2WCC3

Phage lambda intdbd1-64 complex with p prime 2 dna
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
b'MGRRRSHERRDLPPNLYIRNNGYYCYRDPRTGKEFGLGRDRRIAITEAIQANIELFSGHKHKPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*DCP*DGP*DAP*DGP*DTP*DCP*DAP *DAP*DAP*DAP*DTP*DC)-
publication title NMR Structure of the Amino-Terminal Domain of the Lambda Integrase Protein in Complex with DNA: Immobilization of a Flexible Tail Facilitates Beta- Sheet Recognition of the Major Groove.
pubmed doi rcsb
source organism Enterobacteria phage lambda
molecule tags Protein/dna
total genus 11
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2009-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2wcc300
2EPUA 2EE8A 1X6EA 2YTJA 2ELYA 2EMAA 2YSPA 2LT7A 1Z1BA 2EMWA 2RSIA 1TF6A 2I13A 1A1GA 2WCC3 2EOFA 4R2SA 1ZAAC 2YTPA 2EN8A 1G2DC 1UN6B 2LVHA 2YU8A 2EOIA 2LCEA 2EOJA 3UK3C 2EMHA 2J7JA 2MKNA 2EN3A 1DGCA 2EMZA 4R2AA 2WBTA 2EM4A 4F2JC 2CTDA 4X9JA 1KJKA 1A1IA 2EP3A 2CSHA 2EOHA 2EMKA 4R2DA 3M99B 1TF3A 1X5WA 2EMGA 2D9HA 3EPLA 5KL3A 2MKDA 3MHSC 2GLIA 2YTGA 3EPHA 3VHTB 2EM6A 1LLMC 3EPJA 1A1KA 1RMDA 2CT1A 2PRTA 1F2IG 2HGHA 2EL6A 5KL2A 1JK2A 1ZR9A 2EPCA 3MHHC 2WBUA 3EPKA 4WSGA 1JK1A 2M9AA 2LO3A 2A25A 2EM2A 2EMCA 2MDGA 2EOEA 1TN9A 2EM9A 2EN1A 2YTDA 4R2EA 2BB8A 2EN2A 4IS1C 2DLQA 2EPXA 2YRMA 4R2RA 2EMYA 4F6NA 2ADRA 2EOMA 4IJDA 2YSOA 2JPAA 1X6FA 2EOYA 1X3CA 2YRKA 4R2CA 1A1LA 2EQ0A 2ENCA 2EM0A 1BB8A 2EPZA 1BBOA 1UBDC 2JP9A 2DLKA 2E72A 4FK5C 2EL4A 2GHFA 2EOSA 1AAYA 2EMBA 2EQ3A 2YTIA 2DMIA 4GZNC 5KL4A 2EPAA 4R2QA 1X6HA 2YTNA 2YU5A 5KL6A 1YUJA 2EM5A 2EOQA 2EJ4A 2DRPA 2YTFA 1NCSA 2EM3A 2LV2A 2EN6A 2VRDA 2RPCA 1A1FA 2YTEA 2EL5A 4F6MA 2NABA 2YTOA 2EN4A 1MEYC 2ENAA 2EM7A 2ENHA 1G2FC 5KL5A 1YUIA 1A1JA 4R2PA 1A1HA 5KL7A 2EMFA 2YRHA 2EMIA 2EQ1A 2EOZA 1B69A 2EORA 1YSAC 2EPRA 2EN7A 2WBSA 2EMXA 1P47A 1WJPA 2R1FA 2DGCA 4M9VC 2YTQA 1ZU1A 2EM8A 2EMLA 2EOXA 2EPPA 2ELZA 2EOOA
chains in the Genus database with same CATH superfamily
