2WCC3

Phage lambda intdbd1-64 complex with p prime 2 dna
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
MGRRRSHERRDLPPNLYIRNNGYYCYRDPRTGKEFGLGRDRRIAITEAIQANIELFSGHKHKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of the Amino-Terminal Domain of the Lambda Integrase Protein in Complex with DNA: Immobilization of a Flexible Tail Facilitates Beta- Sheet Recognition of the Major Groove.
pubmed doi rcsb
source organism Enterobacteria phage lambda
molecule tags Protein/dna
molecule keywords DNA (5'-D(*DCP*DGP*DAP*DGP*DTP*DCP*DAP *DAP*DAP*DAP*DTP*DC)-
total genus 11
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2009-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2wcc300
2EORA 2EOJA 1Z1BA 3M99B 2YU5A 4R2EA 2R1FA 2JP9A 2EOEA 2DMIA 4FK5C 2EN2A 2YRHA 2LVHA 1A1HA 2EPCA 1JK1A 2EOMA 1A1KA 2EOYA 2EMCA 2EMFA 2EN4A 1B69A 2EM7A 2YRKA 2CT1A 2EP3A 3EPLA 3UK3C 2EPAA 2EPPA 2LO3A 2EM3A 2ENHA 1DGCA 1MEYC 2EOZA 2EN7A 2EMZA 5KL7A 4R2DA 4IS1C 1TF3A 2EL5A 5KL6A 2WBTA 1A1GA 2EOOA 2EL4A 2EMXA 3VHTB 1A1LA 1F2IG 2EOFA 2LT7A 2YTPA 1RMDA 5KL3A 2EM8A 1UN6B 2EN8A 2EPRA 1X3CA 1NCSA 2JPAA 2DLQA 2EM5A 2EPZA 2EM4A 2MDGA 1ZR9A 2WBUA 2I13A 4R2CA 5KL4A 2ADRA 2YTGA 4R2PA 1X6HA 2YSOA 2ELYA 2EN1A 2CTDA 2EM6A 2EMHA 1A1IA 1G2FC 2EMLA 2YTEA 1TF6A 2EN3A 4X9JA 1ZAAC 1LLMC 2YTDA 1JK2A 2EM9A 2E72A 2EN6A 3MHHC 4R2SA 4R2RA 2EPUA 4IJDA 2EQ3A 4R2QA 1YSAC 2LV2A 2GLIA 1YUJA 2EOXA 2RPCA 2WBSA 1X6EA 2EOIA 2YTFA 2DRPA 2NABA 1AAYA 2EQ1A 2EMBA 2YU8A 2DLKA 2YTJA 2HGHA 2J7JA 3MHSC 4R2AA 2MKDA 2EMWA 2EMAA 4F2JC 3EPHA 1G2DC 2RSIA 2YTOA 5KL2A 2EE8A 2ENAA 2ELZA 2A25A 2MKNA 1WJPA 2WCC3 2VRDA 2CSHA 1A1JA 2DGCA 2YRMA 1KJKA 4WSGA 2ENCA 2EJ4A 1A1FA 2EM2A 2EMKA 1YUIA 2EOQA 4GZNC 2EPXA 4F6NA 1P47A 2BB8A 2D9HA 2EOHA 2EOSA 2EMYA 3EPKA 5KL5A 2YTNA 1UBDC 4M9VC 2EL6A 2EM0A 2LCEA 1X5WA 1ZU1A 3EPJA 1BBOA 2EQ0A 1BB8A 2PRTA 2YTQA 2YTIA 2EMIA 1X6FA 2YSPA 2EMGA 1TN9A 4F6MA 2GHFA 2M9AA
chains in the Genus database with same CATH superfamily
