2WCC3

Phage lambda intdbd1-64 complex with p prime 2 dna
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
MGRRRSHERRDLPPNLYIRNNGYYCYRDPRTGKEFGLGRDRRIAITEAIQANIELFSGHKHKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of the Amino-Terminal Domain of the Lambda Integrase Protein in Complex with DNA: Immobilization of a Flexible Tail Facilitates Beta- Sheet Recognition of the Major Groove.
pubmed doi rcsb
source organism Enterobacteria phage lambda
molecule tags Protein/dna
molecule keywords DNA (5'-D(*DCP*DGP*DAP*DGP*DTP*DCP*DAP *DAP*DAP*DAP*DTP*DC)-
total genus 11
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2009-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2wcc300
2LV2A 2EOIA 2WBTA 2EMIA 2EMFA 2ELYA 2EQ1A 1Z1BA 1UN6B 2NABA 3MHHC 2EL5A 5KL3A 2JPAA 2YTJA 2EM5A 3UK3C 2EP3A 1WJPA 2YTDA 2YU5A 2YRHA 2EOHA 1A1IA 1A1FA 2LT7A 2EN3A 2ENHA 2YU8A 1A1GA 2YTIA 2EPZA 2EN7A 5KL2A 3EPHA 2EMZA 2EOQA 1JK1A 2EPAA 2CTDA 2RSIA 2EJ4A 4FK5C 1G2FC 3EPJA 2EM3A 2EM6A 2EN6A 1X3CA 2YTPA 3VHTB 1ZAAC 1NCSA 1TN9A 2EPPA 2EORA 2CSHA 2ELZA 2YRKA 4R2SA 1RMDA 2EOZA 2M9AA 1A1HA 2EPCA 2EN1A 2WBUA 2EQ3A 2YTFA 3M99B 4IS1C 2EMLA 2EMAA 1ZR9A 1YUJA 2EOOA 2EE8A 2LCEA 1X6HA 3EPKA 2YSOA 1MEYC 2EMBA 2MDGA 1YSAC 2MKNA 2EPRA 5KL4A 2YTQA 2I13A 2EOEA 1BBOA 2GHFA 2D9HA 2YSPA 1X6FA 1X6EA 2DLKA 2EMHA 4R2AA 1LLMC 2DRPA 1YUIA 1DGCA 2DLQA 2MKDA 2YTOA 2EMWA 4R2RA 2EL6A 2JP9A 2EMYA 1X5WA 1KJKA 2EM4A 1P47A 1B69A 1ZU1A 2ENCA 5KL7A 4M9VC 2YTGA 2EL4A 2WCC3 2EN4A 2EM2A 1F2IG 2PRTA 1A1LA 3EPLA 2EM9A 2R1FA 2EOSA 2DGCA 1UBDC 2EPXA 2EOJA 4X9JA 1A1JA 2EOXA 2EOMA 2EN8A 1AAYA 2J7JA 2E72A 4F6NA 4F2JC 4R2EA 4F6MA 2EMXA 2EM7A 2EOYA 2VRDA 2CT1A 2LVHA 4R2CA 2EMCA 4R2DA 2EPUA 1JK2A 2HGHA 2BB8A 2EM0A 2A25A 4R2QA 2YTNA 1TF6A 5KL5A 2ADRA 2EQ0A 4WSGA 2EM8A 2EOFA 2LO3A 4GZNC 1A1KA 1G2DC 2WBSA 4R2PA 2EN2A 3MHSC 2GLIA 1BB8A 4IJDA 2DMIA 2EMKA 2YTEA 2EMGA 2RPCA 2ENAA 5KL6A 1TF3A 2YRMA
chains in the Genus database with same CATH superfamily
