2HGHA

Transcription factor iiia zinc fingers 4-6 bound to 5s rrna 55mer (nmr structure)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
87
structure length
87
Chain Sequence
MYVCHFENCGKAFKKHNQLKVHQFSHTQQLPYECPHEGCDKRFSLPSRLKRHEKVHAGYPCKKDDSCSFVGKTWTLYLKHVAECHQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/rna
molecule keywords 55-MER
publication title Induced Fit and 'Lock and Key' Recognition of 5 S RNA by Zinc Fingers of Transcription Factor IIIA
pubmed doi rcsb
source organism Xenopus laevis
total genus 25
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2006-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2hghA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2hghA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2hghA03
1JK1A 2RPCA 2YSPA 3EPHA 3MHHC 2EM8A 4FK5C 2BB8A 2YTOA 1ZU1A 4R2CA 1BBOA 2WBUA 1X6EA 2A25A 2LVHA 1A1IA 2LV2A 2EMWA 2EL6A 2EMGA 2CSHA 2EMLA 2R1FA 3UK3C 1DGCA 1TF6A 2JPAA 2EM0A 1TF3A 2EMKA 1YUIA 2EN3A 2WCC3 2RSIA 2EQ1A 1WJPA 2EMIA 4R2SA 2EPCA 1A1HA 2DMIA 1A1LA 2EMYA 2MKDA 2ELYA 2EPPA 5KL7A 1UBDC 3VHTB 2YRHA 2I13A 2EOHA 2EL4A 2YTDA 2EM9A 4IS1C 2EE8A 2E72A 2WBSA 2LCEA 2ELZA 2YSOA 2YTNA 1P47A 2HGHA 1A1JA 2YU8A 2EPXA 1AAYA 1YUJA 1X3CA 2EMAA 2MDGA 2EM5A 4GZNC 2EM3A 1RMDA 2EM7A 5KL4A 2EMZA 1A1KA 4F6MA 2YTQA 3EPKA 2VRDA 2YTFA 4F2JC 5KL3A 2ENCA 2NABA 2EQ3A 1A1FA 2EPUA 2DLKA 2YTPA 2EP3A 2YU5A 2EOMA 5KL5A 2EOEA 1ZR9A 1G2DC 1TN9A 2EOQA 2EMXA 4R2EA 2GHFA 1NCSA 2EN8A 1X6FA 1ZAAC 4WSGA 2EMCA 4R2PA 2EM2A 2EQ0A 2LT7A 2YTEA 1KJKA 4R2DA 2J7JA 1X5WA 4R2QA 2CTDA 2EM6A 2MKNA 2ENHA 2EOSA 2EN4A 2EL5A 5KL6A 1Z1BA 2EOJA 2M9AA 2EOFA 2DRPA 2EOYA 2YRMA 3EPLA 1BB8A 2ADRA 2PRTA 1F2IG 2EN2A 2D9HA 2WBTA 2EMFA 2YTIA 2EPRA 2EN7A 2DLQA 2EMHA 2YTGA 2EMBA 1JK2A 2ENAA 4F6NA 2LO3A 1G2FC 1UN6B 2JP9A 4X9JA 4IJDA 2EOOA 4R2RA 3EPJA 2EN1A 2EOXA 2EOIA 2YRKA 3M99B 1LLMC 2DGCA 4M9VC 2EN6A 2EM4A 2EPZA 2CT1A 1YSAC 2GLIA 1X6HA 2YTJA 2EORA 4R2AA 2EOZA 2EPAA 5KL2A 3MHSC 1A1GA 1MEYC 2EJ4A 1B69A
