2WCC3

Phage lambda intdbd1-64 complex with p prime 2 dna
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
MGRRRSHERRDLPPNLYIRNNGYYCYRDPRTGKEFGLGRDRRIAITEAIQANIELFSGHKHKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*DCP*DGP*DAP*DGP*DTP*DCP*DAP *DAP*DAP*DAP*DTP*DC)-
publication title NMR Structure of the Amino-Terminal Domain of the Lambda Integrase Protein in Complex with DNA: Immobilization of a Flexible Tail Facilitates Beta- Sheet Recognition of the Major Groove.
pubmed doi rcsb
source organism Enterobacteria phage lambda
molecule tags Protein/dna
total genus 11
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2009-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2wcc300
1A1JA 1A1LA 2WCC3 2EOOA 1YSAC 2EPCA 5KL4A 2EN2A 2GHFA 5KL7A 2EP3A 4R2SA 4R2RA 3EPJA 2DMIA 4F6NA 1LLMC 2DGCA 5KL5A 1TN9A 2EMHA 2MDGA 4R2AA 2EL4A 2EM8A 2EOYA 3M99B 4R2CA 4R2EA 2EN4A 2EPZA 1A1IA 2WBTA 2EPAA 2LV2A 2YSPA 2LCEA 1Z1BA 2EMYA 2EORA 2EOHA 2PRTA 2EOMA 2LVHA 1A1HA 2EE8A 2JP9A 2YTJA 2EMCA 2EM3A 2EMKA 2YTQA 2ADRA 2I13A 2ELYA 4R2QA 2RPCA 2EL5A 1BBOA 2D9HA 1YUIA 1TF3A 1X5WA 2ENHA 2R1FA 2YRMA 2YTNA 1X6FA 4IJDA 2WBUA 2EQ0A 5KL6A 1P47A 1YUJA 1ZAAC 1BB8A 2YTDA 2EMBA 2WBSA 2EM9A 4M9VC 2EMWA 2EOXA 1B69A 1ZU1A 2EOIA 2CSHA 2EMGA 2EMZA 2DLQA 2ELZA 2EM6A 2EM0A 1WJPA 1JK2A 1TF6A 2YU5A 2EMXA 2YRHA 2EN6A 1UN6B 2EN8A 1A1KA 1G2DC 2EQ3A 1RMDA 3EPKA 2HGHA 2EL6A 2YTOA 5KL2A 2CT1A 2MKDA 4R2DA 1NCSA 1DGCA 2GLIA 3EPLA 2M9AA 1ZR9A 2YTPA 1UBDC 1X6HA 2YTFA 2DRPA 2EM5A 2EMIA 2EN1A 2EQ1A 4X9JA 1MEYC 2EOEA 3MHSC 2EN3A 3UK3C 1AAYA 4IS1C 1A1GA 1G2FC 2MKNA 1A1FA 2YTGA 2CTDA 2YRKA 2EMAA 2YSOA 2JPAA 2EMFA 1X6EA 2J7JA 2YTEA 4WSGA 2NABA 4GZNC 2EOSA 4R2PA 1F2IG 3EPHA 2EM7A 2EOZA 2E72A 5KL3A 4F2JC 1JK1A 2EOJA 2YU8A 2EN7A 2EPXA 2EM4A 3VHTB 4F6MA 1KJKA 2EPUA 3MHHC 2EPPA 2YTIA 2EJ4A 2ENCA 2EPRA 2EOQA 2EOFA 2EMLA 2RSIA 4FK5C 2BB8A 1X3CA 2DLKA 2ENAA 2A25A 2VRDA 2LO3A 2EM2A 2LT7A
chains in the Genus database with same CATH superfamily