4RHBB 2FV4B 4MLQA 2BBGA 3MHHC 2B7VA 2EM5A 1WJPA 2YTDA 4JI0E 4N4RB 2EOHA 3T1HE 4BC9A 2YU8A 2ODRD 4BBYA 2JR1A 3ADGA 3VYYA 1JK1A 4ZYGA 2DB2A 2CTDA 1YYOA 1YFHA 2RSIA 1G2FC 2E1MA 3VHTB 1NCSA 2EORA 1N33E 3LLHA 4BHBA 4M2ZA 2EPLX 1YYWA 1YUJA 4JI5E 3VYXA 1X6HA 3LMLA 1MEYC 2EMBA 3TQMA 2MKNA 2EPRA 4MLVA 5KL4A 2EOEA 3HPZA 2DLKA 1YUIA 2DLQA 4LF8E 1SR9A 4JI8E 4AQYE 2EL6A 2EMYA 1X5WA 4LFCE 4X8WA 1XNRE 2EM4A 5FLXC 1P47A 1B69A 4WYQB 2JOBA 3IWCA 1IBME 1ZU1A 2H36X 2ENCA 4M9VC 1MGTA 4TUIA 4J8ZA 4RH8A 1WXRA 2B3TB 2L2MA 1T38A 2EM9A 2EOSA 3ECRA 4B3SE 1UBDC 5LL6R 4K0KE 3J80C 4NZVA 5IWAE 4WX9A 1AAYA 1L4SA 2ODRC 4F9AB 4F2JC 4JI2E 5LMUE 4F6MA 2EMXA 2EOYA 1T4LB 2RS7A 3BBGA 3HXLA 1PJQA 2LVHA 2EMCA 1UILA 2EPUA 1PDAA 4BC7A 2IHR1 4DUZE 2A25A 4R2QA 3HPSA 2YTNA 1TF6A 1IMUA 4DV0E 2EM8A 2EOFA 4O5GA 3F6GA 2WBSA 2EN2A 2VF1A 5AE2A 1BBGA 5IT9C 4HTGA 4DV1E 1X49A 2HC5A 4O4KA 1X47A 2EWLA 4F54A 1TF3A 4LF4E 2EMFA 3C4BA 1Z1BA 2B7TA 3C6KA 2EL5A 5KL3A 2EP3A 3VK6A 2YRHA 1YZ9A 4DUYE 4LF5E 2EPNA 2N8XA 2JY9A 2UXDE 2EN7A 1X48A 2NUGA 1PKPA 4NXNE 2EMZA 5LMNE 3EPHA 2EPAA 1IQSA 3ADIA 3ADLA 3AV0A 4LF9E 4R03A 4O24A 3K6QA 2EM6A 4DR2E 2JWOA 1ZAAC 1TN9A 2EPPA 3HTXA 2LBSB 2CSHA 2ELZA 2YRKA 3C6MA 4Q28A 5A6BA 2EPCA 2V8QB 2WBUA 4DV5E 2EMLA 4JI7E 2M7QA 2RQLA 4X62E 1T39A 2LCEA 2L3JA 2YSOA 2MDGA 1YSAC 4WFTA 2YTQA 4L5NC 1AH5A 1O0WA 2I13A 4LU9A 2D9HA 2YSPA 1RC7A 2EMHA 1DGCA 1EH8A 3JTZA 3C4TA 4R2RA 2M4IA 2JP9A 5IV8B 2JYAA 1WRJA 1KJKA 2L2KB 5KL7A 2EL4A 2WCC3 4DV2E 2EM2A 2LUPB 2PRTA 1A1LA 3OTOE 3EPLA 2R1FA 3J7AG 1IQOA 2KOUA 4DV7E 4X66E 2K7IA 4KZSA 4Q35B 4X9JA 1J5EE 2UUAE 4X64E 4KHPE 3THNA 2EPOA 2FGGA 3RMPA 2EM7A 2B9DA 1XMQE 2CT1A 4R2CA 4WPYA 2V85A 2LMZA 2EM0A 4B3RE 1HNWE 2F4VE 3QG5C 4LF7E 2ADRA 5DNYA 5AC4A 4KWYA 2GPIA 5A6JA 5F3WA 4GZNC 1A1KA 1N3GA 1N32E 2GLIA 4IJDA 1WHQA 2DMIA 3J81C 2YPNA 3L00A 2LE2A 2RPCA 1T4NA 2ENAA 5KL6A 3AUZA 2LV2A 5AC5A 2EPMX 2EMIA 2EQ1A 2MDRA 1UN6B 3FIGA 2JPAA 3UK3C 1IBLE 3MSWA 4F9CB 1A1FA 1WHNA 2LT7A 2EN3A 1A1GA 2HJJA 2YTIA 2NUFA 4B3ME 2YZTA 1N34E 1HR0E 3DF6A 4FK5C 2UUCE 3JAMC 