2YTEA

Solution structure of the c2h2 type zinc finger (region 484-512) of human zinc finger protein 473
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
42
structure length
42
Chain Sequence
b'GSSGSSGEKPYSCAECKETFSDNNRLVQHQKMHTVKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 473
publication title Solution structure of the C2H2 type zinc finger (region 484-512) of human Zinc finger protein 473
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 8
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2007-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2yteA01
2YTQA 2EMAA 1RMDA 4IJDA 1JK1A 1B69A 1A1GA 1WJPA 1X6FA 2CTDA 4R2EA 2EM0A 2NABA 2YRHA 2D9HA 1AAYA 1ZU1A 1TF3A 2EM5A 2YTGA 2EM6A 2WBUA 2YRKA 5KL7A 2WBSA 1YUJA 2RPCA 2EL6A 1X6EA 5KL4A 2ENCA 2EM3A 1NCSA 2EN1A 2YTIA 2J7JA 4M9VC 2ELZA 2EMHA 1X3CA 2EOOA 2PRTA 4R2QA 4R2CA 2EM2A 2YTNA 2EMYA 3MHHC 2EORA 2I13A 2EPPA 2ADRA 1X5WA 2EOIA 2YTEA 2EJ4A 1A1FA 2EQ0A 2DLQA 2HGHA 2E72A 2EOHA 2M9AA 2JPAA 2EOZA 2EN2A 2YTJA 1G2DC 2GLIA 1Z1BA 2YTDA 2EN6A 2CSHA 2DMIA 1P47A 2ENAA 5KL3A 2EMCA 2EPZA 1A1LA 2CT1A 4FK5C 2EM7A 2EOFA 2VRDA 2EQ1A 2BB8A 2EOQA 2EMWA 2EN4A 3EPHA 4R2AA 2EMXA 2YTPA 1A1IA 1G2FC 1A1JA 2EOSA 2LO3A 1ZR9A 1X6HA 2LCEA 1TN9A 2EM8A 4R2SA 2EMLA 2EPXA 2MKNA 4R2DA 5KL5A 1KJKA 2LT7A 2EN3A 2EMKA 2EOMA 2RSIA 2DGCA 2EMIA 2EL4A 4R2RA 2A25A 3VHTB 3EPJA 2GHFA 2ENHA 2LVHA 2EOYA 2EPAA 2EL5A 2MKDA 1JK2A 1ZAAC 2YRMA 2EOEA 2EP3A 5KL2A 3UK3C 2JP9A 2EPUA 1DGCA 4X9JA 2WBTA 3MHSC 1TF6A 5KL6A 2YU8A 1BBOA 2EOJA 2EPRA 1A1KA 2EMFA 2YSOA 4WSGA 2YSPA 2R1FA 2EN7A 2ELYA 1MEYC 2MDGA 1YUIA 1F2IG 2DLKA 1A1HA 2WCC3 3EPLA 2EMZA 1LLMC 4F2JC 4F6NA 2YTFA 2EM9A 4F6MA 2EMBA 4R2PA 3M99B 2EOXA 2EPCA 1UN6B 4IS1C 1YSAC 2DRPA 2YTOA 1UBDC 2EMGA 2LV2A 2EN8A 4GZNC 2YU5A 1BB8A 2EM4A 2EE8A 2EQ3A 3EPKA
chains in the Genus database with same CATH superfamily