1A1LA 4WFTA 2EOOA 2UXCE 2EN2A 2VQEE 4R2SA 5CFFE 5AE3A 4F6NA 4DR4E 1PKPA 2B7VA 5T6JA 2EL4A 2EM8A 2LE2A 3M99B 3J80C 4LF4E 2EN4A 2EPZA 4M30A 4DV7E 1YYOA 2EPAA 2LV2A 2RS6A 1EH6A 5LL6R 2EOHA 4DV1E 2V83A 2YTJA 4LFCE 3K6QA 2ADRA 5A69A 1BBOA 2D9HA 4K0KE 4BC7A 2R1FA 5A6BA 1N33E 4IJDA 3JAMC 4WPYA 1HNZE 1YUJA 4BBYA 4KHPE 4M9VC 2HHHE 5AC5A 2YWQA 4JI7E 3C4TA 2FTXB 2EM6A 5LLQA 2YRHA 2WZOA 2EN6A 3AUZA 1UN6B 2EQ3A 3EPKA 1ZBTA 2LTRA 2YZTA 2EL6A 3HQ1A 2YTOA 3C4BA 3ADLA 2GLIA 4J8ZA 2M9AA 3P1XA 4DV2E 2H36X 2JOBA 2EQ1A 3THOB 4X9JA 2EOEA 2FV4B 4DV6E 4ZYEA 4DR6E 3MHSC 4ZYDA 4JI8E 3AV0A 4AQYE 1G2FC 1DQ3A 2MKNA 2CTDA 3KZYA 2YSOA 5A6KA 4LFBE 5IWAE 3EPHA 4BS9A 1MGTA 2RSMA 4GEQB 1ZBQA 2EN7A 3VHTB 4F6MA 4YY3E 4I8OA 2L2NA 3KWRA 2EPPA 2B9DA 2EOFA 4F9BB 2LUPB 4FK5C 2DLKA 2VRDA 2A25A 3LMLA 2LT7A 1A1JA 4HTGA 2JWOA 1SFEA 3QG5C 2LMZA 2WCC3 1YSAC 2UXBE 2LJUA 3H09A 4NXME 1XNRE 3C6KA 5KL7A 2EP3A 4R2RA 4X62E 1YFHA 5TSEA 2VF1A 2EMHA 2MDGA 1T4NA 5AE2A 2JVAA 4R2AA 3BBGA 4LF9E 2YSPA 2RS7A 1WHNA 2EORA 4OX9E 2LRSA 1WRJA 2EOMA 2PRTA 2EE8A 4R03A 4WSPA 1L4SA 2I13A 2RPCA 1N36E 2EPMX 4BHCA 1IQSA 1YUIA 2ENHA 4GKKE 4N4RB 1YPNA 2YTNA 4NHRA 2EQ0A 2E5LE 4RHBB 2HJJA 4Q28A 4KWYA 2VE7C 2EMBA 5A6BD 5DNYA 2JY9A 2EOXA 2DIXA 1N34E 3OTOE 4X65E 2EPKX 4DR7E 4DV5E 4ZYGA 2EM0A 1WJPA 1TF6A 2YU5A 2EMXA 3T1YE 4B3TE 3DF6A 1A1KA 3C6MA 4TUGA 1X48A 2LBSB 4JI5E 1GZ6A 1O0WA 2M4IA 2UU9E 2CT1A 3LLHA 2MKDA 4R2DA 5ADZA 1FKAE 1EH8A 3EPLA 3FIGA 2YTPA 1EKZA 2V89A 2VQFE 4RH8A 4LU9A 4DR2E 1XMQE 2B7TA 1AAYA 4X8WA 4IS1C 2RTXA 2YTGA 1J26A 1GTKA 2JPAA 2UUBE 1X6EA 2J7JA 2YTEA 4DV4E 4GZNC 2KHXA 3J81C 1F2IG 2EM7A 2EOZA 1IBKE 3HXLA 2E72A 4F2JC 2N3GA 1JK1A 2L8TA 2EPXA 2EM4A 4LFAE 2KONA 4MLVA 1IMUA 1KJKA 4B3SE 1XMOE 3HTXA 4DMIA 5LMUE 2YTIA 2EJ4A 2ENCA 2EPRA 1HR0E 1AH5A 4KZSA 2BB8A 3T1HE 5A6AA 2YTFA 1IBLE 3IWBA 4JI2E 4OOGC 1FJGE 2NUGA 4NXNE 1YZ9A 4M2ZA 3THNA 2DMIA 2EWLA 2DGCA 5KL5A 3IWCA 4O43A 5BR8E 4R2CA 2NA2A 1PDAA 1A1IA 3HPSA 2F4VE 1Z1BA 4DV0E 1J5EE 2EMYA 1I94E 2L3JA 2FGGA 2DB2A 1A1HA 2LVHA 3KZZA 5AC4A 4WYQB 2EMKA 4DUYE 