4Q35B 4I8OA 1Z1BA 3M99B 4DR4E 4WXDA 4R2EA 4JI2E 2DSYA 2UXDE 2LVHA 2EPCA 1XNQE 2MC5A 1YZ9A 2EOYA 1N33E 1IQOA 2EZ6A 2M1SA 1XMOE 4L5NC 1T38A 3IWCA 2EM3A 1DGCA 3ZOQB 2EOZA 2L3CA 4LF4E 3HXLA 4X66E 2E5LE 2B7VA 1A1GA 2EOOA 2EL4A 2V86A 2EMXA 3OMLA 2YTPA 2VQEE 1RMDA 5IWAE 5AASA 2LE2A 3KZZA 2UUCE 2EM5A 2EPZA 2EM4A 4DV2E 3T1YE 3FIGA 5KL4A 2ADRA 5ADZA 2YSOA 5AC4A 2L92A 1A1IA 4J8ZA 2M7QA 4NXME 4BC7A 1PKPA 1ZAAC 4ZYGA 4R2SA 4R2RA 4LF8E 4F9CB 2JWOA 1EH6A 2R76A 1T4OA 2HC5A 2JXPA 2LJUA 4L8NA 4KZSA 2L8TA 5F3WA 1X6EA 4BC9A 3TQMA 5T6JA 1YYOA 5LL6R 2E1MA 2J7JA 2B7TA 2NUEA 1N3GA 2V83A 2L2NA 3HTXA 2VF1A 2ELZA 1J5EE 4JI5E 1A1JA 2DGCA 4WSGA 2ENCA 2EJ4A 2EM2A 2L3JA 2EPXA 1UILA 4DV0E 2LTRA 2EMYA 4P78A 5KL5A 4M9VC 2LCEA 3ADGA 4YHHE 3IWDA 3EPJA 1WXRA 5A2QC 2RSMA 2YTIA 4N4RB 4DR3E 2HHHE 4BHCA 2LUQA 3KWRA 4B3SE 3EQ1A 1N32E 5IT9C 1T4LB 2EOJA 4LFBE 2EPKX 2FV4B 2YU5A 2JP9A 2FTXB 1A1HA 3MSWA 2EOMA 1A1KA 4RHBB 4NZVA 2ZM6E 2LUPB 1B69A 2EM7A 2NUFA 3C4BA 2EPLX 4JYAE 4DV1E 2L2MA 1I94E 3UK3C 2EPAA 4R8OA 1YYWA 4DR5E 4JI4E 4R2DA 2EN7A 5A6JA 1TF3A 4OOGC 3QG5C 2NA2A 2F8BA 1DI2A 3VHTB 1F2IG 2LT7A 2LBSB 4LF5E 3VK6A 1BBGA 1T39A 5KL3A 1IQSA 2HJJA 5LMNE 2JPAA 2RQLA 4HEIA 2I13A 4HTGA 2N3HA 4DV4E 4R2PA 2DMYA 1X6HA 4O43A 4OX9E 4DUYE 2EN3A 4M2ZA 3DJWA 1GQEA 4DUZE 3ADJA 4DKKA 2EPUA 4WFTA 4WXCA 1RQ0A 4JI8E 2EPMX 4F54A 2EOXA 4NXNE 2RPCA 2YWQA 1O0WA 4DR1E 3K6QA 1RC7A 2FGGA 2NABA 3J81C 2Q8UA 2DIXA 4X65E 2EMBA 2YU8A 5A6KA 2DLKA 2JYAA 2YTJA 1IBKE 2MKDA 3BGHA 2EMAA 4X64E 4AQYE 2RSIA 1IBME 2LTSA 2A25A 1WHQA 1L4SA 4JI1E 3THOB 4TUGA 4Q28A 4B3TE 3BBGA 1J26A 1YUIA 2EOQA 4DV7E 4NHRA 3OTOE 2BB8A 2D9HA 2EOSA 3EPKA 2YTNA 4ZYEA 3JTZA 5AC5A 4DV5E 4O24A 1BBOA 2K4VA 3IWBA 4WPYA 2EMGA 4F6MA 3F6GA 2GHFA 1UBDC 1YYKA 2EORA 2H36X 5IXMB 2L2KB 2UXCE 1IMUA 2EOEA 4GEQB 5A6BD 2JOBA 2EN2A 2YRHA 1FKAE 4KHPE 1JK1A 2VE7C 2EMCA 2YRKA 2VQFE 2EP3A 2IHR1 2EPPA 2LO3A 2ENHA 2EPOA 1MEYC 5DNYA 1YPNA 4M30A 2EMZA 4IS1C 2I9IA 4MLVA 3C6MA 2BBGA 3RMPA 5AE1A 4LF7E 2EM8A 3DF6A 1UN6B 4LU9A 4JI6E 2MDGA 4BHBA 4R2CA 2YTGA 4BMJA 2B9DA 