2WCC3

Phage lambda intdbd1-64 complex with p prime 2 dna
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
64
Chain Sequence
b'MGRRRSHERRDLPPNLYIRNNGYYCYRDPRTGKEFGLGRDRRIAITEAIQANIELFSGHKHKPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*DCP*DGP*DAP*DGP*DTP*DCP*DAP *DAP*DAP*DAP*DTP*DC)-
publication title NMR Structure of the Amino-Terminal Domain of the Lambda Integrase Protein in Complex with DNA: Immobilization of a Flexible Tail Facilitates Beta- Sheet Recognition of the Major Groove.
pubmed doi rcsb
source organism Enterobacteria phage lambda
molecule tags Protein/dna
total genus 11
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2009-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2wcc300
2R1FA 2EMWA 2EMAA 1X5WA 2GLIA 1ZU1A 1KJKA 2EM9A 4X9JA 3EPHA 1TN9A 4FK5C 3MHHC 4R2QA 2EOFA 2EPXA 4GZNC 2EN4A 2EQ0A 2LVHA 2EMXA 2YU8A 4WSGA 2LT7A 1AAYA 2EOIA 1JK1A 1A1GA 1A1FA 1X3CA 1ZR9A 1DGCA 2EMGA 2YTNA 4R2EA 2EPRA 2DMIA 2NABA 1BBOA 2EMKA 4R2RA 2EJ4A 2ENAA 4IJDA 5KL7A 2VRDA 2EL4A 2EPZA 1RMDA 1MEYC 2EL5A 2YSPA 5KL5A 4R2SA 2MDGA 2EE8A 2EMLA 1X6HA 2EL6A 2YTJA 2YRKA 1JK2A 2EM5A 1BB8A 1Z1BA 1X6EA 2EQ3A 2CT1A 1F2IG 2ELYA 2EOMA 2ELZA 2YU5A 2CTDA 2YTFA 2EM6A 3UK3C 1TF3A 2BB8A 2A25A 2EOJA 2EORA 1UN6B 2YTGA 2YTOA 2YTPA 2DLKA 3EPJA 1B69A 1TF6A 2EOZA 2YTIA 5KL4A 2EOOA 2EN2A 2EN7A 2LCEA 2ENHA 4R2PA 2EN1A 2EMZA 2D9HA 2ENCA 5KL3A 1A1KA 5KL6A 2M9AA 4IS1C 2EPCA 2EMBA 2EM4A 2DRPA 2RSIA 1A1LA 2DGCA 2EOQA 2YTQA 2WBTA 2EM8A 2EQ1A 2EOSA 2YTEA 4F6MA 1YUIA 2MKNA 2J7JA 2EM3A 2EMCA 2LV2A 2EM7A 1X6FA 4M9VC 2ADRA 3EPLA 1UBDC 2EM0A 2EOYA 2CSHA 2YRHA 1YUJA 1NCSA 2DLQA 2E72A 2YTDA 1A1HA 1G2DC 2HGHA 2EOHA 2MKDA 2EN3A 2EP3A 2GHFA 4F6NA 1G2FC 3MHSC 2EMHA 2EMYA 2EOEA 3M99B 1A1IA 4R2DA 2EMIA 2EPUA 2EN6A 5KL2A 1P47A 2LO3A 3EPKA 4R2AA 2EN8A 4R2CA 2EMFA 2WBSA 2JP9A 2WCC3 3VHTB 1WJPA 1A1JA 1LLMC 2EOXA 2EPAA 2YRMA 2JPAA 2EM2A 2YSOA 2PRTA 1YSAC 2RPCA 4F2JC 2EPPA 1ZAAC 2WBUA 2I13A
chains in the Genus database with same CATH superfamily