1T4LB 4B3ME 4MLQA 3J7Yp 2ELYA 4R2QA 1QNTA 4P7DA 1X5WA 2I9IA 1X6FA 3IWDA 2L2KB 5KL6A 4JI1E 2M1SA 1P47A 1BB8A 3F6GA 1YYWA 4P78A 5IT9C 1N3GA 2EOIA 4YHHE 2CSHA 2EMGA 2EMZA 4TUIA 2DLQA 2ELZA 2K4VA 2DSYA 1JK2A 2NUEA 2LTSA 1EH7A 2JXPA 1HNWE 2HC5A 1G2DC 5F3WA 2BBGA 3DJWA 2JR1A 5KL2A 4BMJA 1YYKA 3JTZA 4BHBA 1X47A 3ADIA 2NUFA 1DGCA 3ZOQB 4L5NC 4O4KA 1X6HA 2EM5A 2EMIA 1MEYC 2RQLA 3BIDA 2KOUA 5A2QC 1A1GA 2N3HA 3VYXA 2MC5A 4R8OA 2R76A 4L8NA 3ADJA 2EZ6A 2EPNA 4WXCA 4DV3E 3RMPA 4WSGA 3OMLA 5IV8B 2G7HA 3MSWA 5KL3A 2LJHA 4X66E 2EOJA 3TQMA 1GQEA 3F6HA 4DR5E 2L2MA 3MHHC 4JI6E 1T39A 4JI0E 4LF6E 1IQOA 2EOQA 4LF7E 2EMLA 2E1MA 2RSIA 1X3CA 2ENAA 2UUCE 2LO3A 4F54A 2LUQA 2Q8UA 2EM2A 3VK6A 3EPJA 2CPNA 2EPCA 5KL4A 2GHFA 3BF2A 2GPIA 4X64E 1PJQA 4JI4E 1LLMC 2ZM6E 1TN9A 1UILA 4F9AB 4Q35B 5AASA 2UUAE 1PJSA 3L00A 2EOYA 4O24A 4R2EA 1X49A 2WBTA 4JI3E 1DI2A 2LCEA 1NEIA 4DR3E 2ODRD 1PJTA 1QU6A 3EQ1A 2JP9A 5IXMB 1KYQA 1RC7A 2EM3A 2EMCA 2YTQA 4JV5E 2EL5A 1TF3A 2L3CA 2V86A 2YRMA 4JYAE 2V88A 2WBUA 1IBME 1WHQA 4WXDA 2L6MA 1ZAAC 2YTDA 2WBSA 2EM9A 2B3TB 2EMWA 1UHZA 1B69A 1ZU1A 2K7IA 4DUZE 2DMYA 4DR1E 2EPLX 3J7AG 1T4OA 2EPOA 5FLXC 1BBGA 2EN8A 1STUA 1RMDA 2HGHA 4LTYA 1T38A 2V87A 1NCSA 4ZYHA 3ADGA 3BGHA 1XNQE 1ZR9A 2IHR1 2M7QA 1WXRA 1UBDC 3ECRA 2DRPA 2EN1A 4NZVA 4BC9A 2YPNA 2V85A 2V8QB 2EN3A 3UK3C 4M0VA 4F9CB 4O5GA 1RQ0A 2MDRA 1A1FA 2YRKA 3JU0A 2UXDE 2MC6A 2ODRC 2EMAA 4WX9A 1SR9A 2EMFA 2L33A 2NABA 4DKKA 2EOSA 4R2PA 5AE1A 5LMNE 4LF5E 1N32E 4GKJE 2YU8A 4BCAA 1HNXE 2EPUA 2JOXA 5A6JA 4LF8E 2JYAA 2YT4A 4B3RE 3HPZA 3VYYA 4HEIA 2N8XA 2F8BA 2L92A
chains in the Genus database with same CATH topology
1A1JA 1A1LA 2WCC3 2EOOA 1YSAC 2EPCA 5KL4A 2EN2A 2GHFA 5KL7A 2EP3A 4R2SA 4R2RA 3EPJA 2DMIA 4F6NA 1LLMC 2DGCA 5KL5A 1TN9A 2EMHA 2MDGA 4R2AA 2EL4A 2EM8A 2EOYA 3M99B 4R2CA 4R2EA 2EN4A 2EPZA 1A1IA 2WBTA 2EPAA 2LV2A 2YSPA 2LCEA 1Z1BA 2EMYA 2EORA 2EOHA 2PRTA 2EOMA 2LVHA 1A1HA 2EE8A 2JP9A 2YTJA 2EMCA 2EM3A 2EMKA 2YTQA 2ADRA 2I13A 2ELYA 4R2QA 2RPCA 2EL5A 1BBOA 2D9HA 1YUIA 