2ELYA 5LLQA 3ADLA 1G2FC 1SFEA 2UUAE 5FLXC 2YTEA 4X9JA 3HQ1A 2WZOA 3HPZA 5A6AA 2F4VE 2M9AA 4JI3E 2E72A 3MHHC 3J7Yp 2V87A 2DB2A 4DMIA 2EQ3A 4R03A 5IV8B 4JV5E 4O4KA 2ODRD 2LV2A 3VYYA 1YSAC 2WBSA 5CFFE 1PJQA 3ECRA 4ZYDA 3L00A 1AH5A 3VYXA 2ODRC 2K7IA 1AAYA 1QNTA 3BF2A 2HGHA 3C6KA 1ZBQA 4R2AA 2EMWA 4X62E 1X47A 4F2JC 3EPHA 4GKKE 1N36E 5LMUE 2EE8A 2MKNA 1PJTA 3LLHA 1WRJA 4LFCE 4DR6E 2V85A 2VRDA 2CSHA 3AUZA 3THNA 4BBYA 1QU6A 3AV0A 4JI7E 5A69A 2N3GA 2LJHA 1FJGE 2JVAA 3JAMC 1X49A 3ADIA 4BS9A 4F9BB 2EL6A 4LF6E 1X5WA 3LMLA 2RS7A 5TSEA 2RS6A 1ZU1A 2JR1A 5AE2A 1EH8A 2PRTA 2YTQA 2V89A 1PJSA 4ZYHA 1TN9A 1EH7A 3P1XA 1X48A 4TUIA 2YPNA 2R1FA 2DMIA 2RTXA 4FK5C 2UXBE 3C4TA 4DR2E 4X8WA 2B3TB 3JU0A 4DR7E 2EMFA 2EN4A 4YY3E 4RH8A 2CT1A 2EWLA 3EPLA 1ZBTA 5A6BA 3J7AG 2LMZA 4WYQB 4P7DA 2CPNA 5KL7A 2EL5A 5KL6A 2WBTA 1IBLE 1A1LA 2EOFA 4M0VA 2KHXA 1PDAA 1GZ6A 3BIDA 4JI0E 2JOXA 1HR0E 4B3RE 2EN8A 4MLQA 2EPRA 1NCSA 4KWYA 2DLQA 1HNZE 2N8XA 1ZR9A 2WBUA 4LTYA 4DV6E 1GTKA 1DQ3A 2GPIA 2EN1A 2CTDA 2EM6A 2UUBE 2EMHA 2MDRA 2EPNA 2EMLA 3T1HE 1TF6A 4O5GA 1LLMC 3F6HA 1XNRE 4GKJE 2YTDA 1JK2A 1WHNA 1EKZA 2EM9A 2NUGA 2EN6A 3KZYA 2JY9A 2KOUA 4R2QA 4IJDA 2GLIA 1YUJA 1MGTA 1XMQE 1SR9A 2YT4A 1KYQA 2EOIA 1YFHA 2YTFA 2L33A 4BCAA 2DRPA 4K0KE 1N34E 2EQ1A 2MC6A 3MHSC 3J80C 3H09A 4LF9E 2KONA 1G2DC 5KL2A 2ENAA 3HPSA 1UHZA 1WJPA 2WCC3 2YRMA 4WX9A 2V8QB 1KJKA 1STUA 1T4NA 1A1FA 2EMKA 4GZNC 2V88A 4F9AB 1NEIA 4F6NA 1HNWE 4B3ME 1P47A 2EOHA 2LRSA 4WSPA 1HNXE 2UU9E 2EM0A 4LFAE 5BR8E 2EQ0A 1BB8A 2YZTA 4DV3E 5AE3A 2L6MA 2M4IA 2EMIA 1X6FA 2YSPA 2G7HA 1X3CA 2YTOA
chains in the Genus database with same CATH topology
2EORA 2EOJA 1Z1BA 3M99B 2YU5A 4R2EA 2R1FA 2JP9A 2EOEA 2DMIA 4FK5C 2EN2A 2YRHA 2LVHA 1A1HA 2EPCA 1JK1A 2EOMA 1A1KA 2EOYA 2EMCA 2EMFA 2EN4A 1B69A 2EM7A 2YRKA 2CT1A 2EP3A 3EPLA 3UK3C 2EPAA 2EPPA 2LO3A 2EM3A 2ENHA 1DGCA 1MEYC 2EOZA 2EN7A 2EMZA 5KL7A 4R2DA 4IS1C 1TF3A 2EL5A 5KL6A 2WBTA 1A1GA 2EOOA 2EL4A 2EMXA 3VHTB 1A1LA 1F2IG 2EOFA 2LT7A 2YTPA 1RMDA 5KL3A 2EM8A 1UN6B 