2YTEA

Solution structure of the c2h2 type zinc finger (region 484-512) of human zinc finger protein 473
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
42
structure length
42
Chain Sequence
GSSGSSGEKPYSCAECKETFSDNNRLVQHQKMHTVKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 484-512) of human Zinc finger protein 473
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 473
total genus 8
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2007-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2yteA01
5KL3A 2WBSA 2EN6A 1F2IG 2CT1A 2LT7A 2YTOA 2E72A 2YRKA 2EOXA 1B69A 2YRHA 4FK5C 2EMIA 4F2JC 2WBTA 1YSAC 4GZNC 4R2RA 2EMWA 1JK1A 1DGCA 2EN1A 2PRTA 1X3CA 2EM9A 2EP3A 2RPCA 5KL4A 2EPZA 2EPPA 2D9HA 2EMFA 2LO3A 2EE8A 2ELYA 2EQ3A 2YSPA 2JP9A 1ZAAC 2CTDA 2EM0A 2EMKA 2EMYA 2EN8A 2MKNA 2M9AA 4R2PA 1LLMC 1YUJA 2MDGA 1A1FA 2EPCA 4IS1C 2EPRA 2EL6A 2EMBA 2EMAA 2JPAA 2DGCA 2WBUA 2EOJA 4M9VC 2BB8A 2YU8A 4IJDA 1UBDC 1NCSA 3EPHA 2DLQA 2LV2A 4R2QA 1BB8A 3EPJA 2EPUA 1A1JA 3M99B 1X6FA 2EPXA 3VHTB 2EN7A 1JK2A 2LCEA 2EM3A 2EM4A 1X6EA 2ENCA 2EOMA 4R2EA 4F6NA 2EOIA 1A1IA 2EQ1A 2YTIA 5KL5A 2YSOA 1X6HA 2R1FA 2EM2A 1TN9A 2EOZA 4WSGA 2DMIA 2EOQA 4R2DA 2EORA 2VRDA 2EN3A 2EJ4A 2J7JA 1YUIA 2YTJA 2RSIA 2EMHA 3EPKA 1G2DC 2EOOA 2WCC3 5KL2A 2EMZA 2NABA 3EPLA 2EOYA 2EM7A 2YTGA 2ELZA 3MHHC 2ENHA 2YRMA 3UK3C 2EM5A 1AAYA 1MEYC 2YTQA 2YTNA 2EOFA 2MKDA 2ADRA 1A1KA 2EMXA 2YU5A 2YTEA 1A1LA 4R2AA 2EMCA 2I13A 2GHFA 2EN2A 1G2FC 1UN6B 2EN4A 2DRPA 1A1HA 5KL7A 2A25A 1TF6A 2DLKA 1ZU1A 2EQ0A 1X5WA 1ZR9A 4R2SA 1TF3A 2EL4A 1BBOA 2EOHA 3MHSC 2YTDA 4R2CA 5KL6A 2EOSA 2HGHA 2CSHA 2EOEA 2EM8A 2EL5A 1P47A 4X9JA 2EM6A 1Z1BA 1A1GA 2ENAA 2YTFA 1RMDA 2EMGA 2EPAA 1WJPA 2LVHA 1KJKA 2EMLA 2YTPA 2GLIA 4F6MA
chains in the Genus database with same CATH superfamily
