2YTEA

Solution structure of the c2h2 type zinc finger (region 484-512) of human zinc finger protein 473
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
42
structure length
42
Chain Sequence
GSSGSSGEKPYSCAECKETFSDNNRLVQHQKMHTVKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 473
publication title Solution structure of the C2H2 type zinc finger (region 484-512) of human Zinc finger protein 473
rcsb
source organism Homo sapiens
total genus 8
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2007-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2yteA01
1MEYC 2LV2A 2EPAA 2EMHA 1Z1BA 1JK2A 3MHHC 1LLMC 1YUIA 1X6EA 2NABA 4X9JA 5KL7A 2CSHA 2EN6A 2YRKA 2EPCA 1DGCA 1TF3A 1A1GA 2EOFA 1P47A 1X3CA 2MKNA 1TN9A 4R2SA 4R2RA 1F2IG 2EMFA 2ENHA 2EM2A 1A1HA 2DGCA 2RSIA 2EOZA 5KL6A 2DRPA 4R2PA 2EOJA 1G2FC 2YTFA 2LVHA 1A1JA 5KL4A 2EOXA 2ADRA 2ELYA 2EOQA 2EM4A 4F6MA 1YUJA 2EPUA 1BBOA 2LO3A 2CTDA 2EL5A 4IS1C 2EN8A 2EOYA 2WCC3 4IJDA 2EM7A 2EN1A 2A25A 1TF6A 2EM8A 2EOSA 2YSPA 1UN6B 2ELZA 2YTGA 1ZAAC 2EJ4A 2ENAA 2CT1A 4R2QA 2DMIA 2JPAA 4GZNC 1ZU1A 2EN2A 2YU5A 2JP9A 2DLQA 2M9AA 4R2EA 2EM9A 2YTNA 2RPCA 1RMDA 1X6HA 2J7JA 3EPHA 3EPKA 1A1FA 1ZR9A 3VHTB 2EL4A 2EPXA 2YRHA 2MDGA 2MKDA 2EMLA 2GHFA 2EN3A 2LCEA 2YTIA 2I13A 2YSOA 4F6NA 2EOOA 5KL2A 2EMIA 2EMBA 2EOHA 2YTPA 2EMGA 2EM3A 4FK5C 2LT7A 2BB8A 2D9HA 2YTDA 2HGHA 2EMWA 2YTJA 2PRTA 1UBDC 2EORA 4R2AA 2EM0A 2R1FA 2VRDA 2EQ1A 2EP3A 3EPLA 4F2JC 2YTOA 2WBTA 1WJPA 4R2CA 1A1IA 2EE8A 1X5WA 2EOIA 2EN7A 5KL5A 2YTQA 3M99B 5KL3A 2EL6A 1YSAC 1B69A 2ENCA 2E72A 2EPPA 2WBUA 2EM5A 1A1LA 2EMZA 2EMKA 2EQ0A 1KJKA 2YRMA 1JK1A 2YU8A 4WSGA 2EOMA 2DLKA 1X6FA 2EMYA 2EMCA 3MHSC 1A1KA 1BB8A 4R2DA 2EQ3A 2EPRA 2WBSA 2EMXA 1G2DC 1NCSA 3EPJA 4M9VC 2GLIA 1AAYA 2EPZA 2EMAA 2EOEA 2EM6A 2EN4A 2YTEA 3UK3C
chains in the Genus database with same CATH superfamily