chains in the Genus database with same CATH superfamily
1JK1A 2RPCA 2LTRA 3MHHC 2EM8A 1XNQE 4M2ZA 2FTXB 3FIGA 2N8XA 1UHZA 4WFTA 4R2CA 1BBOA 1SFEA 1A1IA 2A25A 2JPAA 3UK3C 2R1FA 4J8ZA 1DGCA 2LJUA 1YUIA 3JAMC 1XMQE 1N34E 2EN3A 2B7VA 1EKZA 2HJJA 2L6MA 2EMIA 4GKKE 4JI7E 4NXME 4LU9A 1IQSA 2JVAA 1N3GA 4BHCA 5KL7A 1FKAE 2ZM6E 5A2QC 2YRHA 1N32E 2YZTA 4RH8A 2EWLA 3IWDA 3RMPA 2EE8A 4WX9A 1L4SA 2WBSA 4RHBB 4HEIA 3ADJA 2L2KB 2B7TA 2NA2A 4ZYHA 1XMOE 4R8OA 2YPNA 4DMIA 2UU9E 5KL4A 3JU0A 2VRDA 1XNRE 2ENCA 3THOB 2ODRD 4BCAA 4M0VA 1A1FA 3TQMA 2EP3A 1BBGA 2YU5A 4TUGA 4F54A 2EMXA 5AE3A 4DR7E 1ZAAC 2EM2A 3C6KA 2LT7A 4LF9E 2YTEA 2NUGA 3IWBA 5AC5A 2J7JA 4R2QA 5A69A 1J5EE 5IWAE 4DR3E 4JI3E 3MSWA 2V85A 4JI1E 3BBGA 1J26A 3L00A 2RS7A 4B3SE 4LFCE 4LFBE 2YTIA 5IV8B 5FLXC 3AV0A 2EMBA 2UXBE 3THNA 4F6NA 4JV5E 2LO3A 3J80C 3ZOQB 2HC5A 4JI0E 1GZ6A 4DV7E 3H09A 4X9JA 5A6JA 4L8NA 2EN1A 5ADZA 2EPNA 2YRKA 2EN6A 3KZYA 4BBYA 1YSAC 2GLIA 3VK6A 2LBSB 2EORA 4O43A 5KL2A 2EJ4A 1PDAA 2L33A 4K0KE 5A6AA 2MC6A 1T4NA 3T1YE 1ZU1A 5LLQA 4OX9E 2JR1A 1X6EA 2Q8UA 1TF6A 2CSHA 2YWQA 2EM0A 1TF3A 2ODRC 3C4BA 4X8WA 4DKKA 1WJPA 2NUEA 2IHR1 1A1LA 2F4VE 4N4RB 2EMYA 2ELYA 2EPPA 3F6GA 3IWCA 1YZ9A 5TSEA 5BR8E 3C6MA 2LUPB 2I9IA 2HGHA 5F3WA 1HNZE 1AAYA 2EM7A 2EMZA 2N3HA 2DMYA 2L8TA 2L2MA 4F9BB 1IBKE 2EQ3A 4BC7A 2H36X 5AC4A 3AUZA 1YFHA 3VYXA 2YTPA 4BMJA 4JI6E 3HXLA 1ZR9A 1TN9A 2EOQA 5AASA 2JOBA 5CFFE 4LF5E 2UXCE 4GKJE 3DF6A 4JI8E 4WSGA 2EMCA 4R2PA 2EQ0A 3BIDA 4R2DA 4NXNE 4BHBA 4KZSA 2ENHA 1DQ3A 3J7Yp 4DV5E 2EN4A 1SR9A 2EL5A 2EPOA 2EOJA 1YYKA 2FGGA 2V8QB 3EPLA 2DSYA 2K7IA 2WZOA 3LLHA 1BB8A 2ADRA 2PRTA 4O4KA 1F2IG 1KYQA 2WBTA 2EMFA 2EPRA 4WXCA 3JTZA 2V89A 1JK2A 4LF8E 1IQOA 1DI2A 4YY3E 4R2RA 4O5GA 4JI2E 2EOXA 1UILA 2EOIA 2KOUA 4DV0E 3T1HE 2EPZA 2CT1A 1X48A 4X62E 1IBLE 4ZYDA 2L3CA 2LJHA 2V87A 2VE7C 5AE2A 4X65E 3HQ1A 2B9DA 4P7DA 4DV6E 2HHHE 1B69A 2MC5A 4FK5C 2UUCE 2BB8A 3VYYA 4M30A 1EH6A 2JXPA 2CPNA 2LVHA 2MDRA 2LV2A 2EMGA 4DV1E 2B3TB 4KHPE 2EMKA 2UXDE 2LE2A 2RSIA 2G7HA 4R2SA 4P78A 4ZYEA 1A1HA 2DMIA 2MKDA 5IT9C 