3DA 5FLXZ 2W84A 3EYIA 2L3DA 4N9IA 5H6RA 2V6CA 2F5EA 3FM3A 4WCGA 1OYYA 2V1DA 2ZCWA 4O6JA 5JI6A 3IL2A 2VE9A 2VC1A 4IVNA 2ZFWA 3WTTC 1P4XA 4HF0A 3QAHA 2QYOA 2RKHA 1FPQA 3GZ5A 3M9AA 4E70A 2ZKZA 2CYYA 4RAZA 1BOAA 2Z99A 3NEUA 4S05A 4M9ZA 3HSEA 1XGSA 2JT1A 2HS5A 1J59A 2DW4A 1S8NA 4H0EA 4S04A 4HV6A 4LLLA 4BH9A 4UV8A 1NHAA 3R0JA 1G3WA 2HDCA 3ISPA 3RPQA 3ZMUA 5CJ9A 2E1CA 1G4DA 1CF7A 4Y17A 2AXLA 1OKRA 4GCVA 1W7PB 4IRHA 1YW8A 1B4AA 3SZTA 4KDPA 3I59B 1WSUA 3WTWC 5EEGA 2A3SA 3I58A 4L0ZB 4L5IA 3I71A 2R3SA 3E5UA 3E6DA 3KP3A 3G3ZA 3L09A 4HX4A 1BM9A 2IRFG 1JHFA 1REPC 4A6EA 3C7JA 4TV7A 2DI3A 2XAGA 3BOQA 4KA4A 1WKMA 4BXUA 1WRJA 3DP7A 1E2XA 2FEZA 3KP2A 4I01A 1ULYA 2NYXA 3GXOA 2EK5A 4WXDA 5J8CA 1B1BA 4FX0A 5HS8A 2GA2A 4PCQA 3JTGA 1L3LA 3R4KA 2QQBA 1G3SA 4KIFA 1O7FA 1XSDA 3BDDA 4NHJA 5LHGA 1I6XA 4MNUA 3CTAA 3JAMK 2P6SA
chains in the Genus database with same CATH superfamily
1OQYA 2DA1A 3C2BA 2HOSA 2FUG2 2KLOA 3CDLA 2Q8KA 2LRSA 1K79A 1N25A 3OYEA 1XMAA 2WB1N 2CS3A 3ZQIA 3OYMA 2HKXA 3CUQA 5D5VB 4Y13A 4LK1F 3V42A 1H89C 1OR7A 4U87A 1ODDA 2AS5F 1QHGA 5HNFA 1R49A 2MDGA 2EA4A 2QF7A 3HIFA 3E6CC 1YRNB 2EPOA 2V85A 4G7OF 1O3QA 3CCUI 1T4NA 3AKZA 3DU5A 1FBUA 5KK1A 1ZG1A 2V7FA 2Y75A 2EFPA 5DEQA 1HF0A 4RGUA 2W7NA 3CDIA 1YJNI 3LQRA 2Q2EB 2PRTA 1X1AA 1V5GA 3I54A 3L1PA 1FYMA 1QZZA 3H5AA 2K3PA 3FK7A 3GVAA 3GW2A 2GOMA 2BHZA 2RQQA 1MMAA 3VYTB 5IPAA 2NVYJ 4AWXB 1ETXA 1GZ6A 4B44A 3TO9A 2VASA 4DV0E 3WODF 4LK0F 4J00A 1YYKA 3OOPA 1ZGWA 4OX9E 2ADUA 1Z6TA 3BQZA 2P7VB 2DO7A 3V7CA 4A93J 2H1LA 3BROA 2GAUA 4OU0A 1Z67A 2EMWA 3HKZA 2EWLA 4CCJA 4RM3A 3EDPA 2CTDA 3O8GA 4FK5C 1HSTA 1R4MB 2HVRA 2JPAA 2Y0SA 4RAYA 1LE8A 2KMUA 1ITYA 1XCVA 2LK2A 2QCOA 1YW7A 1XGOA 2E1NA 4DV3E 2KFDA 4NUBA 2ICWG 4ZZDA 4J19A 3F9KA 5B3SH 3CP8A 2H36X 4AQYE 2YRMA 4M9XA 5AIPA 2CG4A 1KU7A 2OJED 1XMQE 1A36A 1IW7F 1RI7A 4MGRA 5ILVA 4F52A 2WCC3 4DBRA 2YWQA 3PUBA 1V5FA 3IH2A 1BI1A 2HDDA 1MJ9A 3S32A 5J4YA 3JSOA 3I55I 5M5YJ 4IZZA 1XX5A 3CDHA 4BXFA 1QU3A 1B72A 3DTKA 1XSXA 2DFFA 1YIJI 3KETA 2F5VA 3LFUA 5AE3A 4S0HB 3FMQA 2LTRA 4I98B 4IOCF 2F4VE 2VJ4A 2LOOA 1MDMA 5FLXK 5HLHA 2VE8A 1IN5A 4UUSA 2XRLA 2EIKH 5E20A 1D8JA 1VFCA 5M3FJ 5H20A 2VBWA 5E1WA 3FXRA 1BC8C 2JTVA 4EJWA 1FEXA 3ECRA 1ZARA 3PM1A 1B59A 1I3QJ 1YYVA 2I8DA 3T1YE 4R8OA 4M3BA 2QKMB 1HNWE 1U6GA 3K69A 4R1HA 4BY7J 4BQAA 3JU0A 4MLQA 4Y15A 1TQMA 5AONA 3TW7A 2X0LA 2EMIA 1K78A 1SAUA 2VC0A 4FX4A 5IOZA 1I27A 1WCMJ 4P55A 4LF4E 3VSKA 4B3XA 2V1XA 2XAHA 2PMHA 1K78B 4PJJA 2YTEA 3CF2A 1MBHA 1RETA 1Z7LA 3I56I 2ODRD 1YIOA 1T4OA 2A68F 4WK8F 2CW8A 2EIMH 4A12A 1NK3P 3WGIA 4C3HJ 4LFAE 5HOOA 2LKSA 2CSOA 1NG6A 1U5TB 1MBFA 3HHGA 3BG9A 1U2WA 4YELA 1ERDA 1TQPA 3UR3C 4M6VA 1GT0C 3H9JA 4QSHA 1OJLA 1RKTA 1D0ZA 1QPMA 2QQAA 4L9VA 2Z16A 4ZDLA 3QWLA 2YRKA 3ASOH 2IBDA 1YX3A 3PO3J 1FIPA 3QP5A 4NXNE 3SHFA 3HTUA 5DS9A 2BYVE 4LF5E 1YSAC 3I5UA 1P9QC 2VI6A 2ZMEB 2ELJA 1X4PA 3EUHC 4LG0B 5CVJA 1I5ZA 2HQNA 3KEOA 3U1KA 2M1BA 1K4TA 1BJAA 4I6ZA 2CO5A 3FMRA 5FJ8J 1T8IA 3HOXJ 3WU0A 4AVPA 1PUFA 2EMKA 1Y1VJ 2FRHA 1VF9A 1VTNC 2EZHA 2M7QA 4HX8A 2M4GA 3JRDA 2G9WA 1RR8C 4DW6A 3CCEI 4I7HA 2LY9A 3RTRA 1IN6A 3F8FA 4GXOA 2CWEA 3GFMA 2I10A 2ESNA 2XUBA 1KYQA 4EMSA 2M0CA 1IBKE 5JR3A 3QODA 3OYFA 2HQ5A 4XLHA 3Q9SA 2V79A 1GXPA 1RPWA 2NA2A 4NZVA 1LFBA 4X66E 3ABMH 4WX9A 3HZJA 3TP3A 4DR1E 4XMYA 1H9GA 1LKXA 4U0VA 5A2QZ 1FJLA 1N3GA 3FKJA 4QPOA 4IKFA 2HEOA 4XOPA 2YRHA 3B73A 2HTSA 4E7LA 2FBKA 4X64E 4FHTA 2YU5A 2E1MC 2B63J 5FLMJ 3RI4A 3DWLE 1T98A 4LF9E 2KIMA 3Q0VA 3GLLA 4Q48A 1D1BA 2V86A 3D5RC 4E6KG 2IS4A 2K02A 1P6RA 2HR3A 3N4MA 2LR8A 2JVGA 2WADA 3LMMA 1X6EA 2N3HA 3C4BA 3ZQCA 2ECCA 4DIQA 3ML6A 2L2OA 4D1QA 2EH3A 2EZLA 4LF8E 1WQ2A 3DLAA 1W7PD 2OQRA 2ELYA 3P9CA 2R93J 2RQLA 2JJ7A 1IRXA 4JI5E 2EV0A 2X6XA 4LMYA 1FIAA 4F55A 1R9TJ 3BCAA 2XSDC 3HOZJ 5F0CA 2VBZA 3BLYA 4M3FA 3MCZA 2E2IJ 1AHDP 3S2DJ 2LDUA 3ADLA 5IP9J 1SFUA 2L7ZA 3A01B 5A2QK 3KYCB 1NK2P 4ITVA 2Z5UA 4HZFA 1O3SA 1RNLA 1U5TA 2ZO4A 2EPFA 4M9SA 5IT9K 4WF2A 5IY5H 1H0MA 3GTPJ 2H94A 3THOB 3SQNA 4GKKE 