4L5NC 1RQ0A 2EPAA 2LTSA 2N3GA 4ZYGA 2EN6A 1YYWA 2B7TA 2YRKA 2LBSB 4LF8E 2EPKX 4X64E 5LMUE 4LFAE 2MKNA 4NHRA 2R76A 4TUIA 2NUEA 2V88A 5LMNE 4LTYA 4JI6E 2DGCA 4BC7A 2B7VA 1GQEA 4LFBE 1G2FC 2JYAA 2LUQA 2LVHA 3BF2A 2EOXA 2ADRA 1T4OA 3THOB 4F6MA 3ADGA 3KWRA 3C6KA 2K4VA 4LF5E 4ZYHA 1DI2A 4AQYE 4DR5E 1TF6A 2EM7A 3C4BA 2A25A 2YSPA 1UN6B 2ELZA 1ZAAC 4R2QA 1AH5A 4F9CB 4GZNC 2KONA 1ZU1A 4RHBB 4DV6E 2EN2A 2M7QA 4JV5E 2DLQA 2M9AA 4DV0E 2EM9A 4DR1E 2L2MA 2E1MA 1BBGA 5LLQA 5T6JA 2LE2A 2M4IA 2YTIA 4DV7E 2YSOA 2EOOA 5KL2A 1WXRA 4O4KA 4DR4E 2EMGA 2EM3A 2BB8A 2UUBE 2EZ6A 2YTJA 2PRTA 3HXLA 4BCAA 3THNA 2LJUA 2DIXA 2VRDA 3RMPA 2LRSA 1SFEA 2RS7A 1PKPA 4WX9A 1YZ9A 5A2QC 4MLVA 2LMZA 1NEIA 1X5WA 2L2NA 3F6GA 1XNRE 2EN7A 4NZVA 1J26A 1IMUA 2EPPA 1ZBQA 2WBUA 4DV2E 1PJSA 2EMKA 2EQ0A 3LMLA 5A6BD 2EOMA 2EMYA 3MHSC 2HC5A 4DR7E 3JAMC 3L00A 2EPRA 2L3CA 5AE1A 2I9IA 2L8TA 1N33E 1X48A 5LL6R 4KWYA 4M9VC 2N3HA 5CFFE 4GKJE 4KZSA 2EMAA 2JVAA 3VK6A 3HPSA 4P7DA 1MEYC 2L6MA 1JK2A 2L33A 3MHHC 3DF6A 1X6EA 1EH6A 2NABA 4X9JA 3OTOE 5KL7A 2Q8UA 4M30A 2UXCE 1T38A 1FKAE 4F9AB 4X66E 2EOFA 1GZ6A 3JTZA 1T39A 1P47A 1YFHA 5AC4A 4R2RA 2JXPA 3C4TA 2EMFA 4DV1E 4DMIA 1F2IG 2ZM6E 5KL6A 2DRPA 4DUZE 2UUAE 2YTFA 1N3GA 4JI3E 1A1JA 4WPYA 4BHCA 5KL4A 4Q35B 2ELYA 4JI7E 1X49A 2EM4A 2DSYA 4DUYE 2KOUA 2L2KB 4IS1C 2EOYA 1FJGE 2EOSA 4DKKA 2ODRC 3K6QA 2DMIA 2M1SA 5A6KA 1YYKA 2YTNA 3IWBA 2RPCA 1RMDA 1QU6A 1X6HA 1ZR9A 1PDAA 4Q28A 2EMLA 1WHQA 2V87A 4JYAE 2LCEA 4JI2E 4R03A 1EH8A 3IWDA 2LJHA 1EKZA 3T1HE 1YPNA 2UU9E 4LF6E 3HTXA 4FK5C 2NUFA 2LT7A 2F4VE 2EMWA 4JI8E 1N36E 2EP3A 3VYXA 5BR8E 4OX9E 2YTOA 3HPZA 4L8NA 1HNZE 1A1IA 2EPNA 2EL6A 2NUGA 1B69A 4JI5E 1HR0E 1KYQA 2E72A 4M0VA 4HTGA 2EMZA 3P1XA 1KJKA 4OOGC 2DLKA 2IHR1 2GPIA 4R2DA 2NA2A 4DR2E 4MLQA 2JY9A 1NCSA 3F6HA 5A6AA 4O24A 2E5LE 4ZYDA 1AAYA 3ADIA 3OMLA 2JWOA 1UHZA 4B3ME 1T4NA 2EOEA 3JU0A 3DJWA 3UK3C 2EMHA 3H09A 1HNWE 1IBLE 1LLMC 4J8ZA 1YUIA 4NXNE 2YZTA 1GTKA 1IQSA 1DGCA 1TF3A 4WXCA 4R2SA 2V85A 3J80C 2EM2A 4I8OA 2EOJA 3MSWA 3ECRA 3BGHA 4WYQB 4R8OA 3ADJA 4GKKE 1IQOA 5IT9C 2BBGA 2EWLA 4GEQB 3VYYA 1YUJA 2EPUA 1DQ3A 2EL5A 2WCC3 2EN1A 5AE2A 5IWAE 5F3WA 2L92A 