1TF3A 1X5WA 2ENHA 2R1FA 2YRMA 2YTNA 1X6FA 4IJDA 2WBUA 2EQ0A 5KL6A 1P47A 1YUJA 1ZAAC 1BB8A 2YTDA 2EMBA 2WBSA 2EM9A 4M9VC 2EMWA 2EOXA 1B69A 1ZU1A 2EOIA 2CSHA 2EMGA 2EMZA 2DLQA 2ELZA 2EM6A 2EM0A 1WJPA 1JK2A 1TF6A 2YU5A 2EMXA 2YRHA 2EN6A 1UN6B 2EN8A 1A1KA 1G2DC 2EQ3A 1RMDA 3EPKA 2HGHA 2EL6A 2YTOA 5KL2A 2CT1A 2MKDA 4R2DA 1NCSA 1DGCA 2GLIA 3EPLA 2M9AA 1ZR9A 2YTPA 1UBDC 1X6HA 2YTFA 2DRPA 2EM5A 2EMIA 2EN1A 2EQ1A 4X9JA 1MEYC 2EOEA 3MHSC 2EN3A 3UK3C 1AAYA 4IS1C 1A1GA 1G2FC 2MKNA 1A1FA 2YTGA 2CTDA 2YRKA 2EMAA 2YSOA 2JPAA 2EMFA 1X6EA 2J7JA 2YTEA 4WSGA 2NABA 4GZNC 2EOSA 4R2PA 1F2IG 3EPHA 2EM7A 2EOZA 2E72A 5KL3A 4F2JC 1JK1A 2EOJA 2YU8A 2EN7A 2EPXA 2EM4A 3VHTB 4F6MA 1KJKA 2EPUA 3MHHC 2EPPA 2YTIA 2EJ4A 2ENCA 2EPRA 2EOQA 2EOFA 2EMLA 2RSIA 4FK5C 2BB8A 1X3CA 2DLKA 2ENAA 2A25A 2VRDA 2LO3A 2EM2A 2LT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A1J A;  1A1L A;  2WCC 3;  2EOO A;  1YSA C;  2EPC A;  5KL4 A;  2EN2 A;  2GHF A;  5KL7 A;  2EP3 A;  4R2S A;  4R2R A;  3EPJ A;  2DMI A;  4F6N A;  1LLM C;  2DGC A;  5KL5 A;  1TN9 A;  2EMH A;  2MDG A;  4R2A A;  2EL4 A;  2EM8 A;  2EOY A;  3M99 B;  4R2C A;  4R2E A;  2EN4 A;  2EPZ A;  1A1I A;  2WBT A;  2EPA A;  2LV2 A;  2YSP A;  2LCE A;  1Z1B A;  2EMY A;  2EOR A;  2EOH A;  2PRT A;  2EOM A;  2LVH A;  1A1H A;  2EE8 A;  2JP9 A;  2YTJ A;  2EMC A;  2EM3 A;  2EMK A;  2YTQ A;  2ADR A;  2I13 A;  2ELY A;  4R2Q A;  2RPC A;  2EL5 A;  1BBO A;  2D9H A;  1YUI A;  1TF3 A;  1X5W A;  2ENH A;  2R1F A;  2YRM A;  2YTN A;  1X6F A;  4IJD A;  2WBU A;  2EQ0 A;  5KL6 A;  1P47 A;  1YUJ A;  1ZAA C;  1BB8 A;  2YTD A;  2EMB A;  2WBS A;  2EM9 A;  4M9V C;  2EMW A;  2EOX A;  1B69 A;  1ZU1 A;  2EOI A;  2CSH A;  2EMG A;  2EMZ A;  2DLQ A;  2ELZ A;  2EM6 A;  2EM0 A;  1WJP A;  1JK2 A;  1TF6 A;  2YU5 A;  2EMX A;  2YRH A;  2EN6 A;  1UN6 B;  2EN8 A;  1A1K A;  1G2D C;  2EQ3 A;  1RMD A;  3EPK A;  2HGH A;  2EL6 A;  2YTO A;  5KL2 A;  2CT1 A;  2MKD A;  4R2D A;  1NCS A;  1DGC A;  2GLI A;  3EPL A;  2M9A A;  1ZR9 A;  2YTP A;  1UBD C;  