4M3GA 4HPQA 2EOJA 1LDDA 1XN7A 4E7IA 3AAFA 5FKKA 3CESA 2DQRA 4V2GA 2DFEA 2ZNYA 4UUSB 3HL2A 3NRVA 5M3MJ 3I3LA 3FDYA 2E2JJ 2YTJA 3JRAA 3QYBA 1ZRFA 5E3LA 3S1RJ 2R5YB 4PFPA 2NUEA 4GYGA 4AC0A 4XKCA 1J7KA 2DCEA 3LSGA 1UELB 3BR2A 4CCMA 2LF7A 2EWNA 4DV6E 1JUPA 1P4WA 2RVCA 5D5UB 2HOTA 2BXZA 2HU9A 2FQ3A 2YSOA 5EZGA 4F6MA 1GXQA 1W7PA 3LLHA 2DT7B 2LJUA 4JYAE 1T33A 3ADJA 4NQWB 4X8WA 5F1JA 4TUIA 2JUCA 5EG0B 4B3ME 3T1HE 4XK4A 3L2WA 3OR1C 1JKRC 1FLIA 3EPJA 3IH4A 4M6XA 3J7YJ 1U8BA 1ETWA 3H0DA 3VHTB 1G8XA 2CQNA 4D7NA 4P7DA 1BI3A 2Y2ZA 1ZLKA 3V8LA 2ZJRF 1A6QA 2E1MA 2ZFUA 5F27A 4XRFA 1V55H 3RMPA 2O8XA 3L2UA 2M34A 3ZXSA 2QEXI 1FSHA 3D5SC 4ABZA 2X1CA 2J5OA 1HR0E 1MBKA 4ZYGA 3PNVA 4CICA 2O6GE 2G7UA 2L2KB 2Y9YA 4ZYHA 4BJTA 3S17J 2K3FA 2O3FA 5LEKA 2HXIA 3CP2A 5LEJA 1HLVA 5J47A 5K7FA 1X47A 2EMCA 4NXME 1YOVB 2NAZA 4MEXF 2VIXA 4FASD 5TRDA 1HW1A 2CGPA 2AXTC 1N33E 1FJGE 2LP0A 3PL8A 2F4IA 1Y0NA 2HDWA 3HEFA 2DGCA 4UB6C 2P6TA 2EPCA 1MBEA 4LLGF 3CCQI 1XPXA 6PAXA 3Q0UA 2BY2A 5LLQA 1GUUA 3KEQA 1S5LC 1KA8A 1V3FA 4CXFA 1V4RA 1TBXA 4JK1X 3JCUC 2EV6A 2TRTA 4B48A 4M30A 3S3OA 2QVOA 4WXHA 2O5RA 1S6LA 5LHHA 4IO9F 3F0CA 2MDRA 4KN4X 4O5GA 1AKHA 2ZMEC 4RGRA 3HG9A 5KAFC 2PN6A 4MEYF 1ZK8A 4GGGA 3R0AA 3MVPA 1ZGJA 2M8EA 2KJBA 2Z1DA 3BTCA 3CLOA 1OPCA 3FX3A 5AC5A 3ZQLA 4AD9A 4AIHA 4GDFA 2A6EF 4YFNF 2ZNZA 2HZTA 1K6OA 5DUIA 5A6JA 1TQIA 3C2GA 4DR2E 5L3CA 1SAXA 1SANA 4HSRA 2XF6A 2YSRA 2LKPA 3WTXC 2XAQA 1TL8A 1FNNA 3J81C 1MSFC 5LFAA 3HQ1A 5BQTA 2IT0A 1U3EM 2M5WA 3J7AO 4G6QA 4PZJA 4AUXA 2OZ6A 4IJDA 4IL6C 1MSEC 5FKOA 3B02A 3OYCA 2K40A 3CC4I 2A5YB 2LC2A 1F2IG 2OAZA 3FIGA 2WAFA 4U7BA 4HV5A 4LG3A 2DTZA 3ZQQA 5IYCJ 3OS0A 3J80C 3LSKA 2IA0A 3KCCA 4RAFA 3OYGA 3HJEA 1JTYA 4HDVA 3IKVA 2ENCA 1Z6RA 4LD5A 3HM5A 1YYWA 4OAYA 4EJVA 3WTUC 1HKSA 4II3A 1XDSA 2LVHA 2UXXA 3OIPA 1PJQA 2PG4A 2NUFA 4UHTA 2WAQA 4KFCA 2LUQA 1WJPA 4D0PA 1L0OC 2GWRA 1GDTA 4I76A 1EH8A 2EMYA 3WU2C 2CSHA 2JA8J 3GEZA 1ZH5A 2R7QA 2XASA 1IN7A 4KITB 1X6HA 4P96A 4X1EA 2Y30A 2CFOA 4BE0A 4JI0E 3MKZA 2VQGA 3AFHA 5L3BA 4WXCA 1KGSA 3TOAA 3HOYJ 2ELHA 1FTTA 1OCCH 5EJCA 1JJ8C 2LRDA 1JGSA 2ZM6E 3BCBA 4MQ9F 1P4AA 2N3GA 2FJ1A 1HW5A 1FY7A 4BU2A 3HRSA 4PFOA 2WTEA 2GIVA 5CVRA 2DFHA 2E7XA 2EP3A 2V6EA 3T0YA 1R5HA 2JSCA 3WG9A 2EMFA 2EOFA 5KL5A 5AIQA 1EKZA 3HKZN 1K7AA 2R7UA 1JUMA 1ZKGA 2NOJB 2VKVA 2L6MA 4IQ4A 2VQFE 4M9VC 3GWZA 3KPHA 3IP4B 4I0AA 2MC5A 3KYDB 1MBJA 3H9QA 1E3OC 1TT5B 1WPKA 2WA0A 4KICA 5J3LA 2LY1A 1P2FA 2VQCA 1G3YA 3WTZA 4HTGA 5HODA 2HHHE 1TNSA 4G7HF 3DPUA 5ERIA 3GFJA 2YZTA 3QQAA 2ZJ2A 3V7SA 2FMYA 4LITA 2VXDA 3FXKA 4A3KJ 3BTIA 2O8KA 1XGNA 1MJBA 3K70C 1GTKA 4HF1A 5K5OA 5C4JJ 3H3VK 3H3ZA 4BHCA 3RKYA 4IHYA 1YS7A 1YE9A 1SVLA 3HC7A 5HDKA 3IHUA 1W36C 2E7WA 2L9SA 4ENMA 3LSIA 2BHYA 1JE8A 2DOFA 3SDGA 3ZQGA 4DR3E 2R7SA 4JI6E 1YYOA 3FIWA 5FD5A 2QQ9A 3PJRA 2JR1A 1WXRA 3FHZA 3OS1A 4HSTA 4B3AA 4R2EA 3EQLF 2NVQJ 1XG1A 2EOIA 2DMUA 1MW7A 4JYKA 2OCCH 2W82A 3FWEA 2L0KA 2B3TB 4RA2A 2DN0A 1BB8A 3K0LA 3I64A 5KAIC 1PKPA 4NC7A 3O6BB 1R5GA 3TDZC 1SD7A 2HQAA 1QO0D 1T0FC 1IXSB 1TT0A 2LG4A 2XPVA 4MIMA 3ZMTA 4AYBA 5JHUA 1DUXC 1EJ9A 2KIUA 1QHHD 4IXAA 4OIQF 2JOXA 3LA3A 2L2NA 2H6BA 4JQFA 5DCMA 4HEIA 1BOBA 5A6KA 1G6NA 2F2EA 2WAQN 4PSWA 5E18F 1POGA 2W24A 1SC7A 1QU6A 4R79A 2K86A 4CA0A 4CCKA 1UG0A 1ZAAC 4KISA 3CUQB 4RS8A 4BY1J 2DJIA 4YY3E 2OQGA 1S7OA 2L2MA 3H92A 1IO2A 1PJRA 2P5VA 1E3PA 2YTIA 3QU3A 2F8BA 1HSJA 3HRMA 4XIDA 1ON2A 3CUOA 2B7EA 4A5NA 1KU2A 1YTYA 1A31A 2PJRB 4PK4A 4D7MA 3H09A 2LSOA 2O03A 2VT2A 2R7DA 4HOBA 3LNQA 4BBYA 3I4MJ 4JP0A 4XLNF 5A6BA 1MDMB 1A1LA 4A3EJ 2MLKA 2EN4A 4HW0A 4QPQA 4G8XA 3FXLA 4D5CA 5J8FA 5LL6R 1DQUA 4U0WA 2D2WA 4LFUA 1XS9A 2XF7A 1S9HA 3DEUA 2UWMA 2ETHA 3CF5F 4LB5A 1KQ8A 3M4OJ 4HAMA 4I99C 3L2RA 2J7JA 2EPPA 1ZG5A 2MD0A 2DBBA 3QPHA 1TZLA 5D6FA 4OIRF 1Y56A 2ESHA 3KWRA 5CQEA 4F7ZA 4UXNA 4Q35B 1IRFA 2M8GX 3WGHA 2DB2A 3DF8A 3LMLA 2K9NA 3FXQA 2VOPA 4HF2A 3O8HA 4UVAA 2ZSIB 4BUPA 3GMEA 3WE2A 4KJZA 2M1SA 3DV8A 1UG2A 1X3WB 4N4NB 3C4TA 2P4WA 2EOQA 1R4NB 3FF5A 5HS7A 4JI2E 