1IQSA 2EPUA 4F9CB 1PDAA 2LBSB 1T4OA 4ZYEA 2LUPB 2LT7A 1Z1BA 2EMWA 2RSIA 4TUIA 4R8OA 2L6MA 2V89A 4BHBA 1UN6B 2LCEA 4BHCA 2FGGA 5LMNE 2MKNA 3ADJA 4B3SE 1DGCA 2I9IA 4LF5E 4DUZE 1N36E 2ODRC 2JVAA 1KJKA 2EP3A 5F3WA 3J7Yp 1TF3A 4M30A 2LJHA 1X5WA 2F4VE 3MHSC 1EH6A 4NHRA 2RS6A 1YYKA 4WFTA 2DB2A 2EM6A 3VHTB 1RMDA 2CT1A 3P1XA 5KL2A 1YPNA 1JK2A 1ZR9A 2EPCA 4YHHE 1AH5A 2EOEA 2EN1A 2YTDA 2BB8A 2EN2A 4LF9E 2VE7C 4R2RA 3ADLA 3HXLA 4DR1E 3C4BA 2YSOA 3MSWA 2UXCE 1X6FA 2EOYA 1X3CA 2YRKA 4HEIA 4X66E 2V87A 1BB8A 2EPZA 1BBOA 3ADIA 2GHFA 1AAYA 1YYOA 2YTIA 1BBGA 2DIXA 2DMIA 3QG5C 4GZNC 3VYYA 3OMLA 4R2QA 5TSEA 2MDRA 4JI0E 2UUBE 2BBGA 5IT9C 3OTOE 2LUQA 2RPCA 4B3RE 4DV3E 4F6MA 3AUZA 4JI5E 4ZYHA 2HJJA 5ADZA 1MEYC 2HHHE 1O0WA 2UXDE 3DJWA 2R76A 1A1HA 2YPNA 1UILA 5KL7A 5AC4A 2EN7A 3L00A 1WJPA 4L8NA 1ZU1A 2EMLA 2EOXA 2I13A 3HTXA 2VQFE 4DR4E 4BCAA 2YWQA 4DV2E 1WHNA 4NZVA 2ODRD 1XMQE 4DV0E 4JI2E 2V85A 1T4LB 5LMUE 1A1GA 2B7VA 4DR3E 1IBKE 2EOFA 2MC6A 3AV0A 1ZAAC 1G2DC 5A6AA 2LVHA 2YU8A 2EOIA 4MLVA 5AE3A 4NXME 3C6MA 4TUGA 2G7HA 2EMHA 2J7JA 3C6KA 4MLQA 3J7AG 2B3TB 2FTXB 4AQYE 4LFAE 2LMZA 2M4IA 2CSHA 2N3HA 5DNYA 1ZBTA 1N3GA 1EH7A 2EMGA 2D9HA 5IXMB 3RMPA 1T38A 2UU9E 4B3TE 4KHPE 3C4TA 2EPLX 4LF8E 2KOUA 1A1KA 1L4SA 3EPKA 1IMUA 4O43A 2EZ6A 2EM2A 1TN9A 2JWOA 4R2EA 1I94E 4DKKA 2DLQA 2JY9A 2YRMA 1RQ0A 4LF7E 2EMYA 2Q8UA 2RTXA 4IJDA 4DMIA 2JOBA 5LLQA 2JOXA 4R2CA 1YFHA 1A1LA 2EM0A 2EPKX 4X65E 2E72A 4RH8A 2EL4A 2L92A 4X64E 4J8ZA 3K6QA 1STUA 2EPAA 1X6HA 4YY3E 1FKAE 4JI7E 1YUJA 2DSYA 2EM5A 2EOQA 4JI3E 2V88A 1NCSA 1EH8A 2VRDA 1WXRA 1T4NA 1XNQE 1GTKA 1N32E 2NABA 1SFEA 4DR5E 5T6JA 2ENAA 2LE2A 3JTZA 4R2PA 4WSPA 4WXCA 2V83A 2EQ1A 2EPRA 4M2ZA 2EMXA 2E1MA 4JI8E 2R1FA 4M9VC 2EM8A 2JXPA 2EPPA 3FIGA 2EOOA 1PJTA 4DV7E 2EE8A 4DR7E 2YTJA 2L3CA 2ELYA 1N33E 3THNA 2LTRA 1TF6A 4M0VA 4DV4E 3ADGA 2WCC3 1DI2A 2M1SA 2YTPA 4JV5E 5IV8B 2EOJA 2EPMX 3H09A 4LTYA 2EN3A 2N3GA 2H36X 2EMZA 1GQEA 1HNZE 2EM4A 4X9JA 1ZBQA 2M7QA 4F9BB 4R2DA 2NUGA 4DUYE 5A6KA 5FLXC 2MKDA 2EWLA 3BGHA 4LU9A 4B3ME 1LLMC 3EPJA 