1X6H A;  2YTF A;  2DRP A;  2EM5 A;  2EMI A;  2EN1 A;  2EQ1 A;  4X9J A;  1MEY C;  2EOE A;  3MHS C;  2EN3 A;  3UK3 C;  1AAY A;  4IS1 C;  1A1G A;  1G2F C;  2MKN A;  1A1F A;  2YTG A;  2CTD A;  2YRK A;  2EMA A;  2YSO A;  2JPA A;  2EMF A;  1X6E A;  2J7J A;  2YTE A;  4WSG A;  2NAB A;  4GZN C;  2EOS A;  4R2P A;  1F2I G;  3EPH A;  2EM7 A;  2EOZ A;  2E72 A;  5KL3 A;  4F2J C;  1JK1 A;  2EOJ A;  2YU8 A;  2EN7 A;  2EPX A;  2EM4 A;  3VHT B;  4F6M A;  1KJK A;  2EPU A;  3MHH C;  2EPP A;  2YTI A;  2EJ4 A;  2ENC A;  2EPR A;  2EOQ A;  2EOF A;  2EML A;  2RSI A;  4FK5 C;  2BB8 A;  1X3C A;  2DLK A;  2ENA A;  2A25 A;  2VRD A;  2LO3 A;  2EM2 A;  2LT7 A; 
#chains in the Genus database with same CATH topology
 1A1L A;  4WFT A;  2EOO A;  2UXC E;  2EN2 A;  2VQE E;  4R2S A;  5CFF E;  5AE3 A;  4F6N A;  4DR4 E;  1PKP A;  2B7V A;  5T6J A;  2EL4 A;  2EM8 A;  2LE2 A;  3M99 B;  3J80 C;  4LF4 E;  2EN4 A;  2EPZ A;  4M30 A;  4DV7 E;  1YYO A;  2EPA A;  2LV2 A;  2RS6 A;  1EH6 A;  5LL6 R;  2EOH A;  4DV1 E;  2V83 A;  2YTJ A;  4LFC E;  3K6Q A;  2ADR A;  5A69 A;  1BBO A;  2D9H A;  4K0K E;  4BC7 A;  2R1F A;  5A6B A;  1N33 E;  4IJD A;  3JAM C;  4WPY A;  1HNZ E;  1YUJ A;  4BBY A;  4KHP E;  4M9V C;  2HHH E;  5AC5 A;  2YWQ A;  4JI7 E;  3C4T A;  2FTX B;  2EM6 A;  5LLQ A;  2YRH A;  2WZO A;  2EN6 A;  3AUZ A;  1UN6 B;  2EQ3 A;  3EPK A;  1ZBT A;  2LTR A;  2YZT A;  2EL6 A;  3HQ1 A;  2YTO A;  3C4B A;  3ADL A;  2GLI A;  4J8Z A;  2M9A A;  3P1X A;  4DV2 E;  2H36 X;  2JOB A;  2EQ1 A;  3THO B;  4X9J A;  2EOE A;  2FV4 B;  4DV6 E;  4ZYE A;  4DR6 E;  3MHS C;  4ZYD A;  4JI8 E;  3AV0 A;  4AQY E;  1G2F C;  1DQ3 A;  2MKN A;  2CTD A;  3KZY A;  2YSO A;  5A6K A;  4LFB E;  5IWA E;  3EPH A;  4BS9 A;  1MGT A;  2RSM A;  4GEQ B;  1ZBQ A;  2EN7 A;  3VHT B;  4F6M A;  4YY3 E;  4I8O A;  2L2N A;  3KWR A;  2EPP A;  2B9D A;  2EOF A;  4F9B B;  2LUP B;  4FK5 C;  2DLK A;  2VRD A;  2A25 A;  3LML A;  2LT7 A;  1A1J A;  4HTG A;  2JWO A;  1SFE A;  3QG5 C;  2LMZ A;  2WCC 3;  1YSA C;  2UXB E;  2LJU