1KQ9A 4YEJA 4BQQA 2NNYA 3G2BA 2R5ZA 1FBSA 3HOSA 4ENKA 2B9SA 1K4SA 3AG2H 3W6KB 1RC9A 2C6YA 1X49A 4NC8A 2BZTA 2FBIA 3U9GA 2QSGX 1OFCX 3VWBA 2DMYA 2EOMA 4IF4A 3DBRB 3H0GJ 4PUSA 2FA5A 3HB9A 4F2JC 2HFHA 1KQ0A 1YS6A 2DLLA 3CCSI 2LKXA 4FE7A 3IWCA 2EMZA 1SEUA 3FXOA 4B1RA 2YSPA 4F6NA 3MKLA 2LBSB 2YTPA 3J7AY 1WZ2A 4RB3C 4E7ZA 1F43A 3W2VA 3S15J 4ZYAA 2MC6A 3TEDA 3S1QJ 3VODA 3KZZA 3HXLA 2IGOA 2R7OA 4U7DA 2MGQA 2HTJA 5K5QA 1ZHFA 2OTJI 3HSRA 2EPKX 4MO7A 1X19A 3BZKA 3FISA 1VQ6I 2OF7A 5TISC 5IYDJ 3E0JB 1IXCA 1VQ4I 2YU9J 3F8NA 2HQRA 4L5NC 5IV8B 2RN7A 5GPCA 4LTYA 1BN5A 3E5QA 4XNFA 1RC7A 5L3GA 2OZUA 3K4MA 4A6DA 2DYRH 2P5KA 2BE5F 3A1YA 3V8KA 4AVZA 4DZPA 4EVIA 3CCLI 2H1KA 5LMNE 2EPZA 1GHCA 3KZIC 1TWCJ 3K4CA 3JRCA 2KOUA 1MH4A 1XC5A 5E79C 5KHDA 4CCLA 2EINH 4N9HA 3J7AG 2Z2SB 2MBFA 4MFEA 4ESJA 4PGGA 2YPNA 4NB5A 5IT9Z 2MC4A 3KEYA 5M5XJ 2EQRA 1K6YA 2EOYA 2PFBA 2VJIA 4DYCA 4ZDOA 3OS2A 4D9JA 2QM3A 5EZHA 1J26A 1R58A 4I0BA 5H2FC 3DXJF 4OMZA 3ZQHA 2ME6A 4HNTA 1IGNA 2WV0A 3SZGA 3WHCA 2JPBA 3F8BA 1NH3A 3FXUA 2EQ1A 3A0HC 3MHHC 2JA2A 2F5DA 1UBDC 1LDJA 2FE3A 4AM3A 3I59A 1OCOH 3OYNA 1QGPA 5JVTA 3NWTA 3L7WA 2IXSA 5FB2A 1U8RA 2RPCA 1GLNA 1QNTA 3OL4A 5B66C 2G0EA 1Z1DA 1UZCA 2WC2A 4L9JA 4L5JA 4M73A 1SFOJ 2RREA 2K7LA 4XSZF 2F4MB 4IQJA 1TTYA 3W6VA 2G7HA 3S8PA 2L01A 4L9TA 3MKWB 1HKQA 1BIAA 3K4KA 2VXZA 2LMZA 4RB2C 4ZTFA 2EOZA 3E6BA 2GOXB 2VRDA 2R5YA 3FM5A 3KFWX 2ZBKA 4W97A 2JWOA 4X6AJ 1B9MA 3GFIA 1X1DA 1D1AA 5F3WA 2JA5J 3CC2I 2EM7A 1JK1A 1VI0A 3BZCA 3K1PA 4XL9A 1MMSA 3BJ6A 4EJUA 2ZJQF 4RH8A 3HHHA 4GYIA 5FGMA 5HLIA 3ZMSA 2EM5A 2L7MP 4EGZA 1FP2A 1X3UA 1ORKA 3EETA 3F72A 3TO6A 2XV4S 3DU6A 2YUSA 2IA1A 2IP2A 3REOA 3HGGA 4H4KC 4MHGA 2CPNA 3AV0A 5A2QC 2M45A 2W00A 2DK8A 2BVLA 2JUGA 3OOUA 2HWVA 1IV6A 4GFBA 2O61A 2OA4A 2OCEA 4A0YA 4DYQA 4JX5A 3P9IA 1MNMC 2PX9A 3C2HA 2WBSA 2FF4A 3O3KA 4I8OA 4M74A 5TJJA 3CMEI 1WHNA 2EZKA 2KZVA 5D4SA 1YITI 2ID6A 4C3JJ 4CZZA 2R7VA 1UCRA 1S29A 3RJPA 3R60A 1BC7C 1GV2A 3MQ0A 1T56A 4A3CJ 1T0FA 4OIPF 3G1LA 3HOVJ 1DU0A 1IRZA 1Q1VA 1D0XA 4NDLA 1UAAA 1L4SA 2ZXJA 3ONQA 4JI4E 4B3RE 2KDZA 2DYSH 4IHTA 2HXOA 3K10A 5F08A 4EQQA 3WTYC 2LFBA 4KIGA 3E1SA 4XRSA 3QPSA 4P1WA 5KL4A 3G1MA 2V9VA 2EOOA 4Q28A 2JP9A 2B7TA 1HXDA 5GADJ 1APLC 3BZ6A 5K7HA 4BE1A 3FBNB 1LE8B 5IP7J 2K9QA 1R6RA 4FQGA 1F1ZA 2KPMA 5FLVA 1UHZA 3H5RA 3OYHA 5HNHA 4JI1E 4DV5E 4IHSA 1BIBA 3JREA 2DODA 3GBGA 4WFTA 2CMPA 2JWTA 2RC4A 3KP5A 2JZYA 2R0QC 4C9YA 4N0BA 1OR7C 4FISA 4BAYA 1WH5A 2HVSA 4DYRA 4W1UA 1PDAA 2K9LA 2JQ7A 3GCMA 2AO9A 3IKTA 2PLYA 3JAMC 5D5XB 2GA1A 2QZ8A 2X1DA 3M8JA 4R2QA 4JBAA 3EPHA 1MNEA 2FX0A 2JRTA 3RQ4A 4IHXA 3VYXA 4HDUA 3CJNA 3OYBA 1BL0A 1A1FA 3MKYB 3G1OA 2GXBA 2B7VA 2Q2EA 3AG4H 4M2ZA 3P9KA 4CDGA 2KT0A 3BWGA 3BR6A 1HDDC 1DPRA 4AIKA 2YT4A 4D5FA 4UUVA 4DQ2A 2CV0A 4MFDA 1DU6A 1IAWA 1FBQA 4CYDA 3VYYA 1AOYA 5LGTA 2E1OA 2EQ3A 5E1XA 1U9NA 4B47A 3ABTA 4Q5SF 2VPRA 2CV1A 5IT9C 1HDPA 2FSWA 3S16J 1A35A 4P9UA 1X2MA 2YR2A 4EM1A 2W48A 2R7XA 2NOGA 2VN2A 1UHWA 2KHMA 1RESA 3LSRA 3E5XA 4FE4A 3DEEA 1TP4A 2E34A 1PDNC 3TW6A 4U88A 5K7ZA 1UN6B 3DBHB 2ACJA 2X6YA 3C3WA 3L9FA 2STWA 2EL5A 1K83J 2A6HF 3IC7A 4KMFA 4AIDA 1PP7U 1MKMA 4RB1A 1A1KA 3WHBA 3DEWA 2IEKA 2VL8A 4HYEA 2LD5A 4KUMA 1IC8A 4O43A 3E7LA 4I02A 5GAHJ 1RZ4A 4HX7A 1O0WA 1PP8F 5EG0A 1S72I 3ZMZA 4EM0B 2VF1A 3CUQC 3LA7A 4ZYEA 1T38A 3BT9A 4XLAA 4YG2F 3OTOE 4OINF 3CC7I 2XGDA 1VQ7I 3A03A 1HOMA 2Q1ZB 4R2SA 4DMIA 2UU9E 5LGUA 1XB4A 2LLKA 1MBGA 1K61A 1W1WE 3K70D 3FXMA 2UXCE 4LU9A 2DQLA 1ZN2A 5ICCA 5LRRA 4V19K 2EL6A 1TW3A 1UMQA 3DKWA 2NVUB 1S3JA 5J1RA 1SFXA 2EBIA 2P7CB 4IOAF 2Y69H 2FOKA 3QPLA 4YRVA 4EATA 5ILUA 5H6QA 2FNPA 1LVKA 4B8XA 5EGOB 3OYKA 1R23A 2JVHA 3HOUJ 2DSYA 1MNDA 4F54A 2EL4A 3ECHA 1DI2A 2HGHA 4M3DA 1CF7B 3Q0WA 3HSFA 3BR0A 1DQ3A 4G94A 3VYSB 1ZG3A 3BGHA 4IPAA 2KIFA 1OCZH 2Q0OA 2ZC2A 5F1RA 2P5LC 1LLMC 1W5CC 3U2RA 2YPRA 4IHWA 2D1HA 2EN1A 1VQNI 1WHUA 1AH5A 3H3UA 3OIOA 5JLWA 1DGCA 2QGUA 3R6SA 2F5FA 4I09A 1VQKI 1KONA 2ISYA 1ETQA 5BNGA 2KISA 4KT6A 4PGHA 2NS7A 4BC7A 5IT3A 4YIRX 