2PRTA 1F2IG 2LJUA 2HGHA 2EL6A 1PJQA 1T39A 2EPOA 4K0KE 1RC7A 3TQMA 2L2MA 1IBME 4WSGA 1JK1A 4Q35B 1X49A 2L8TA 2A25A 2MDGA 2EM9A 3EQ1A 4LFBE 2K4VA 2EPXA 3F6GA 3HPSA 4JI6E 4F6NA 4OOGC 3J81C 2KONA 1YYWA 1WHQA 3IWCA 2ZM6E 2JPAA 3HQ1A 5BR8E 2EQ0A 2RSMA 2DLKA 4BC7A 4I8OA 2B9DA 4O24A 2EMBA 1FJGE 4DR6E 4WXDA 2VQEE 4O5GA 3THOB 4GEQB 1EKZA 2NUEA 2YU5A 2JR1A 5KL6A 4BBYA 3BIDA 3VYXA 2DRPA 2YTFA 2EM3A 2NA2A 3F6HA 5AASA 2RS7A 5LL6R 1IBLE 1IQOA 5AE2A 1A1FA 4JYAE 2EL5A 2F8BA 2HC5A 3T1YE 2YZTA 3JAMC 2ENHA 4DR2E 5KL5A 1YUIA 4ZYDA 4LF6E 2EMFA 2YRHA 1QNTA 2LRSA 2UXBE 2B7TA 1B69A 1YSAC 1J26A 1NEIA 2DGCA 4JI1E 2YTQA 4F54A 5A6JA 1SR9A 1X6EA 4DV5E 3LLHA 4RHBB 4BMJA 2EMAA 3HPZA 2YSPA 3T1HE 4KZSA 2WZOA 5AC5A 4R2SA 2UUCE 2EN8A 3UK3C 4DV1E 2L3JA 2L2NA 4OX9E 3BF2A 4LF4E 4R2AA 1GZ6A 2WBTA 3ECRA 4X62E 2L2KB 1PJSA 2CTDA 4F2JC 1PKPA 4KWYA 2RQLA 1A1IA 3BBGA 3VK6A 2EOHA 2EMKA 3M99B 4BC9A 3EPLA 1XMOE 5KL3A 2GLIA 2YTGA 3EPHA 3DF6A 2YT4A 4GKJE 2L33A 5AE1A 1X48A 2V8QB 4NXNE 3MHHC 2WBUA 2M9AA 2LO3A 4BS9A 1N34E 2EMCA 4IS1C 3LMLA 1HNXE 4LFCE 4P78A 2MC5A 4WPYA 2ADRA 2EOMA 2N8XA 5CFFE 3IWDA 5A6BD 5A6BA 4L5NC 4WYQB 2ENCA 4Q28A 2EPNA 1X47A 2VF1A 3JU0A 4X8WA 1UBDC 2JP9A 4FK5C 2EOSA 4F9AB 2EQ3A 2JYAA 4GKKE 4R03A 2K7IA 2NUFA 4WX9A 1UHZA 5KL4A 2YTNA 5A69A 4P7DA 1HR0E 1J5EE 2EJ4A 3ZOQB 4HTGA 5IWAE 1KYQA 2LV2A 2IHR1 3IWBA 3J80C 2EN6A 2CPNA 2YTEA 4JI4E 5A2QC 1YZ9A 2YTOA 2V86A 4N4RB 1QU6A 3KWRA 3KZYA 2EN4A 1WRJA 4ZYGA 1MGTA 2EM7A 1G2FC 4O4KA 1DQ3A 1A1JA 1HNWE 2FV4B 2LTSA 1XNRE 2EMIA 2EOZA 2EORA 2WBSA 2DMYA 2UUAE 4DV6E 1P47A 2KHXA 2E5LE 3KZZA 2GPIA 2ELZA
chains in the Genus database with same CATH topology
2EPUA 2EE8A 1X6EA 2YTJA 2ELYA 2EMAA 2YSPA 2LT7A 1Z1BA 2EMWA 2RSIA 1TF6A 2I13A 1A1GA 2WCC3 2EOFA 4R2SA 1ZAAC 2YTPA 2EN8A 1G2DC 1UN6B 2LVHA 2YU8A 2EOIA 2LCEA 2EOJA 3UK3C 2EMHA 2J7JA 2MKNA 2EN3A 1DGCA 2EMZA 4R2AA 2WBTA 2EM4A 4F2JC 2CTDA 4X9JA 1KJKA 1A1IA 2EP3A 2CSHA 2EOHA 2EMKA 4R2DA 3M99B 1TF3A 1X5WA 2EMGA 2D9HA 3EPLA 5KL3A 2MKDA 3MHSC 2GLIA 2YTGA 3EPHA 3VHTB 2EM6A 