2K7IA 2EJ4A 1J5EE 2CPNA 2CT1A 2HHHE 1IBKE 2N8XA 1MGTA 5FLXC 2V83A 2V8QB 3EPHA 3EPKA 4O5GA 1A1FA 2EL4A 2YRHA 2LTRA 2JR1A 2RS6A 5AASA 2MKDA 2G7HA 4HEIA 2EPOA 4TUGA 2DB2A 2VE7C 2EMIA 4WFTA 2EOHA 3ADLA 2YTPA 1ZBTA 2HJJA 4DR6E 2UXBE 3BIDA 1UBDC 2EORA 5A6JA 5DNYA 1IBME 2R1FA 2L3JA 4N4RB 4LF9E 4F2JC 2WBTA 4R2CA 4DV3E 3J7Yp 2EE8A 2EOIA 2RQLA 2YTQA 3M99B 4WXDA 3J7AG 4B3TE 3KZZA 1I94E 2ENCA 2F8BA 4KHPE 4BHBA 1XNQE 2EPMX 2V89A 1A1LA 1O0WA 1PJTA 5TSEA 1JK1A 4WSGA 4BMJA 1X6FA 4NXME 1A1KA 1BB8A 1XMOE 2FGGA 4DV4E 2WBSA 2EMXA 3EPJA 3BBGA 2B9DA 2UUCE 4B3SE 2EM6A 2EN4A 2YTEA 3AUZA 4M2ZA 2LV2A 3IWCA 5A69A 2DMYA 1Z1BA 2B3TB 1QNTA 2CSHA 4BS9A 2EPCA 4X62E 1A1GA 1X3CA 4LFCE 1TN9A 4WSPA 2VQEE 2ENHA 1A1HA 2FTXB 2VQFE 2RSIA 2EOZA 4YHHE 4P78A 4DR3E 4R2PA 2YT4A 3HQ1A 5ADZA 2H36X 1N32E 1HNXE 2UXDE 1WRJA 2EOQA 3FIGA 4ZYEA 1BBOA 2LO3A 2CTDA 2EN8A 3AV0A 4LF4E 4IJDA 3T1YE 3TQMA 2EM8A 3LLHA 2YTGA 4JI0E 2LUPB 2ENAA 2JPAA 3EQ1A 2YU5A 4O43A 2JP9A 2KHXA 4R2EA 5IV8B 2MC6A 2V86A 4K0KE 1RC7A 2J7JA 2MDRA 3VHTB 2EPXA 1YYOA 2MDGA 1SR9A 1N34E 4LF7E 2GHFA 2EN3A 2I13A 2EPLX 4B3RE 5AE3A 4LU9A 4F6NA 2ODRD 2EMBA 4DV5E 1UILA 2D9HA 2YTDA 2HGHA 5A6BA 4RH8A 4R2AA 3J81C 2VF1A 2EM0A 2RTXA 2WZOA 2EQ1A 1WHNA 1STUA 5IXMB 2JOBA 4F54A 3EPLA 2JOXA 1WJPA 4BC9A 1X47A 4YY3E 5KL5A 5KL3A 4JI4E 1YSAC 2MC5A 3C6MA 2EM5A 2YWQA 2YRMA 2YU8A 4X65E 2EMCA 1L4SA 2EQ3A 1PJQA 1G2DC 5AC5A 4BBYA 1T4LB 2GLIA 2YPNA 3QG5C 1EH7A 2EPZA 4X8WA 2RSMA 4F9BB 1XMQE 2FV4B 4JI1E 3ZOQB 3KZYA
chains in the Genus database with same CATH topology
1MEYC 2LV2A 2EPAA 2EMHA 1Z1BA 1JK2A 3MHHC 1LLMC 1YUIA 1X6EA 2NABA 4X9JA 5KL7A 2CSHA 2EN6A 2YRKA 2EPCA 1DGCA 1TF3A 1A1GA 2EOFA 1P47A 1X3CA 2MKNA 1TN9A 4R2SA 4R2RA 1F2IG 2EMFA 2ENHA 2EM2A 1A1HA 2DGCA 2RSIA 2EOZA 5KL6A 2DRPA 4R2PA 2EOJA 1G2FC 2YTFA 2LVHA 1A1JA 5KL4A 2EOXA 2ADRA 2ELYA 2EOQA 2EM4A 4F6MA 1YUJA 2EPUA 1BBOA 2LO3A 2CTDA 2EL5A 4IS1C 2EN8A 2EOYA 2WCC3 4IJDA 2EM7A 2EN1A 2A25A 1TF6A 2EM8A 2EOSA 2YSPA 1UN6B 2ELZA 2YTGA 1ZAAC 2EJ4A 2ENAA 2CT1A 