4TUIA 4LF4E 2VF1A 4DV2E 2JWOA 1UBDC 2L2NA 1AH5A 1O0WA 2EL4A 2EOHA 2YTDA 2EM9A 3P1XA 1T39A 1PJTA 2NUFA 4NHRA 1PJQA 2YTNA 2R76A 1WXRA 1GTKA 1P47A 1A1JA 2YU8A 2EPXA 1YUJA 2EMAA 2RS6A 2EM5A 4F9AB 4GZNC 3HPZA 1IMUA 1NEIA 4F6MA 3EPKA 4MLVA 4JI4E 4NZVA 4L5NC 5KL3A 4F2JC 3OMLA 1HR0E 2DB2A 2EPUA 2DLKA 4DV4E 4YHHE 1T38A 1QU6A 3J81C 2JY9A 2UUAE 2GHFA 4R03A 2EN8A 1X6FA 2V88A 1RQ0A 1IBME 1KJKA 1X5WA 2E1MA 2CTDA 2EM6A 2MKNA 2JYAA 3K6QA 2VQFE 2KONA 2YT4A 5KL6A 1Z1BA 4JI5E 1PKPA 4OOGC 1YPNA 2EOYA 2YRMA 3KWRA 4GEQB 2L92A 3ADGA 2EN2A 2D9HA 4HTGA 1T4OA 4WPYA 2YTGA 4X64E 3EQ1A 4DUYE 2ENAA 4LFAE 4DR4E 2JP9A 3KZZA 3C4TA 1LLMC 3HTXA 2EM4A 4Q35B 2DIXA 3ADLA 2VQEE 1WRJA 2BBGA 2GPIA 2RQLA 3ECRA 4B3TE 1A1GA 3MHSC 1PJSA 3F6HA 3EPHA 2YSPA 4BS9A 2L3JA 2M1SA 2N3GA 2YTOA 2JOXA 2WBUA 2EMWA 2EL6A 5LMNE 2EMLA 1STUA 2FV4B 2WCC3 4DR2E 4DV3E 3HPSA 2EQ1A 4MLQA 5A6BD 3ADIA 5A6BA 2EPCA 2K4VA 3BGHA 4DR6E 4WSPA 4LTYA 2LMZA 3VHTB 2I13A 2E5LE 3DJWA 4IS1C 2E72A 2LCEA 2ELZA 4B3ME 2YSOA 2EPKX 4DR5E 4JYAE 1X3CA 2MDGA 2V86A 2EM3A 1RMDA 1ZBTA 4LF7E 5AE1A 2EZ6A 1A1KA 1X49A 2EPLX 2YTQA 2YTFA 2NABA 1MGTA 1ZBQA 4I8OA 4Q28A 1WHQA 2EOMA 4KWYA 5KL5A 2EOEA 5A6KA 1G2DC 4O24A 4DUZE 4R2EA 1T4LB 2UUBE 1EH8A 1NCSA 1FJGE 1YYWA 2F8BA 4AQYE 1YYOA 2V83A 2LTSA 1X47A 4LF6E 2EOSA 1N33E 2RSMA 3J7AG 2M9AA 2EOFA 2DRPA 2M4IA 3QG5C 5DNYA 2EPMX 5T6JA 4DR1E 5IXMB 2M7QA 1RC7A 4X66E 2EN7A 1GQEA 2DLQA 2EMHA 4WYQB 5LL6R 3OTOE 2KHXA 1QNTA 1G2FC 1UN6B 2LRSA 4IJDA 2EOOA 3EPJA 1HNXE 5LMUE 3BF2A 3M99B 1I94E 4M9VC 1EH7A 2DGCA 4BC9A 4B3RE 1HNWE 1N36E 3LMLA 4WXDA 1X6HA 2YTJA 4ZYGA 4R2AA 1WHNA 2EOZA 2EPAA 2RTXA 1MEYC 4F9CB 2LUQA
chains in the Genus database with same CATH topology
1JK1A 2RPCA 2YSPA 3EPHA 3MHHC 2EM8A 4FK5C 2BB8A 2YTOA 1ZU1A 4R2CA 1BBOA 2WBUA 1X6EA 2A25A 2LVHA 1A1IA 2LV2A 2EMWA 2EL6A 2EMGA 2CSHA 2EMLA 2R1FA 3UK3C 1DGCA 1TF6A 2JPAA 2EM0A 1TF3A 2EMKA 1YUIA 2EN3A 2WCC3 2RSIA 2EQ1A 1WJPA 2EMIA 4R2SA 2EPCA 1A1HA 2DMIA 1A1LA 2EMYA 2MKDA 2ELYA 2EPPA 5KL7A 1UBDC 3VHTB 2YRHA 2I13A 2EOHA 2EL4A 2YTDA 