5KL3A 3C6KA 1F2IG 2LT7A 2YRKA 2EOXA 2JXPA 3C6MA 4OOGC 4R03A 2EM9A 2RPCA 5KL4A 5LMUE 1X49A 2F8BA 2ELYA 2LUPB 2JP9A 1ZAAC 2EN8A 2EM0A 2EMYA 4R2PA 2MDGA 4F54A 2VE7C 1SR9A 2EPRA 2LTSA 4TUIA 4WSPA 4DMIA 4LFBE 4MLQA 1I94E 3ADGA 3BBGA 3EPJA 2EPUA 3J81C 2EPXA 3VHTB 2L3CA 2LCEA 1X6EA 3JTZA 3TQMA 2EOIA 1IBKE 1A1IA 2KOUA 2EQ1A 3HXLA 3L00A 4BS9A 1X6HA 3VYXA 2EM2A 3F6GA 2EOZA 5AASA 2N8XA 3ADJA 2RS7A 3J7Yp 5A6BD 4R2DA 2V83A 2LE2A 2YTJA 2RSIA 2EMHA 3FIGA 3ZOQB 1O0WA 4LF4E 3ECRA 2NABA 4DV6E 2EM7A 4P7DA 2HJJA 2BBGA 2EOFA 2JVAA 1NEIA 2ADRA 4DR6E 2RSMA 2YU5A 5AE1A 2YZTA 4DV1E 2E1MA 2LJUA 4LU9A 1A1LA 1HNWE 4JI4E 4B3SE 2FTXB 1GZ6A 1G2FC 1T38A 4DV4E 4YY3E 4O5GA 2DLKA 1ZU1A 4Q35B 1YZ9A 1ZR9A 2ZM6E 1TF3A 4OX9E 1EKZA 1PJTA 3IWDA 4K0KE 2EL4A 3MHSC 2LUQA 2EPLX 2K4VA 2VQEE 2NA2A 2V85A 5A6BA 1IQSA 1FKAE 3MSWA 4N4RB 1DI2A 2FV4B 4B3RE 2G7HA 2E5LE 5A2QC 1RMDA 2EMGA 2EPAA 3T1YE 5IWAE 1KJKA 1QU6A 1N36E 2JYAA 2CT1A 2YTOA 2M7QA 1WXRA 2UXDE 2YRHA 4FK5C 3KZZA 5LLQA 4JI0E 2PRTA 2EP3A 2EPZA 2D9HA 4M0VA 4KWYA 4ZYHA 2YSPA 4GKJE 2IHR1 4WX9A 4DV7E 2M9AA 2M1SA 2EPCA 2GPIA 2NUEA 4IS1C 2B7TA 5AC4A 3T1HE 4IJDA 2EZ6A 2RS6A 3EPHA 2EPOA 1BB8A 2Q8UA 4RHBB 2RTXA 4WYQB 1MGTA 2YPNA 3M99B 4DR5E 1A1JA 2EN7A 1IBME 4LF6E 4BCAA 2ENCA 1IBLE 3DJWA 2YTIA 3VK6A 2K7IA 2YSOA 2R1FA 2DMIA 2MC6A 4L5NC 5A6AA 2EORA 4DR4E 2EN3A 1N33E 2J7JA 1YUIA 1G2DC 2EOOA 2EMZA 3EPLA 4B3TE 5BR8E 3IWBA 4JI3E 2ENHA 2YRMA 1PDAA 2YTQA 3ADLA 2YTNA 4LF5E 2V88A 1UILA 4X8WA 2MKDA 2UU9E 4JI2E 5IXMB 1YFHA 3LMLA 3AV0A 4R2AA 2I13A 2GHFA 2EN2A 2JOBA 2EN4A 3THNA 1A1HA 2UUAE 4BC7A 3K6QA 5LMNE 2KONA 2MC5A 1BBOA 4RH8A 2YTDA 4R2CA 2L92A 4DKKA 1PJQA 2ODRC 3KZYA 2NUFA 2EOSA 1YYKA 5ADZA 2I9IA 5A6KA 1P47A 2L2MA 1ZBTA 2EM6A 4X9JA 1A1GA 4TUGA 1IQOA 2V89A 1HNZE 2WZOA 2DIXA 4DV0E 2YTPA 2GLIA 4JI1E 2WBSA 2EN6A 4LF9E 2E72A 1KYQA 3DF6A 4JV5E 4NXME 1YSAC 4R2RA 2EMWA 1DGCA 1X3CA 4KHPE 5DNYA 2LRSA 4DR2E 5F3WA 5AE3A 4LF8E 2LO3A 1WHQA 1SFEA 4ZYGA 4JYAE 1XMQE 3AUZA 2EQ3A 4F9BB 4DR1E 2CTDA 2EMKA 4NHRA 4L8NA 4WFTA 4JI6E 2MKNA 4WXDA 3THOB 1LLMC 4HEIA 1A1FA 2B9DA 3VYYA 2EMAA 4O4KA 2DGCA 2WBUA 2UUBE 2EOJA 4M9VC 2YU8A 1UBDC 4BBYA 2LV2A 4GEQB 3QG5C 1X6FA 2EM4A 4X65E 1EH8A 1IMUA 5KL5A 4DV2E 