2CRGA 4XONA 2JA7J 3FHNA 5GPAA 1ZBQA 3CCRI 2KHXA 3TQMA 1P7JA 5LMUE 2FXAA 3RZDJ 4CH7A 1HA8A 4M3EA 3D1NI 1ON1A 1QQIA 4KT5C 3Q9VA 2WZOA 1LEAA 3LSTA 1J2XA 2DOEA 3L2VA 2FOWA 2VOOA 1X4OA 2KRHA 4IEJA 1ETVA 4IJAA 1JT0A 1TWFJ 2R7ZJ 4B3SE 1W5TA 4EJOA 1MIJA 4KYWA 1EH7A 4UVBA 4XKWA 2W57A 2X9DA 1T95A 2XSJC 1J0RA 3CJQB 3KZYA 2E72A 4XSXF 1YUIA 2WAEA 2FU4A 4IRGA 3J7ZI 4BCAA 2E71A 2MH9A 1EH6A 1SFEA 2EMHA 2ZJPF 2KQRA 3AG3H 1OCTC 4R2DA 5B1BH 3A0BC 2XGEA 3N97A 4HNUA 4XOTA 2F48A 1MMGA 3S2WA 1U5TC 3MEXA 1F36A 2HYFA 1BI2A 3DBLB 2LT7A 4DUYE 3L00A 3FK6A 2Z9OA 2MYSA 3SEQA 1YPNA 2CQQA 5ADZA 3CMYA 2GXAA 1AA7A 2YX7A 2MG4A 2Q8UA 2DDAA 3THNA 4XBFA 1RUOA 2ZMEA 1MJAA 1N77A 2UUBE 4C3IJ 2STTA 4OOIA 2NVXJ 1MEYC 3PSFA 1JKQC 4ANJA 3RPUA 1SMTA 2Y0MA 3CO7C 2EM4A 5LHIA 5JLXA 4XQFA 4A3BJ 1B8IA 2L5QA 1QPIA 3BJOA 4HLYA 5GAGJ 3W6JB 4BEHA 2DRPA 1R36A 1B69A 3RYPA 1O7LA 2UV1A 3I0TA 5LBQA 2VONA 4BBSJ 2DXIA 2MC3A 2YTQA 2KDOA 2VB6A 1LVAA 2F6CA 3ERED 3SJMA 1ZBTA 5F6FA 1IMUA 1VQLI 2H27A 2XC7A 2L9VA 2NVTJ 5KL6A 3CQZJ 3QYFA 3AL0B 4KZSA 3LSJA 1UFMA 2LTPA 1TWGJ 4DV1E 3ZMVA 2WWYA 2DK5A 2XAUA 3QOEA 2E36A 2EN6A 3IWBA 2ECBA 4ESFA 4F3QA 4A3GJ 4A3IJ 2D1VA 2HI3A 1T39A 2GPIA 2KKOA 2KIQA 4M72A 4ZTJA 1Z9CA 1FOXA 4XLEA 1MH3A 5KVRA 4ESBA 2RS6A 3FXJA 2L3JA 3RSNA 2XGCA 5ICEA 5DD8A 3BQYA 1STUA 2LTSA 2E60A 3ABUA 3EUHA 3GTGJ 1MZBA 2BW3B 4IX7A 1J9IA 3BG7A 1ZR9A 1Y1WJ 5DNYA 3DQVC 1QZEA 1DGWY 5TGTA 2BY1A 1D5YA 1A1IA 4XORA 3PIPF 1EA3A 2UUAE 3GUDA 2HPIA 2L3CA 1P92A 2DT6A 4B3TE 2ZSHB 2W25A 3OSGA 3ZQFA 4MLVA 2QLZA 4HQEA 3E6MA 3WTSC 3H5NA 1KZHA 1BW6A 4RLFA 3H9GA 3GX4X 1IN4A 1G59A 4KMUX 4PJLA 3ZMDA 3WU1B 2R5ZB 1IUYA 4DGWB 3S93A 2K4VA 4BS9A 1WJEA 4RAGA 5K5RA 5L3EA 1WH7A 4BEHB 5DDGA 4LF6E 2L92A 4R03A 4UV9A 5JFRA 3JRBA 2O9LA 3PIOF 5C4XJ 2V87A 5IOYA 3BBGA 1JT6A 2HOEA 3IH3A 2K4BA 3QG5C 4BJ6C 1RR7A 4P5OA 1T2KA 1PJSA 4CUGA 1A5JA 2BXYA 4O4KA 2E5LE 2ZXIA 2XDVA 3VB2A 4CZCA 5J1UA 2XVCA 2WV1A 2D5VA 3BPVA 3LSHA 4BYYA 4BNCA 2HJJA 3KLOA 4XLPF 1G2FC 4EJTA 4XR6A 4A0ZA 2XAFA 2DTRA 4ASNA 3DTIA 2OBPA 2RS7A 2EFNA 2X1EA 3BJAA 2LY2A 2XF5A 3TQNA 3JRGA 3D5LA 3C6MA 3DKYA 1ETOA 2EM8A 3J81Z 5CKTA 3LWFA 4L18B 3BTLA 5BPDA 2IW5A 2IS2A 1YW9A 1YX5A 1B9NA 2WBUA 4WSPA 2CU7A 2GHFA 3MZHA 1GVJA 3M07A 1CQTA 1QVUA 4IS1C 4HRIA 2EMBA 1LEBA 2COBA 2EM9A 2JY9A 4X65E 2FMLA 3U1DA 2GBYA 5A6AA 4E7SA 2A05A 3K6GA 3TKYA 3RZOJ 2P81A 2QKLB 1O4XA 1YJWI 5LGNA 5E3MA 2CW7A 2KL4A 1DP3A 4OWRB 2LV2A 2YS9A 4BDZA 3AL0C 1JTXA 1XDUA 2CUFA 3CCYA 3QOPA 3K4BA 4B09A 1UHMA 1EV7A 4L0YB 2LJHA 2RNJA 3ABKH 3RDIA 2JMWA 1KYZA 2JPCA 3PSIA 4JX4A 5LRSA 4OAZA 1J09A 3QP6A 4ZZLA 2K5CA 4GRIA 4RB0A 2M4IA 1WFXA 4MTDA 4WSGA 2WB1A 2KP6A 2IGKA 4BKXA 1WJAA 1HW2A 4IRIA 2XB5A 1ETKA 2X4HA 2RV8A 2EQ0A 1ZELA 1LFPA 5CFFE 2UXBE 2FD5A 1Z91A 3BY6A 1NCSA 4DV2E 3IWZA 2VUMJ 3HTXA 1J75A 1JXSA 1FOWA 5DUKA 2HGCA 4LFCE 5D4RA 3HDDA 1LQ1A 2GXGA 1YLFA 3EUKL 1DGRM 1X1PA 2QQ8A 2ADRA 1R1VA 2CV2A 5IP6A 1VQMI 1Z21A 2QBYA 5EGOA 5GTHC 3SYTA 1ZAOA 3F6OA 3HRUA 2X6OA 3CCJI 2H8RA 1G2DC 2YX4A 5EEHA 5FLXC 3OYIA 3IV5A 4E4HA 2L7KA 2GZWA 2BY3A 4YFXF 4BGDA 2EN7A 4C2MJ 3J7Yp 4Y7NJ 5CPRB 4BACA 1YFHA 3WTVC 3COAC 2E2HJ 4KHPE 3A2KA 5BMZA 2JVAA 2EILH 5FFZA 3JRIA 1FYKA 2DMIA 4LFBE 1TN9A 4A5MA 2ME0A 1FWZA 4YIFA 1BBYA 3PNTA 4Q47A 2P8TA 5HLGA 3OYAA 3ZN1A 1IZ1A 4UVCA 4Y3OA 2EJ4A 3ZQ7A 2XB0X 2Y0SN 3OYLA 4LF7E 2MW8A 4FETA 4MTEA 1QRYA 1R22A 3C18A 1BBOA 3EPZA 4KIBA 5CLSA 1CGPA 2RSIA 1HC8A 4CYCB 2RNGA 2YTOA 4LB6B 2LBFB 1Z1BA 2JYAA 3J80K 2NXNB 2LMDA 2VQLA 4Q4ZF 2ZXHA 1IRGA 2EPRA 2EPLX 4Y4RA 4P9FA 3BF2A 5E1ZB 4CCNA 1J5YA 2DMNA 4L9NA 3IWFA 4U0YA 3DFGA 1UHSA 2PJPA 3IAS2 2VPLA 1A1JA 1QVTA 1JJ6C 1F4KA 2A07F 4PJ0C 1Q1HA 2PMUA 4LGWA 1LB2A 2R92J 1ZTRA 4M71A 1H8AC 2JXPA 2CJJA 4G12A 3DKXA 4DBQA 5JVGF 5LD2C 3TO7A 1A6IA 1TW2A 5CVIA 1O3TA 1F5TA 1VQOI 3M99B 1F9NA 1W36D 2E5ZA 3M8FA 1X48A 2B0LA 2IA2A 2ZXWH 3EQ1A 4FTHA 2F4OB 1IQSA 1Y8RB 3ESWB 4EGYA 2XAJA 3L2QA 2VKDA 3WE3A 2J5PA 4CHUA 2EMXA 2YTGA 3O2PE 2EOHA 1NG7A 3LQQA 2ODRC 3OMYA 3GFLA 3F23A 4MLOA 1TF3A 1OYIA 1FMWA 