A;  3H09 A;  4NXM E;  1XNR E;  3C6K A;  5KL7 A;  2EP3 A;  4R2R A;  4X62 E;  1YFH A;  5TSE A;  2VF1 A;  2EMH A;  2MDG A;  1T4N A;  5AE2 A;  2JVA A;  4R2A A;  3BBG A;  4LF9 E;  2YSP A;  2RS7 A;  1WHN A;  2EOR A;  4OX9 E;  2LRS A;  1WRJ A;  2EOM A;  2PRT A;  2EE8 A;  4R03 A;  4WSP A;  1L4S A;  2I13 A;  2RPC A;  1N36 E;  2EPM X;  4BHC A;  1IQS A;  1YUI A;  2ENH A;  4GKK E;  4N4R B;  1YPN A;  2YTN A;  4NHR A;  2EQ0 A;  2E5L E;  4RHB B;  2HJJ A;  4Q28 A;  4KWY A;  2VE7 C;  2EMB A;  5A6B D;  5DNY A;  2JY9 A;  2EOX A;  2DIX A;  1N34 E;  3OTO E;  4X65 E;  2EPK X;  4DR7 E;  4DV5 E;  4ZYG A;  2EM0 A;  1WJP A;  1TF6 A;  2YU5 A;  2EMX A;  3T1Y E;  4B3T E;  3DF6 A;  1A1K A;  3C6M A;  4TUG A;  1X48 A;  2LBS B;  4JI5 E;  1GZ6 A;  1O0W A;  2M4I A;  2UU9 E;  2CT1 A;  3LLH A;  2MKD A;  4R2D A;  5ADZ A;  1FKA E;  1EH8 A;  3EPL A;  3FIG A;  2YTP A;  1EKZ A;  2V89 A;  2VQF E;  4RH8 A;  4LU9 A;  4DR2 E;  1XMQ E;  2B7T A;  1AAY A;  4X8W A;  4IS1 C;  2RTX A;  2YTG A;  1J26 A;  1GTK A;  2JPA A;  2UUB E;  1X6E A;  2J7J A;  2YTE A;  4DV4 E;  4GZN C;  2KHX A;  3J81 C;  1F2I G;  2EM7 A;  2EOZ A;  1IBK E;  3HXL A;  2E72 A;  4F2J C;  2N3G A;  1JK1 A;  2L8T A;  2EPX A;  2EM4 A;  4LFA E;  2KON A;  4MLV A;  1IMU A;  1KJK A;  4B3S E;  1XMO E;  3HTX A;  4DMI A;  5LMU E;  2YTI A;  2EJ4 A;  2ENC A;  2EPR A;  1HR0 E;  1AH5 A;  4KZS A;  2BB8 A;  3T1H E;  5A6A A;  2YTF A;  1IBL E;  3IWB A;  4JI2 E;  4OOG C;  1FJG E;  2NUG A;  4NXN E;  1YZ9 A;  4M2Z A;  3THN A;  2DMI A;  2EWL A;  2DGC A;  5KL5 A;  3IWC A;  4O43 A;  5BR8 E;  4R2C A;  2NA2 A;  1PDA A;  1A1I A;  3HPS A;  2F4V E;  1Z1B A;  4DV0 E;  1J5E E;  2EMY A;  1I94 E;  2L3J A;  2FGG A;  2DB2 A;  1A1H A;  2LVH A;  3KZZ A;  5AC4 A;  4WYQ B;  2EMK A;  4DUY E;  1T4L B;  4B3M E;  4MLQ A;  3J7Y p;  2ELY A;  4R2Q A;  1QNT A;  4P7D A;  1X5W A;  2I9I A;  1X6F A;  3IWD A;  2L2K B;  5KL6 A;  4JI1 E;  2M1S A;  1P47 A;  1BB8 A;  3F6G A;  1YYW A;  4P78 A;  5IT9 C;  1N3G A;  2EOI A;  4YHH E;  2CSH A;  2EMG A;  