5IT9C 2DMYA 2EPKX 2LMZA 2EOQA 2DB2A 4JI5E 2UXCE 1YPNA 2EJ4A 2YT4A 5FLXC 4DV3E 1HNXE 1WHNA 1N3GA 2LJHA 4ZYDA 3EPKA 1T39A 4BMJA 3BGHA 1DQ3A 2EOYA 2L33A 3LLHA 4AQYE 2N3HA 3HPZA 2ELZA 2L2NA 1T4NA 3MHHC 4BHCA 1PKPA 4DUYE 1AAYA 1MEYC 1WRJA 3J7AG 4LTYA 1YYWA 4DR3E 2VQFE 2L8TA 4BC9A 1HR0E 1XNQE 1XNRE 2YTEA 5A69A 3JU0A 5A6JA 3HPSA 4YHHE 4GKKE 2DRPA 5KL7A 1TF6A 2EQ0A 1X5WA 2H36X 4R2SA 2UXBE 2B3TB 2R76A 2V86A 4WXCA 1STUA 1N32E 4DV5E 1ZBQA 3BIDA 2HGHA 1AH5A 2EOEA 4F9CB 4MLVA 2EM8A 2EL5A 1RC7A 1Z1BA 2YTFA 3HQ1A 5TSEA 4R8OA 2CPNA 1XMOE 1WJPA 4B3ME 2EMLA 3EQ1A 2FGGA 4F6MA 5AC5A 2B7VA 4ZYEA 2M4IA 2JY9A 1B69A 2EMIA 4F2JC 2WBTA 4GZNC 1JK1A 2EN1A 1UHZA 2YWQA 4JI8E 2EPPA 2EMFA 4KZSA 4DR7E 4O43A 2JR1A 2EE8A 2JOXA 3P1XA 3RMPA 3IWCA 1X47A 1YUJA 1PJSA 2V87A 2EL6A 2EWLA 2L2KB 3OTOE 2EMBA 2JPAA 4BHBA 2HHHE 2BB8A 1NCSA 2DLQA 4R2QA 4LFCE 4X66E 1JK2A 2EM3A 4J8ZA 4WPYA 2EOMA 4R2EA 4F6NA 3JAMC 2KHXA 3H09A 1EH6A 3HTXA 2L6MA 2HC5A 4X62E 4WSGA 1GQEA 5CFFE 1TN9A 1FJGE 1J26A 2VRDA 4DUZE 4LF7E 1L4SA 4JI7E 1YYOA 3C4BA 4I8OA 5KL2A 2WCC3 2N3GA 3C4TA 2EPNA 3OMLA 2JWOA 2MDRA 4F9AB 2EPMX 2YTGA 3UK3C 2EM5A 1J5EE 1X48A 3KWRA 1T4LB 2NUGA 1GTKA 4M2ZA 3J80C 1A1KA 4HTGA 2EMXA 4P78A 3BF2A 1N34E 2V8QB 2LBSB 2RQLA 2EMCA 2VF1A 5LL6R 1BBGA 1UN6B 4O24A 3F6HA 2A25A 1T4OA 1EH7A 5IV8B 2F4VE 2ODRD 4NXNE 2EOHA 5KL6A 2DSYA 2UUCE 1QNTA 2LTRA 4NZVA 5AE2A 3ADIA 2CSHA 1RQ0A 2L3JA 4X64E 4M30A 2ENAA 5T6JA 4Q28A 2LVHA 4LFAE
chains in the Genus database with same CATH topology
5KL3A 2WBSA 2EN6A 1F2IG 2CT1A 2LT7A 2YTOA 2E72A 2YRKA 2EOXA 1B69A 2YRHA 4FK5C 2EMIA 4F2JC 2WBTA 1YSAC 4GZNC 4R2RA 2EMWA 1JK1A 1DGCA 2EN1A 2PRTA 1X3CA 2EM9A 2EP3A 2RPCA 5KL4A 2EPZA 2EPPA 2D9HA 2EMFA 2LO3A 2EE8A 2ELYA 2EQ3A 2YSPA 2JP9A 1ZAAC 2CTDA 2EM0A 2EMKA 2EMYA 2EN8A 2MKNA 2M9AA 4R2PA 1LLMC 1YUJA 2MDGA 1A1FA 2EPCA 4IS1C 2EPRA 2EL6A 2EMBA 2EMAA 2JPAA 2DGCA 2WBUA 2EOJA 4M9VC 2BB8A 2YU8A 4IJDA 1UBDC 1NCSA 3EPHA 2DLQA 2LV2A 4R2QA 1BB8A 3EPJA 2EPUA 1A1JA 3M99B 1X6FA 2EPXA 3VHTB 