3NQOA 3I53A 1GVDA 3GZ6A 2R4GA 2OTLI 3ECOA 4BHPA 2LE2A 1R00A 4DJAA 1G2HA 3SEZA 1B6AA 1WI3A 1X5WA 2W1OA 2R7FA 4L8NA 3JRFA 4DR4E 4KN7X 1I39A 2X48A 4F92B 1DP7P 3VYUB 2BW3A 3OWTA 2L7FP 2LCEA 2LBFA 3IRRA 4ZJZA 2BBYA 2QA4I 2ZB9A 2O0YA 3MAJA 3HUGA 2RTXA 3F8MA 4JOMA 2I13A 4PSXA 4XICA 5A6BD 3A02A 3S1MJ 2D9HA 3OMLA 4CGZA 2MLGA 2XKOA 1WJDA 2H09A 4QWQA 1BJZA 3BG3A 3FKIJ 4XRSG 3P7NA 1OCPA 2DT5A 1A1HA 1N32E 3LA2A 2HZDA 3ELKA 2PI0A 2E5NA 1USTA 1PUEE 2IS6A 3HBLA 4HG2A 2MH2A 5FKMA 2XROA 2Y48A 4A2UA 2CQKA 3TGNA 1ONVA 1PJTA 1ZQ3P 2LVSA 1U9OA 1IG7A 2GQQA 3HTSB 1RMDA 3KLNA 3A01A 2EN8A 3M1EA 4HA8A 2OV7A 3KP7A 4O3MA 3MD2A 1USSA 4UNOA 2I5UA 3LAPA 2EPXA 3HYIA 2XPUA 3AG1H 3RYRA 1IUFA 3FMSA 4DUZE 1HQCA 2WY8Q 3RCOA 2GIZA 3FBIB 3WG7H 4PDKA 2MKNA 5HDGA 2EM6A 1OCRH 4R2AA 4YIIA 1RKWA 4NQWA 2EFWA 4N4RB 4QTRA 1QBJA 2NS8A 2TCTA 2EOEA 2MD5A 2PMZN 3VEPA 4BDYA 5BPIA 2A61A 3I4NJ 5J1YA 4F9BB 3OL3A 3MFKA 3V8JA 2Y31A 5DYMA 4Z6YA 1YUJA 1E3HA 3G6EI 3K1NA 2DOAA 2HOAA 4ENJA 5DCFA 1YQAA 2X6WA 1R71A 1BR4A 3DPLC 3ULQB 3L2CA 2M3AA 2DAOA 5J40A 2BVMA 1ZGAA 2H6CA 2WBMA 2ISZA 2CUJA 1D0YA 2EZIA 2JK3A 2NS0A 3TL4X 3TOBA 1IJWC 4E7HA 1T6SA 1VQ8I 2AQEA 5IWAE 2M7BA 2LF8A 1UB9A 5FFXA 2K27A 1W5SA 2CQXA 3F6GA 1IQOA 3PQJA 2XIGA 2LO3A 3QPTA 2OD5A 3R61A 5HDNA 1D3YA 3MZYA 5HVQC 5C44J 3ZP5A 2GLOA 3W3CA 1ZRCA 4KNYA 2WBTA 1PYVA 4AU7A 3PFIA 2QWWA 3B6AA 5KL3A 4ZH4F 1OYWA 4AIJA 3UK3C 4J01A 3I9V2 5DM7F 2DFIA 2IPQX 4P78A 3M7GA 4BHBA 3DPTA 2R76A 3H1CA 4DNCA 4ZC3A 1Z05A 2VE7C 1I1GA 1JUSA 1ENHA 3JR9A 2A6TA 3HPHA 5EYRA 3JRHA 2QENA 3ROUA 3T8TA 1I1SA 3EPKA 2O7OA 4G7ZF 3S3NA 4XKVA 1W0TA 1XSVA 5DCMB 2D45A 5GP9A 3HOTA 1W0UA 2JSPA 3VK6A 1Z0XA 3KX2A 3QRFF 1E17A 4V2FA 1VQ5I 2M9AA 4A3FJ 4CYCA 2A5WA 3Q5FA 2OUMA 2ENAA 1LFUP 4WPYA 3OR2C 1U0JA 2QUFA 5FD6A 3K2ZA 2RAEA 2IHR1 3U21A 3KP4A 1JHHA 5HLTA 1N78A 3ZRGA 1IF1A 3CO6C 1O3RA 1X1CA 5GAEJ 2DPUA 2RDPA 5HS9A 1SFKA 2M30A 4XKBA 4BE2A 4RHBB 2HYGD 2DA3A 1PVEA 4OMYA 3HPSA 1IDZA 1FZPB 1XNQE 2N8GA 4M0VA 2L9RA 4HBLA 4Y33A 1UJ8A 4A3DJ 2R7TA 1SR9A 2MSYA 3GLXA 3LAJA 4F91B 5ICGA 5K1YA 3V7RA 3BG6A 4F9CB 3TBIA 2XGXA 1X2NA 3ZOBA 2IS1A 2XKPA 2IGNA 9ANTA 4A69C 5DV5A 4ENNA 4LOCA 5D5WB 3RIRA 2QSHX 3F22A 2Z3YA 2OC6A 4G9YA 3G71I 2V1UA 3WGGA 3KP6A 3D0SA 3DF6A 2EPNA 2QBYB 3M3YJ 1LDKB 1GV5A 5KNLA 1C0WA 1KYWA 4LJZF 2YU8A 2NNNA 5D6EA 3T8RA 5BS6A 2V88A 4B43A 1J5EE 2EPMX 4M6YA 4TUGA 1Z3XA 1R5ID 1XMOE 3MMYB 4DR7E 5AE1A 2CFXA 3C1DA 2P0WA 3MHSC 1P47A 1SVMA 3HGYA 3J81K 2VJJA 2K85A 1H9TA 2UXNA 1TWHJ 5E8GA 4A3JJ 4DR5E 3ZPLA 4DKKA 2V8QB 3ADGA 1S7AA 1X6FA 4XM3A 4XLCA 3CD6I 4X9JA 1DPUA 3GYHX 2UUCE 1WJ5A 1UILA 3JW4A 3I4PA 2CW0F 4K2EA 3NAUA 3BPXA 4L5EA 5FKNA 2BOLA 2BGCA 3F3XA 4MQVA 2K9MA 3SFZA 3W2AA 3JSPA 5ILSA 1JK2A 2NRAC 4FCYA 2YU3A 4X62E 1HCRA 4LG0A 2DIXA 3CCMI 3PFYA 2EOXA 3E3VA 1HNXE 2JA6J 5FRNA 1Z7UA 3N05A 3CLQA 3BC8A 1OISA 1W4MA 2DU9A 2PBIA 1IN8A 4I2OA 1D8KA 3ASNH 2EM3A 2ENHA 2L4AA 2BV6A 2MABA 3LFKA 1HKTA 4HNVA 3W2WA 2IVMA 2FNAA 5D8KB 3ERMA 4G6DA 2TDXA 4RLQA 4WWCA 1HBXG 1TNTA 2K9SA 2EV5A 1A04A 1JI8A 4GO1A 1M1EB 2R7WA 2DA5A 3F21A 1O57A 4ETSA 3BTJA 3CMAI 5F64A 1ACIA 2EOSA 2A69F 4QIWN 4DV7E 4DZJA 4PJNA 4GKJE 2FV4B 2UUZA 3BP8A 2EE8A 5E3OA 1XMKA 2L8TA 1V5EA 5EEAA 4CSWA 2L02A 1FC3A 5IYBJ 2DDBA 3GTOJ 1XD7A 2FTXB 2V9KA 1HNZE 1B8IB 2VJ5A 3M1CA 2EPAA 3T5XA 5FKLA 2ELZA 2HPMA 4OIOF 4WYQB 3BR1A 1FSEA 5F0HA 3OYJA 3K1MA 5FROA 5FO5A 5EDNA 2VBXA 4RGSA 2W85A 1SD5A 1MGTA 3T1BA 2M4KA 3ZCOA 5AC4A 3SZPA 4RDUA 3HRTA 1TLHB 4Y52J 1I94E 5F0FA 1FX7A 3KE2A 2E19A 5CVUA 1Y8QB 5D8LB 1VQ9I 5TSEA 3MN2A 5F04A 4II2A 1BR1A 3DLLF 2F5CA 5KL7A 1IBME 1T4LB 3EUAA 1R7JA 1WI9A 4ZYDA 2KZGA 3BR5A 4O5VA 1OLTA 3NWSA 4JX6A 3BIDA 3ZN0A 2NABA 2R1FA 5L3FA 1FP1D 3PO2J 3HUGB 1WJCA 1LUJB 2VQHA 2KJCA 1X58A 1P7IA 2PEXA 3S3MA 2EJRA 1B72B 3SFIA 1RQ0A 1XTAA 3J80Z 1WGXA 3RPUD 4BBRJ 1ZRDA 2QSFX 3CZ6A 3NARA 2L4MA 3RKXA 2UZKA 3S1NJ 3JAMZ 3E97A 4F9AB 1ZYRF 1SMYF 3FZVA 4EM2A 3OSFA 1JKPC 1AU7A 2PQ8A 2M9HA 2EM2A 4F93B 4LLNA 1TF6A 3GTLJ 2EA2A 2VKHA 4XN3A 1PUFB 3PNYA 1D5VA 2EIJH 