2EPMX 2ZM6E 4NXNE 2ODRC 4R2EA 2EM0A 4WSPA 2D9HA 1AAYA 2M4IA 1TF3A 4DR7E 1J5EE 2HJJA 5A6BA 4B3SE 2YTGA 2EM6A 5LL6R 2M7QA 1XMQE 4WYQB 4BHCA 3IWCA 3LLHA 2EN1A 1NCSA 2UUAE 2B7TA 2NUFA 2L8TA 2YTIA 4F9AB 4DV6E 4N4RB 2EMHA 5TSEA 2F8BA 1EH6A 2WZOA 5AE1A 2E5LE 1YZ9A 2NUEA 3VYXA 2YTEA 1X5WA 4OX9E 2EJ4A 3AUZA 1A1FA 2M9AA 2YTJA 2UUBE 4ZYEA 1P47A 4JI6E 1XNQE 2LE2A 2EMCA 2EPZA 2VQEE 1N34E 2CT1A 2V86A 2EOFA 1YYOA 3JAMC 2B7VA 2EOQA 1T4LB 2EMXA 1G2FC 1N32E 3HTXA 1QNTA 3QG5C 2EOSA 3IWBA 1EH8A 2MC6A 4O5GA 2EM8A 2DMYA 2K4VA 3T1HE 5F3WA 1T4NA 5IV8B 2LJHA 4DV4E 4YY3E 4LF4E 4L5NC 5A6AA 2GHFA 2MKDA 2N3HA 2LRSA 5IT9C 3HPSA 2MC5A 2YRMA 4X65E 3KZZA 3KWRA 4B3RE 1IBKE 3J81C 4LFAE 4LF6E 3MSWA 2RS7A 5KL6A 2EZ6A 2EPRA 2LUQA 3C6MA 2V89A 3F6GA 4X8WA 4WSGA 1HNZE 1KYQA 4NXME 1L4SA 1A1HA 1LLMC 5AC5A 2EM9A 1GTKA 2L2MA 3M99B 2EOXA 2UXCE 3DF6A 4WFTA 3ADLA 2DRPA 4GZNC 2EN8A 2EPLX 5AE3A 1BB8A 3THOB 4WX9A 2EMAA 5BR8E 4M0VA 1JK1A 2EPNA 4LU9A 1B69A 1T4OA 4KWYA 1ZU1A 5T6JA 2I9IA 2EM5A 1IBLE 3J7AG 4JI5E 5LMUE 2YRKA 5KL7A 3HPZA 2BBGA 3K6QA 1YUJA 4JI8E 2EL6A 3ADIA 2DB2A 2ENCA 1NEIA 2EM3A 2L6MA 4M9VC 2L33A 3HXLA 1X3CA 2EOOA 4LF8E 4R2CA 2EM2A 4DV2E 5A6BD 3MHHC 2MDRA 2I13A 2B3TB 1QU6A 3JU0A 5LLQA 4R03A 1MGTA 2JPAA 2UXDE 1UILA 2GLIA 4BC9A 1O0WA 1Z1BA 4M30A 2EN6A 2CSHA 2ENAA 4DKKA 5IXMB 3H09A 1X49A 4HTGA 1IBME 2GPIA 2R76A 4FK5C 2EM7A 2VRDA 2UU9E 4NZVA 2EQ1A 5AC4A 3KZYA 5AASA 3EPHA 4R2AA 4ZYDA 4DMIA 4DUYE 2L3JA 3AV0A 1X6HA 4JI0E 2LCEA 5A69A 2NUGA 4JV5E 4R2SA 4MLVA 2EMLA 2EPXA 5DNYA 2JR1A 5KL5A 4X62E 2RS6A 3ADGA 4R8OA 4ZYGA 2RSIA 4JI4E 3LMLA 2DGCA 4R2RA 3BGHA 3EPJA 2ENHA 1JK2A 4JI7E 1ZAAC 2LTSA 3ECRA 2JP9A 2EPUA 1DGCA 2WBTA 4O4KA 2VF1A 2JOXA 1HNXE 4DV7E 1AH5A 4O43A 4BBYA 2YU8A 4DR1E 1BBOA 3J80C 1A1KA 2EMFA 1FJGE 3DJWA 2YWQA 2YSOA 1DI2A 2R1FA 1HNWE 1MEYC 2JOBA 4DV1E 4BHBA 4F2JC 4F6NA 4M2ZA 1IQSA 2YTFA 4F6MA 2EPCA 2FGGA 2IHR1 1GQEA 4NHRA 4RH8A 2YU5A 4LTYA 4Q28A 3BBGA 2EE8A 1EKZA 1TN9A 3TQMA 3J7Yp 4IJDA 1WJPA 1X6FA 3FIGA 4L8NA 2NABA 2YRHA 1GZ6A 2G7HA 4BC7A 1FKAE 2WBUA 5IWAE 2UXBE 1WRJA 4JI1E 3IWDA 2FV4B 2RPCA 2YZTA 1X6EA 2DSYA 3C4BA 4BMJA 1WHNA 4ZYHA 5FLXC 2E1MA 4KHPE 2N3GA 