2EN7A 1JK2A 2LCEA 2EM3A 2EM4A 1X6EA 2ENCA 2EOMA 4R2EA 4F6NA 2EOIA 1A1IA 2EQ1A 2YTIA 5KL5A 2YSOA 1X6HA 2R1FA 2EM2A 1TN9A 2EOZA 4WSGA 2DMIA 2EOQA 4R2DA 2EORA 2VRDA 2EN3A 2EJ4A 2J7JA 1YUIA 2YTJA 2RSIA 2EMHA 3EPKA 1G2DC 2EOOA 2WCC3 5KL2A 2EMZA 2NABA 3EPLA 2EOYA 2EM7A 2YTGA 2ELZA 3MHHC 2ENHA 2YRMA 3UK3C 2EM5A 1AAYA 1MEYC 2YTQA 2YTNA 2EOFA 2MKDA 2ADRA 1A1KA 2EMXA 2YU5A 2YTEA 1A1LA 4R2AA 2EMCA 2I13A 2GHFA 2EN2A 1G2FC 1UN6B 2EN4A 2DRPA 1A1HA 5KL7A 2A25A 1TF6A 2DLKA 1ZU1A 2EQ0A 1X5WA 1ZR9A 4R2SA 1TF3A 2EL4A 1BBOA 2EOHA 3MHSC 2YTDA 4R2CA 5KL6A 2EOSA 2HGHA 2CSHA 2EOEA 2EM8A 2EL5A 1P47A 4X9JA 2EM6A 1Z1BA 1A1GA 2ENAA 2YTFA 1RMDA 2EMGA 2EPAA 1WJPA 2LVHA 1KJKA 2EMLA 2YTPA 2GLIA 4F6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KL3 A;  2WBS A;  2EN6 A;  1F2I G;  2CT1 A;  2LT7 A;  2YTO A;  2E72 A;  2YRK A;  2EOX A;  1B69 A;  2YRH A;  4FK5 C;  2EMI A;  4F2J C;  2WBT A;  1YSA C;  4GZN C;  4R2R A;  2EMW A;  1JK1 A;  1DGC A;  2EN1 A;  2PRT A;  1X3C A;  2EM9 A;  2EP3 A;  2RPC A;  5KL4 A;  2EPZ A;  2EPP A;  2D9H A;  2EMF A;  2LO3 A;  2EE8 A;  2ELY A;  2EQ3 A;  2YSP A;  2JP9 A;  1ZAA C;  2CTD A;  2EM0 A;  2EMK A;  2EMY A;  2EN8 A;  2MKN A;  2M9A A;  4R2P A;  1LLM C;  1YUJ A;  2MDG A;  1A1F A;  2EPC A;  4IS1 C;  2EPR A;  2EL6 A;  2EMB A;  2EMA A;  2JPA A;  2DGC A;  2WBU A;  2EOJ A;  4M9V C;  2BB8 A;  2YU8 A;  4IJD A;  1UBD C;  1NCS A;  3EPH A;  2DLQ A;  2LV2 A;  4R2Q A;  1BB8 A;  3EPJ A;  2EPU A;  1A1J A;  3M99 B;  1X6F A;  2EPX A;  3VHT B;  2EN7 A;  1JK2 A;  2LCE A;  2EM3 A;  2EM4 A;  1X6E A;  2ENC A;  2EOM A;  4R2E A;  4F6N A;  2EOI A;  1A1I A;  2EQ1 A;  2YTI A;  5KL5 A;  2YSO A;  1X6H A;  2R1F A;  2EM2 A;  1TN9 A;  2EOZ A;  4WSG A;  2DMI A;  2EOQ A;  4R2D A;  2EOR A;  2VRD A;  2EN3 A;  2EJ4 A;  2J7J A;  1YUI A;  2YTJ A;  2RSI A;  2EMH A;  3EPK A;  1G2D C;  2EOO A;  2WCC 3;  5KL2 A;  2EMZ A;  2NAB A;  3EPL A;  2EOY A;  2EM7 A;  2YTG A;  2ELZ A;  3MHH C;  2ENH A;  2YRM A;  3UK3 C;  2EM5 A;  1AAY A;  