5IXMB 1KJKA 2RQLA 3MSWA 2E5LE 4DR3E 3BF2A 4WSGA 1AAYA 2EMXA 4GKJE 5CFFE 4JI3E 4I8OA 2YT4A 3IWDA 2K4VA 4HEIA 1ZR9A 2EZ6A 2DMIA 2NABA 2YWQA 5A2QC 5KL7A 2NUFA 2KONA 2EPZA 1XMOE 1MEYC 4LF5E 2LRSA 2YSPA 1MGTA 1STUA 5KL5A 1DI2A 2MDGA 3KWRA 3BBGA 2K7IA 2L3CA 2RS6A 1F2IG 2LTSA 2CTDA 4LF4E 2EM6A 2JVAA 4DUYE 1UHZA 1UN6B 2V86A 4BC7A 4DV0E 2NUEA 2YTOA 3JTZA 4JI1E 2DLKA 2LUQA 3IWCA 4OOGC 1XNQE 1X47A 2I9IA 2RS7A 2JOXA 2Q8UA 3K6QA 1J26A 2V85A 5AASA 1TF6A 4LF9E 4GEQB 2EN7A 2LCEA 4R2PA 5KL3A 5KL6A 5BR8E 2M9AA 1GQEA 2VE7C 2EMBA 4BHBA 5LMUE 2RSIA 1A1LA 2EOQA 2EM8A 5AE3A 4M2ZA 2MKNA 4WPYA 1EKZA 5DNYA 1EH6A 5TSEA 3OMLA 4F9CB 3EPLA 3J80C 3HPSA 4DR4E 1NCSA 4J8ZA 2DLQA 2EOHA 2EN3A 2V8QB 2VF1A 3AV0A 2V87A 4DMIA 3J81C 3ZOQB 4HTGA 2EMHA 4O43A 2JY9A 2JXPA 3VYYA 5F3WA 4NXME 4DV5E 4WX9A 3RMPA 5AE2A 4R2CA 2JP9A 1RC7A 2NUGA 1PJTA 1PJQA 2YRMA 2EM2A 2HJJA 2GPIA 2YSOA 2F8BA 2PRTA 1YSAC 4F2JC 1ZAAC 4JI7E 4RH8A 2I13A 2R1FA 2EMWA 1X5WA 2EM9A 2L6MA 3LMLA 4ZYDA 4NHRA 4R2QA 4GZNC 2EQ0A 3KZZA 2LT7A 1J5EE 2EPNA 1JK1A 2B3TB 1GTKA 1A1FA 4NXNE 3BGHA 4R2EA 2YTNA 4BMJA 1ZBQA 1AH5A 4DV7E 1BBOA 2L2MA 2ENAA 1WHNA 2VRDA 2JYAA 3T1HE 1RMDA 1IBLE 1YYWA 2MDRA 1PKPA 2RSMA 2EL6A 4B3SE 2YTJA 2YRKA 4RHBB 2CT1A 2UUCE 2ELYA 2EOMA 2YTFA 3UK3C 1HR0E 2N8XA 5A6KA 1T4LB 2EOJA 1O0WA 4ZYHA 2B7TA 1FJGE 1I94E 2MC5A 2YTPA 5IWAE 4DV6E 4DUZE 4LTYA 4DV4E 4YHHE 3C6MA 4YY3E 3BIDA 2EOOA 2EN2A 1A1KA 2ENCA 4M30A 4IS1C 4TUIA 4KHPE 2YTEA 2IHR1 2J7JA 4MLVA 2EM3A 2M7QA 1X6FA 1FKAE 5A6JA 4AQYE 2YRHA 3VK6A 1YUJA 2YTDA 2M4IA 1G2DC 5AC5A 1BBGA 2E1MA 3AUZA 4X64E 3DJWA 4MLQA 1T38A 1G2FC 2NA2A 2L8TA 2VQEE 3EQ1A 2LMZA 4L5NC 1A1IA 4R2DA 2EN6A 4B3TE 2LO3A 1EH7A 1GZ6A 2DMYA 2JWOA 2WBSA 3VHTB 4JI2E 1LLMC 2EPAA 3P1XA 3TQMA 3ADJA 2R76A 4JI8E 1IBKE 1T4NA 2EPPA 1WHQA 4WSPA 2GLIA 1ZU1A 2N3HA 1T4OA 4JI0E 4X9JA 2V88A 4N4RB 5A6AA 1WRJA 2EPXA 2EN4A 2LVHA 2YU8A 4F9BB 2EOIA 4OX9E 2FV4B 2UXDE 1N32E 4DR1E 1YPNA 1X3CA 1DGCA 2EMGA 5A6BA 2EPRA 4NZVA 5AC4A 4BS9A 4R2RA 4JV5E 4IJDA 3ECRA 3J7AG 2EL4A 4K0KE 2CPNA 3ADIA 2EL5A 