2EM9A 4IS1C 2EE8A 2E72A 2WBSA 2LCEA 2ELZA 2YSOA 2YTNA 1P47A 2HGHA 1A1JA 2YU8A 2EPXA 1AAYA 1YUJA 1X3CA 2EMAA 2MDGA 2EM5A 4GZNC 2EM3A 1RMDA 2EM7A 5KL4A 2EMZA 1A1KA 4F6MA 2YTQA 3EPKA 2VRDA 2YTFA 4F2JC 5KL3A 2ENCA 2NABA 2EQ3A 1A1FA 2EPUA 2DLKA 2YTPA 2EP3A 2YU5A 2EOMA 5KL5A 2EOEA 1ZR9A 1G2DC 1TN9A 2EOQA 2EMXA 4R2EA 2GHFA 1NCSA 2EN8A 1X6FA 1ZAAC 4WSGA 2EMCA 4R2PA 2EM2A 2EQ0A 2LT7A 2YTEA 1KJKA 4R2DA 2J7JA 1X5WA 4R2QA 2CTDA 2EM6A 2MKNA 2ENHA 2EOSA 2EN4A 2EL5A 5KL6A 1Z1BA 2EOJA 2M9AA 2EOFA 2DRPA 2EOYA 2YRMA 3EPLA 1BB8A 2ADRA 2PRTA 1F2IG 2EN2A 2D9HA 2WBTA 2EMFA 2YTIA 2EPRA 2EN7A 2DLQA 2EMHA 2YTGA 2EMBA 1JK2A 2ENAA 4F6NA 2LO3A 1G2FC 1UN6B 2JP9A 4X9JA 4IJDA 2EOOA 4R2RA 3EPJA 2EN1A 2EOXA 2EOIA 2YRKA 3M99B 1LLMC 2DGCA 4M9VC 2EN6A 2EM4A 2EPZA 2CT1A 1YSAC 2GLIA 1X6HA 2YTJA 2EORA 4R2AA 2EOZA 2EPAA 5KL2A 3MHSC 1A1GA 1MEYC 2EJ4A 1B69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JK1 A;  2RPC A;  2YSP A;  3EPH A;  3MHH C;  2EM8 A;  4FK5 C;  2BB8 A;  2YTO A;  1ZU1 A;  4R2C A;  1BBO A;  2WBU A;  1X6E A;  2A25 A;  2LVH A;  1A1I A;  2LV2 A;  2EMW A;  2EL6 A;  2EMG A;  2CSH A;  2EML A;  2R1F A;  3UK3 C;  1DGC A;  1TF6 A;  2JPA A;  2EM0 A;  1TF3 A;  2EMK A;  1YUI A;  2EN3 A;  2WCC 3;  2RSI A;  2EQ1 A;  1WJP A;  2EMI A;  4R2S A;  2EPC A;  1A1H A;  2DMI A;  1A1L A;  2EMY A;  2MKD A;  2ELY A;  2EPP A;  5KL7 A;  1UBD C;  3VHT B;  2YRH A;  2I13 A;  2EOH A;  2EL4 A;  2YTD A;  2EM9 A;  4IS1 C;  2EE8 A;  2E72 A;  2WBS A;  2LCE A;  2ELZ A;  2YSO A;  2YTN A;  1P47 A;  2HGH A;  1A1J A;  2YU8 A;  2EPX A;  1AAY A;  1YUJ A;  1X3C A;  2EMA A;  2MDG A;  2EM5 A;  4GZN C;  2EM3 A;  1RMD A;  2EM7 A;  5KL4 A;  2EMZ A;  1A1K A;  4F6M A;  2YTQ A;  3EPK A;  2VRD A;  2YTF A;  4F2J C;  5KL3 A;  2ENC A;  2NAB A;  2EQ3 A;  1A1F A;  2EPU A;  2DLK A;  2YTP A;  2EP3 A;  2YU5 A;  2EOM A;  5KL5 A;  2EOE A;  1ZR9 A;  1G2D C;  1TN9 A;  2EOQ A;  2EMX A;  4R2E A;  2GHF A;  1NCS A;  2EN8 A;  1X6F A;  1ZAA C;  4WSG A;  2EMC A;  4R2P A;  2EM2 A;  2EQ0 A;  2LT7 A;  2YTE