2ELZA 4MLQA 4DUZE 2PRTA 2ODRD 4WXCA 2YTNA 4DV5E 1IMUA 2Q8UA 2EPPA 4OOGC 3JTZA 1BBGA 2LUPB 2HGHA 2E72A 2EOHA 2EN2A 1G2DC 2JVAA 2RTXA 2KOUA 1WHQA 4WPYA 1A1LA 2K7IA 2EWLA 1YYWA 2CPNA 4DR4E 1ZBTA 3ADJA 2V85A 2V88A 4DR5E 1A1IA 4JI2E 1A1JA 1SFEA 4GKJE 3L00A 5AE2A 2V87A 5A6JA 1XMOE 2MKNA 4WXDA 1KJKA 2LT7A 2EN3A 2EMKA 2EOMA 4F54A 2HC5A 2N8XA 2EL4A 4GKKE 2FTXB 4X66E 2A25A 3VHTB 1PJQA 2LVHA 5A6KA 2EOYA 1ZBQA 2EPAA 4TUGA 2EOEA 3UK3C 1DQ3A 2DIXA 2RSMA 3VK6A 1PKPA 3MHSC 4X64E 1TF6A 2V83A 4BCAA 2EOJA 2KHXA 1I94E 1XNRE 2EN7A 2JYAA 1J26A 4F9BB 2MDGA 4DR3E 2DLKA 4GEQB 2WCC3 3EPLA 2EMZA 2V8QB 2EPKX 4R2PA 4IS1C 2EPOA 1YSAC 3C4TA 4LF5E 2JY9A 1UBDC 2EMGA 4Q35B 1PJSA 4RHBB 2EM4A 2EQ3A 3EPKA 2YTQA 1RMDA 1A1GA 2VQFE 1PJTA 2CTDA 4B3TE 3T1YE 5LMNE 2JXPA 1STUA 2WBSA 2KONA 5KL4A 4DV0E 4KZSA 5ADZA 2J7JA 2LMZA 4I8OA 1YYKA 4JI3E 4B3ME 4JYAE 3P1XA 2LTRA 4R2QA 2H36X 1WXRA 3HQ1A 4LF7E 4P7DA 2EMYA 2EORA 2L92A 2ADRA 1YPNA 2EOIA 2UUCE 5CFFE 2EQ0A 2DLQA 1RQ0A 1T39A 2EOZA 2NA2A 1RC7A 2L2KB 1YFHA 3C6KA 2F4VE 4DV3E 2YTDA 2DMIA 3EQ1A 5KL3A 4LF9E 4K0KE 1X48A 4HEIA 4P78A 2BB8A 2EMWA 2EN4A 2YTPA 3F6HA 2VE7C 3ZOQB 4DR6E 1HR0E 3BF2A 2B9DA 2LO3A 1ZR9A 1T38A 1EH7A 1N36E 4R2DA 3THNA 1UHZA 2L2NA 3RMPA 4LFBE 4F9CB 2EMIA 2RQLA 4DR2E 2LBSB 2L3CA 2EL5A 3OMLA 1IQOA 1PDAA 1X47A 2EP3A 2JWOA 5KL2A 4X9JA 4YHHE 3VYYA 4LFCE 3BIDA 4J8ZA 4O24A 3OTOE 4TUIA 2LJUA 2YSPA 4BS9A 2M1SA 1N3GA 2ELYA 1SR9A 1N33E 1YUIA 1F2IG 2YT4A 2EMBA 2YPNA 1UN6B 2YTOA 2HHHE 2LV2A 4AQYE 5A2QC
chains in the Genus database with same CATH topology
2YTQA 2EMAA 1RMDA 4IJDA 1JK1A 1B69A 1A1GA 1WJPA 1X6FA 2CTDA 4R2EA 2EM0A 2NABA 2YRHA 2D9HA 1AAYA 1ZU1A 1TF3A 2EM5A 2YTGA 2EM6A 2WBUA 2YRKA 5KL7A 2WBSA 1YUJA 2RPCA 2EL6A 1X6EA 5KL4A 2ENCA 2EM3A 1NCSA 2EN1A 2YTIA 2J7JA 4M9VC 2ELZA 2EMHA 1X3CA 2EOOA 2PRTA 4R2QA 4R2CA 2EM2A 2YTNA 2EMYA 3MHHC 2EORA 2I13A 2EPPA 2ADRA 1X5WA 2EOIA 2YTEA 2EJ4A 1A1FA 2EQ0A 2DLQA 2HGHA 2E72A 2EOHA 2M9AA 2JPAA 2EOZA 2EN2A 2YTJA 1G2DC 2GLIA 1Z1BA 2YTDA 2EN6A 2CSHA 