4R2QA 2DMIA 2JPAA 4GZNC 1ZU1A 2EN2A 2YU5A 2JP9A 2DLQA 2M9AA 4R2EA 2EM9A 2YTNA 2RPCA 1RMDA 1X6HA 2J7JA 3EPHA 3EPKA 1A1FA 1ZR9A 3VHTB 2EL4A 2EPXA 2YRHA 2MDGA 2MKDA 2EMLA 2GHFA 2EN3A 2LCEA 2YTIA 2I13A 2YSOA 4F6NA 2EOOA 5KL2A 2EMIA 2EMBA 2EOHA 2YTPA 2EMGA 2EM3A 4FK5C 2LT7A 2BB8A 2D9HA 2YTDA 2HGHA 2EMWA 2YTJA 2PRTA 1UBDC 2EORA 4R2AA 2EM0A 2R1FA 2VRDA 2EQ1A 2EP3A 3EPLA 4F2JC 2YTOA 2WBTA 1WJPA 4R2CA 1A1IA 2EE8A 1X5WA 2EOIA 2EN7A 5KL5A 2YTQA 3M99B 5KL3A 2EL6A 1YSAC 1B69A 2ENCA 2E72A 2EPPA 2WBUA 2EM5A 1A1LA 2EMZA 2EMKA 2EQ0A 1KJKA 2YRMA 1JK1A 2YU8A 4WSGA 2EOMA 2DLKA 1X6FA 2EMYA 2EMCA 3MHSC 1A1KA 1BB8A 4R2DA 2EQ3A 2EPRA 2WBSA 2EMXA 1G2DC 1NCSA 3EPJA 4M9VC 2GLIA 1AAYA 2EPZA 2EMAA 2EOEA 2EM6A 2EN4A 2YTEA 3UK3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MEY C;  2LV2 A;  2EPA A;  2EMH A;  1Z1B A;  1JK2 A;  3MHH C;  1LLM C;  1YUI A;  1X6E A;  2NAB A;  4X9J A;  5KL7 A;  2CSH A;  2EN6 A;  2YRK A;  2EPC A;  1DGC A;  1TF3 A;  1A1G A;  2EOF A;  1P47 A;  1X3C A;  2MKN A;  1TN9 A;  4R2S A;  4R2R A;  1F2I G;  2EMF A;  2ENH A;  2EM2 A;  1A1H A;  2DGC A;  2RSI A;  2EOZ A;  5KL6 A;  2DRP A;  4R2P A;  2EOJ A;  1G2F C;  2YTF A;  2LVH A;  1A1J A;  5KL4 A;  2EOX A;  2ADR A;  2ELY A;  2EOQ A;  2EM4 A;  4F6M A;  1YUJ A;  2EPU A;  1BBO A;  2LO3 A;  2CTD A;  2EL5 A;  4IS1 C;  2EN8 A;  2EOY A;  2WCC 3;  4IJD A;  2EM7 A;  2EN1 A;  2A25 A;  1TF6 A;  2EM8 A;  2EOS A;  2YSP A;  1UN6 B;  2ELZ A;  2YTG A;  1ZAA C;  2EJ4 A;  2ENA A;  2CT1 A;  4R2Q A;  2DMI A;  2JPA A;  4GZN C;  1ZU1 A;  2EN2 A;  2YU5 A;  2JP9 A;  2DLQ A;  2M9A A;  4R2E A;  2EM9 A;  2YTN A;  2RPC A;  1RMD A;  1X6H A;  2J7J A;  3EPH A;  3EPK A;  1A1F A;  1ZR9 A;  3VHT B;  2EL4 A;  2EPX A;  2YRH A;  2MDG A;  2MKD A;  2EML A;  2GHF A;  2EN3 A;  2LCE A;  2YTI A;  2I13 A;  2YSO A;  4F6N A;  2EOO A;  5KL2 A;  2EMI A;  2EMB A;  2EOH A;  2YTP A;  2EMG A;  2EM3 A;  4FK5 C;  2LT7 A;  2BB8 A;  2D9H A;  2YTD A;  2HGH A;  2EMW A;  2YTJ A;  2PRT A;  1UBD C;  2EOR A;  