1MEY C;  2YTQ A;  2YTN A;  2EOF A;  2MKD A;  2ADR A;  1A1K A;  2EMX A;  2YU5 A;  2YTE A;  1A1L A;  4R2A A;  2EMC A;  2I13 A;  2GHF A;  2EN2 A;  1G2F C;  1UN6 B;  2EN4 A;  2DRP A;  1A1H A;  5KL7 A;  2A25 A;  1TF6 A;  2DLK A;  1ZU1 A;  2EQ0 A;  1X5W A;  1ZR9 A;  4R2S A;  1TF3 A;  2EL4 A;  1BBO A;  2EOH A;  3MHS C;  2YTD A;  4R2C A;  5KL6 A;  2EOS A;  2HGH A;  2CSH A;  2EOE A;  2EM8 A;  2EL5 A;  1P47 A;  4X9J A;  2EM6 A;  1Z1B A;  1A1G A;  2ENA A;  2YTF A;  1RMD A;  2EMG A;  2EPA A;  1WJP A;  2LVH A;  1KJK A;  2EML A;  2YTP A;  2GLI A;  4F6M A; 
#chains in the Genus database with same CATH topology
 5KL3 A;  3C6K A;  1F2I G;  2LT7 A;  2YRK A;  2EOX A;  2JXP A;  3C6M A;  4OOG C;  4R03 A;  2EM9 A;  2RPC A;  5KL4 A;  5LMU E;  1X49 A;  2F8B A;  2ELY A;  2LUP B;  2JP9 A;  1ZAA C;  2EN8 A;  2EM0 A;  2EMY A;  4R2P A;  2MDG A;  4F54 A;  2VE7 C;  1SR9 A;  2EPR A;  2LTS A;  4TUI A;  4WSP A;  4DMI A;  4LFB E;  4MLQ A;  1I94 E;  3ADG A;  3BBG A;  3EPJ A;  2EPU A;  3J81 C;  2EPX A;  3VHT B;  2L3C A;  2LCE A;  1X6E A;  3JTZ A;  3TQM A;  2EOI A;  1IBK E;  1A1I A;  2KOU A;  2EQ1 A;  3HXL A;  3L00 A;  4BS9 A;  1X6H A;  3VYX A;  2EM2 A;  3F6G A;  2EOZ A;  5AAS A;  2N8X A;  3ADJ A;  2RS7 A;  3J7Y p;  5A6B D;  4R2D A;  2V83 A;  2LE2 A;  2YTJ A;  2RSI A;  2EMH A;  3FIG A;  3ZOQ B;  1O0W A;  4LF4 E;  3ECR A;  2NAB A;  4DV6 E;  2EM7 A;  4P7D A;  2HJJ A;  2BBG A;  2EOF A;  2JVA A;  1NEI A;  2ADR A;  4DR6 E;  2RSM A;  2YU5 A;  5AE1 A;  2YZT A;  4DV1 E;  2E1M A;  2LJU A;  4LU9 A;  1A1L A;  1HNW E;  4JI4 E;  4B3S E;  2FTX B;  1GZ6 A;  1G2F C;  1T38 A;  4DV4 E;  4YY3 E;  4O5G A;  2DLK A;  1ZU1 A;  4Q35 B;  1YZ9 A;  1ZR9 A;  2ZM6 E;  1TF3 A;  4OX9 E;  1EKZ A;  1PJT A;  3IWD A;  4K0K E;  2EL4 A;  3MHS C;  2LUQ A;  2EPL X;  2K4V A;  2VQE E;  2NA2 A;  2V85 A;  5A6B A;  1IQS A;  1FKA E;  3MSW A;  4N4R B;  1DI2 A;  2FV4 B;  4B3R E;  2G7H A;  2E5L E;  5A2Q C;  1RMD A;  2EMG A;  2EPA A;  3T1Y E;  5IWA E;  1KJK A;  1QU6 A;  