2DIXA 2EN6A 5LLQA 2KHXA 3IWBA 1ZBQA 2EOZA 2EN1A 4OOGC 2YTFA 3M99B 4IS1C 2EMAA 2EOOA 2LUQA 4WXDA 2M1SA 1QU6A 3EPKA 1STUA 1SFEA 2NA2A 3F6HA 4DMIA 3J7Yp 1EH7A 1HNZE 1X6FA 1X6EA 4R2AA 4DR1E 2DRPA 3BGHA 2V83A 2MKDA 2EMWA 2V88A 3IWDA 1YYKA 1DI2A 5A6KA 2DSYA 2YTGA 5T6JA 4I8OA 2EN4A 1EH6A 4LFBE 4OX9E 2L92A 4JI1E 5AE3A 5IXMB 2L33A 2I9IA 5A69A 4TUGA 2RS6A 2JOXA 1A1JA 2FTXB 3JU0A 4ZYHA 4JI3E 5AE1A 2EN8A 5A6AA 4BCAA 2J7JA 2V89A 2E72A 4F6NA 4DR7E 4R2EA 2VRDA 2L2NA 5A2QC 2MC6A 4LTYA 4P78A 4DR5E 1EKZA 1RQ0A 1YPNA 4GKJE 4R2DA 2HGHA 5BR8E 1IBKE 4LF6E 1XNQE 3THOB 5KL5A 4JI4E 2LTRA 4M0VA 4DKKA 2EZ6A 1DQ3A 2LO3A 3H09A 1G2DC 2RSMA 4R2PA 1BB8A 4GKKE 4NHRA 2VQEE 2UUBE 2N3GA 3HQ1A 2WZOA 1FKAE 2NABA 2L6MA 1BBOA 2EOIA 2WBTA 3ADJA 1HNXE 2E5LE 2ELYA 4L8NA 2L3CA 2YTJA 4BMJA 1XMOE 2YU5A 4DV3E 1A1IA 4DR6E 2RTXA 2UXCE 2K4VA 3P1XA 1ZBTA 4DV6E 2ENHA 2YT4A 2EPZA 4M30A 4B3TE 4R8OA 5KL2A 2EOQA 2JVAA 2UU9E 1GTKA 2EJ4A 2NUEA 3EPJA 2EM3A 1PJSA 1X3CA 2YTPA 4NXME 4BS9A 5A6BD 4R2SA 1RMDA 2M9AA 5AASA 5CFFE 1A1HA 1N36E 1QNTA 2EQ3A 4DR4E 1ZR9A 2G7HA 2V86A 2EE8A 3EQ1A 3KZYA 4JI6E 1UHZA 1GQEA 3DJWA 4HEIA 3T1YE 2GHFA 3OMLA 4X65E 2LJUA 1LLMC 3KZZA 2VE7C 2YTOA 1J26A 2EPKX 2Q8UA 2LTSA 2MC5A 2V87A 4O43A 4DV4E 2F8BA 3BIDA 2N3HA 4WXCA 2YWQA 4ZYEA 4DR3E 1FJGE 4JYAE 1F2IG 4F9BB 2DGCA 2EPXA 2EOJA 2DMYA 4LFAE 4JV5E 2VQFE 1NEIA 2EOXA 2EOMA 2ZM6E 2L8TA 4YHHE 1T4OA 3KWRA 4YY3E 4GEQB 2HHHE 1JK2A 2BB8A 4ZYDA 1I94E 2KONA 5ADZA 2UXBE 1PJTA 1GZ6A 2EQ0A 4P7DA 4WSGA 4BHCA 2JXPA 2LRSA 1KYQA 2LJHA 3MHSC 5TSEA 2R76A 2EMKA 2YTEA 4WSPA 2CPNA 2EMGA 3ZOQB 3BF2A 2YRMA
chains in the Genus database with same CATH topology
2LV2A 2EOIA 2WBTA 2EMIA 2EMFA 2ELYA 2EQ1A 1Z1BA 1UN6B 2NABA 3MHHC 2EL5A 5KL3A 2JPAA 2YTJA 2EM5A 3UK3C 2EP3A 1WJPA 2YTDA 2YU5A 2YRHA 2EOHA 1A1IA 1A1FA 2LT7A 2EN3A 2ENHA 2YU8A 1A1GA 2YTIA 2EPZA 2EN7A 5KL2A 3EPHA 2EMZA 2EOQA 1JK1A 2EPAA 2CTDA 2RSIA 2EJ4A 4FK5C 1G2FC 3EPJA 2EM3A 2EM6A 2EN6A 1X3CA 2YTPA 3VHTB 1ZAAC 1NCSA 1TN9A 2EPPA 2EORA 2CSHA 2ELZA 2YRKA 4R2SA 1RMDA 2EOZA 2M9AA 1A1HA 2EPCA 2EN1A 2WBUA 2EQ3A 2YTFA 3M99B 4IS1C 2EMLA 2EMAA 1ZR9A 1YUJA 2EOOA 2EE8A 2LCEA 1X6HA 3EPKA 2YSOA 1MEYC 2EMBA 2MDGA 1YSAC 2MKNA 2EPRA 5KL4A 2YTQA 2I13A 2EOEA 1BBOA 2GHFA 2D9HA 2YSPA 1X6FA 1X6EA 2DLKA 2EMHA 4R2AA 1LLMC 2DRPA 1YUIA 1DGCA 2DLQA 2MKDA 2YTOA 2EMWA 4R2RA 2EL6A 2JP9A 2EMYA 1X5WA 1KJKA 2EM4A 1P47A 1B69A 1ZU1A 2ENCA 5KL7A 4M9VC 2YTGA 2EL4A 2WCC3 2EN4A 2EM2A 1F2IG 2PRTA 1A1LA 3EPLA 2EM9A 2R1FA 2EOSA 2DGCA 1UBDC 2EPXA 2EOJA 4X9JA 1A1JA 2EOXA 2EOMA 2EN8A 1AAYA 2J7JA 2E72A 4F6NA 4F2JC 4R2EA 4F6MA 2EMXA 2EM7A 2EOYA 2VRDA 2CT1A 2LVHA 4R2CA 2EMCA 4R2DA 2EPUA 1JK2A 2HGHA 2BB8A 2EM0A 2A25A 4R2QA 2YTNA 1TF6A 5KL5A 2ADRA 2EQ0A 4WSGA 2EM8A 2EOFA 2LO3A 4GZNC 1A1KA 1G2DC 2WBSA 4R2PA 2EN2A 3MHSC 2GLIA 1BB8A 4IJDA 2DMIA 2EMKA 2YTEA 2EMGA 2RPCA 2ENAA 5KL6A 1TF3A 2YRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LV2 A;  2EOI A;  2WBT A;  2EMI A;  2EMF A;  2ELY A;  2EQ1 A;  1Z1B A;  1UN6 B;  2NAB A;  3MHH C;  2EL5 A;  5KL3 A;  2JPA A;  2YTJ A;  2EM5 A;  3UK3 C;  2EP3 A;  1WJP A;  2YTD A;  2YU5 A;  2YRH A;  2EOH A;  1A1I A;  1A1F A;  2LT7 A;  2EN3 A;  2ENH A;  2YU8 A;  1A1G A;  2YTI A;  2EPZ A;  2EN7 A;  5KL2 A;  3EPH A;  2EMZ A;  2EOQ A;  1JK1 A;  2EPA A;  2CTD A;  2RSI A;  2EJ4 A;  4FK5 C;  1G2F C;  3EPJ A;  2EM3 A;  2EM6 A;  2EN6 A;  1X3C A;  2YTP A;  3VHT B;  1ZAA C;  1NCS A;  1TN9 A;  2EPP A;  2EOR A;  2CSH A;  2ELZ A;  2YRK A;  4R2S A;  1RMD A;  2EOZ A;  2M9A A;  1A1H A;  2EPC A;  2EN1 A;  2WBU A;  2EQ3 A;  2YTF A;  3M99 B;  4IS1 C;  2EML A;  2EMA A;  1ZR9 A;  1YUJ A;  2EOO A;  2EE8 A;  2LCE A;  1X6H A;  3EPK A;  2YSO A;  1MEY C;  2EMB A;  2MDG A;  1YSA C;  2MKN A;  2EPR A;  5KL4 A;  2YTQ A;  2I13 A;  2EOE A;  1BBO A;  2GHF A;  2D9H A;  2YSP A;  1X6F A;  1X6E A;  2DLK A;  2EMH A;  4R2A A;  1LLM C;  2DRP A;  1YUI A;  1DGC A;  2DLQ A;  2MKD A;  2YTO A;  2EMW A;  4R2R A;  2EL6 A;  2JP9 A;  2EMY A;  1X5W A;  1KJK A;  2EM4 A;  1P47 A;  1B69 A;  1ZU1 A;  2ENC A;  5KL7 A;  4M9V C;  2YTG A;  