1LLMC 3EPJA 1A1KA 1RMDA 2CT1A 2PRTA 1F2IG 2HGHA 2EL6A 5KL2A 1JK2A 1ZR9A 2EPCA 3MHHC 2WBUA 3EPKA 4WSGA 1JK1A 2M9AA 2LO3A 2A25A 2EM2A 2EMCA 2MDGA 2EOEA 1TN9A 2EM9A 2EN1A 2YTDA 4R2EA 2BB8A 2EN2A 4IS1C 2DLQA 2EPXA 2YRMA 4R2RA 2EMYA 4F6NA 2ADRA 2EOMA 4IJDA 2YSOA 2JPAA 1X6FA 2EOYA 1X3CA 2YRKA 4R2CA 1A1LA 2EQ0A 2ENCA 2EM0A 1BB8A 2EPZA 1BBOA 1UBDC 2JP9A 2DLKA 2E72A 4FK5C 2EL4A 2GHFA 2EOSA 1AAYA 2EMBA 2EQ3A 2YTIA 2DMIA 4GZNC 5KL4A 2EPAA 4R2QA 1X6HA 2YTNA 2YU5A 5KL6A 1YUJA 2EM5A 2EOQA 2EJ4A 2DRPA 2YTFA 1NCSA 2EM3A 2LV2A 2EN6A 2VRDA 2RPCA 1A1FA 2YTEA 2EL5A 4F6MA 2NABA 2YTOA 2EN4A 1MEYC 2ENAA 2EM7A 2ENHA 1G2FC 5KL5A 1YUIA 1A1JA 4R2PA 1A1HA 5KL7A 2EMFA 2YRHA 2EMIA 2EQ1A 2EOZA 1B69A 2EORA 1YSAC 2EPRA 2EN7A 2WBSA 2EMXA 1P47A 1WJPA 2R1FA 2DGCA 4M9VC 2YTQA 1ZU1A 2EM8A 2EMLA 2EOXA 2EPPA 2ELZA 2EOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPU A;  2EE8 A;  1X6E A;  2YTJ A;  2ELY A;  2EMA A;  2YSP A;  2LT7 A;  1Z1B A;  2EMW A;  2RSI A;  1TF6 A;  2I13 A;  1A1G A;  2WCC 3;  2EOF A;  4R2S A;  1ZAA C;  2YTP A;  2EN8 A;  1G2D C;  1UN6 B;  2LVH A;  2YU8 A;  2EOI A;  2LCE A;  2EOJ A;  3UK3 C;  2EMH A;  2J7J A;  2MKN A;  2EN3 A;  1DGC A;  2EMZ A;  4R2A A;  2WBT A;  2EM4 A;  4F2J C;  2CTD A;  4X9J A;  1KJK A;  1A1I A;  2EP3 A;  2CSH A;  2EOH A;  2EMK A;  4R2D A;  3M99 B;  1TF3 A;  1X5W A;  2EMG A;  2D9H A;  3EPL A;  5KL3 A;  2MKD A;  3MHS C;  2GLI A;  2YTG A;  3EPH A;  3VHT B;  2EM6 A;  1LLM C;  3EPJ A;  1A1K A;  1RMD A;  2CT1 A;  2PRT A;  1F2I G;  2HGH A;  2EL6 A;  5KL2 A;  1JK2 A;  1ZR9 A;  2EPC A;  3MHH C;  2WBU A;  3EPK A;  4WSG A;  1JK1 A;  2M9A A;  2LO3 A;  2A25 A;  2EM2 A;  2EMC A;  2MDG A;  2EOE A;  1TN9 A;  2EM9 A;  2EN1 A;  2YTD A;  4R2E A;  2BB8 A;  2EN2 A;  4IS1 C;  2DLQ A;  2EPX A;  2YRM A;  4R2R A;  2EMY A;  4F6N A;  2ADR A;  2EOM A;  4IJD A;  2YSO A;  2JPA A;  1X6F A;  2EOY A;  1X3C A;  2YRK A;  4R2C A;  1A1L A;  2EQ0 A;  2ENC A;  2EM0 A;  1BB8 A;  2EPZ A;  1BBO A;  1UBD C;  2JP9 A;  2DLK A;  2E72 A;  4FK5 C;  