A;  1KJK A;  4R2D A;  2J7J A;  1X5W A;  4R2Q A;  2CTD A;  2EM6 A;  2MKN A;  2ENH A;  2EOS A;  2EN4 A;  2EL5 A;  5KL6 A;  1Z1B A;  2EOJ A;  2M9A A;  2EOF A;  2DRP A;  2EOY A;  2YRM A;  3EPL A;  1BB8 A;  2ADR A;  2PRT A;  1F2I G;  2EN2 A;  2D9H A;  2WBT A;  2EMF A;  2YTI A;  2EPR A;  2EN7 A;  2DLQ A;  2EMH A;  2YTG A;  2EMB A;  1JK2 A;  2ENA A;  4F6N A;  2LO3 A;  1G2F C;  1UN6 B;  2JP9 A;  4X9J A;  4IJD A;  2EOO A;  4R2R A;  3EPJ A;  2EN1 A;  2EOX A;  2EOI A;  2YRK A;  3M99 B;  1LLM C;  2DGC A;  4M9V C;  2EN6 A;  2EM4 A;  2EPZ A;  2CT1 A;  1YSA C;  2GLI A;  1X6H A;  2YTJ A;  2EOR A;  4R2A A;  2EOZ A;  2EPA A;  5KL2 A;  3MHS C;  1A1G A;  1MEY C;  2EJ4 A;  1B69 A; 
#chains in the Genus database with same CATH topology
 1JK1 A;  2RPC A;  2LTR A;  3MHH C;  2EM8 A;  1XNQ E;  4M2Z A;  2FTX B;  3FIG A;  2N8X A;  1UHZ A;  4WFT A;  4R2C A;  1BBO A;  1SFE A;  1A1I A;  2A25 A;  2JPA A;  3UK3 C;  2R1F A;  4J8Z A;  1DGC A;  2LJU A;  1YUI A;  3JAM C;  1XMQ E;  1N34 E;  2EN3 A;  2B7V A;  1EKZ A;  2HJJ A;  2L6M A;  2EMI A;  4GKK E;  4JI7 E;  4NXM E;  4LU9 A;  1IQS A;  2JVA A;  1N3G A;  4BHC A;  5KL7 A;  1FKA E;  2ZM6 E;  5A2Q C;  2YRH A;  1N32 E;  2YZT A;  4RH8 A;  2EWL A;  3IWD A;  3RMP A;  2EE8 A;  4WX9 A;  1L4S A;  2WBS A;  4RHB B;  4HEI A;  3ADJ A;  2L2K B;  2B7T A;  2NA2 A;  4ZYH A;  1XMO E;  4R8O A;  2YPN A;  4DMI A;  2UU9 E;  5KL4 A;  3JU0 A;  2VRD A;  1XNR E;  2ENC A;  3THO B;  2ODR D;  4BCA A;  4M0V A;  1A1F A;  3TQM A;  2EP3 A;  1BBG A;  2YU5 A;  4TUG A;  4F54 A;  2EMX A;  5AE3 A;  4DR7 E;  1ZAA C;  2EM2 A;  3C6K A;  2LT7 A;  4LF9 E;  2YTE A;  2NUG A;  3IWB A;  5AC5 A;  2J7J A;  4R2Q A;  5A69 A;  1J5E E;  5IWA E;  4DR3 E;  4JI3 E;  3MSW A;  2V85 A;  4JI1 E;  3BBG A;  1J26 A;  3L00 A;  2RS7 A;  4B3S E;  4LFC E;  4LFB E;  2YTI A;  5IV8 B;  5FLX C;  3AV0 A;  2EMB A;  2UXB E;  3THN A;  4F6N A;  4JV5 E;  2LO3 A;  3J80 C;  3ZOQ B;  2HC5 A;  4JI0 E;  1GZ6 A;  4DV7 E;  3H09 A;  4X9J A;  5A6J A;  4L8N A;  2EN1 A;  5ADZ A;  2EPN A;  