2EL4 A;  2WCC 3;  2EN4 A;  2EM2 A;  1F2I G;  2PRT A;  1A1L A;  3EPL A;  2EM9 A;  2R1F A;  2EOS A;  2DGC A;  1UBD C;  2EPX A;  2EOJ A;  4X9J A;  1A1J A;  2EOX A;  2EOM A;  2EN8 A;  1AAY A;  2J7J A;  2E72 A;  4F6N A;  4F2J C;  4R2E A;  4F6M A;  2EMX A;  2EM7 A;  2EOY A;  2VRD A;  2CT1 A;  2LVH A;  4R2C A;  2EMC A;  4R2D A;  2EPU A;  1JK2 A;  2HGH A;  2BB8 A;  2EM0 A;  2A25 A;  4R2Q A;  2YTN A;  1TF6 A;  5KL5 A;  2ADR A;  2EQ0 A;  4WSG A;  2EM8 A;  2EOF A;  2LO3 A;  4GZN C;  1A1K A;  1G2D C;  2WBS A;  4R2P A;  2EN2 A;  3MHS C;  2GLI A;  1BB8 A;  4IJD A;  2DMI A;  2EMK A;  2YTE A;  2EMG A;  2RPC A;  2ENA A;  5KL6 A;  1TF3 A;  2YRM A; 
#chains in the Genus database with same CATH topology
 4RHB B;  2FV4 B;  4MLQ A;  2BBG A;  3MHH C;  2B7V A;  2EM5 A;  1WJP A;  2YTD A;  4JI0 E;  4N4R B;  2EOH A;  3T1H E;  4BC9 A;  2YU8 A;  2ODR D;  4BBY A;  2JR1 A;  3ADG A;  3VYY A;  1JK1 A;  4ZYG A;  2DB2 A;  2CTD A;  1YYO A;  1YFH A;  2RSI A;  1G2F C;  2E1M A;  3VHT B;  1NCS A;  2EOR A;  1N33 E;  3LLH A;  4BHB A;  4M2Z A;  2EPL X;  1YYW A;  1YUJ A;  4JI5 E;  3VYX A;  1X6H A;  3LML A;  1MEY C;  2EMB A;  3TQM A;  2MKN A;  2EPR A;  4MLV A;  5KL4 A;  2EOE A;  3HPZ A;  2DLK A;  1YUI A;  2DLQ A;  4LF8 E;  1SR9 A;  4JI8 E;  4AQY E;  2EL6 A;  2EMY A;  1X5W A;  4LFC E;  4X8W A;  1XNR E;  2EM4 A;  5FLX C;  1P47 A;  1B69 A;  4WYQ B;  2JOB A;  3IWC A;  1IBM E;  1ZU1 A;  2H36 X;  2ENC A;  4M9V C;  1MGT A;  4TUI A;  4J8Z A;  4RH8 A;  1WXR A;  2B3T B;  2L2M A;  1T38 A;  2EM9 A;  2EOS A;  3ECR A;  4B3S E;  1UBD C;  5LL6 R;  4K0K E;  3J80 C;  4NZV A;  5IWA E;  4WX9 A;  1AAY A;  1L4S A;  2ODR C;  4F9A B;  4F2J C;  4JI2 E;  5LMU E;  4F6M A;  2EMX A;  2EOY A;  1T4L B;  2RS7 A;  3BBG A;  3HXL A;  1PJQ A;  2LVH A;  2EMC A;  1UIL A;  2EPU A;  1PDA A;  4BC7 A;  2IHR 1;  4DUZ E;  2A25 A;  4R2Q A;  3HPS A;  2YTN A;  1TF6 A;  1IMU A;  4DV0 E;  2EM8 A;  2EOF A;  4O5G A;  3F6G A;  2WBS A;  2EN2 A;  2VF1 A;  5AE2 A;  1BBG A;  5IT9 C;  4HTG A;  4DV1 E;  1X49 