5LMNE 4LU9A 1WXRA 2EE8A 4LFAE 1X6HA 3L00A 3LLHA 1XMQE 1JK2A 4R8OA 4BCAA 1X6EA 1L4SA 4DKKA 2EQ3A 2ELZA 1IMUA 1TF3A 2A25A 4DR7E 2EPKX 1QU6A 3JAMC 4F54A 1YFHA 2EPOA 2UUAE 2UXBE 2ODRD 1ZBTA 3J7Yp 1N34E 2L92A 4X66E 1XNRE 3EPJA 4X62E 2YTIA 3QG5C 2ENHA 4Q35B 2EN1A 2D9HA 1X49A 2EPCA 5A69A 2DRPA 2DGCA 3ADGA 4F6MA 2EM7A 4M9VC 2EPLX 1UBDC 2EM0A 2EOYA 1KYQA 2EWLA 1QNTA 2CSHA 1NEIA 2JR1A 4JI5E 2LE2A 4JI6E 2UUBE 3DF6A 2E72A 3FIGA 4DR6E 4ZYEA 4WXCA 2MKDA 2EP3A 4F6NA 1IQSA 2L2KB 3JU0A 4O5GA 2MC6A 1IQOA 3THOB 2V83A 1N36E 1PJSA 2EMIA 2EPUA 2YZTA 4WXDA 5IV8B 2F4VE 4WFTA 1P47A 1DQ3A 4JI4E 4F9AB 3ADLA 4BHCA 2EMFA 4M0VA 2B9DA 1HNWE 4LFBE 5A6BD 4X8WA 2RPCA 1YYOA 4BBYA 3H09A 2EMAA 2ZM6E 5AE1A 3EPHA 1TN9A 4FK5C 3MHHC 2B7VA 2EOFA 1Z1BA 3HPZA 3T1YE 4JYAE 2VQFE 2LTRA 2DB2A 4Q28A 2FTXB 4LF6E 1RQ0A 1A1GA 4TUGA 5ADZA 3C4TA 4P78A 1EH8A 3KZYA 3IWBA 2EMKA 2M1SA 2EJ4A 4DR5E 5FLXC 2LBSB 2YPNA 2ODRC 4R2SA 3OTOE 2EMLA 1YYKA 1X48A 4L8NA 2EM5A 1BB8A 2YU5A 1HNZE 2BB8A 3F6HA 2EORA 2EPMX 4B3ME 4O24A 2YTGA 3HQ1A 1SFEA 2V89A 3THNA 3HXLA 4ZYGA 4DV3E 1B69A 2H36X 2EOZA 5KL4A 1PDAA 2LJHA 2EMZA 3C4BA 4WYQB 1IBME 2BBGA 2EM4A 2HC5A 4B3RE 4DV2E 2YTQA 2WBTA 2EQ1A 2EOSA 1YUIA 4P7DA 4LFCE 2EMCA 2LV2A 1HNXE 2ADRA 4X65E 2KOUA 2L33A 3C6KA 2WZOA 2HHHE 4LF7E 2DIXA 1A1HA 2HGHA 1T39A 2DSYA 4R03A 5IT9C 4O4KA 4LF8E 2GHFA 2KHXA 4DR2E 3VYXA 5LLQA 4KZSA 3MHSC 1N33E 2L2NA 2EMYA 2UXCE 2EOEA 3M99B 4DV1E 3F6GA 4GKKE 2JOBA 5KL2A 4BC9A 3HTXA 3EPKA 4R2AA 2EN8A 2RTXA 2WCC3 2UU9E 1WJPA 1A1JA 2N3GA 2EOXA 2G7HA 1UILA 4KWYA 2JPAA 2FGGA 2LUPB 2L3JA 1YZ9A 1N3GA 1SR9A 5LL6R 5T6JA 2WBUA 2LJUA
chains in the Genus database with same CATH topology
2R1FA 2EMWA 2EMAA 1X5WA 2GLIA 1ZU1A 1KJKA 2EM9A 4X9JA 3EPHA 1TN9A 4FK5C 3MHHC 4R2QA 2EOFA 2EPXA 4GZNC 2EN4A 2EQ0A 2LVHA 2EMXA 2YU8A 4WSGA 2LT7A 1AAYA 2EOIA 1JK1A 1A1GA 1A1FA 1X3CA 1ZR9A 1DGCA 2EMGA 2YTNA 4R2EA 2EPRA 2DMIA 2NABA 1BBOA 2EMKA 4R2RA 2EJ4A 2ENAA 4IJDA 5KL7A 2VRDA 2EL4A 2EPZA 1RMDA 1MEYC 2EL5A 2YSPA 5KL5A 4R2SA 2MDGA 2EE8A 2EMLA 1X6HA 2EL6A 