1N36 E;  2JYA A;  2CT1 A;  2YTO A;  2M7Q A;  1WXR A;  2UXD E;  2YRH A;  4FK5 C;  3KZZ A;  5LLQ A;  4JI0 E;  2PRT A;  2EP3 A;  2EPZ A;  2D9H A;  4M0V A;  4KWY A;  4ZYH A;  2YSP A;  4GKJ E;  2IHR 1;  4WX9 A;  4DV7 E;  2M9A A;  2M1S A;  2EPC A;  2GPI A;  2NUE A;  4IS1 C;  2B7T A;  5AC4 A;  3T1H E;  4IJD A;  2EZ6 A;  2RS6 A;  3EPH A;  2EPO A;  1BB8 A;  2Q8U A;  4RHB B;  2RTX A;  4WYQ B;  1MGT A;  2YPN A;  3M99 B;  4DR5 E;  1A1J A;  2EN7 A;  1IBM E;  4LF6 E;  4BCA A;  2ENC A;  1IBL E;  3DJW A;  2YTI A;  3VK6 A;  2K7I A;  2YSO A;  2R1F A;  2DMI A;  2MC6 A;  4L5N C;  5A6A A;  2EOR A;  4DR4 E;  2EN3 A;  1N33 E;  2J7J A;  1YUI A;  1G2D C;  2EOO A;  2EMZ A;  3EPL A;  4B3T E;  5BR8 E;  3IWB A;  4JI3 E;  2ENH A;  2YRM A;  1PDA A;  2YTQ A;  3ADL A;  2YTN A;  4LF5 E;  2V88 A;  1UIL A;  4X8W A;  2MKD A;  2UU9 E;  4JI2 E;  5IXM B;  1YFH A;  3LML A;  3AV0 A;  4R2A A;  2I13 A;  2GHF A;  2EN2 A;  2JOB A;  2EN4 A;  3THN A;  1A1H A;  2UUA E;  4BC7 A;  3K6Q A;  5LMN E;  2KON A;  2MC5 A;  1BBO A;  4RH8 A;  2YTD A;  4R2C A;  2L92 A;  4DKK A;  1PJQ A;  2ODR C;  3KZY A;  2NUF A;  2EOS A;  1YYK A;  5ADZ A;  2I9I A;  5A6K A;  1P47 A;  2L2M A;  1ZBT A;  2EM6 A;  4X9J A;  1A1G A;  4TUG A;  1IQO A;  2V89 A;  1HNZ E;  2WZO A;  2DIX A;  4DV0 E;  2YTP A;  2GLI A;  4JI1 E;  2WBS A;  2EN6 A;  4LF9 E;  2E72 A;  1KYQ A;  3DF6 A;  4JV5 E;  4NXM E;  1YSA C;  4R2R A;  2EMW A;  1DGC A;  1X3C A;  4KHP E;  5DNY A;  2LRS A;  4DR2 E;  5F3W A;  5AE3 A;  4LF8 E;  2LO3 A;  1WHQ A;  1SFE A;  4ZYG A;  4JYA E;  1XMQ E;  3AUZ A;  2EQ3 A;  4F9B B;  4DR1 E;  2CTD A;  2EMK A;  4NHR A;  4L8N A;  4WFT A;  4JI6 E;  2MKN A;  4WXD A;  3THO B;  1LLM C;  4HEI A;  1A1F A;  2B9D A;  3VYY A;  2EMA A;  4O4K A;  2DGC A;  2WBU A;  2UUB E;  2EOJ A;  4M9V C;  2YU8 A;  1UBD C;  4BBY A;  2LV2 A;  4GEQ B;  3QG5 C;  1X6F A;  2EM4 A;  4X65 E;  1EH8 A;  1IMU A;  5KL5 A;  4DV2 E;  5IT9 C;  2DMY A;  2EPK X;  2LMZ A;  2EOQ A;  2DB2 A;  4JI5 E;  2UXC E;  1YPN A;  