2EN8A 2EPRA 1X3CA 1NCSA 2JPAA 2DLQA 2EM5A 2EPZA 2EM4A 2MDGA 1ZR9A 2WBUA 2I13A 4R2CA 5KL4A 2ADRA 2YTGA 4R2PA 1X6HA 2YSOA 2ELYA 2EN1A 2CTDA 2EM6A 2EMHA 1A1IA 1G2FC 2EMLA 2YTEA 1TF6A 2EN3A 4X9JA 1ZAAC 1LLMC 2YTDA 1JK2A 2EM9A 2E72A 2EN6A 3MHHC 4R2SA 4R2RA 2EPUA 4IJDA 2EQ3A 4R2QA 1YSAC 2LV2A 2GLIA 1YUJA 2EOXA 2RPCA 2WBSA 1X6EA 2EOIA 2YTFA 2DRPA 2NABA 1AAYA 2EQ1A 2EMBA 2YU8A 2DLKA 2YTJA 2HGHA 2J7JA 3MHSC 4R2AA 2MKDA 2EMWA 2EMAA 4F2JC 3EPHA 1G2DC 2RSIA 2YTOA 5KL2A 2EE8A 2ENAA 2ELZA 2A25A 2MKNA 1WJPA 2WCC3 2VRDA 2CSHA 1A1JA 2DGCA 2YRMA 1KJKA 4WSGA 2ENCA 2EJ4A 1A1FA 2EM2A 2EMKA 1YUIA 2EOQA 4GZNC 2EPXA 4F6NA 1P47A 2BB8A 2D9HA 2EOHA 2EOSA 2EMYA 3EPKA 5KL5A 2YTNA 1UBDC 4M9VC 2EL6A 2EM0A 2LCEA 1X5WA 1ZU1A 3EPJA 1BBOA 2EQ0A 1BB8A 2PRTA 2YTQA 2YTIA 2EMIA 1X6FA 2YSPA 2EMGA 1TN9A 4F6MA 2GHFA 2M9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOR A;  2EOJ A;  1Z1B A;  3M99 B;  2YU5 A;  4R2E A;  2R1F A;  2JP9 A;  2EOE A;  2DMI A;  4FK5 C;  2EN2 A;  2YRH A;  2LVH A;  1A1H A;  2EPC A;  1JK1 A;  2EOM A;  1A1K A;  2EOY A;  2EMC A;  2EMF A;  2EN4 A;  1B69 A;  2EM7 A;  2YRK A;  2CT1 A;  2EP3 A;  3EPL A;  3UK3 C;  2EPA A;  2EPP A;  2LO3 A;  2EM3 A;  2ENH A;  1DGC A;  1MEY C;  2EOZ A;  2EN7 A;  2EMZ A;  5KL7 A;  4R2D A;  4IS1 C;  1TF3 A;  2EL5 A;  5KL6 A;  2WBT A;  1A1G A;  2EOO A;  2EL4 A;  2EMX A;  3VHT B;  1A1L A;  1F2I G;  2EOF A;  2LT7 A;  2YTP A;  1RMD A;  5KL3 A;  2EM8 A;  1UN6 B;  2EN8 A;  2EPR A;  1X3C A;  1NCS A;  2JPA A;  2DLQ A;  2EM5 A;  2EPZ A;  2EM4 A;  2MDG A;  1ZR9 A;  2WBU A;  2I13 A;  4R2C A;  5KL4 A;  2ADR A;  2YTG A;  4R2P A;  1X6H A;  2YSO A;  2ELY A;  2EN1 A;  2CTD A;  2EM6 A;  2EMH A;  1A1I A;  1G2F C;  2EML A;  2YTE A;  1TF6 A;  2EN3 A;  4X9J A;  1ZAA C;  1LLM C;  2YTD A;  1JK2 A;  2EM9 A;  2E72 A;  2EN6 A;  3MHH C;  4R2S A;  4R2R A;  2EPU A;  4IJD A;  2EQ3 A;  4R2Q A;  1YSA C;  2LV2 A;  2GLI A;  1YUJ A;  2EOX A;  2RPC A;  2WBS A;  1X6E A;  2EOI A;  2YTF A;  2DRP A;  2NAB A;  1AAY A;  2EQ1 A;  2EMB A;  2YU8 