2YRK A;  2EN6 A;  3KZY A;  4BBY A;  1YSA C;  2GLI A;  3VK6 A;  2LBS B;  2EOR A;  4O43 A;  5KL2 A;  2EJ4 A;  1PDA A;  2L33 A;  4K0K E;  5A6A A;  2MC6 A;  1T4N A;  3T1Y E;  1ZU1 A;  5LLQ A;  4OX9 E;  2JR1 A;  1X6E A;  2Q8U A;  1TF6 A;  2CSH A;  2YWQ A;  2EM0 A;  1TF3 A;  2ODR C;  3C4B A;  4X8W A;  4DKK A;  1WJP A;  2NUE A;  2IHR 1;  1A1L A;  2F4V E;  4N4R B;  2EMY A;  2ELY A;  2EPP A;  3F6G A;  3IWC A;  1YZ9 A;  5TSE A;  5BR8 E;  3C6M A;  2LUP B;  2I9I A;  2HGH A;  5F3W A;  1HNZ E;  1AAY A;  2EM7 A;  2EMZ A;  2N3H A;  2DMY A;  2L8T A;  2L2M A;  4F9B B;  1IBK E;  2EQ3 A;  4BC7 A;  2H36 X;  5AC4 A;  3AUZ A;  1YFH A;  3VYX A;  2YTP A;  4BMJ A;  4JI6 E;  3HXL A;  1ZR9 A;  1TN9 A;  2EOQ A;  5AAS A;  2JOB A;  5CFF E;  4LF5 E;  2UXC E;  4GKJ E;  3DF6 A;  4JI8 E;  4WSG A;  2EMC A;  4R2P A;  2EQ0 A;  3BID A;  4R2D A;  4NXN E;  4BHB A;  4KZS A;  2ENH A;  1DQ3 A;  3J7Y p;  4DV5 E;  2EN4 A;  1SR9 A;  2EL5 A;  2EPO A;  2EOJ A;  1YYK A;  2FGG A;  2V8Q B;  3EPL A;  2DSY A;  2K7I A;  2WZO A;  3LLH A;  1BB8 A;  2ADR A;  2PRT A;  4O4K A;  1F2I G;  1KYQ A;  2WBT A;  2EMF A;  2EPR A;  4WXC A;  3JTZ A;  2V89 A;  1JK2 A;  4LF8 E;  1IQO A;  1DI2 A;  4YY3 E;  4R2R A;  4O5G A;  4JI2 E;  2EOX A;  1UIL A;  2EOI A;  2KOU A;  4DV0 E;  3T1H E;  2EPZ A;  2CT1 A;  1X48 A;  4X62 E;  1IBL E;  4ZYD A;  2L3C A;  2LJH A;  2V87 A;  2VE7 C;  5AE2 A;  4X65 E;  3HQ1 A;  2B9D A;  4P7D A;  4DV6 E;  2HHH E;  1B69 A;  2MC5 A;  4FK5 C;  2UUC E;  2BB8 A;  3VYY A;  4M30 A;  1EH6 A;  2JXP A;  2CPN A;  2LVH A;  2MDR A;  2LV2 A;  2EMG A;  4DV1 E;  2B3T B;  4KHP E;  2EMK A;  2UXD E;  2LE2 A;  2RSI A;  2G7H A;  4R2S A;  4P78 A;  4ZYE A;  1A1H A;  2DMI A;  2MKD A;  5IT9 C;  4TUI A;  4LF4 E;  2VF1 A;  4DV2 E;  2JWO A;  1UBD C;  2L2N A;  1AH5 A;  1O0W A;  2EL4 A;  2EOH A;  2YTD A;  2EM9 A;  3P1X A;  1T39 A;  1PJT A;  2NUF A;  4NHR A;  1PJQ A;  2YTN A;  2R76 A;  1WXR A;  1GTK A;  1P47 A;  1A1J A;  2YU8 A;  2EPX A;  1YUJ A;  2EMA A;  2RS6 A;  2EM5 A;  4F9A B;  4GZN C;  