2EMZ A;  4TUI A;  2DLQ A;  2ELZ A;  2K4V A;  2DSY A;  1JK2 A;  2NUE A;  2LTS A;  1EH7 A;  2JXP A;  1HNW E;  2HC5 A;  1G2D C;  5F3W A;  2BBG A;  3DJW A;  2JR1 A;  5KL2 A;  4BMJ A;  1YYK A;  3JTZ A;  4BHB A;  1X47 A;  3ADI A;  2NUF A;  1DGC A;  3ZOQ B;  4L5N C;  4O4K A;  1X6H A;  2EM5 A;  2EMI A;  1MEY C;  2RQL A;  3BID A;  2KOU A;  5A2Q C;  1A1G A;  2N3H A;  3VYX A;  2MC5 A;  4R8O A;  2R76 A;  4L8N A;  3ADJ A;  2EZ6 A;  2EPN A;  4WXC A;  4DV3 E;  3RMP A;  4WSG A;  3OML A;  5IV8 B;  2G7H A;  3MSW A;  5KL3 A;  2LJH A;  4X66 E;  2EOJ A;  3TQM A;  1GQE A;  3F6H A;  4DR5 E;  2L2M A;  3MHH C;  4JI6 E;  1T39 A;  4JI0 E;  4LF6 E;  1IQO A;  2EOQ A;  4LF7 E;  2EML A;  2E1M A;  2RSI A;  1X3C A;  2ENA A;  2UUC E;  2LO3 A;  4F54 A;  2LUQ A;  2Q8U A;  2EM2 A;  3VK6 A;  3EPJ A;  2CPN A;  2EPC A;  5KL4 A;  2GHF A;  3BF2 A;  2GPI A;  4X64 E;  1PJQ A;  4JI4 E;  1LLM C;  2ZM6 E;  1TN9 A;  1UIL A;  4F9A B;  4Q35 B;  5AAS A;  2UUA E;  1PJS A;  3L00 A;  2EOY A;  4O24 A;  4R2E A;  1X49 A;  2WBT A;  4JI3 E;  1DI2 A;  2LCE A;  1NEI A;  4DR3 E;  2ODR D;  1PJT A;  1QU6 A;  3EQ1 A;  2JP9 A;  5IXM B;  1KYQ A;  1RC7 A;  2EM3 A;  2EMC A;  2YTQ A;  4JV5 E;  2EL5 A;  1TF3 A;  2L3C A;  2V86 A;  2YRM A;  4JYA E;  2V88 A;  2WBU A;  1IBM E;  1WHQ A;  4WXD A;  2L6M A;  1ZAA C;  2YTD A;  2WBS A;  2EM9 A;  2B3T B;  2EMW A;  1UHZ A;  1B69 A;  1ZU1 A;  2K7I A;  4DUZ E;  2DMY A;  4DR1 E;  2EPL X;  3J7A G;  1T4O A;  2EPO A;  5FLX C;  1BBG A;  2EN8 A;  1STU A;  1RMD A;  2HGH A;  4LTY A;  1T38 A;  2V87 A;  1NCS A;  4ZYH A;  3ADG A;  3BGH A;  1XNQ E;  1ZR9 A;  2IHR 1;  2M7Q A;  1WXR A;  1UBD C;  3ECR A;  2DRP A;  2EN1 A;  4NZV A;  4BC9 A;  2YPN A;  2V85 A;  2V8Q B;  2EN3 A;  3UK3 C;  4M0V A;  4F9C B;  4O5G A;  1RQ0 A;  2MDR A;  1A1F A;  2YRK A;  3JU0 A;  2UXD E;  2MC6 A;  2ODR C;  2EMA A;  4WX9 A;  1SR9 A;  2EMF A;  2L33 A;  2NAB A;  4DKK A;  2EOS A;  4R2P A;  5AE1 A;  5LMN E;  4LF5 E;  1N32 E;  4GKJ E;  2YU8 A;  4BCA A;  1HNX E;  2EPU A;  2JOX A;  5A6J A;  4LF8 E;  2JYA A;  2YT4 A;  4B3R E;  3HPZ A;  3VYY A;  4HEI A;  2N8X A;  2F8B A;  2L92 A; 