2DMIA 1P47A 2ENAA 5KL3A 2EMCA 2EPZA 1A1LA 2CT1A 4FK5C 2EM7A 2EOFA 2VRDA 2EQ1A 2BB8A 2EOQA 2EMWA 2EN4A 3EPHA 4R2AA 2EMXA 2YTPA 1A1IA 1G2FC 1A1JA 2EOSA 2LO3A 1ZR9A 1X6HA 2LCEA 1TN9A 2EM8A 4R2SA 2EMLA 2EPXA 2MKNA 4R2DA 5KL5A 1KJKA 2LT7A 2EN3A 2EMKA 2EOMA 2RSIA 2DGCA 2EMIA 2EL4A 4R2RA 2A25A 3VHTB 3EPJA 2GHFA 2ENHA 2LVHA 2EOYA 2EPAA 2EL5A 2MKDA 1JK2A 1ZAAC 2YRMA 2EOEA 2EP3A 5KL2A 3UK3C 2JP9A 2EPUA 1DGCA 4X9JA 2WBTA 3MHSC 1TF6A 5KL6A 2YU8A 1BBOA 2EOJA 2EPRA 1A1KA 2EMFA 2YSOA 4WSGA 2YSPA 2R1FA 2EN7A 2ELYA 1MEYC 2MDGA 1YUIA 1F2IG 2DLKA 1A1HA 2WCC3 3EPLA 2EMZA 1LLMC 4F2JC 4F6NA 2YTFA 2EM9A 4F6MA 2EMBA 4R2PA 3M99B 2EOXA 2EPCA 1UN6B 4IS1C 1YSAC 2DRPA 2YTOA 1UBDC 2EMGA 2LV2A 2EN8A 4GZNC 2YU5A 1BB8A 2EM4A 2EE8A 2EQ3A 3EPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTQ A;  2EMA A;  1RMD A;  4IJD A;  1JK1 A;  1B69 A;  1A1G A;  1WJP A;  1X6F A;  2CTD A;  4R2E A;  2EM0 A;  2NAB A;  2YRH A;  2D9H A;  1AAY A;  1ZU1 A;  1TF3 A;  2EM5 A;  2YTG A;  2EM6 A;  2WBU A;  2YRK A;  5KL7 A;  2WBS A;  1YUJ A;  2RPC A;  2EL6 A;  1X6E A;  5KL4 A;  2ENC A;  2EM3 A;  1NCS A;  2EN1 A;  2YTI A;  2J7J A;  4M9V C;  2ELZ A;  2EMH A;  1X3C A;  2EOO A;  2PRT A;  4R2Q A;  4R2C A;  2EM2 A;  2YTN A;  2EMY A;  3MHH C;  2EOR A;  2I13 A;  2EPP A;  2ADR A;  1X5W A;  2EOI A;  2YTE A;  2EJ4 A;  1A1F A;  2EQ0 A;  2DLQ A;  2HGH A;  2E72 A;  2EOH A;  2M9A A;  2JPA A;  2EOZ A;  2EN2 A;  2YTJ A;  1G2D C;  2GLI A;  1Z1B A;  2YTD A;  2EN6 A;  2CSH A;  2DMI A;  1P47 A;  2ENA A;  5KL3 A;  2EMC A;  2EPZ A;  1A1L A;  2CT1 A;  4FK5 C;  2EM7 A;  2EOF A;  2VRD A;  2EQ1 A;  2BB8 A;  2EOQ A;  2EMW A;  2EN4 A;  3EPH A;  4R2A A;  2EMX A;  2YTP A;  1A1I A;  1G2F C;  1A1J A;  2EOS A;  2LO3 A;  1ZR9 A;  1X6H A;  2LCE A;  1TN9 A;  2EM8 A;  4R2S A;  2EML A;  2EPX A;  2MKN A;  4R2D A;  5KL5 A;  1KJK A;  2LT7 A;  2EN3 A;  2EMK A;  2EOM A;  2RSI A;  2DGC A;  2EMI A;  2EL4 A;  4R2R A;  2A25 A;  3VHT B;  3EPJ A;  2GHF A;  2ENH A;  2LVH A;  2EOY A;  2EPA A;  2EL5 