2YTJA 2YRKA 1JK2A 2EM5A 1BB8A 1Z1BA 1X6EA 2EQ3A 2CT1A 1F2IG 2ELYA 2EOMA 2ELZA 2YU5A 2CTDA 2YTFA 2EM6A 3UK3C 1TF3A 2BB8A 2A25A 2EOJA 2EORA 1UN6B 2YTGA 2YTOA 2YTPA 2DLKA 3EPJA 1B69A 1TF6A 2EOZA 2YTIA 5KL4A 2EOOA 2EN2A 2EN7A 2LCEA 2ENHA 4R2PA 2EN1A 2EMZA 2D9HA 2ENCA 5KL3A 1A1KA 5KL6A 2M9AA 4IS1C 2EPCA 2EMBA 2EM4A 2DRPA 2RSIA 1A1LA 2DGCA 2EOQA 2YTQA 2WBTA 2EM8A 2EQ1A 2EOSA 2YTEA 4F6MA 1YUIA 2MKNA 2J7JA 2EM3A 2EMCA 2LV2A 2EM7A 1X6FA 4M9VC 2ADRA 3EPLA 1UBDC 2EM0A 2EOYA 2CSHA 2YRHA 1YUJA 1NCSA 2DLQA 2E72A 2YTDA 1A1HA 1G2DC 2HGHA 2EOHA 2MKDA 2EN3A 2EP3A 2GHFA 4F6NA 1G2FC 3MHSC 2EMHA 2EMYA 2EOEA 3M99B 1A1IA 4R2DA 2EMIA 2EPUA 2EN6A 5KL2A 1P47A 2LO3A 3EPKA 4R2AA 2EN8A 4R2CA 2EMFA 2WBSA 2JP9A 2WCC3 3VHTB 1WJPA 1A1JA 1LLMC 2EOXA 2EPAA 2YRMA 2JPAA 2EM2A 2YSOA 2PRTA 1YSAC 2RPCA 4F2JC 2EPPA 1ZAAC 2WBUA 2I13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R1F A;  2EMW A;  2EMA A;  1X5W A;  2GLI A;  1ZU1 A;  1KJK A;  2EM9 A;  4X9J A;  3EPH A;  1TN9 A;  4FK5 C;  3MHH C;  4R2Q A;  2EOF A;  2EPX A;  4GZN C;  2EN4 A;  2EQ0 A;  2LVH A;  2EMX A;  2YU8 A;  4WSG A;  2LT7 A;  1AAY A;  2EOI A;  1JK1 A;  1A1G A;  1A1F A;  1X3C A;  1ZR9 A;  1DGC A;  2EMG A;  2YTN A;  4R2E A;  2EPR A;  2DMI A;  2NAB A;  1BBO A;  2EMK A;  4R2R A;  2EJ4 A;  2ENA A;  4IJD A;  5KL7 A;  2VRD A;  2EL4 A;  2EPZ A;  1RMD A;  1MEY C;  2EL5 A;  2YSP A;  5KL5 A;  4R2S A;  2MDG A;  2EE8 A;  2EML A;  1X6H A;  2EL6 A;  2YTJ A;  2YRK A;  1JK2 A;  2EM5 A;  1BB8 A;  1Z1B A;  1X6E A;  2EQ3 A;  2CT1 A;  1F2I G;  2ELY A;  2EOM A;  2ELZ A;  2YU5 A;  2CTD A;  2YTF A;  2EM6 A;  3UK3 C;  1TF3 A;  2BB8 A;  2A25 A;  2EOJ A;  2EOR A;  1UN6 B;  2YTG A;  2YTO A;  2YTP A;  2DLK A;  3EPJ A;  1B69 A;  1TF6 A;  2EOZ A;  2YTI A;  5KL4 A;  2EOO A;  2EN2 A;  2EN7 A;  2LCE A;  2ENH A;  4R2P A;  2EN1 A;  2EMZ A;  2D9H A;  2ENC A;  5KL3 A;  1A1K A;  5KL6 A;  2M9A A;  4IS1 C;  2EPC A;  2EMB A;  2EM4 A;  2DRP A;  2RSI A;  1A1L A;  2DGC A;  2EOQ A;  2YTQ A;  2WBT A;  2EM8 A;  2EQ1 A;  2EOS A;  