3HPZ A;  1IMU A;  1NEI A;  4F6M A;  3EPK A;  4MLV A;  4JI4 E;  4NZV A;  4L5N C;  5KL3 A;  4F2J C;  3OML A;  1HR0 E;  2DB2 A;  2EPU A;  2DLK A;  4DV4 E;  4YHH E;  1T38 A;  1QU6 A;  3J81 C;  2JY9 A;  2UUA E;  2GHF A;  4R03 A;  2EN8 A;  1X6F A;  2V88 A;  1RQ0 A;  1IBM E;  1KJK A;  1X5W A;  2E1M A;  2CTD A;  2EM6 A;  2MKN A;  2JYA A;  3K6Q A;  2VQF E;  2KON A;  2YT4 A;  5KL6 A;  1Z1B A;  4JI5 E;  1PKP A;  4OOG C;  1YPN A;  2EOY A;  2YRM A;  3KWR A;  4GEQ B;  2L92 A;  3ADG A;  2EN2 A;  2D9H A;  4HTG A;  1T4O A;  4WPY A;  2YTG A;  4X64 E;  3EQ1 A;  4DUY E;  2ENA A;  4LFA E;  4DR4 E;  2JP9 A;  3KZZ A;  3C4T A;  1LLM C;  3HTX A;  2EM4 A;  4Q35 B;  2DIX A;  3ADL A;  2VQE E;  1WRJ A;  2BBG A;  2GPI A;  2RQL A;  3ECR A;  4B3T E;  1A1G A;  3MHS C;  1PJS A;  3F6H A;  3EPH A;  2YSP A;  4BS9 A;  2L3J A;  2M1S A;  2N3G A;  2YTO A;  2JOX A;  2WBU A;  2EMW A;  2EL6 A;  5LMN E;  2EML A;  1STU A;  2FV4 B;  2WCC 3;  4DR2 E;  4DV3 E;  3HPS A;  2EQ1 A;  4MLQ A;  5A6B D;  3ADI A;  5A6B A;  2EPC A;  2K4V A;  3BGH A;  4DR6 E;  4WSP A;  4LTY A;  2LMZ A;  3VHT B;  2I13 A;  2E5L E;  3DJW A;  4IS1 C;  2E72 A;  2LCE A;  2ELZ A;  4B3M E;  2YSO A;  2EPK X;  4DR5 E;  4JYA E;  1X3C A;  2MDG A;  2V86 A;  2EM3 A;  1RMD A;  1ZBT A;  4LF7 E;  5AE1 A;  2EZ6 A;  1A1K A;  1X49 A;  2EPL X;  2YTQ A;  2YTF A;  2NAB A;  1MGT A;  1ZBQ A;  4I8O A;  4Q28 A;  1WHQ A;  2EOM A;  4KWY A;  5KL5 A;  2EOE A;  5A6K A;  1G2D C;  4O24 A;  4DUZ E;  4R2E A;  1T4L B;  2UUB E;  1EH8 A;  1NCS A;  1FJG E;  1YYW A;  2F8B A;  4AQY E;  1YYO A;  2V83 A;  2LTS A;  1X47 A;  4LF6 E;  2EOS A;  1N33 E;  2RSM A;  3J7A G;  2M9A A;  2EOF A;  2DRP A;  2M4I A;  3QG5 C;  5DNY A;  2EPM X;  5T6J A;  4DR1 E;  5IXM B;  2M7Q A;  1RC7 A;  4X66 E;  2EN7 A;  1GQE A;  2DLQ A;  2EMH A;  4WYQ B;  5LL6 R;  3OTO E;  2KHX A;  1QNT A;  1G2F C;  1UN6 B;  2LRS A;  4IJD A;  2EOO A;  3EPJ A;  1HNX E;  5LMU E;  3BF2 A;  3M99 B;  1I94 E;  4M9V C;  1EH7 A;  2DGC A;  4BC9 A;  4B3R E;  1HNW E;  1N36 E;  3LML A;  4WXD A;  1X6H A;  2YTJ A;  4ZYG A;  4R2A A;  1WHN A;  2EOZ A;  2EPA A;  2RTX A;  1MEY C;  4F9C B;  2LUQ A; 