2EJ4 A;  2YT4 A;  5FLX C;  4DV3 E;  1HNX E;  1WHN A;  1N3G A;  2LJH A;  4ZYD A;  3EPK A;  1T39 A;  4BMJ A;  3BGH A;  1DQ3 A;  2EOY A;  2L33 A;  3LLH A;  4AQY E;  2N3H A;  3HPZ A;  2ELZ A;  2L2N A;  1T4N A;  3MHH C;  4BHC A;  1PKP A;  4DUY E;  1AAY A;  1MEY C;  1WRJ A;  3J7A G;  4LTY A;  1YYW A;  4DR3 E;  2VQF E;  2L8T A;  4BC9 A;  1HR0 E;  1XNQ E;  1XNR E;  2YTE A;  5A69 A;  3JU0 A;  5A6J A;  3HPS A;  4YHH E;  4GKK E;  2DRP A;  5KL7 A;  1TF6 A;  2EQ0 A;  1X5W A;  2H36 X;  4R2S A;  2UXB E;  2B3T B;  2R76 A;  2V86 A;  4WXC A;  1STU A;  1N32 E;  4DV5 E;  1ZBQ A;  3BID A;  2HGH A;  1AH5 A;  2EOE A;  4F9C B;  4MLV A;  2EM8 A;  2EL5 A;  1RC7 A;  1Z1B A;  2YTF A;  3HQ1 A;  5TSE A;  4R8O A;  2CPN A;  1XMO E;  1WJP A;  4B3M E;  2EML A;  3EQ1 A;  2FGG A;  4F6M A;  5AC5 A;  2B7V A;  4ZYE A;  2M4I A;  2JY9 A;  1B69 A;  2EMI A;  4F2J C;  2WBT A;  4GZN C;  1JK1 A;  2EN1 A;  1UHZ A;  2YWQ A;  4JI8 E;  2EPP A;  2EMF A;  4KZS A;  4DR7 E;  4O43 A;  2JR1 A;  2EE8 A;  2JOX A;  3P1X A;  3RMP A;  3IWC A;  1X47 A;  1YUJ A;  1PJS A;  2V87 A;  2EL6 A;  2EWL A;  2L2K B;  3OTO E;  2EMB A;  2JPA A;  4BHB A;  2HHH E;  2BB8 A;  1NCS A;  2DLQ A;  4R2Q A;  4LFC E;  4X66 E;  1JK2 A;  2EM3 A;  4J8Z A;  4WPY A;  2EOM A;  4R2E A;  4F6N A;  3JAM C;  2KHX A;  3H09 A;  1EH6 A;  3HTX A;  2L6M A;  2HC5 A;  4X62 E;  4WSG A;  1GQE A;  5CFF E;  1TN9 A;  1FJG E;  1J26 A;  2VRD A;  4DUZ E;  4LF7 E;  1L4S A;  4JI7 E;  1YYO A;  3C4B A;  4I8O A;  5KL2 A;  2WCC 3;  2N3G A;  3C4T A;  2EPN A;  3OML A;  2JWO A;  2MDR A;  4F9A B;  2EPM X;  2YTG A;  3UK3 C;  2EM5 A;  1J5E E;  1X48 A;  3KWR A;  1T4L B;  2NUG A;  1GTK A;  4M2Z A;  3J80 C;  1A1K A;  4HTG A;  2EMX A;  4P78 A;  3BF2 A;  1N34 E;  2V8Q B;  2LBS B;  2RQL A;  2EMC A;  2VF1 A;  5LL6 R;  1BBG A;  1UN6 B;  4O24 A;  3F6H A;  2A25 A;  1T4O A;  1EH7 A;  5IV8 B;  2F4V E;  2ODR D;  4NXN E;  2EOH A;  5KL6 A;  2DSY A;  2UUC E;  1QNT A;  2LTR A;  4NZV A;  5AE2 A;  3ADI A;  2CSH A;  1RQ0 A;  2L3J A;  4X64 E;  4M30 A;  2ENA A;  5T6J A;  4Q28 A;  2LVH A;  4LFA E; 