2XRNA 1I50J 2BY0A 4R2PA 5DTDA 2EFQA 1FT9A 4PJMA 4UB8C 4XN0A 5ICFA 3OYDA 3VFZA 3K4LA 3UKGA 2M0MA 3IWDA 2ELKA 2MFZA 5CVVA 1YZ9A 1X3ZB 3HPZA 1STZA 3TMOA 2JOBA 5T6JA 2KRFA 3SXYA 2BBGA 3P1XA 3P5JA 1N34E 1N36E 2V89A 3OIQA 4FT8A 4R8HA 3GF2A 3UNGC 1GQEA 2B9DA 1R1TA 2OU2A 3OV8A 3DCFA 2Z33A 4BXXJ 2E35A 1I6HJ 1QZYA 3G73A 1KU9A 5KCMA 3EYYA 4RBOA 5CQGA 1TC3C 2EMGA 2HC5A 4AYBN 2KRCA 2RGVA 3PQKA 1ZREA 2CUZA 2V83A 4HLXA 2LNBA 3IRQA 1RUNA 3VYRB 4K0KE 3K2AA 1XCBA 1LNWA 1DDNA 5DD4A 2EZ6A 3TDUC 2VODA 1X1BA 2JRMA 1QA6A 2CUEA 1BBGA 3F6HA 1E0EA 1FOKA 1KU3A 1R1UA 4NC6A 1IBLE 2COMA 3GTKJ 5BR8E 1OMIA 4GEQB 4OOGC 5E17F 3VOEA 2K4JA 3RQIA 4X0GA 3IAM2 1D1CA 2DLQA 3JTHA 4HQMA 5CYVA 2DPDA 1LPQA 1FYLA 5ED4A 4A3MJ 1XGMA 4Z2YA 1Y0UA 4BJ5C 4J8ZA 4JI8E 4LIVA 2M87A 3V4GA 2DMPA 1IDYA 3K9TA 2EFOA 2M2EA 5E3NA 2VT3A 2DMQA 3GO5A 5GTIC 4RMNA 1ZLJA 3RKWA 3VDXA 2XHKA 1S7EA 2MA3A 3ABLH 3ZOQB 3M8EA 2FBHA 4GZNC 2IGMA 2YTNA 1WWXA 2HKOA 2XPWA 1YO5C 3F6VA 2L54A 2JN6A 2VBYA 4RGXA 5J6XA 2EB7A 4EV0A 4QLCU 5E8IA 1AWCA 2EN3A 3MWMA 3A4CA 2IJLA 1MD0A 4NBQA 4A0XA 2VKEA 4ON0A 2DA2A 4BQNA 5IXMB 1WVRA 2HVQA 2YTDA 2DA6A 1BI0A 3F8CA 2IAIA 1RRJA 1RIOH 1FTZA 1IXRC 4BL0B 2RQPA 4C30A 5AE2A 1AKHB 4NHRA 1LJ9A 1MMNA 4CO8A 1SD4A 2AHQA 1A1GA 1G3TA 1I3AA 3ZGKA 4YFKF 2HYJA 2M7AA 3K4NA 2Y9ZA 1YG2A 1U78A 4JI7E 3KYLA 5BOXA 2BEOA 1SD6A 3QU6A 5L3DA 5FLXZ 2LUPB 1EKEA 2W84A 3EYIA 1T08B 2L3DA 4O24A 1EF4A 4N9IA 5H6RA 2V6CA 2ID3A 1XMXA 2V26A 2F5EA 4E7JA 2EORA 1VZ0A 3CJRB 3BG5A 5A69A 3FM3A 2DA4A 4B4CA 1OYYA 4WCGA 3LSPA 2V1DA 2EM0A 2KONA 4BMJA 4XLFA 2W4SA 2PMZA 2ZCWA 2VLAA 2FQ4A 4O6JA 1VQPI 3OY9A 5JI6A 3HOWJ 4BQOA 3B6CA 3DJWA 5B1AH 3IL2A 1FKAE 2VE9A 2VC1A 4IVNA 1JKOC 1X3CA 2ZFWA 3DTEA 3WTTC 2VQEE 1P4XA 3S14J 4HF0A 1ZR4A 1IV8A 3QAHA 2QYOA 1YRNA 2E1MB 3LSMA 1FOYA 2RKHA 2EMLA 1FPQA 3GZ5A 3M9AA 2I9IA 4E70A 2ZKZA 1Y39A 3HPGA 2CYYA 2PJRA 4JV5E 5M5WJ 2EMAA 4ZDPA 4RAZA 2Z99A 1BOAA 2V1NA 3K4JA 3NEUA 3K7AJ 4S05A 4R2RA 3PUFA 3EPLA 1N75A 3LOCA 3S2HJ 4CCOA 4E7KA 1JGGA 1YI2I 4M9ZA 3HSEA 3RKQA 1XGSA 2JT1A 2HS5A 3X2QH 1J59A 2DW4A 4NNJA 1S8NA 1YHQI 5J4VA 4KWYA 4H0EA 4S04A 5B5EC 2YTFA 1TWAJ 2LREA 4HV6A 4DV4E 4LLLA 2LYCA 2MKDA 4BH9A 5DM6F 4R2CA 4UV8A 1NHAA 3SDBA 3QYEA 3R0JA 2UXDE 4DR6E 1G3WA 1AAYA 2HDCA 3ISPA 3RPQA 3ZMUA 5CJ9A 2DLKA 3C6KA 2V9PA 1NEIA 2X51A 3K6QA 2E1CA 4BC9A 1G4DA 1CF7A 4HEA2 4Y17A 1BA5A 1BR2A 4C2TA 3CJTB 3MSWA 2AXLA 1YJ9I 1WHQA 4EEFG 3VPRA 3GZNB 1OKRA 2FGGA 4GCVA 3BR3A 4C2UA 4DOZA 1W7PB 5EF6A 4IRHA 1MMDA 2CT1A 1YW8A 1B4AA 3SZTA 3TP0A 5JHFA 4KDPA 3I59B 1WSUA 3WTWC 5EEGA 2A3SA 2K7IA 4LIUA 3I58A 4L0ZB 3GTJJ 1BW5A 4L5IA 1VNDA 1SVOA 3Q3SA 3GTMJ 5KL2A 3VSLA 4A3LJ 2RSMA 3E6DA 2R3SA 3E5UA 3I71A 3KP3A 3G3ZA 1Z77A 3L09A 1BM9A 2X85A 4HX4A 1JHFA 2IRFG 1REPC 4A6EA 1FMVA 2CQ7A 2DI3A 2XAGA 3C7JA 3H36A 4TV7A 2DJNA 4IHVA 5FRMA 4UY8I 3BOQA 4JI3E 1ETYA 4KA4A 2GLIA 1WKMA 4BXUA 3IUOA 4XRMA 3CCVI 2L33A 1WRJA 2N8XA 5AASA 2EN2A 1ZR2A 3DP7A 1E2XA 2A25A 2V4JC 2FEZA 3KP2A 4UUTA 2DA7A 4I01A 3AUZA 1ULYA 2NYXA 3ADIA 3CMMA 2L9NA 3GXOA 2CH0A 2EK5A 2EPUA 4WXDA 3MZ8A 2R7RA 5J8CA 1B1BA 5C3EJ 2LH9A 3ZR8X 2GM4A 4FX0A 1Y6IA 3JTZA 4RM2A 2HNHA 5HS8A 1ZU1A 3GTQJ 1WJBA 2GA2A 2DMTA 4PCQA 3JTGA 1KJKA 1L3LA 3R4KA 2QQBA 1G3SA 4KIFA 1O7FA 3G4SI 3KIOA 1XSDA 3LL7A 2NUGA 3BDDA 4G6TB 2H8WA 1NTCA 2WY7Q 1V54H 4NHJA 5LHGA 3H35A 2AQFA 1I6XA 1XNRE 4MNUA 2BB8A 3CTAA 3JAMK 1H88C 2OPTA 2P6SA 4N4OB 1Z3YA 1WJFA 4YHHE
chains in the Genus database with same CATH topology