A;  2MKD A;  1JK2 A;  1ZAA C;  2YRM A;  2EOE A;  2EP3 A;  5KL2 A;  3UK3 C;  2JP9 A;  2EPU A;  1DGC A;  4X9J A;  2WBT A;  3MHS C;  1TF6 A;  5KL6 A;  2YU8 A;  1BBO A;  2EOJ A;  2EPR A;  1A1K A;  2EMF A;  2YSO A;  4WSG A;  2YSP A;  2R1F A;  2EN7 A;  2ELY A;  1MEY C;  2MDG A;  1YUI A;  1F2I G;  2DLK A;  1A1H A;  2WCC 3;  3EPL A;  2EMZ A;  1LLM C;  4F2J C;  4F6N A;  2YTF A;  2EM9 A;  4F6M A;  2EMB A;  4R2P A;  3M99 B;  2EOX A;  2EPC A;  1UN6 B;  4IS1 C;  1YSA C;  2DRP A;  2YTO A;  1UBD C;  2EMG A;  2LV2 A;  2EN8 A;  4GZN C;  2YU5 A;  1BB8 A;  2EM4 A;  2EE8 A;  2EQ3 A;  3EPK A; 
#chains in the Genus database with same CATH topology
 2EPM X;  2ZM6 E;  4NXN E;  2ODR C;  4R2E A;  2EM0 A;  4WSP A;  2D9H A;  1AAY A;  2M4I A;  1TF3 A;  4DR7 E;  1J5E E;  2HJJ A;  5A6B A;  4B3S E;  2YTG A;  2EM6 A;  5LL6 R;  2M7Q A;  1XMQ E;  4WYQ B;  4BHC A;  3IWC A;  3LLH A;  2EN1 A;  1NCS A;  2UUA E;  2B7T A;  2NUF A;  2L8T A;  2YTI A;  4F9A B;  4DV6 E;  4N4R B;  2EMH A;  5TSE A;  2F8B A;  1EH6 A;  2WZO A;  5AE1 A;  2E5L E;  1YZ9 A;  2NUE A;  3VYX A;  2YTE A;  1X5W A;  4OX9 E;  2EJ4 A;  3AUZ A;  1A1F A;  2M9A A;  2YTJ A;  2UUB E;  4ZYE A;  1P47 A;  4JI6 E;  1XNQ E;  2LE2 A;  2EMC A;  2EPZ A;  2VQE E;  1N34 E;  2CT1 A;  2V86 A;  2EOF A;  1YYO A;  3JAM C;  2B7V A;  2EOQ A;  1T4L B;  2EMX A;  1G2F C;  1N32 E;  3HTX A;  1QNT A;  3QG5 C;  2EOS A;  3IWB A;  1EH8 A;  2MC6 A;  4O5G A;  2EM8 A;  2DMY A;  2K4V A;  3T1H E;  5F3W A;  1T4N A;  5IV8 B;  2LJH A;  4DV4 E;  4YY3 E;  4LF4 E;  4L5N C;  5A6A A;  2GHF A;  2MKD A;  2N3H A;  2LRS A;  5IT9 C;  3HPS A;  2MC5 A;  2YRM A;  4X65 E;  3KZZ A;  3KWR A;  4B3R E;  1IBK E;  3J81 C;  4LFA E;  4LF6 E;  3MSW A;  2RS7 A;  5KL6 A;  2EZ6 A;  2EPR A;  2LUQ A;  3C6M A;  2V89 A;  3F6G A;  4X8W A;  4WSG A;  1HNZ E;  1KYQ A;  4NXM E;  1L4S A;  1A1H A;  1LLM C;  5AC5 A;  2EM9 A;  1GTK A;  2L2M A;  3M99 B;  2EOX A;  2UXC E;  3DF6 A;  4WFT A;  3ADL A;  2DRP A;  4GZN C;  2EN8 A;  2EPL X;  5AE3 A;  1BB8 