2EL4 A;  2GHF A;  2EOS A;  1AAY A;  2EMB A;  2EQ3 A;  2YTI A;  2DMI A;  4GZN C;  5KL4 A;  2EPA A;  4R2Q A;  1X6H A;  2YTN A;  2YU5 A;  5KL6 A;  1YUJ A;  2EM5 A;  2EOQ A;  2EJ4 A;  2DRP A;  2YTF A;  1NCS A;  2EM3 A;  2LV2 A;  2EN6 A;  2VRD A;  2RPC A;  1A1F A;  2YTE A;  2EL5 A;  4F6M A;  2NAB A;  2YTO A;  2EN4 A;  1MEY C;  2ENA A;  2EM7 A;  2ENH A;  1G2F C;  5KL5 A;  1YUI A;  1A1J A;  4R2P A;  1A1H A;  5KL7 A;  2EMF A;  2YRH A;  2EMI A;  2EQ1 A;  2EOZ A;  1B69 A;  2EOR A;  1YSA C;  2EPR A;  2EN7 A;  2WBS A;  2EMX A;  1P47 A;  1WJP A;  2R1F A;  2DGC A;  4M9V C;  2YTQ A;  1ZU1 A;  2EM8 A;  2EML A;  2EOX A;  2EPP A;  2ELZ A;  2EOO A; 
#chains in the Genus database with same CATH topology
 1IQS A;  2EPU A;  4F9C B;  1PDA A;  2LBS B;  1T4O A;  4ZYE A;  2LUP B;  2LT7 A;  1Z1B A;  2EMW A;  2RSI A;  4TUI A;  4R8O A;  2L6M A;  2V89 A;  4BHB A;  1UN6 B;  2LCE A;  4BHC A;  2FGG A;  5LMN E;  2MKN A;  3ADJ A;  4B3S E;  1DGC A;  2I9I A;  4LF5 E;  4DUZ E;  1N36 E;  2ODR C;  2JVA A;  1KJK A;  2EP3 A;  5F3W A;  3J7Y p;  1TF3 A;  4M30 A;  2LJH A;  1X5W A;  2F4V E;  3MHS C;  1EH6 A;  4NHR A;  2RS6 A;  1YYK A;  4WFT A;  2DB2 A;  2EM6 A;  3VHT B;  1RMD A;  2CT1 A;  3P1X A;  5KL2 A;  1YPN A;  1JK2 A;  1ZR9 A;  2EPC A;  4YHH E;  1AH5 A;  2EOE A;  2EN1 A;  2YTD A;  2BB8 A;  2EN2 A;  4LF9 E;  2VE7 C;  4R2R A;  3ADL A;  3HXL A;  4DR1 E;  3C4B A;  2YSO A;  3MSW A;  2UXC E;  1X6F A;  2EOY A;  1X3C A;  2YRK A;  4HEI A;  4X66 E;  2V87 A;  1BB8 A;  2EPZ A;  1BBO A;  3ADI A;  2GHF A;  1AAY A;  1YYO A;  2YTI A;  1BBG A;  2DIX A;  2DMI A;  3QG5 C;  4GZN C;  3VYY A;  3OML A;  4R2Q A;  5TSE A;  2MDR A;  4JI0 E;  2UUB E;  2BBG A;  5IT9 C;  3OTO E;  2LUQ A;  2RPC A;  4B3R E;  4DV3 E;  4F6M A;  3AUZ A;  4JI5 E;  4ZYH A;  2HJJ A;  5ADZ A;  1MEY C;  2HHH E;  1O0W A;  2UXD E;  3DJW A;  2R76 A;  1A1H A;  2YPN A;  1UIL A;  5KL7 A;  5AC4 A;  2EN7 A;  3L00 A;  1WJP A;  4L8N A;  1ZU1 A;  2EML A;  2EOX A;  2I13 A;  3HTX A;  2VQF E;  4DR4 E;  4BCA A;  2YWQ A;  4DV2 E;  1WHN A;  4NZV A;  2ODR D;  1XMQ E;  4DV0 E;  4JI2 E;  2V85 A;  1T4L B;  5LMU E;  1A1G A;  2B7V A;  4DR3 E;  1IBK E;  2EOF A;  2MC6 A;  3AV0 A;  1ZAA C;  1G2D C;  5A6A A;  2LVH A;  2YU8 A;  2EOI A;  4MLV A;  5AE3 A;  4NXM E;  3C6M A;  4TUG A;  2G7H A;  2EMH A;  2J7J A;  3C6K A;  4MLQ A;  3J7A G;  2B3T B;  2FTX B;  4AQY E;  4LFA E;  2LMZ A;  2M4I A;  2CSH A;  2N3H A;  5DNY A;  1ZBT A;  1N3G A;  1EH7 A;  2EMG A;  2D9H A;  5IXM B;  3RMP A;  1T38 A;  2UU9 E;  4B3T E;  4KHP E;  3C4T A;  2EPL X;  4LF8 E;  2KOU A;  1A1K A;  1L4S A;  3EPK A;  1IMU A;  4O43 A;  2EZ6 A;  2EM2 A;  1TN9 A;  2JWO A;  4R2E A;  1I94 E;  4DKK A;  2DLQ A;  2JY9 A;  2YRM A;  1RQ0 A;  4LF7 E;  2EMY A;  2Q8U A;  2RTX A;  4IJD A;  4DMI A;  2JOB A;  5LLQ A;  2JOX A;  4R2C A;  1YFH A;  1A1L A;  2EM0 A;  2EPK X;  4X65 E;  2E72 A;  4RH8 A;  2EL4 A;  2L92 A;  4X64 E;  4J8Z A;  3K6Q A;  1STU A;  2EPA A;  1X6H A;  4YY3 E;  1FKA E;  4JI7 E;  1YUJ A;  2DSY A;  2EM5 A;  2EOQ A;  4JI3 E;  2V88 A;  1NCS A;  1EH8 A;  2VRD A;  1WXR A;  1T4N A;  1XNQ E;  1GTK A;  1N32 E;  2NAB A;  1SFE A;  4DR5 E;  5T6J A;  2ENA A;  2LE2 A;  3JTZ A;  4R2P A;  4WSP A;  4WXC A;  2V83 A;  2EQ1 A;  2EPR A;  4M2Z A;  2EMX A;  2E1M A;  4JI8 E;  2R1F A;  4M9V C;  2EM8 A;  2JXP A;  2EPP A;  3FIG A;  2EOO A;  1PJT A;  4DV7 E;  2EE8 A;  4DR7 E;  2YTJ A;  2L3C A;  2ELY A;  1N33 E;  3THN A;  2LTR A;  1TF6 A;  4M0V A;  4DV4 E;  3ADG A;  2WCC 3;  1DI2 A;  2M1S A;  2YTP A;  4JV5 E;  5IV8 B;  2EOJ A;  2EPM X;  3H09 A;  4LTY A;  2EN3 A;  2N3G A;  2H36 X;  2EMZ A;  1GQE A;  1HNZ E;  2EM4 A;  4X9J A;  1ZBQ A;  2M7Q A;  4F9B B;  4R2D A;  2NUG A;  4DUY E;  5A6K A;  5FLX C;  2MKD A;  2EWL A;  3BGH A;  4LU9 A;  4B3M E;  1LLM C;  3EPJ A;  2PRT A;  1F2I G;  2LJU A;  2HGH A;  2EL6 A;  1PJQ A;  1T39 A;  2EPO A;  4K0K E;  1RC7 A;  3TQM A;  2L2M A;  1IBM E;  4WSG A;  1JK1 A;  4Q35 B;  1X49 A;  2L8T A;  2A25 A;  2MDG A;  2EM9 A;  3EQ1 A;  4LFB E;  2K4V A;  2EPX A;  3F6G A;  3HPS A;  4JI6 