4R2A A;  2EM0 A;  2R1F A;  2VRD A;  2EQ1 A;  2EP3 A;  3EPL A;  4F2J C;  2YTO A;  2WBT A;  1WJP A;  4R2C A;  1A1I A;  2EE8 A;  1X5W A;  2EOI A;  2EN7 A;  5KL5 A;  2YTQ A;  3M99 B;  5KL3 A;  2EL6 A;  1YSA C;  1B69 A;  2ENC A;  2E72 A;  2EPP A;  2WBU A;  2EM5 A;  1A1L A;  2EMZ A;  2EMK A;  2EQ0 A;  1KJK A;  2YRM A;  1JK1 A;  2YU8 A;  4WSG A;  2EOM A;  2DLK A;  1X6F A;  2EMY A;  2EMC A;  3MHS C;  1A1K A;  1BB8 A;  4R2D A;  2EQ3 A;  2EPR A;  2WBS A;  2EMX A;  1G2D C;  1NCS A;  3EPJ A;  4M9V C;  2GLI A;  1AAY A;  2EPZ A;  2EMA A;  2EOE A;  2EM6 A;  2EN4 A;  2YTE A;  3UK3 C; 
#chains in the Genus database with same CATH topology
 4L5N C;  1RQ0 A;  2EPA A;  2LTS A;  2N3G A;  4ZYG A;  2EN6 A;  1YYW A;  2B7T A;  2YRK A;  2LBS B;  4LF8 E;  2EPK X;  4X64 E;  5LMU E;  4LFA E;  2MKN A;  4NHR A;  2R76 A;  4TUI A;  2NUE A;  2V88 A;  5LMN E;  4LTY A;  4JI6 E;  2DGC A;  4BC7 A;  2B7V A;  1GQE A;  4LFB E;  1G2F C;  2JYA A;  2LUQ A;  2LVH A;  3BF2 A;  2EOX A;  2ADR A;  1T4O A;  3THO B;  4F6M A;  3ADG A;  3KWR A;  3C6K A;  2K4V A;  4LF5 E;  4ZYH A;  1DI2 A;  4AQY E;  4DR5 E;  1TF6 A;  2EM7 A;  3C4B A;  2A25 A;  2YSP A;  1UN6 B;  2ELZ A;  1ZAA C;  4R2Q A;  1AH5 A;  4F9C B;  4GZN C;  2KON A;  1ZU1 A;  4RHB B;  4DV6 E;  2EN2 A;  2M7Q A;  4JV5 E;  2DLQ A;  2M9A A;  4DV0 E;  2EM9 A;  4DR1 E;  2L2M A;  2E1M A;  1BBG A;  5LLQ A;  5T6J A;  2LE2 A;  2M4I A;  2YTI A;  4DV7 E;  2YSO A;  2EOO A;  5KL2 A;  1WXR A;  4O4K A;  4DR4 E;  2EMG A;  2EM3 A;  2BB8 A;  2UUB E;  2EZ6 A;  2YTJ A;  2PRT A;  3HXL A;  4BCA A;  3THN A;  2LJU A;  2DIX A;  2VRD A;  3RMP A;  2LRS A;  1SFE A;  2RS7 A;  1PKP A;  4WX9 A;  1YZ9 A;  5A2Q C;  4MLV A;  2LMZ A;  1NEI A;  1X5W A;  2L2N A;  3F6G A;  1XNR E;  2EN7 A;  4NZV A;  1J26 A;  1IMU A;  2EPP A;  1ZBQ A;  2WBU A;  4DV2 E;  1PJS A;  2EMK A;  2EQ0 A;  3LML A;  5A6B D;  2EOM A;  2EMY A;  3MHS C;  2HC5 A;  4DR7 E;  3JAM C;  3L00 A;  2EPR A;  2L3C A;  5AE1 A;  2I9I A;  2L8T A;  1N33 E;  1X48 A;  5LL6 