A;  2HC5 A;  4O4K A;  1X47 A;  2EWL A;  4F54 A;  1TF3 A;  4LF4 E;  2EMF A;  3C4B A;  1Z1B A;  2B7T A;  3C6K A;  2EL5 A;  5KL3 A;  2EP3 A;  3VK6 A;  2YRH A;  1YZ9 A;  4DUY E;  4LF5 E;  2EPN A;  2N8X A;  2JY9 A;  2UXD E;  2EN7 A;  1X48 A;  2NUG A;  1PKP A;  4NXN E;  2EMZ A;  5LMN E;  3EPH A;  2EPA A;  1IQS A;  3ADI A;  3ADL A;  3AV0 A;  4LF9 E;  4R03 A;  4O24 A;  3K6Q A;  2EM6 A;  4DR2 E;  2JWO A;  1ZAA C;  1TN9 A;  2EPP A;  3HTX A;  2LBS B;  2CSH A;  2ELZ A;  2YRK A;  3C6M A;  4Q28 A;  5A6B A;  2EPC A;  2V8Q B;  2WBU A;  4DV5 E;  2EML A;  4JI7 E;  2M7Q A;  2RQL A;  4X62 E;  1T39 A;  2LCE A;  2L3J A;  2YSO A;  2MDG A;  1YSA C;  4WFT A;  2YTQ A;  4L5N C;  1AH5 A;  1O0W A;  2I13 A;  4LU9 A;  2D9H A;  2YSP A;  1RC7 A;  2EMH A;  1DGC A;  1EH8 A;  3JTZ A;  3C4T A;  4R2R A;  2M4I A;  2JP9 A;  5IV8 B;  2JYA A;  1WRJ A;  1KJK A;  2L2K B;  5KL7 A;  2EL4 A;  2WCC 3;  4DV2 E;  2EM2 A;  2LUP B;  2PRT A;  1A1L A;  3OTO E;  3EPL A;  2R1F A;  3J7A G;  1IQO A;  2KOU A;  4DV7 E;  4X66 E;  2K7I A;  4KZS A;  4Q35 B;  4X9J A;  1J5E E;  2UUA E;  4X64 E;  4KHP E;  3THN A;  2EPO A;  2FGG A;  3RMP A;  2EM7 A;  2B9D A;  1XMQ E;  2CT1 A;  4R2C A;  4WPY A;  2V85 A;  2LMZ A;  2EM0 A;  4B3R E;  1HNW E;  2F4V E;  3QG5 C;  4LF7 E;  2ADR A;  5DNY A;  5AC4 A;  4KWY A;  2GPI A;  5A6J A;  5F3W A;  4GZN C;  1A1K A;  1N3G A;  1N32 E;  2GLI A;  4IJD A;  1WHQ A;  2DMI A;  3J81 C;  2YPN A;  3L00 A;  2LE2 A;  2RPC A;  1T4N A;  2ENA A;  5KL6 A;  3AUZ A;  2LV2 A;  5AC5 A;  2EPM X;  2EMI A;  2EQ1 A;  2MDR A;  1UN6 B;  3FIG A;  2JPA A;  3UK3 C;  1IBL E;  3MSW A;  4F9C B;  1A1F A;  1WHN A;  2LT7 A;  2EN3 A;  1A1G A;  2HJJ A;  2YTI A;  2NUF A;  4B3M E;  2YZT A;  1N34 E;  1HR0 E;  3DF6 A;  4FK5 C;  2UUC E;  3JAM C;  2DIX A;  2EN6 A;  5LLQ A;  2KHX A;  3IWB A;  1ZBQ A;  2EOZ A;  2EN1 A;  4OOG C;  2YTF A;  3M99 B;  4IS1 C;  2EMA A;  2EOO A;  2LUQ A;  4WXD A;  2M1S A;  1QU6 A;  3EPK A;  1STU A;  1SFE A;  2NA2 A;  3F6H A;  4DMI A;  3J7Y p;  1EH7 A;  1HNZ E;  