E;  4F6N A;  4OOG C;  3J81 C;  2KON A;  1YYW A;  1WHQ A;  3IWC A;  2ZM6 E;  2JPA A;  3HQ1 A;  5BR8 E;  2EQ0 A;  2RSM A;  2DLK A;  4BC7 A;  4I8O A;  2B9D A;  4O24 A;  2EMB A;  1FJG E;  4DR6 E;  4WXD A;  2VQE E;  4O5G A;  3THO B;  4GEQ B;  1EKZ A;  2NUE A;  2YU5 A;  2JR1 A;  5KL6 A;  4BBY A;  3BID A;  3VYX A;  2DRP A;  2YTF A;  2EM3 A;  2NA2 A;  3F6H A;  5AAS A;  2RS7 A;  5LL6 R;  1IBL E;  1IQO A;  5AE2 A;  1A1F A;  4JYA E;  2EL5 A;  2F8B A;  2HC5 A;  3T1Y E;  2YZT A;  3JAM C;  2ENH A;  4DR2 E;  5KL5 A;  1YUI A;  4ZYD A;  4LF6 E;  2EMF A;  2YRH A;  1QNT A;  2LRS A;  2UXB E;  2B7T A;  1B69 A;  1YSA C;  1J26 A;  1NEI A;  2DGC A;  4JI1 E;  2YTQ A;  4F54 A;  5A6J A;  1SR9 A;  1X6E A;  4DV5 E;  3LLH A;  4RHB B;  4BMJ A;  2EMA A;  3HPZ A;  2YSP A;  3T1H E;  4KZS A;  2WZO A;  5AC5 A;  4R2S A;  2UUC E;  2EN8 A;  3UK3 C;  4DV1 E;  2L3J A;  2L2N A;  4OX9 E;  3BF2 A;  4LF4 E;  4R2A A;  1GZ6 A;  2WBT A;  3ECR A;  4X62 E;  2L2K B;  1PJS A;  2CTD A;  4F2J C;  1PKP A;  4KWY A;  2RQL A;  1A1I A;  3BBG A;  3VK6 A;  2EOH A;  2EMK A;  3M99 B;  4BC9 A;  3EPL A;  1XMO E;  5KL3 A;  2GLI A;  2YTG A;  3EPH A;  3DF6 A;  2YT4 A;  4GKJ E;  2L33 A;  5AE1 A;  1X48 A;  2V8Q B;  4NXN E;  3MHH C;  2WBU A;  2M9A A;  2LO3 A;  4BS9 A;  1N34 E;  2EMC A;  4IS1 C;  3LML A;  1HNX E;  4LFC E;  4P78 A;  2MC5 A;  4WPY A;  2ADR A;  2EOM A;  2N8X A;  5CFF E;  3IWD A;  5A6B D;  5A6B A;  4L5N C;  4WYQ B;  2ENC A;  4Q28 A;  2EPN A;  1X47 A;  2VF1 A;  3JU0 A;  4X8W A;  1UBD C;  2JP9 A;  4FK5 C;  2EOS A;  4F9A B;  2EQ3 A;  2JYA A;  4GKK E;  4R03 A;  2K7I A;  2NUF A;  4WX9 A;  1UHZ A;  5KL4 A;  2YTN A;  5A69 A;  4P7D A;  1HR0 E;  1J5E E;  2EJ4 A;  3ZOQ B;  4HTG A;  5IWA E;  1KYQ A;  2LV2 A;  2IHR 1;  3IWB A;  3J80 C;  2EN6 A;  2CPN A;  2YTE A;  4JI4 E;  5A2Q C;  1YZ9 A;  2YTO A;  2V86 A;  4N4R B;  1QU6 A;  3KWR A;  3KZY A;  2EN4 A;  1WRJ A;  4ZYG A;  1MGT A;  2EM7 A;  1G2F C;  4O4K A;  1DQ3 A;  1A1J A;  1HNW E;  2FV4 B;  2LTS A;  1XNR E;  2EMI A;  2EOZ A;  2EOR A;  2WBS A;  2DMY A;  2UUA E;  4DV6 E;  1P47 A;  2KHX A;  2E5L E;  3KZZ A;  2GPI A;  2ELZ A; 