2YTE A;  4F6M A;  1YUI A;  2MKN A;  2J7J A;  2EM3 A;  2EMC A;  2LV2 A;  2EM7 A;  1X6F A;  4M9V C;  2ADR A;  3EPL A;  1UBD C;  2EM0 A;  2EOY A;  2CSH A;  2YRH A;  1YUJ A;  1NCS A;  2DLQ A;  2E72 A;  2YTD A;  1A1H A;  1G2D C;  2HGH A;  2EOH A;  2MKD A;  2EN3 A;  2EP3 A;  2GHF A;  4F6N A;  1G2F C;  3MHS C;  2EMH A;  2EMY A;  2EOE A;  3M99 B;  1A1I A;  4R2D A;  2EMI A;  2EPU A;  2EN6 A;  5KL2 A;  1P47 A;  2LO3 A;  3EPK A;  4R2A A;  2EN8 A;  4R2C A;  2EMF A;  2WBS A;  2JP9 A;  2WCC 3;  3VHT B;  1WJP A;  1A1J A;  1LLM C;  2EOX A;  2EPA A;  2YRM A;  2JPA A;  2EM2 A;  2YSO A;  2PRT A;  1YSA C;  2RPC A;  4F2J C;  2EPP A;  1ZAA C;  2WBU A;  2I13 A; 
#chains in the Genus database with same CATH topology
 5IXM B;  1KJK A;  2RQL A;  3MSW A;  2E5L E;  4DR3 E;  3BF2 A;  4WSG A;  1AAY A;  2EMX A;  4GKJ E;  5CFF E;  4JI3 E;  4I8O A;  2YT4 A;  3IWD A;  2K4V A;  4HEI A;  1ZR9 A;  2EZ6 A;  2DMI A;  2NAB A;  2YWQ A;  5A2Q C;  5KL7 A;  2NUF A;  2KON A;  2EPZ A;  1XMO E;  1MEY C;  4LF5 E;  2LRS A;  2YSP A;  1MGT A;  1STU A;  5KL5 A;  1DI2 A;  2MDG A;  3KWR A;  3BBG A;  2K7I A;  2L3C A;  2RS6 A;  1F2I G;  2LTS A;  2CTD A;  4LF4 E;  2EM6 A;  2JVA A;  4DUY E;  1UHZ A;  1UN6 B;  2V86 A;  4BC7 A;  4DV0 E;  2NUE A;  2YTO A;  3JTZ A;  4JI1 E;  2DLK A;  2LUQ A;  3IWC A;  4OOG C;  1XNQ E;  1X47 A;  2I9I A;  2RS7 A;  2JOX A;  2Q8U A;  3K6Q A;  1J26 A;  2V85 A;  5AAS A;  1TF6 A;  4LF9 E;  4GEQ B;  2EN7 A;  2LCE A;  4R2P A;  5KL3 A;  5KL6 A;  5BR8 E;  2M9A A;  1GQE A;  2VE7 C;  2EMB A;  4BHB A;  5LMU E;  2RSI A;  1A1L A;  2EOQ A;  2EM8 A;  5AE3 A;  4M2Z A;  2MKN A;  4WPY A;  1EKZ A;  5DNY A;  1EH6 A;  5TSE A;  3OML A;  4F9C B;  3EPL A;  3J80 C;  3HPS A;  4DR4 E;  1NCS A;  4J8Z A;  2DLQ A;  2EOH A;  2EN3 A;  2V8Q B;  2VF1 A;  3AV0 A;  2V87 A;  4DMI A;  3J81 C;  3ZOQ B;  4HTG A;  2EMH A;  4O43 A;  2JY9 A;  2JXP A;  3VYY A;  5F3W A;  4NXM E;  4DV5 E;  4WX9 A;  3RMP A;  5AE2 A;  4R2C A;  2JP9 A;  1RC7 A;  2NUG A;  1PJT A;  1PJQ A;  2YRM A;  2EM2 