A;  2DLK A;  2YTJ A;  2HGH A;  2J7J A;  3MHS C;  4R2A A;  2MKD A;  2EMW A;  2EMA A;  4F2J C;  3EPH A;  1G2D C;  2RSI A;  2YTO A;  5KL2 A;  2EE8 A;  2ENA A;  2ELZ A;  2A25 A;  2MKN A;  1WJP A;  2WCC 3;  2VRD A;  2CSH A;  1A1J A;  2DGC A;  2YRM A;  1KJK A;  4WSG A;  2ENC A;  2EJ4 A;  1A1F A;  2EM2 A;  2EMK A;  1YUI A;  2EOQ A;  4GZN C;  2EPX A;  4F6N A;  1P47 A;  2BB8 A;  2D9H A;  2EOH A;  2EOS A;  2EMY A;  3EPK A;  5KL5 A;  2YTN A;  1UBD C;  4M9V C;  2EL6 A;  2EM0 A;  2LCE A;  1X5W A;  1ZU1 A;  3EPJ A;  1BBO A;  2EQ0 A;  1BB8 A;  2PRT A;  2YTQ A;  2YTI A;  2EMI A;  1X6F A;  2YSP A;  2EMG A;  1TN9 A;  4F6M A;  2GHF A;  2M9A A; 
#chains in the Genus database with same CATH topology
 4Q35 B;  4I8O A;  1Z1B A;  3M99 B;  4DR4 E;  4WXD A;  4R2E A;  4JI2 E;  2DSY A;  2UXD E;  2LVH A;  2EPC A;  1XNQ E;  2MC5 A;  1YZ9 A;  2EOY A;  1N33 E;  1IQO A;  2EZ6 A;  2M1S A;  1XMO E;  4L5N C;  1T38 A;  3IWC A;  2EM3 A;  1DGC A;  3ZOQ B;  2EOZ A;  2L3C A;  4LF4 E;  3HXL A;  4X66 E;  2E5L E;  2B7V A;  1A1G A;  2EOO A;  2EL4 A;  2V86 A;  2EMX A;  3OML A;  2YTP A;  2VQE E;  1RMD A;  5IWA E;  5AAS A;  2LE2 A;  3KZZ A;  2UUC E;  2EM5 A;  2EPZ A;  2EM4 A;  4DV2 E;  3T1Y E;  3FIG A;  5KL4 A;  2ADR A;  5ADZ A;  2YSO A;  5AC4 A;  2L92 A;  1A1I A;  4J8Z A;  2M7Q A;  4NXM E;  4BC7 A;  1PKP A;  1ZAA C;  4ZYG A;  4R2S A;  4R2R A;  4LF8 E;  4F9C B;  2JWO A;  1EH6 A;  2R76 A;  1T4O A;  2HC5 A;  2JXP A;  2LJU A;  4L8N A;  4KZS A;  2L8T A;  5F3W A;  1X6E A;  4BC9 A;  3TQM A;  5T6J A;  1YYO A;  5LL6 R;  2E1M A;  2J7J A;  2B7T A;  2NUE A;  1N3G A;  2V83 A;  2L2N A;  3HTX A;  2VF1 A;  2ELZ A;  1J5E E;  4JI5 E;  1A1J A;  2DGC A;  4WSG A;  2ENC A;  2EJ4 A;  2EM2 A;  2L3J A;  2EPX A;  1UIL A;  4DV0 E;  2LTR A;  2EMY A;  4P78 A;  5KL5 A;  4M9V C;  2LCE A;  3ADG A;  4YHH E;  3IWD A;  3EPJ A;  1WXR A;  5A2Q C;  2RSM A;  2YTI A;  4N4R B;  4DR3 E;  2HHH E;  4BHC A;  2LUQ A;  3KWR A;  4B3S E;  3EQ1 A;  1N32 E;  5IT9 C;  1T4L B;  2EOJ A;  4LFB E;  2EPK