A;  3THO B;  4WX9 A;  2EMA A;  5BR8 E;  4M0V A;  1JK1 A;  2EPN A;  4LU9 A;  1B69 A;  1T4O A;  4KWY A;  1ZU1 A;  5T6J A;  2I9I A;  2EM5 A;  1IBL E;  3J7A G;  4JI5 E;  5LMU E;  2YRK A;  5KL7 A;  3HPZ A;  2BBG A;  3K6Q A;  1YUJ A;  4JI8 E;  2EL6 A;  3ADI A;  2DB2 A;  2ENC A;  1NEI A;  2EM3 A;  2L6M A;  4M9V C;  2L33 A;  3HXL A;  1X3C A;  2EOO A;  4LF8 E;  4R2C A;  2EM2 A;  4DV2 E;  5A6B D;  3MHH C;  2MDR A;  2I13 A;  2B3T B;  1QU6 A;  3JU0 A;  5LLQ A;  4R03 A;  1MGT A;  2JPA A;  2UXD E;  1UIL A;  2GLI A;  4BC9 A;  1O0W A;  1Z1B A;  4M30 A;  2EN6 A;  2CSH A;  2ENA A;  4DKK A;  5IXM B;  3H09 A;  1X49 A;  4HTG A;  1IBM E;  2GPI A;  2R76 A;  4FK5 C;  2EM7 A;  2VRD A;  2UU9 E;  4NZV A;  2EQ1 A;  5AC4 A;  3KZY A;  5AAS A;  3EPH A;  4R2A A;  4ZYD A;  4DMI A;  4DUY E;  2L3J A;  3AV0 A;  1X6H A;  4JI0 E;  2LCE A;  5A69 A;  2NUG A;  4JV5 E;  4R2S A;  4MLV A;  2EML A;  2EPX A;  5DNY A;  2JR1 A;  5KL5 A;  4X62 E;  2RS6 A;  3ADG A;  4R8O A;  4ZYG A;  2RSI A;  4JI4 E;  3LML A;  2DGC A;  4R2R A;  3BGH A;  3EPJ A;  2ENH A;  1JK2 A;  4JI7 E;  1ZAA C;  2LTS A;  3ECR A;  2JP9 A;  2EPU A;  1DGC A;  2WBT A;  4O4K A;  2VF1 A;  2JOX A;  1HNX E;  4DV7 E;  1AH5 A;  4O43 A;  4BBY A;  2YU8 A;  4DR1 E;  1BBO A;  3J80 C;  1A1K A;  2EMF A;  1FJG E;  3DJW A;  2YWQ A;  2YSO A;  1DI2 A;  2R1F A;  1HNW E;  1MEY C;  2JOB A;  4DV1 E;  4BHB A;  4F2J C;  4F6N A;  4M2Z A;  1IQS A;  2YTF A;  4F6M A;  2EPC A;  2FGG A;  2IHR 1;  1GQE A;  4NHR A;  4RH8 A;  2YU5 A;  4LTY A;  4Q28 A;  3BBG A;  2EE8 A;  1EKZ A;  1TN9 A;  3TQM A;  3J7Y p;  4IJD A;  1WJP A;  1X6F A;  3FIG A;  4L8N A;  2NAB A;  2YRH A;  1GZ6 A;  2G7H A;  4BC7 A;  1FKA E;  2WBU A;  5IWA E;  2UXB E;  1WRJ A;  4JI1 E;  3IWD A;  2FV4 B;  2RPC A;  2YZT A;  1X6E A;  2DSY A;  3C4B A;  4BMJ A;  1WHN A;  4ZYH A;  5FLX C;  2E1M A;  4KHP E;  2N3G A;  2ELZ A;  4MLQ A;  4DUZ E;  2PRT A;  2ODR D;  4WXC A;  2YTN A;  4DV5 E;  1IMU A;  2Q8U A;  2EPP A;  4OOG C;  3JTZ A;  1BBG A;  2LUP B;  