#chains in the Genus database with same CATH homology
 2EPU A;  2EE8 A;  1X6E A;  2YTJ A;  2ELY A;  2EMA A;  2YSP A;  2LT7 A;  1Z1B A;  2EMW A;  2RSI A;  1TF6 A;  2I13 A;  1A1G A;  2WCC 3;  2EOF A;  4R2S A;  1ZAA C;  2YTP A;  2EN8 A;  1G2D C;  1UN6 B;  2LVH A;  2YU8 A;  2EOI A;  2LCE A;  2EOJ A;  3UK3 C;  2EMH A;  2J7J A;  2MKN A;  2EN3 A;  1DGC A;  2EMZ A;  4R2A A;  2WBT A;  2EM4 A;  4F2J C;  2CTD A;  4X9J A;  1KJK A;  1A1I A;  2EP3 A;  2CSH A;  2EOH A;  2EMK A;  4R2D A;  3M99 B;  1TF3 A;  1X5W A;  2EMG A;  2D9H A;  3EPL A;  5KL3 A;  2MKD A;  3MHS C;  2GLI A;  2YTG A;  3EPH A;  3VHT B;  2EM6 A;  1LLM C;  3EPJ A;  1A1K A;  1RMD A;  2CT1 A;  2PRT A;  1F2I G;  2HGH A;  2EL6 A;  5KL2 A;  1JK2 A;  1ZR9 A;  2EPC A;  3MHH C;  2WBU A;  3EPK A;  4WSG A;  1JK1 A;  2M9A A;  2LO3 A;  2A25 A;  2EM2 A;  2EMC A;  2MDG A;  2EOE A;  1TN9 A;  2EM9 A;  2EN1 A;  2YTD A;  4R2E A;  2BB8 A;  2EN2 A;  4IS1 C;  2DLQ A;  2EPX A;  2YRM A;  4R2R A;  2EMY A;  4F6N A;  2ADR A;  2EOM A;  4IJD A;  2YSO A;  2JPA A;  1X6F A;  2EOY A;  1X3C A;  2YRK A;  4R2C A;  1A1L A;  2EQ0 A;  2ENC A;  2EM0 A;  1BB8 A;  2EPZ A;  1BBO A;  1UBD C;  2JP9 A;  2DLK A;  2E72 A;  4FK5 C;  2EL4 A;  2GHF A;  2EOS A;  1AAY A;  2EMB A;  2EQ3 A;  2YTI A;  2DMI A;  4GZN C;  5KL4 A;  2EPA A;  4R2Q A;  1X6H A;  2YTN A;  2YU5 A;  5KL6 A;  1YUJ A;  2EM5 A;  2EOQ A;  2EJ4 A;  2DRP A;  2YTF A;  1NCS A;  2EM3 A;  2LV2 A;  2EN6 A;  2VRD A;  2RPC A;  1A1F A;  2YTE A;  2EL5 A;  4F6M A;  2NAB A;  2YTO A;  2EN4 A;  1MEY C;  2ENA A;  2EM7 A;  2ENH A;  1G2F C;  5KL5 A;  1YUI A;  1A1J A;  4R2P A;  1A1H A;  5KL7 A;  2EMF A;  2YRH A;  2EMI A;  2EQ1 A;  2EOZ A;  1B69 A;  2EOR A;  1YSA C;  2EPR A;  2EN7 A;  2WBS A;  2EMX A;  1P47 A;  1WJP A;  2R1F A;  2DGC A;  4M9V C;  2YTQ A;  1ZU1 A;  2EM8 A;  2EML A;  2EOX A;  2EPP A;  2ELZ A;  2EOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...