X;  2FV4 B;  2YU5 A;  2JP9 A;  2FTX B;  1A1H A;  3MSW A;  2EOM A;  1A1K A;  4RHB B;  4NZV A;  2ZM6 E;  2LUP B;  1B69 A;  2EM7 A;  2NUF A;  3C4B A;  2EPL X;  4JYA E;  4DV1 E;  2L2M A;  1I94 E;  3UK3 C;  2EPA A;  4R8O A;  1YYW A;  4DR5 E;  4JI4 E;  4R2D A;  2EN7 A;  5A6J A;  1TF3 A;  4OOG C;  3QG5 C;  2NA2 A;  2F8B A;  1DI2 A;  3VHT B;  1F2I G;  2LT7 A;  2LBS B;  4LF5 E;  3VK6 A;  1BBG A;  1T39 A;  5KL3 A;  1IQS A;  2HJJ A;  5LMN E;  2JPA A;  2RQL A;  4HEI A;  2I13 A;  4HTG A;  2N3H A;  4DV4 E;  4R2P A;  2DMY A;  1X6H A;  4O43 A;  4OX9 E;  4DUY E;  2EN3 A;  4M2Z A;  3DJW A;  1GQE A;  4DUZ E;  3ADJ A;  4DKK A;  2EPU A;  4WFT A;  4WXC A;  1RQ0 A;  4JI8 E;  2EPM X;  4F54 A;  2EOX A;  4NXN E;  2RPC A;  2YWQ A;  1O0W A;  4DR1 E;  3K6Q A;  1RC7 A;  2FGG A;  2NAB A;  3J81 C;  2Q8U A;  2DIX A;  4X65 E;  2EMB A;  2YU8 A;  5A6K A;  2DLK A;  2JYA A;  2YTJ A;  1IBK E;  2MKD A;  3BGH A;  2EMA A;  4X64 E;  4AQY E;  2RSI A;  1IBM E;  2LTS A;  2A25 A;  1WHQ A;  1L4S A;  4JI1 E;  3THO B;  4TUG A;  4Q28 A;  4B3T E;  3BBG A;  1J26 A;  1YUI A;  2EOQ A;  4DV7 E;  4NHR A;  3OTO E;  2BB8 A;  2D9H A;  2EOS A;  3EPK A;  2YTN A;  4ZYE A;  3JTZ A;  5AC5 A;  4DV5 E;  4O24 A;  1BBO A;  2K4V A;  3IWB A;  4WPY A;  2EMG A;  4F6M A;  3F6G A;  2GHF A;  1UBD C;  1YYK A;  2EOR A;  2H36 X;  5IXM B;  2L2K B;  2UXC E;  1IMU A;  2EOE A;  4GEQ B;  5A6B D;  2JOB A;  2EN2 A;  2YRH A;  1FKA E;  4KHP E;  1JK1 A;  2VE7 C;  2EMC A;  2YRK A;  2VQF E;  2EP3 A;  2IHR 1;  2EPP A;  2LO3 A;  2ENH A;  2EPO A;  1MEY C;  5DNY A;  1YPN A;  4M30 A;  2EMZ A;  4IS1 C;  2I9I A;  4MLV A;  3C6M A;  2BBG A;  3RMP A;  5AE1 A;  4LF7 E;  2EM8 A;  3DF6 A;  1UN6 B;  4LU9 A;  4JI6 E;  2MDG A;  4BHB A;  4R2C A;  2YTG A;  4BMJ A;  2B9D A;  2ELY A;  5LLQ A;  3ADL A;  1G2F C;  1SFE A;  2UUA E;  5FLX C;  2YTE A;  4X9J A;  3HQ1 A;  2WZO A;  3HPZ A;  5A6A A;  2F4V E;  2M9A A;  4JI3 E;  2E72 A;  3MHH C;  3J7Y p;  2V87 A;  2DB2 A;  4DMI A;  2EQ3 A;  4R03 A;  5IV8 B;  4JV5 E;  4O4K A;  