2HGH A;  2E72 A;  2EOH A;  2EN2 A;  1G2D C;  2JVA A;  2RTX A;  2KOU A;  1WHQ A;  4WPY A;  1A1L A;  2K7I A;  2EWL A;  1YYW A;  2CPN A;  4DR4 E;  1ZBT A;  3ADJ A;  2V85 A;  2V88 A;  4DR5 E;  1A1I A;  4JI2 E;  1A1J A;  1SFE A;  4GKJ E;  3L00 A;  5AE2 A;  2V87 A;  5A6J A;  1XMO E;  2MKN A;  4WXD A;  1KJK A;  2LT7 A;  2EN3 A;  2EMK A;  2EOM A;  4F54 A;  2HC5 A;  2N8X A;  2EL4 A;  4GKK E;  2FTX B;  4X66 E;  2A25 A;  3VHT B;  1PJQ A;  2LVH A;  5A6K A;  2EOY A;  1ZBQ A;  2EPA A;  4TUG A;  2EOE A;  3UK3 C;  1DQ3 A;  2DIX A;  2RSM A;  3VK6 A;  1PKP A;  3MHS C;  4X64 E;  1TF6 A;  2V83 A;  4BCA A;  2EOJ A;  2KHX A;  1I94 E;  1XNR E;  2EN7 A;  2JYA A;  1J26 A;  4F9B B;  2MDG A;  4DR3 E;  2DLK A;  4GEQ B;  2WCC 3;  3EPL A;  2EMZ A;  2V8Q B;  2EPK X;  4R2P A;  4IS1 C;  2EPO A;  1YSA C;  3C4T A;  4LF5 E;  2JY9 A;  1UBD C;  2EMG A;  4Q35 B;  1PJS A;  4RHB B;  2EM4 A;  2EQ3 A;  3EPK A;  2YTQ A;  1RMD A;  1A1G A;  2VQF E;  1PJT A;  2CTD A;  4B3T E;  3T1Y E;  5LMN E;  2JXP A;  1STU A;  2WBS A;  2KON A;  5KL4 A;  4DV0 E;  4KZS A;  5ADZ A;  2J7J A;  2LMZ A;  4I8O A;  1YYK A;  4JI3 E;  4B3M E;  4JYA E;  3P1X A;  2LTR A;  4R2Q A;  2H36 X;  1WXR A;  3HQ1 A;  4LF7 E;  4P7D A;  2EMY A;  2EOR A;  2L92 A;  2ADR A;  1YPN A;  2EOI A;  2UUC E;  5CFF E;  2EQ0 A;  2DLQ A;  1RQ0 A;  1T39 A;  2EOZ A;  2NA2 A;  1RC7 A;  2L2K B;  1YFH A;  3C6K A;  2F4V E;  4DV3 E;  2YTD A;  2DMI A;  3EQ1 A;  5KL3 A;  4LF9 E;  4K0K E;  1X48 A;  4HEI A;  4P78 A;  2BB8 A;  2EMW A;  2EN4 A;  2YTP A;  3F6H A;  2VE7 C;  3ZOQ B;  4DR6 E;  1HR0 E;  3BF2 A;  2B9D A;  2LO3 A;  1ZR9 A;  1T38 A;  1EH7 A;  1N36 E;  4R2D A;  3THN A;  1UHZ A;  2L2N A;  3RMP A;  4LFB E;  4F9C B;  2EMI A;  2RQL A;  4DR2 E;  2LBS B;  2L3C A;  2EL5 A;  3OML A;  1IQO A;  1PDA A;  1X47 A;  2EP3 A;  2JWO A;  5KL2 A;  4X9J A;  4YHH E;  3VYY A;  4LFC E;  3BID A;  4J8Z A;  4O24 A;  3OTO E;  4TUI A;  2LJU A;  2YSP A;  4BS9 A;  2M1S A;  1N3G A;  2ELY A;  1SR9 A;  1N33 E;  1YUI A;  1F2I G;  2YT4 A;  2EMB A;  2YPN A;  1UN6 B;  2YTO A;  2HHH E;  2LV2 A;  4AQY E;  5A2Q C; 