#chains in the Genus database with same CATH homology
 5KL3 A;  2WBS A;  2EN6 A;  1F2I G;  2CT1 A;  2LT7 A;  2YTO A;  2E72 A;  2YRK A;  2EOX A;  1B69 A;  2YRH A;  4FK5 C;  2EMI A;  4F2J C;  2WBT A;  1YSA C;  4GZN C;  4R2R A;  2EMW A;  1JK1 A;  1DGC A;  2EN1 A;  2PRT A;  1X3C A;  2EM9 A;  2EP3 A;  2RPC A;  5KL4 A;  2EPZ A;  2EPP A;  2D9H A;  2EMF A;  2LO3 A;  2EE8 A;  2ELY A;  2EQ3 A;  2YSP A;  2JP9 A;  1ZAA C;  2CTD A;  2EM0 A;  2EMK A;  2EMY A;  2EN8 A;  2MKN A;  2M9A A;  4R2P A;  1LLM C;  1YUJ A;  2MDG A;  1A1F A;  2EPC A;  4IS1 C;  2EPR A;  2EL6 A;  2EMB A;  2EMA A;  2JPA A;  2DGC A;  2WBU A;  2EOJ A;  4M9V C;  2BB8 A;  2YU8 A;  4IJD A;  1UBD C;  1NCS A;  3EPH A;  2DLQ A;  2LV2 A;  4R2Q A;  1BB8 A;  3EPJ A;  2EPU A;  1A1J A;  3M99 B;  1X6F A;  2EPX A;  3VHT B;  2EN7 A;  1JK2 A;  2LCE A;  2EM3 A;  2EM4 A;  1X6E A;  2ENC A;  2EOM A;  4R2E A;  4F6N A;  2EOI A;  1A1I A;  2EQ1 A;  2YTI A;  5KL5 A;  2YSO A;  1X6H A;  2R1F A;  2EM2 A;  1TN9 A;  2EOZ A;  4WSG A;  2DMI A;  2EOQ A;  4R2D A;  2EOR A;  2VRD A;  2EN3 A;  2EJ4 A;  2J7J A;  1YUI A;  2YTJ A;  2RSI A;  2EMH A;  3EPK A;  1G2D C;  2EOO A;  2WCC 3;  5KL2 A;  2EMZ A;  2NAB A;  3EPL A;  2EOY A;  2EM7 A;  2YTG A;  2ELZ A;  3MHH C;  2ENH A;  2YRM A;  3UK3 C;  2EM5 A;  1AAY A;  1MEY C;  2YTQ A;  2YTN A;  2EOF A;  2MKD A;  2ADR A;  1A1K A;  2EMX A;  2YU5 A;  2YTE A;  1A1L A;  4R2A A;  2EMC A;  2I13 A;  2GHF A;  2EN2 A;  1G2F C;  1UN6 B;  2EN4 A;  2DRP A;  1A1H A;  5KL7 A;  2A25 A;  1TF6 A;  2DLK A;  1ZU1 A;  2EQ0 A;  1X5W A;  1ZR9 A;  4R2S A;  1TF3 A;  2EL4 A;  1BBO A;  2EOH A;  3MHS C;  2YTD A;  4R2C A;  5KL6 A;  2EOS A;  2HGH A;  2CSH A;  2EOE A;  2EM8 A;  2EL5 A;  1P47 A;  4X9J A;  2EM6 A;  1Z1B A;  1A1G A;  2ENA A;  2YTF A;  1RMD A;  2EMG A;  2EPA A;  1WJP A;  2LVH A;  1KJK A;  2EML A;  2YTP A;  2GLI A;  4F6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...