A;  2HJJ A;  2GPI A;  2YSO A;  2F8B A;  2PRT A;  1YSA C;  4F2J C;  1ZAA C;  4JI7 E;  4RH8 A;  2I13 A;  2R1F A;  2EMW A;  1X5W A;  2EM9 A;  2L6M A;  3LML A;  4ZYD A;  4NHR A;  4R2Q A;  4GZN C;  2EQ0 A;  3KZZ A;  2LT7 A;  1J5E E;  2EPN A;  1JK1 A;  2B3T B;  1GTK A;  1A1F A;  4NXN E;  3BGH A;  4R2E A;  2YTN A;  4BMJ A;  1ZBQ A;  1AH5 A;  4DV7 E;  1BBO A;  2L2M A;  2ENA A;  1WHN A;  2VRD A;  2JYA A;  3T1H E;  1RMD A;  1IBL E;  1YYW A;  2MDR A;  1PKP A;  2RSM A;  2EL6 A;  4B3S E;  2YTJ A;  2YRK A;  4RHB B;  2CT1 A;  2UUC E;  2ELY A;  2EOM A;  2YTF A;  3UK3 C;  1HR0 E;  2N8X A;  5A6K A;  1T4L B;  2EOJ A;  1O0W A;  4ZYH A;  2B7T A;  1FJG E;  1I94 E;  2MC5 A;  2YTP A;  5IWA E;  4DV6 E;  4DUZ E;  4LTY A;  4DV4 E;  4YHH E;  3C6M A;  4YY3 E;  3BID A;  2EOO A;  2EN2 A;  1A1K A;  2ENC A;  4M30 A;  4IS1 C;  4TUI A;  4KHP E;  2YTE A;  2IHR 1;  2J7J A;  4MLV A;  2EM3 A;  2M7Q A;  1X6F A;  1FKA E;  5A6J A;  4AQY E;  2YRH A;  3VK6 A;  1YUJ A;  2YTD A;  2M4I A;  1G2D C;  5AC5 A;  1BBG A;  2E1M A;  3AUZ A;  4X64 E;  3DJW A;  4MLQ A;  1T38 A;  1G2F C;  2NA2 A;  2L8T A;  2VQE E;  3EQ1 A;  2LMZ A;  4L5N C;  1A1I A;  4R2D A;  2EN6 A;  4B3T E;  2LO3 A;  1EH7 A;  1GZ6 A;  2DMY A;  2JWO A;  2WBS A;  3VHT B;  4JI2 E;  1LLM C;  2EPA A;  3P1X A;  3TQM A;  3ADJ A;  2R76 A;  4JI8 E;  1IBK E;  1T4N A;  2EPP A;  1WHQ A;  4WSP A;  2GLI A;  1ZU1 A;  2N3H A;  1T4O A;  4JI0 E;  4X9J A;  2V88 A;  4N4R B;  5A6A A;  1WRJ A;  2EPX A;  2EN4 A;  2LVH A;  2YU8 A;  4F9B B;  2EOI A;  4OX9 E;  2FV4 B;  2UXD E;  1N32 E;  4DR1 E;  1YPN A;  1X3C A;  1DGC A;  2EMG A;  5A6B A;  2EPR A;  4NZV A;  5AC4 A;  4BS9 A;  4R2R A;  4JV5 E;  4IJD A;  3ECR A;  3J7A G;  2EL4 A;  4K0K E;  2CPN A;  3ADI A;  2EL5 A;  5LMN E;  4LU9 A;  1WXR A;  2EE8 A;  4LFA E;  1X6H A;  3L00 A;  3LLH A;  1XMQ E;  1JK2 A;  4R8O A;  4BCA A;  1X6E A;  1L4S A;  4DKK A;  2EQ3 A;  2ELZ A;  1IMU A;  1TF3 A;  2A25 A;  4DR7 E;  2EPK X;  1QU6 A;  3JAM C;  4F54 A;  1YFH A;  2EPO A;  2UUA E;  2UXB E;  