#chains in the Genus database with same CATH homology
 2YTQ A;  2EMA A;  1RMD A;  4IJD A;  1JK1 A;  1B69 A;  1A1G A;  1WJP A;  1X6F A;  2CTD A;  4R2E A;  2EM0 A;  2NAB A;  2YRH A;  2D9H A;  1AAY A;  1ZU1 A;  1TF3 A;  2EM5 A;  2YTG A;  2EM6 A;  2WBU A;  2YRK A;  5KL7 A;  2WBS A;  1YUJ A;  2RPC A;  2EL6 A;  1X6E A;  5KL4 A;  2ENC A;  2EM3 A;  1NCS A;  2EN1 A;  2YTI A;  2J7J A;  4M9V C;  2ELZ A;  2EMH A;  1X3C A;  2EOO A;  2PRT A;  4R2Q A;  4R2C A;  2EM2 A;  2YTN A;  2EMY A;  3MHH C;  2EOR A;  2I13 A;  2EPP A;  2ADR A;  1X5W A;  2EOI A;  2YTE A;  2EJ4 A;  1A1F A;  2EQ0 A;  2DLQ A;  2HGH A;  2E72 A;  2EOH A;  2M9A A;  2JPA A;  2EOZ A;  2EN2 A;  2YTJ A;  1G2D C;  2GLI A;  1Z1B A;  2YTD A;  2EN6 A;  2CSH A;  2DMI A;  1P47 A;  2ENA A;  5KL3 A;  2EMC A;  2EPZ A;  1A1L A;  2CT1 A;  4FK5 C;  2EM7 A;  2EOF A;  2VRD A;  2EQ1 A;  2BB8 A;  2EOQ A;  2EMW A;  2EN4 A;  3EPH A;  4R2A A;  2EMX A;  2YTP A;  1A1I A;  1G2F C;  1A1J A;  2EOS A;  2LO3 A;  1ZR9 A;  1X6H A;  2LCE A;  1TN9 A;  2EM8 A;  4R2S A;  2EML A;  2EPX A;  2MKN A;  4R2D A;  5KL5 A;  1KJK A;  2LT7 A;  2EN3 A;  2EMK A;  2EOM A;  2RSI A;  2DGC A;  2EMI A;  2EL4 A;  4R2R A;  2A25 A;  3VHT B;  3EPJ A;  2GHF A;  2ENH A;  2LVH A;  2EOY A;  2EPA A;  2EL5 A;  2MKD A;  1JK2 A;  1ZAA C;  2YRM A;  2EOE A;  2EP3 A;  5KL2 A;  3UK3 C;  2JP9 A;  2EPU A;  1DGC A;  4X9J A;  2WBT A;  3MHS C;  1TF6 A;  5KL6 A;  2YU8 A;  1BBO A;  2EOJ A;  2EPR A;  1A1K A;  2EMF A;  2YSO A;  4WSG A;  2YSP A;  2R1F A;  2EN7 A;  2ELY A;  1MEY C;  2MDG A;  1YUI A;  1F2I G;  2DLK A;  1A1H A;  2WCC 3;  3EPL A;  2EMZ A;  1LLM C;  4F2J C;  4F6N A;  2YTF A;  2EM9 A;  4F6M A;  2EMB A;  4R2P A;  3M99 B;  2EOX A;  2EPC A;  1UN6 B;  4IS1 C;  1YSA C;  2DRP A;  2YTO A;  1UBD C;  2EMG A;  2LV2 A;  2EN8 A;  4GZN C;  2YU5 A;  1BB8 A;  2EM4 A;  2EE8 A;  2EQ3 A;  3EPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...