#chains in the Genus database with same CATH homology
 1JK1 A;  2RPC A;  2YSP A;  3EPH A;  3MHH C;  2EM8 A;  4FK5 C;  2BB8 A;  2YTO A;  1ZU1 A;  4R2C A;  1BBO A;  2WBU A;  1X6E A;  2A25 A;  2LVH A;  1A1I A;  2LV2 A;  2EMW A;  2EL6 A;  2EMG A;  2CSH A;  2EML A;  2R1F A;  3UK3 C;  1DGC A;  1TF6 A;  2JPA A;  2EM0 A;  1TF3 A;  2EMK A;  1YUI A;  2EN3 A;  2WCC 3;  2RSI A;  2EQ1 A;  1WJP A;  2EMI A;  4R2S A;  2EPC A;  1A1H A;  2DMI A;  1A1L A;  2EMY A;  2MKD A;  2ELY A;  2EPP A;  5KL7 A;  1UBD C;  3VHT B;  2YRH A;  2I13 A;  2EOH A;  2EL4 A;  2YTD A;  2EM9 A;  4IS1 C;  2EE8 A;  2E72 A;  2WBS A;  2LCE A;  2ELZ A;  2YSO A;  2YTN A;  1P47 A;  2HGH A;  1A1J A;  2YU8 A;  2EPX A;  1AAY A;  1YUJ A;  1X3C A;  2EMA A;  2MDG A;  2EM5 A;  4GZN C;  2EM3 A;  1RMD A;  2EM7 A;  5KL4 A;  2EMZ A;  1A1K A;  4F6M A;  2YTQ A;  3EPK A;  2VRD A;  2YTF A;  4F2J C;  5KL3 A;  2ENC A;  2NAB A;  2EQ3 A;  1A1F A;  2EPU A;  2DLK A;  2YTP A;  2EP3 A;  2YU5 A;  2EOM A;  5KL5 A;  2EOE A;  1ZR9 A;  1G2D C;  1TN9 A;  2EOQ A;  2EMX A;  4R2E A;  2GHF A;  1NCS A;  2EN8 A;  1X6F A;  1ZAA C;  4WSG A;  2EMC A;  4R2P A;  2EM2 A;  2EQ0 A;  2LT7 A;  2YTE A;  1KJK A;  4R2D A;  2J7J A;  1X5W A;  4R2Q A;  2CTD A;  2EM6 A;  2MKN A;  2ENH A;  2EOS A;  2EN4 A;  2EL5 A;  5KL6 A;  1Z1B A;  2EOJ A;  2M9A A;  2EOF A;  2DRP A;  2EOY A;  2YRM A;  3EPL A;  1BB8 A;  2ADR A;  2PRT A;  1F2I G;  2EN2 A;  2D9H A;  2WBT A;  2EMF A;  2YTI A;  2EPR A;  2EN7 A;  2DLQ A;  2EMH A;  2YTG A;  2EMB A;  1JK2 A;  2ENA A;  4F6N A;  2LO3 A;  1G2F C;  1UN6 B;  2JP9 A;  4X9J A;  4IJD A;  2EOO A;  4R2R A;  3EPJ A;  2EN1 A;  2EOX A;  2EOI A;  2YRK A;  3M99 B;  1LLM C;  2DGC A;  4M9V C;  2EN6 A;  2EM4 A;  2EPZ A;  2CT1 A;  1YSA C;  2GLI A;  1X6H A;  2YTJ A;  2EOR A;  4R2A A;  2EOZ A;  2EPA A;  5KL2 A;  3MHS C;  1A1G A;  1MEY C;  2EJ4 A;  1B69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...