2ODR D;  1ZBT A;  3J7Y p;  1N34 E;  2L92 A;  4X66 E;  1XNR E;  3EPJ A;  4X62 E;  2YTI A;  3QG5 C;  2ENH A;  4Q35 B;  2EN1 A;  2D9H A;  1X49 A;  2EPC A;  5A69 A;  2DRP A;  2DGC A;  3ADG A;  4F6M A;  2EM7 A;  4M9V C;  2EPL X;  1UBD C;  2EM0 A;  2EOY A;  1KYQ A;  2EWL A;  1QNT A;  2CSH A;  1NEI A;  2JR1 A;  4JI5 E;  2LE2 A;  4JI6 E;  2UUB E;  3DF6 A;  2E72 A;  3FIG A;  4DR6 E;  4ZYE A;  4WXC A;  2MKD A;  2EP3 A;  4F6N A;  1IQS A;  2L2K B;  3JU0 A;  4O5G A;  2MC6 A;  1IQO A;  3THO B;  2V83 A;  1N36 E;  1PJS A;  2EMI A;  2EPU A;  2YZT A;  4WXD A;  5IV8 B;  2F4V E;  4WFT A;  1P47 A;  1DQ3 A;  4JI4 E;  4F9A B;  3ADL A;  4BHC A;  2EMF A;  4M0V A;  2B9D A;  1HNW E;  4LFB E;  5A6B D;  4X8W A;  2RPC A;  1YYO A;  4BBY A;  3H09 A;  2EMA A;  2ZM6 E;  5AE1 A;  3EPH A;  1TN9 A;  4FK5 C;  3MHH C;  2B7V A;  2EOF A;  1Z1B A;  3HPZ A;  3T1Y E;  4JYA E;  2VQF E;  2LTR A;  2DB2 A;  4Q28 A;  2FTX B;  4LF6 E;  1RQ0 A;  1A1G A;  4TUG A;  5ADZ A;  3C4T A;  4P78 A;  1EH8 A;  3KZY A;  3IWB A;  2EMK A;  2M1S A;  2EJ4 A;  4DR5 E;  5FLX C;  2LBS B;  2YPN A;  2ODR C;  4R2S A;  3OTO E;  2EML A;  1YYK A;  1X48 A;  4L8N A;  2EM5 A;  1BB8 A;  2YU5 A;  1HNZ E;  2BB8 A;  3F6H A;  2EOR A;  2EPM X;  4B3M E;  4O24 A;  2YTG A;  3HQ1 A;  1SFE A;  2V89 A;  3THN A;  3HXL A;  4ZYG A;  4DV3 E;  1B69 A;  2H36 X;  2EOZ A;  5KL4 A;  1PDA A;  2LJH A;  2EMZ A;  3C4B A;  4WYQ B;  1IBM E;  2BBG A;  2EM4 A;  2HC5 A;  4B3R E;  4DV2 E;  2YTQ A;  2WBT A;  2EQ1 A;  2EOS A;  1YUI A;  4P7D A;  4LFC E;  2EMC A;  2LV2 A;  1HNX E;  2ADR A;  4X65 E;  2KOU A;  2L33 A;  3C6K A;  2WZO A;  2HHH E;  4LF7 E;  2DIX A;  1A1H A;  2HGH A;  1T39 A;  2DSY A;  4R03 A;  5IT9 C;  4O4K A;  4LF8 E;  2GHF A;  2KHX A;  4DR2 E;  3VYX A;  5LLQ A;  4KZS A;  3MHS C;  1N33 E;  2L2N A;  2EMY A;  2UXC E;  2EOE A;  3M99 B;  4DV1 E;  3F6G A;  4GKK E;  2JOB A;  5KL2 A;  4BC9 A;  3HTX A;  3EPK A;  4R2A A;  2EN8 A;  2RTX A;  2WCC 3;  2UU9 E;  1WJP A;  1A1J A;  2N3G A;  2EOX A;  2G7H A;  1UIL A;  4KWY A;  2JPA A;  2FGG A;  2LUP B;  2L3J A;  1YZ9 A;  1N3G A;  1SR9 A;  5LL6 R;  5T6J A;  2WBU A;  2LJU A; 