R;  4KWY A;  4M9V C;  2N3H A;  5CFF E;  4GKJ E;  4KZS A;  2EMA A;  2JVA A;  3VK6 A;  3HPS A;  4P7D A;  1MEY C;  2L6M A;  1JK2 A;  2L33 A;  3MHH C;  3DF6 A;  1X6E A;  1EH6 A;  2NAB A;  4X9J A;  3OTO E;  5KL7 A;  2Q8U A;  4M30 A;  2UXC E;  1T38 A;  1FKA E;  4F9A B;  4X66 E;  2EOF A;  1GZ6 A;  3JTZ A;  1T39 A;  1P47 A;  1YFH A;  5AC4 A;  4R2R A;  2JXP A;  3C4T A;  2EMF A;  4DV1 E;  4DMI A;  1F2I G;  2ZM6 E;  5KL6 A;  2DRP A;  4DUZ E;  2UUA E;  2YTF A;  1N3G A;  4JI3 E;  1A1J A;  4WPY A;  4BHC A;  5KL4 A;  4Q35 B;  2ELY A;  4JI7 E;  1X49 A;  2EM4 A;  2DSY A;  4DUY E;  2KOU A;  2L2K B;  4IS1 C;  2EOY A;  1FJG E;  2EOS A;  4DKK A;  2ODR C;  3K6Q A;  2DMI A;  2M1S A;  5A6K A;  1YYK A;  2YTN A;  3IWB A;  2RPC A;  1RMD A;  1QU6 A;  1X6H A;  1ZR9 A;  1PDA A;  4Q28 A;  2EML A;  1WHQ A;  2V87 A;  4JYA E;  2LCE A;  4JI2 E;  4R03 A;  1EH8 A;  3IWD A;  2LJH A;  1EKZ A;  3T1H E;  1YPN A;  2UU9 E;  4LF6 E;  3HTX A;  4FK5 C;  2NUF A;  2LT7 A;  2F4V E;  2EMW A;  4JI8 E;  1N36 E;  2EP3 A;  3VYX A;  5BR8 E;  4OX9 E;  2YTO A;  3HPZ A;  4L8N A;  1HNZ E;  1A1I A;  2EPN A;  2EL6 A;  2NUG A;  1B69 A;  4JI5 E;  1HR0 E;  1KYQ A;  2E72 A;  4M0V A;  4HTG A;  2EMZ A;  3P1X A;  1KJK A;  4OOG C;  2DLK A;  2IHR 1;  2GPI A;  4R2D A;  2NA2 A;  4DR2 E;  4MLQ A;  2JY9 A;  1NCS A;  3F6H A;  5A6A A;  4O24 A;  2E5L E;  4ZYD A;  1AAY A;  3ADI A;  3OML A;  2JWO A;  1UHZ A;  4B3M E;  1T4N A;  2EOE A;  3JU0 A;  3DJW A;  3UK3 C;  2EMH A;  3H09 A;  1HNW E;  1IBL E;  1LLM C;  4J8Z A;  1YUI A;  4NXN E;  2YZT A;  1GTK A;  1IQS A;  1DGC A;  1TF3 A;  4WXC A;  4R2S A;  2V85 A;  3J80 C;  2EM2 A;  4I8O A;  2EOJ A;  3MSW A;  3ECR A;  3BGH A;  4WYQ B;  4R8O A;  3ADJ A;  4GKK E;  1IQO A;  5IT9 C;  2BBG A;  2EWL A;  4GEQ B;  3VYY A;  1YUJ A;  2EPU A;  1DQ3 A;  2EL5 A;  2WCC 3;  2EN1 A;  5AE2 A;  5IWA E;  5F3W A;  2L92 A;  2K7I A;  2EJ4 A;  1J5E E;  2CPN A;  2CT1 A;  2HHH E;  1IBK E;  2N8X A;  1MGT A;  5FLX C;  2V83 A;  2V8Q B;  3EPH A;  3EPK A;  4O5G