2Q8KA 1K79A 1XMAA 2HKXA 3CUQA 5D5VB 4Y13A 4LK1F 1OR7A 1ODDA 2AS5F 2EA4A 3HIFA 3E6CC 4G7OF 1O3QA 1FBUA 5KK1A 1ZG1A 2Y75A 5DEQA 2EFPA 4RGUA 3LQRA 3I54A 1FYMA 1QZZA 3GVAA 3GW2A 4AWXB 3TO9A 3WODF 4LK0F 3OOPA 2ADUA 1Z6TA 2P7VB 2DO7A 3V7CA 3BROA 2GAUA 4OU0A 3EDPA 1HSTA 4RAYA 1XCVA 1YW7A 1XGOA 2E1NA 4ZZDA 4M9XA 5AIPA 2CG4A 1KU7A 1IW7F 1RI7A 4MGRA 5ILVA 1BI1A 1MJ9A 3JSOA 3CDHA 1XSXA 3KETA 3FMQA 4I98B 1MDMA 5FLXK 5HLHA 2VE8A 1IN5A 5E20A 1D8JA 5H20A 2VBWA 5E1WA 3FXRA 1BC8C 2JTVA 4EJWA 1ZARA 1YYVA 1B59A 1U6GA 3K69A 4R1HA 4BQAA 4Y15A 1TQMA 5AONA 2X0LA 1K78A 2VC0A 4FX4A 1I27A 4P55A 2V1XA 2XAHA 2PMHA 1K78B 1YIOA 2A68F 4WK8F 4A12A 3WGIA 5HOOA 2CSOA 1U5TB 3HHGA 1U2WA 1TQPA 1QPMA 2QQAA 4L9VA 3QP5A 3SHFA 3HTUA 2BYVE 3I5UA 2ZMEB 4LG0B 5CVJA 1I5ZA 2HQNA 3KEOA 2M1BA 1BJAA 2CO5A 3FMRA 3WU0A 4AVPA 2FRHA 1VTNC 4HX8A 2G9WA 4I7HA 3RTRA 1IN6A 3F8FA 4GXOA 2CWEA 3GFMA 2ESNA 2XUBA 4EMSA 5JR3A 1GXPA 3Q9SA 2V79A 4WX9A 1H9GA 4U0VA 5A2QZ 2HEOA 3B73A 2HTSA 2FBKA 4FHTA 3RI4A 1T98A 2KIMA 4Q48A 2K02A 1P6RA 2HR3A 3N4MA 3ML6A 1WQ2A 1W7PD 2OQRA 3P9CA 2EV0A 4LMYA 2VBZA 3MCZA 2LDUA 1SFUA 5A2QK 2Z5UA 4HZFA 1O3SA 1RNLA 1U5TA 2ZO4A 4M9SA 5IT9K 4WF2A 1H0MA 2H94A 3SQNA 1LDDA 1XN7A 3AAFA 2DQRA 2ZNYA 3NRVA 1ZRFA 4GYGA 1J7KA 2LF7A 2EWNA 1P4WA 2RVCA 5D5UB 2FQ3A 1GXQA 1W7PA 1FLIA 4M6XA 1BI3A 1ZLKA 3V8LA 4XRFA 2O8XA 1FSHA 2J5OA 4ZYGA 4CICA 2O6GE 2G7UA 4ZYHA 2O3FA 5LEKA 5LEJA 2NAZA 4MEXF 5TRDA 1HW1A 2CGPA 2P6TA 4LLGF 6PAXA 5LLQA 3KEQA 1KA8A 1V3FA 4CXFA 1V4RA 1TBXA 4JK1X 2EV6A 2QVOA 4WXHA 5LHHA 1S6LA 4KN4X 4RGRA 2PN6A 4MEYF 4GGGA 3R0AA 1ZGJA 2M8EA 2KJBA 3CLOA 1OPCA 3FX3A 4AD9A 4AIHA 2A6EF 4YFNF 2ZNZA 2HZTA 1K6OA 5DUIA 1TQIA 5L3CA 1SAXA 2YSRA 2LKPA 3WTXC 2XAQA 1FNNA 5BQTA 2IT0A 1U3EM 2M5WA 3J7AO 4G6QA 4PZJA 2OZ6A 3B02A 2A5YB 2OAZA 4U7BA 4HV5A 2IA0A 3KCCA 4HDVA 3IKVA 1Z6RA 4LD5A 4EJVA 3WTUC 1HKSA 1XDSA 2UXXA 2PG4A 4UHTA 4KFCA 4D0PA 1L0OC 2GWRA 1EH8A 3GEZA 1ZH5A 2XASA 1IN7A 4P96A 5L3BA 4WXCA 1KGSA 3TOAA 2ELHA 1JGSA 4MQ9F 1P4AA 1HW5A 1FY7A 3HRSA 2WTEA 2GIVA 5CVRA 2E7XA 3T0YA 1R5HA 2JSCA 3WG9A 5AIQA 1K7AA 3GWZA 4I0AA 4KICA 1P2FA 1G3YA 3WTZA 1TNSA 4G7HF 5ERIA 3GFJA 2ZJ2A 3V7SA 2FMYA 1XGNA 1MJBA 4HF1A 5K5OA 3H3ZA 4BHCA 3RKYA 1YS7A 5HDKA 3IHUA 2E7WA 4ENMA 1JE8A 5FD5A 2QQ9A 3FHZA 3EQLF 3FWEA 3K0LA 3I64A 3O6BB 1R5GA 3TDZC 1SD7A 1QO0D 1IXSB 3ZMTA 5JHUA 1DUXC 2KIUA 4IXAA 4OIQF 3LA3A 2H6BA 4JQFA 5DCMA 1G6NA 2F2EA 5E18F 2W24A 4R79A 2K86A 3CUQB 4RS8A 2OQGA 1S7OA 3H92A 2P5VA 3QU3A 1HSJA 3HRMA 1ON2A 3CUOA 4A5NA 1KU2A 1YTYA 2LSOA 2O03A 2VT2A 2R7DA 4HOBA 4XLNF 1MDMB 2MLKA 4HW0A 4G8XA 5J8FA 4U0WA 2D2WA 4LFUA 2UWMA 3DEUA 2ETHA 4LB5A 1KQ8A 4HAMA 1ZG5A 2DBBA 3QPHA 5D6FA 4OIRF 2ESHA 4F7ZA 4UXNA 1IRFA 3WGHA 3DF8A 3FXQA 2VOPA 4HF2A 4UVAA 3WE2A 3DV8A 2P4WA 3FF5A 5HS7A 1KQ9A 2NNYA 1FBSA 3HOSA 4ENKA 3W6KB 2C6YA 2FBIA 3U9GA 4IF4A 2FA5A 2HFHA 1KQ0A 1YS6A 2DLLA 4RB3C 3VODA 3KZZA 4U7DA 2HTJA 5K5QA 1ZHFA 3HSRA 1IXCA 3F8NA 2HQRA 2RN7A 1BN5A 3E5QA 5L3GA 2OZUA 4A6DA 2P5KA 3V8KA 2BE5F 4EVIA 1GHCA 4N9HA 2MBFA 4ESJA 4PGGA 4NB5A 5IT9Z 2PFBA 2QM3A 1R58A 4I0BA 3DXJF 4OMZA 2WV0A 2JPBA 3F8BA 3FXUA 2F5DA 1LDJA 2FE3A 3I59A 1QGPA 5JVTA 3L7WA 5FB2A 1U8RA 1QNTA 1Z1DA 2WC2A 4L9JA 4L5JA 4M73A 2K7LA 4XSZF 1TTYA 2G7HA 2L01A 4L9TA 1HKQA 1BIAA 2VXZA 4RB2C 3E6BA 3FM5A 3KFWX 2ZBKA 1B9MA 3GFIA 3K1PA 3BJ6A 4EJUA 3HHHA 4GYIA 5FGMA 5HLIA 3ZMSA 4EGZA 1FP2A 1X3UA 3EETA 3TO6A 3F72A 2XV4S 2IA1A 2IP2A 3REOA 4MHGA 2M45A 2DK8A 2HWVA 2O61A 2OA4A 4A0YA 3P9IA 2FF4A 3O3KA 4M74A 5TJJA 5D4SA 4CZZA 1UCRA 1S29A 3RJPA 3R60A 1BC7C 3MQ0A 1T0FA 4OIPF 2ZXJA 4IHTA 3WTYC 4EQQA 4KIGA 2V9VA 1HXDA 3BZ6A 1F1ZA 4IHSA 1BIBA 2RC4A 3KP5A 2JZYA 4N0BA 4BAYA 3IKTA 2PLYA 5D5XB 2GA1A 2QZ8A 4JBAA 2JRTA 4HDUA 3CJNA 2GXBA 2Q2EA 3P9KA 4CDGA 3BWGA 1DPRA 4AIKA 4UUVA 4DQ2A 1IAWA 1FBQA 4CYDA 1AOYA 5LGTA 5E1XA 4Q5SF 3ABTA 2FSWA 4P9UA 2YR2A 4EM1A 2VN2A 1UHWA 3E5XA 1PDNC 4U88A 2ACJA 3C3WA 3L9FA 2STWA 2A6HF 3IC7A 4KMFA 1PP7U 1MKMA 4RB1A 4HYEA 4KUMA 4I02A 1RZ4A 4HX7A 1PP8F 3ZMZA 4EM0B 3CUQC 3LA7A 4ZYEA 1T38A 4YG2F 4OINF 5LGUA 1XB4A 2DQLA 1ZN2A 5ICCA 5LRRA 1TW3A 3DKWA 1S3JA 1SFXA 2P7CB 2FOKA 5ILUA 5H6QA 2FNPA 4B8XA 1R23A 3ECHA 1CF7B 3HSFA 4G94A 1ZG3A 4IPAA 2KIFA 2Q0OA 5F1RA 2P5LC 3U2RA 2YPRA 2D1HA 3H3UA 3R6SA 2F5FA 4I09A 2ISYA 4PGHA 5IT3A 2FXAA 1ON1A 1QQIA 4KT5C 3Q9VA 1LEAA 3LSTA 1J2XA 2VOOA 4IJAA 1W5TA 4EJOA 4KYWA 1EH7A 4UVBA 2W57A 1J0RA 3KZYA 4XSXF 4IRGA 2FU4A 2MH9A 1EH6A 1SFEA 3N97A 3S2WA 1U5TC 3MEXA 2HYFA 1BI2A 3L00A 2Z9OA 2YX7A 4XBFA 1RUOA 2ZMEA 1MJAA 2STTA 4OOIA 3RPUA 1SMTA 2Y0MA 3CO7C 5LHIA 3BJOA 4HLYA 