2ODR D;  2LV2 A;  3VYY A;  1YSA C;  2WBS A;  5CFF E;  1PJQ A;  3ECR A;  4ZYD A;  3L00 A;  1AH5 A;  3VYX A;  2ODR C;  2K7I A;  1AAY A;  1QNT A;  3BF2 A;  2HGH A;  3C6K A;  1ZBQ A;  4R2A A;  2EMW A;  4X62 E;  1X47 A;  4F2J C;  3EPH A;  4GKK E;  1N36 E;  5LMU E;  2EE8 A;  2MKN A;  1PJT A;  3LLH A;  1WRJ A;  4LFC E;  4DR6 E;  2V85 A;  2VRD A;  2CSH A;  3AUZ A;  3THN A;  4BBY A;  1QU6 A;  3AV0 A;  4JI7 E;  5A69 A;  2N3G A;  2LJH A;  1FJG E;  2JVA A;  3JAM C;  1X49 A;  3ADI A;  4BS9 A;  4F9B B;  2EL6 A;  4LF6 E;  1X5W A;  3LML A;  2RS7 A;  5TSE A;  2RS6 A;  1ZU1 A;  2JR1 A;  5AE2 A;  1EH8 A;  2PRT A;  2YTQ A;  2V89 A;  1PJS A;  4ZYH A;  1TN9 A;  1EH7 A;  3P1X A;  1X48 A;  4TUI A;  2YPN A;  2R1F A;  2DMI A;  2RTX A;  4FK5 C;  2UXB E;  3C4T A;  4DR2 E;  4X8W A;  2B3T B;  3JU0 A;  4DR7 E;  2EMF A;  2EN4 A;  4YY3 E;  4RH8 A;  2CT1 A;  2EWL A;  3EPL A;  1ZBT A;  5A6B A;  3J7A G;  2LMZ A;  4WYQ B;  4P7D A;  2CPN A;  5KL7 A;  2EL5 A;  5KL6 A;  2WBT A;  1IBL E;  1A1L A;  2EOF A;  4M0V A;  2KHX A;  1PDA A;  1GZ6 A;  3BID A;  4JI0 E;  2JOX A;  1HR0 E;  4B3R E;  2EN8 A;  4MLQ A;  2EPR A;  1NCS A;  4KWY A;  2DLQ A;  1HNZ E;  2N8X A;  1ZR9 A;  2WBU A;  4LTY A;  4DV6 E;  1GTK A;  1DQ3 A;  2GPI A;  2EN1 A;  2CTD A;  2EM6 A;  2UUB E;  2EMH A;  2MDR A;  2EPN A;  2EML A;  3T1H E;  1TF6 A;  4O5G A;  1LLM C;  3F6H A;  1XNR E;  4GKJ E;  2YTD A;  1JK2 A;  1WHN A;  1EKZ A;  2EM9 A;  2NUG A;  2EN6 A;  3KZY A;  2JY9 A;  2KOU A;  4R2Q A;  4IJD A;  2GLI A;  1YUJ A;  1MGT A;  1XMQ E;  1SR9 A;  2YT4 A;  1KYQ A;  2EOI A;  1YFH A;  2YTF A;  2L33 A;  4BCA A;  2DRP A;  4K0K E;  1N34 E;  2EQ1 A;  2MC6 A;  3MHS C;  3J80 C;  3H09 A;  4LF9 E;  2KON A;  1G2D C;  5KL2 A;  2ENA A;  3HPS A;  1UHZ A;  1WJP A;  2WCC 3;  2YRM A;  4WX9 A;  2V8Q B;  1KJK A;  1STU A;  1T4N A;  1A1F A;  2EMK A;  4GZN C;  2V88 A;  4F9A B;  1NEI A;  4F6N A;  1HNW E;  4B3M E;  1P47 A;  2EOH A;  2LRS A;  4WSP A;  1HNX E;  2UU9 E;  2EM0 A;  4LFA E;  5BR8 E;  2EQ0 A;  1BB8 A;  2YZT A;  4DV3 E;  5AE3 A;  2L6M A;  2M4I A;  2EMI A;  1X6F A;  2YSP A;  2G7H A;  1X3C A;  2YTO A; 