#chains in the Genus database with same CATH homology
 1A1J A;  1A1L A;  2WCC 3;  2EOO A;  1YSA C;  2EPC A;  5KL4 A;  2EN2 A;  2GHF A;  5KL7 A;  2EP3 A;  4R2S A;  4R2R A;  3EPJ A;  2DMI A;  4F6N A;  1LLM C;  2DGC A;  5KL5 A;  1TN9 A;  2EMH A;  2MDG A;  4R2A A;  2EL4 A;  2EM8 A;  2EOY A;  3M99 B;  4R2C A;  4R2E A;  2EN4 A;  2EPZ A;  1A1I A;  2WBT A;  2EPA A;  2LV2 A;  2YSP A;  2LCE A;  1Z1B A;  2EMY A;  2EOR A;  2EOH A;  2PRT A;  2EOM A;  2LVH A;  1A1H A;  2EE8 A;  2JP9 A;  2YTJ A;  2EMC A;  2EM3 A;  2EMK A;  2YTQ A;  2ADR A;  2I13 A;  2ELY A;  4R2Q A;  2RPC A;  2EL5 A;  1BBO A;  2D9H A;  1YUI A;  1TF3 A;  1X5W A;  2ENH A;  2R1F A;  2YRM A;  2YTN A;  1X6F A;  4IJD A;  2WBU A;  2EQ0 A;  5KL6 A;  1P47 A;  1YUJ A;  1ZAA C;  1BB8 A;  2YTD A;  2EMB A;  2WBS A;  2EM9 A;  4M9V C;  2EMW A;  2EOX A;  1B69 A;  1ZU1 A;  2EOI A;  2CSH A;  2EMG A;  2EMZ A;  2DLQ A;  2ELZ A;  2EM6 A;  2EM0 A;  1WJP A;  1JK2 A;  1TF6 A;  2YU5 A;  2EMX A;  2YRH A;  2EN6 A;  1UN6 B;  2EN8 A;  1A1K A;  1G2D C;  2EQ3 A;  1RMD A;  3EPK A;  2HGH A;  2EL6 A;  2YTO A;  5KL2 A;  2CT1 A;  2MKD A;  4R2D A;  1NCS A;  1DGC A;  2GLI A;  3EPL A;  2M9A A;  1ZR9 A;  2YTP A;  1UBD C;  1X6H A;  2YTF A;  2DRP A;  2EM5 A;  2EMI A;  2EN1 A;  2EQ1 A;  4X9J A;  1MEY C;  2EOE A;  3MHS C;  2EN3 A;  3UK3 C;  1AAY A;  4IS1 C;  1A1G A;  1G2F C;  2MKN A;  1A1F A;  2YTG A;  2CTD A;  2YRK A;  2EMA A;  2YSO A;  2JPA A;  2EMF A;  1X6E A;  2J7J A;  2YTE A;  4WSG A;  2NAB A;  4GZN C;  2EOS A;  4R2P A;  1F2I G;  3EPH A;  2EM7 A;  2EOZ A;  2E72 A;  5KL3 A;  4F2J C;  1JK1 A;  2EOJ A;  2YU8 A;  2EN7 A;  2EPX A;  2EM4 A;  3VHT B;  4F6M A;  1KJK A;  2EPU A;  3MHH C;  2EPP A;  2YTI A;  2EJ4 A;  2ENC A;  2EPR A;  2EOQ A;  2EOF A;  2EML A;  2RSI A;  4FK5 C;  2BB8 A;  1X3C A;  2DLK A;  2ENA A;  2A25 A;  2VRD A;  2LO3 A;  2EM2 A;  2LT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...