3W6JB 1R36A 3RYPA 1O7LA 3I0TA 5LBQA 2VONA 2MC3A 3ERED 1LVAA 5F6FA 2H27A 1UFMA 3ZMVA 2WWYA 2DK5A 4ESFA 2D1VA 1T39A 2KKOA 4M72A 1Z9CA 4ESBA 5KVRA 5ICEA 5DD8A 3ABUA 3EUHA 1MZBA 1J9IA 3DQVC 3GUDA 1P92A 2W25A 2QLZA 4HQEA 3E6MA 3WTSC 3GX4X 1IN4A 4KMUX 3ZMDA 3WU1B 1IUYA 5K5RA 5L3EA 5DDGA 4UV9A 5JFRA 2HOEA 2K4BA 4P5OA 1T2KA 3VB2A 2XVCA 3BPVA 4BYYA 4BNCA 3KLOA 4XLPF 4EJTA 4A0ZA 2XAFA 2DTRA 4ASNA 2OBPA 2EFNA 3BJAA 3TQNA 3D5LA 3J81Z 3LWFA 4L18B 5BPDA 2IW5A 1YW9A 1B9NA 3MZHA 1GVJA 1LEBA 2FMLA 3U1DA 3TKYA 5LGNA 1XDUA 4B09A 3QOPA 1UHMA 1EV7A 4L0YB 2RNJA 3RDIA 1KYZA 2JPCA 5LRSA 3QP6A 4ZZLA 4RB0A 4MTDA 1HW2A 4IRIA 2X4HA 2RV8A 3BY6A 1Z91A 3IWZA 1J75A 1JXSA 5DUKA 2HGCA 5D4RA 1LQ1A 2GXGA 1YLFA 1R1VA 2QBYA 1ZAOA 3F6OA 3HRUA 2YX4A 5EEHA 2GZWA 4YFXF 1YFHA 3WTVC 3COAC 5BMZA 5FFZA 1FYKA 4A5MA 1FWZA 4YIFA 1BBYA 4Q47A 2P8TA 5HLGA 3ZN1A 1IZ1A 4UVCA 3ZQ7A 4MTEA 1R22A 3C18A 4KIBA 5CLSA 1CGPA 4LB6B 3J80K 4Q4ZF 1IRGA 4P9FA 5E1ZB 1J5YA 4L9NA 3IWFA 4U0YA 3DFGA 2PJPA 1F4KA 2A07F 1LB2A 1Q1HA 2PMUA 4LGWA 4M71A 1F5TA 3TO7A 5CVIA 1TW2A 1O3TA 1F9NA 3M8FA 2B0LA 2IA2A 4EGYA 2XAJA 3WE3A 2J5PA 4CHUA 3O2PE 3LQQA 3GFLA 3F23A 1OYIA 3NQOA 3I53A 3GZ6A 3ECOA 4BHPA 1R00A 1B6AA 2R7FA 4KN7X 1DP7P 3IRRA 2BBYA 2O0YA 3MAJA 3HUGA 3F8MA 4CGZA 2MLGA 2XKOA 4QWQA 2H09A 3P7NA 2DT5A 3LA2A 3ELKA 2PI0A 1USTA 1PUEE 2MH2A 2XROA 2Y48A 4A2UA 2CQKA 3TGNA 1ONVA 2GQQA 3HTSB 3KLNA 3M1EA 4HA8A 3KP7A 4O3MA 1USSA 4UNOA 3LAPA 3HYIA 3RYRA 3FMSA 1HQCA 4PDKA 5HDGA 4YIIA 4NQWA 2EFWA 1QBJA 2MD5A 3VEPA 5BPIA 2A61A 3MFKA 3V8JA 5DYMA 3K1NA 4ENJA 5DCFA 1YQAA 3DPLC 3ULQB 3L2CA 2DAOA 2ISZA 1ZGAA 2H6CA 3TOBA 2NS0A 1T6SA 5FFXA 2LF8A 1UB9A 2K27A 1W5SA 3PQJA 2XIGA 3QPTA 5HDNA 3ZP5A 2OD5A 1D3YA 3MZYA 3R61A 5HVQC 1ZRCA 4KNYA 3PFIA 2QWWA 4ZH4F 1OYWA 4AIJA 2DFIA 2IPQX 3M7GA 4BHBA 3DPTA 4DNCA 1Z05A 1I1GA 1I1SA 2QENA 3ROUA 3T8TA 4G7ZF 1XSVA 5DCMB 2D45A 3HOTA 3QRFF 1E17A 3Q5FA 5FD6A 2QUFA 3K2ZA 3KP4A 1JHHA 1IF1A 3CO6C 1O3RA 2DPUA 2RDPA 5HS9A 2M30A 2HYGD 4OMYA 1FZPB 4HBLA 3GLXA 3LAJA 5ICGA 5K1YA 3V7RA 2XGXA 2XKPA 5DV5A 4ENNA 5D5WB 3RIRA 3F22A 2Z3YA 4G9YA 2V1UA 3WGGA 3KP6A 3D0SA 2QBYB 1LDKB 1C0WA 1KYWA 4LJZF 2NNNA 5D6EA 3T8RA 5BS6A 4M6YA 2CFXA 3C1DA 3J81K 1H9TA 2UXNA 5E8GA 3ZPLA 1S7AA 1DPUA 3GYHX 3JW4A 3I4PA 2CW0F 4K2EA 3BPXA 3F3XA 2BGCA 4MQVA 3SFZA 3JSPA 5ILSA 2NRAC 2YU3A 4LG0A 3E3VA 1Z7UA 1W4MA 2DU9A 2PBIA 1IN8A 4I2OA 1D8KA 2L4AA 2BV6A 3LFKA 1HKTA 2IVMA 2FNAA 5D8KB 4G6DA 2TDXA 4WWCA 1HBXG 1TNTA 2EV5A 1A04A 4GO1A 3F21A 1O57A 4ETSA 5F64A 2A69F 3BP8A 1XMKA 2L02A 1FC3A 1XD7A 3T5XA 4OIOF 1FSEA 3K1MA 5FO5A 2VBXA 4RGSA 2W85A 1SD5A 1MGTA 3T1BA 3SZPA 3HRTA 1TLHB 1FX7A 3KE2A 5CVUA 5D8LB 2F5CA 1R7JA 1WI9A 4ZYDA 4O5VA 3ZN0A 5L3FA 1FP1D 2KJCA 2PEXA 2EJRA 3J80Z 1ZRDA 3RKXA 2L4MA 2UZKA 3JAMZ 3E97A 1ZYRF 1SMYF 3FZVA 4EM2A 2PQ8A 4LLNA 2EA2A 1D5VA 2XRNA 2EFQA 1FT9A 5ICFA 3VFZA 5CVVA 1STZA 2KRFA 3SXYA 4FT8A 4R8HA 3GF2A 1R1TA 2OU2A 3OV8A 2Z33A 1QZYA 3G73A 1KU9A 3EYYA 2RGVA 3PQKA 1ZREA 4HLXA 2LNBA 3IRQA 1RUNA 1XCBA 1LNWA 1DDNA 5DD4A 3TDUC 2VODA 1FOKA 1KU3A 1R1UA 2COMA 1OMIA 5E17F 3VOEA 2K4JA 3JTHA 4HQMA 5CYVA 2DPDA 1FYLA 5ED4A 1XGMA 4Z2YA 1Y0UA 2M87A 3V4GA 3K9TA 2EFOA 2VT3A 3GO5A 1ZLJA 3RKWA 2XHKA 2MA3A 3M8EA 2FBHA 1WWXA 2HKOA 1YO5C 3F6VA 2L54A 2VBYA 4RGXA 5J6XA 2EB7A 4EV0A 4QLCU 5E8IA 1AWCA 3MWMA 2IJLA 1MD0A 4A0XA 4ON0A 1BI0A 3F8CA 1RIOH 1IXRC 2RQPA 1LJ9A 4CO8A 1SD4A 1G3TA 4YFKF 1YG2A 1U78A 5BOXA 2BEOA 1SD6A 3QU6A 5L3DA 5FLXZ 2W84A 3EYIA 2L3DA 4N9IA 5H6RA 2V6CA 2F5EA 3FM3A 4WCGA 1OYYA 2V1DA 2ZCWA 4O6JA 5JI6A 3IL2A 2VE9A 2VC1A 4IVNA 2ZFWA 3WTTC 1P4XA 4HF0A 3QAHA 2QYOA 2RKHA 1FPQA 3GZ5A 3M9AA 4E70A 2ZKZA 2CYYA 4RAZA 1BOAA 2Z99A 3NEUA 4S05A 4M9ZA 3HSEA 1XGSA 2JT1A 2HS5A 1J59A 2DW4A 1S8NA 4H0EA 4S04A 4HV6A 4LLLA 4BH9A 4UV8A 1NHAA 3R0JA 1G3WA 2HDCA 3ISPA 3RPQA 3ZMUA 5CJ9A 2E1CA 1G4DA 1CF7A 4Y17A 2AXLA 1OKRA 4GCVA 1W7PB 4IRHA 1YW8A 1B4AA 3SZTA 4KDPA 3I59B 1WSUA 3WTWC 5EEGA 2A3SA 3I58A 4L0ZB 4L5IA 3I71A 2R3SA 3E5UA 3E6DA 3KP3A 3G3ZA 3L09A 4HX4A 1BM9A 2IRFG <