1X6F A;  1X6E A;  4R2A A;  4DR1 E;  2DRP A;  3BGH A;  2V83 A;  2MKD A;  2EMW A;  2V88 A;  3IWD A;  1YYK A;  1DI2 A;  5A6K A;  2DSY A;  2YTG A;  5T6J A;  4I8O A;  2EN4 A;  1EH6 A;  4LFB E;  4OX9 E;  2L92 A;  4JI1 E;  5AE3 A;  5IXM B;  2L33 A;  2I9I A;  5A69 A;  4TUG A;  2RS6 A;  2JOX A;  1A1J A;  2FTX B;  3JU0 A;  4ZYH A;  4JI3 E;  5AE1 A;  2EN8 A;  5A6A A;  4BCA A;  2J7J A;  2V89 A;  2E72 A;  4F6N A;  4DR7 E;  4R2E A;  2VRD A;  2L2N A;  5A2Q C;  2MC6 A;  4LTY A;  4P78 A;  4DR5 E;  1EKZ A;  1RQ0 A;  1YPN A;  4GKJ E;  4R2D A;  2HGH A;  5BR8 E;  1IBK E;  4LF6 E;  1XNQ E;  3THO B;  5KL5 A;  4JI4 E;  2LTR A;  4M0V A;  4DKK A;  2EZ6 A;  1DQ3 A;  2LO3 A;  3H09 A;  1G2D C;  2RSM A;  4R2P A;  1BB8 A;  4GKK E;  4NHR A;  2VQE E;  2UUB E;  2N3G A;  3HQ1 A;  2WZO A;  1FKA E;  2NAB A;  2L6M A;  1BBO A;  2EOI A;  2WBT A;  3ADJ A;  1HNX E;  2E5L E;  2ELY A;  4L8N A;  2L3C A;  2YTJ A;  4BMJ A;  1XMO E;  2YU5 A;  4DV3 E;  1A1I A;  4DR6 E;  2RTX A;  2UXC E;  2K4V A;  3P1X A;  1ZBT A;  4DV6 E;  2ENH A;  2YT4 A;  2EPZ A;  4M30 A;  4B3T E;  4R8O A;  5KL2 A;  2EOQ A;  2JVA A;  2UU9 E;  1GTK A;  2EJ4 A;  2NUE A;  3EPJ A;  2EM3 A;  1PJS A;  1X3C A;  2YTP A;  4NXM E;  4BS9 A;  5A6B D;  4R2S A;  1RMD A;  2M9A A;  5AAS A;  5CFF E;  1A1H A;  1N36 E;  1QNT A;  2EQ3 A;  4DR4 E;  1ZR9 A;  2G7H A;  2V86 A;  2EE8 A;  3EQ1 A;  3KZY A;  4JI6 E;  1UHZ A;  1GQE A;  3DJW A;  4HEI A;  3T1Y E;  2GHF A;  3OML A;  4X65 E;  2LJU A;  1LLM C;  3KZZ A;  2VE7 C;  2YTO A;  1J26 A;  2EPK X;  2Q8U A;  2LTS A;  2MC5 A;  2V87 A;  4O43 A;  4DV4 E;  2F8B A;  3BID A;  2N3H A;  4WXC A;  2YWQ A;  4ZYE A;  4DR3 E;  1FJG E;  4JYA E;  1F2I G;  4F9B B;  2DGC A;  2EPX A;  2EOJ A;  2DMY A;  4LFA E;  4JV5 E;  2VQF E;  1NEI A;  2EOX A;  2EOM A;  2ZM6 E;  2L8T A;  4YHH E;  1T4O A;  3KWR A;  4YY3 E;  4GEQ B;  2HHH E;  1JK2 A;  2BB8 A;  4ZYD A;  1I94 E;  2KON A;  5ADZ A;  2UXB E;  1PJT A;  1GZ6 A;  2EQ0 A;  4P7D A;  4WSG A;  4BHC A;  2JXP A;  2LRS A;  1KYQ A;  2LJH A;  3MHS C;  5TSE A;  2R76 A;  2EMK A;  2YTE A;  4WSP A;  2CPN A;  2EMG A;  3ZOQ B;  3BF2 A;  2YRM A; 