#chains in the Genus database with same CATH homology
 2R1F A;  2EMW A;  2EMA A;  1X5W A;  2GLI A;  1ZU1 A;  1KJK A;  2EM9 A;  4X9J A;  3EPH A;  1TN9 A;  4FK5 C;  3MHH C;  4R2Q A;  2EOF A;  2EPX A;  4GZN C;  2EN4 A;  2EQ0 A;  2LVH A;  2EMX A;  2YU8 A;  4WSG A;  2LT7 A;  1AAY A;  2EOI A;  1JK1 A;  1A1G A;  1A1F A;  1X3C A;  1ZR9 A;  1DGC A;  2EMG A;  2YTN A;  4R2E A;  2EPR A;  2DMI A;  2NAB A;  1BBO A;  2EMK A;  4R2R A;  2EJ4 A;  2ENA A;  4IJD A;  5KL7 A;  2VRD A;  2EL4 A;  2EPZ A;  1RMD A;  1MEY C;  2EL5 A;  2YSP A;  5KL5 A;  4R2S A;  2MDG A;  2EE8 A;  2EML A;  1X6H A;  2EL6 A;  2YTJ A;  2YRK A;  1JK2 A;  2EM5 A;  1BB8 A;  1Z1B A;  1X6E A;  2EQ3 A;  2CT1 A;  1F2I G;  2ELY A;  2EOM A;  2ELZ A;  2YU5 A;  2CTD A;  2YTF A;  2EM6 A;  3UK3 C;  1TF3 A;  2BB8 A;  2A25 A;  2EOJ A;  2EOR A;  1UN6 B;  2YTG A;  2YTO A;  2YTP A;  2DLK A;  3EPJ A;  1B69 A;  1TF6 A;  2EOZ A;  2YTI A;  5KL4 A;  2EOO A;  2EN2 A;  2EN7 A;  2LCE A;  2ENH A;  4R2P A;  2EN1 A;  2EMZ A;  2D9H A;  2ENC A;  5KL3 A;  1A1K A;  5KL6 A;  2M9A A;  4IS1 C;  2EPC A;  2EMB A;  2EM4 A;  2DRP A;  2RSI A;  1A1L A;  2DGC A;  2EOQ A;  2YTQ A;  2WBT A;  2EM8 A;  2EQ1 A;  2EOS A;  2YTE A;  4F6M A;  1YUI A;  2MKN A;  2J7J A;  2EM3 A;  2EMC A;  2LV2 A;  2EM7 A;  1X6F A;  4M9V C;  2ADR A;  3EPL A;  1UBD C;  2EM0 A;  2EOY A;  2CSH A;  2YRH A;  1YUJ A;  1NCS A;  2DLQ A;  2E72 A;  2YTD A;  1A1H A;  1G2D C;  2HGH A;  2EOH A;  2MKD A;  2EN3 A;  2EP3 A;  2GHF A;  4F6N A;  1G2F C;  3MHS C;  2EMH A;  2EMY A;  2EOE A;  3M99 B;  1A1I A;  4R2D A;  2EMI A;  2EPU A;  2EN6 A;  5KL2 A;  1P47 A;  2LO3 A;  3EPK A;  4R2A A;  2EN8 A;  4R2C A;  2EMF A;  2WBS A;  2JP9 A;  2WCC 3;  3VHT B;  1WJP A;  1A1J A;  1LLM C;  2EOX A;  2EPA A;  2YRM A;  2JPA A;  2EM2 A;  2YSO A;  2PRT A;  1YSA C;  2RPC A;  4F2J C;  2EPP A;  1ZAA C;  2WBU A;  2I13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...