A;  1A1F A;  2EL4 A;  2YRH A;  2LTR A;  2JR1 A;  2RS6 A;  5AAS A;  2MKD A;  2G7H A;  4HEI A;  2EPO A;  4TUG A;  2DB2 A;  2VE7 C;  2EMI A;  4WFT A;  2EOH A;  3ADL A;  2YTP A;  1ZBT A;  2HJJ A;  4DR6 E;  2UXB E;  3BID A;  1UBD C;  2EOR A;  5A6J A;  5DNY A;  1IBM E;  2R1F A;  2L3J A;  4N4R B;  4LF9 E;  4F2J C;  2WBT A;  4R2C A;  4DV3 E;  3J7Y p;  2EE8 A;  2EOI A;  2RQL A;  2YTQ A;  3M99 B;  4WXD A;  3J7A G;  4B3T E;  3KZZ A;  1I94 E;  2ENC A;  2F8B A;  4KHP E;  4BHB A;  1XNQ E;  2EPM X;  2V89 A;  1A1L A;  1O0W A;  1PJT A;  5TSE A;  1JK1 A;  4WSG A;  4BMJ A;  1X6F A;  4NXM E;  1A1K A;  1BB8 A;  1XMO E;  2FGG A;  4DV4 E;  2WBS A;  2EMX A;  3EPJ A;  3BBG A;  2B9D A;  2UUC E;  4B3S E;  2EM6 A;  2EN4 A;  2YTE A;  3AUZ A;  4M2Z A;  2LV2 A;  3IWC A;  5A69 A;  2DMY A;  1Z1B A;  2B3T B;  1QNT A;  2CSH A;  4BS9 A;  2EPC A;  4X62 E;  1A1G A;  1X3C A;  4LFC E;  1TN9 A;  4WSP A;  2VQE E;  2ENH A;  1A1H A;  2FTX B;  2VQF E;  2RSI A;  2EOZ A;  4YHH E;  4P78 A;  4DR3 E;  4R2P A;  2YT4 A;  3HQ1 A;  5ADZ A;  2H36 X;  1N32 E;  1HNX E;  2UXD E;  1WRJ A;  2EOQ A;  3FIG A;  4ZYE A;  1BBO A;  2LO3 A;  2CTD A;  2EN8 A;  3AV0 A;  4LF4 E;  4IJD A;  3T1Y E;  3TQM A;  2EM8 A;  3LLH A;  2YTG A;  4JI0 E;  2LUP B;  2ENA A;  2JPA A;  3EQ1 A;  2YU5 A;  4O43 A;  2JP9 A;  2KHX A;  4R2E A;  5IV8 B;  2MC6 A;  2V86 A;  4K0K E;  1RC7 A;  2J7J A;  2MDR A;  3VHT B;  2EPX A;  1YYO A;  2MDG A;  1SR9 A;  1N34 E;  4LF7 E;  2GHF A;  2EN3 A;  2I13 A;  2EPL X;  4B3R E;  5AE3 A;  4LU9 A;  4F6N A;  2ODR D;  2EMB A;  4DV5 E;  1UIL A;  2D9H A;  2YTD A;  2HGH A;  5A6B A;  4RH8 A;  4R2A A;  3J81 C;  2VF1 A;  2EM0 A;  2RTX A;  2WZO A;  2EQ1 A;  1WHN A;  1STU A;  5IXM B;  2JOB A;  4F54 A;  3EPL A;  2JOX A;  1WJP A;  4BC9 A;  1X47 A;  4YY3 E;  5KL5 A;  5KL3 A;  4JI4 E;  1YSA C;  2MC5 A;  3C6M A;  2EM5 A;  2YWQ A;  2YRM A;  2YU8 A;  4X65 E;  2EMC A;  1L4S A;  2EQ3 A;  1PJQ A;  1G2D C;  5AC5 A;  4BBY A;  1T4L B;  2GLI A;  2YPN A;  3QG5 C;  1EH7 A;  2EPZ A;  4X8W A;  2RSM A;  4F9B B;  1XMQ E;  2FV4 B;  4JI1 E;  3ZOQ B;  3KZY A; 