#chains in the Genus database with same CATH homology
 2EOR A;  2EOJ A;  1Z1B A;  3M99 B;  2YU5 A;  4R2E A;  2R1F A;  2JP9 A;  2EOE A;  2DMI A;  4FK5 C;  2EN2 A;  2YRH A;  2LVH A;  1A1H A;  2EPC A;  1JK1 A;  2EOM A;  1A1K A;  2EOY A;  2EMC A;  2EMF A;  2EN4 A;  1B69 A;  2EM7 A;  2YRK A;  2CT1 A;  2EP3 A;  3EPL A;  3UK3 C;  2EPA A;  2EPP A;  2LO3 A;  2EM3 A;  2ENH A;  1DGC A;  1MEY C;  2EOZ A;  2EN7 A;  2EMZ A;  5KL7 A;  4R2D A;  4IS1 C;  1TF3 A;  2EL5 A;  5KL6 A;  2WBT A;  1A1G A;  2EOO A;  2EL4 A;  2EMX A;  3VHT B;  1A1L A;  1F2I G;  2EOF A;  2LT7 A;  2YTP A;  1RMD A;  5KL3 A;  2EM8 A;  1UN6 B;  2EN8 A;  2EPR A;  1X3C A;  1NCS A;  2JPA A;  2DLQ A;  2EM5 A;  2EPZ A;  2EM4 A;  2MDG A;  1ZR9 A;  2WBU A;  2I13 A;  4R2C A;  5KL4 A;  2ADR A;  2YTG A;  4R2P A;  1X6H A;  2YSO A;  2ELY A;  2EN1 A;  2CTD A;  2EM6 A;  2EMH A;  1A1I A;  1G2F C;  2EML A;  2YTE A;  1TF6 A;  2EN3 A;  4X9J A;  1ZAA C;  1LLM C;  2YTD A;  1JK2 A;  2EM9 A;  2E72 A;  2EN6 A;  3MHH C;  4R2S A;  4R2R A;  2EPU A;  4IJD A;  2EQ3 A;  4R2Q A;  1YSA C;  2LV2 A;  2GLI A;  1YUJ A;  2EOX A;  2RPC A;  2WBS A;  1X6E A;  2EOI A;  2YTF A;  2DRP A;  2NAB A;  1AAY A;  2EQ1 A;  2EMB A;  2YU8 A;  2DLK A;  2YTJ A;  2HGH A;  2J7J A;  3MHS C;  4R2A A;  2MKD A;  2EMW A;  2EMA A;  4F2J C;  3EPH A;  1G2D C;  2RSI A;  2YTO A;  5KL2 A;  2EE8 A;  2ENA A;  2ELZ A;  2A25 A;  2MKN A;  1WJP A;  2WCC 3;  2VRD A;  2CSH A;  1A1J A;  2DGC A;  2YRM A;  1KJK A;  4WSG A;  2ENC A;  2EJ4 A;  1A1F A;  2EM2 A;  2EMK A;  1YUI A;  2EOQ A;  4GZN C;  2EPX A;  4F6N A;  1P47 A;  2BB8 A;  2D9H A;  2EOH A;  2EOS A;  2EMY A;  3EPK A;  5KL5 A;  2YTN A;  1UBD C;  4M9V C;  2EL6 A;  2EM0 A;  2LCE A;  1X5W A;  1ZU1 A;  3EPJ A;  1BBO A;  2EQ0 A;  1BB8 A;  2PRT A;  2YTQ A;  2YTI A;  2EMI A;  1X6F A;  2YSP A;  2EMG A;  1TN9 A;  4F6M A;  2GHF A;  2M9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...