#chains in the Genus database with same CATH homology
 2LV2 A;  2EOI A;  2WBT A;  2EMI A;  2EMF A;  2ELY A;  2EQ1 A;  1Z1B A;  1UN6 B;  2NAB A;  3MHH C;  2EL5 A;  5KL3 A;  2JPA A;  2YTJ A;  2EM5 A;  3UK3 C;  2EP3 A;  1WJP A;  2YTD A;  2YU5 A;  2YRH A;  2EOH A;  1A1I A;  1A1F A;  2LT7 A;  2EN3 A;  2ENH A;  2YU8 A;  1A1G A;  2YTI A;  2EPZ A;  2EN7 A;  5KL2 A;  3EPH A;  2EMZ A;  2EOQ A;  1JK1 A;  2EPA A;  2CTD A;  2RSI A;  2EJ4 A;  4FK5 C;  1G2F C;  3EPJ A;  2EM3 A;  2EM6 A;  2EN6 A;  1X3C A;  2YTP A;  3VHT B;  1ZAA C;  1NCS A;  1TN9 A;  2EPP A;  2EOR A;  2CSH A;  2ELZ A;  2YRK A;  4R2S A;  1RMD A;  2EOZ A;  2M9A A;  1A1H A;  2EPC A;  2EN1 A;  2WBU A;  2EQ3 A;  2YTF A;  3M99 B;  4IS1 C;  2EML A;  2EMA A;  1ZR9 A;  1YUJ A;  2EOO A;  2EE8 A;  2LCE A;  1X6H A;  3EPK A;  2YSO A;  1MEY C;  2EMB A;  2MDG A;  1YSA C;  2MKN A;  2EPR A;  5KL4 A;  2YTQ A;  2I13 A;  2EOE A;  1BBO A;  2GHF A;  2D9H A;  2YSP A;  1X6F A;  1X6E A;  2DLK A;  2EMH A;  4R2A A;  1LLM C;  2DRP A;  1YUI A;  1DGC A;  2DLQ A;  2MKD A;  2YTO A;  2EMW A;  4R2R A;  2EL6 A;  2JP9 A;  2EMY A;  1X5W A;  1KJK A;  2EM4 A;  1P47 A;  1B69 A;  1ZU1 A;  2ENC A;  5KL7 A;  4M9V C;  2YTG A;  2EL4 A;  2WCC 3;  2EN4 A;  2EM2 A;  1F2I G;  2PRT A;  1A1L A;  3EPL A;  2EM9 A;  2R1F A;  2EOS A;  2DGC A;  1UBD C;  2EPX A;  2EOJ A;  4X9J A;  1A1J A;  2EOX A;  2EOM A;  2EN8 A;  1AAY A;  2J7J A;  2E72 A;  4F6N A;  4F2J C;  4R2E A;  4F6M A;  2EMX A;  2EM7 A;  2EOY A;  2VRD A;  2CT1 A;  2LVH A;  4R2C A;  2EMC A;  4R2D A;  2EPU A;  1JK2 A;  2HGH A;  2BB8 A;  2EM0 A;  2A25 A;  4R2Q A;  2YTN A;  1TF6 A;  5KL5 A;  2ADR A;  2EQ0 A;  4WSG A;  2EM8 A;  2EOF A;  2LO3 A;  4GZN C;  1A1K A;  1G2D C;  2WBS A;  4R2P A;  2EN2 A;  3MHS C;  2GLI A;  1BB8 A;  4IJD A;  2DMI A;  2EMK A;  2YTE A;  2EMG A;  2RPC A;  2ENA A;  5KL6 A;  1TF3 A;  2YRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...