#chains in the Genus database with same CATH homology
 1MEY C;  2LV2 A;  2EPA A;  2EMH A;  1Z1B A;  1JK2 A;  3MHH C;  1LLM C;  1YUI A;  1X6E A;  2NAB A;  4X9J A;  5KL7 A;  2CSH A;  2EN6 A;  2YRK A;  2EPC A;  1DGC A;  1TF3 A;  1A1G A;  2EOF A;  1P47 A;  1X3C A;  2MKN A;  1TN9 A;  4R2S A;  4R2R A;  1F2I G;  2EMF A;  2ENH A;  2EM2 A;  1A1H A;  2DGC A;  2RSI A;  2EOZ A;  5KL6 A;  2DRP A;  4R2P A;  2EOJ A;  1G2F C;  2YTF A;  2LVH A;  1A1J A;  5KL4 A;  2EOX A;  2ADR A;  2ELY A;  2EOQ A;  2EM4 A;  4F6M A;  1YUJ A;  2EPU A;  1BBO A;  2LO3 A;  2CTD A;  2EL5 A;  4IS1 C;  2EN8 A;  2EOY A;  2WCC 3;  4IJD A;  2EM7 A;  2EN1 A;  2A25 A;  1TF6 A;  2EM8 A;  2EOS A;  2YSP A;  1UN6 B;  2ELZ A;  2YTG A;  1ZAA C;  2EJ4 A;  2ENA A;  2CT1 A;  4R2Q A;  2DMI A;  2JPA A;  4GZN C;  1ZU1 A;  2EN2 A;  2YU5 A;  2JP9 A;  2DLQ A;  2M9A A;  4R2E A;  2EM9 A;  2YTN A;  2RPC A;  1RMD A;  1X6H A;  2J7J A;  3EPH A;  3EPK A;  1A1F A;  1ZR9 A;  3VHT B;  2EL4 A;  2EPX A;  2YRH A;  2MDG A;  2MKD A;  2EML A;  2GHF A;  2EN3 A;  2LCE A;  2YTI A;  2I13 A;  2YSO A;  4F6N A;  2EOO A;  5KL2 A;  2EMI A;  2EMB A;  2EOH A;  2YTP A;  2EMG A;  2EM3 A;  4FK5 C;  2LT7 A;  2BB8 A;  2D9H A;  2YTD A;  2HGH A;  2EMW A;  2YTJ A;  2PRT A;  1UBD C;  2EOR A;  4R2A A;  2EM0 A;  2R1F A;  2VRD A;  2EQ1 A;  2EP3 A;  3EPL A;  4F2J C;  2YTO A;  2WBT A;  1WJP A;  4R2C A;  1A1I A;  2EE8 A;  1X5W A;  2EOI A;  2EN7 A;  5KL5 A;  2YTQ A;  3M99 B;  5KL3 A;  2EL6 A;  1YSA C;  1B69 A;  2ENC A;  2E72 A;  2EPP A;  2WBU A;  2EM5 A;  1A1L A;  2EMZ A;  2EMK A;  2EQ0 A;  1KJK A;  2YRM A;  1JK1 A;  2YU8 A;  4WSG A;  2EOM A;  2DLK A;  1X6F A;  2EMY A;  2EMC A;  3MHS C;  1A1K A;  1BB8 A;  4R2D A;  2EQ3 A;  2EPR A;  2WBS A;  2EMX A;  1G2D C;  1NCS A;  3EPJ A;  4M9V C;  2GLI A;  1AAY A;  2EPZ A;  2EMA A;  2EOE A;  2EM6 A;  2EN4 A;  2YTE A;  3UK3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...