1EH8A

Benzylated human o6-alkylguanine-dna alkyltransferase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
175
structure length
165
Chain Sequence
CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords O6-ALKYLGUANINE-DNA ALKYLTRANSFERASE
publication title Active and alkylated human AGT structures: a novel zinc site, inhibitor and extrahelical base binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 165
sequence length 175
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2000-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1eh8A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1eh8A01
3P9CA 1TQPA 2IA2A 1JXSA 1YG2A 1ODDA 2FEZA 1LNWA 1UHWA 4HDUA 4O3MA 2D1HA 3FXRA 1KQ8A 3I5UA 4E70A 3ZP5A 1LDKB 2HZTA 3BWGA 3TDUC 1FBUA 2FQ3A 3V4GA 2IT0A 2ZNZA 4HQMA 1J75A 4NQWA 1Z6RA 1RUOA 1REPC 1J9IA 3IRQA 2AXLA 1U6GA 2P7VB 2CW0F 3L00A 1TQMA 1FYMA 4I0BA 4RAZA 3WTUC 5EEHA 1EH6A 5LEKA 4HX7A 2IP2A 2LDUA 2Z33A 1GXQA 2DTRA 2OU2A 2JPCA 2RVCA 4KN4X 1S3JA 3C1DA 2QQBA 3WTYC 2PFBA 3E6DA 3F8BA 3FXQA 5D4RA 3DEUA 5DYMA 2IRFG 4YIFA 3GXOA 2W57A 1SD7A 3RJPA 2V1UA 1O7FA 4IHTA 2V6CA 4WXCA 1QZYA 2DAOA 5LHIA 4A0ZA 1HXDA 2K4BA 4DNCA 3LWFA 1D3YA 4XSXF 1R1TA 2L4MA 2EFNA 1UCRA 3KZZA 1ZHFA 3BDDA 3JW4A 1U3EM 3RKWA 1DDNA 4FT8A 1KU7A 2OA4A 1OR7A 5J6XA 5DCMA 3HSRA 5HOOA 4Z2YA 3TO9A 4N9HA 4OIOF 5JFRA 5HLIA 1FP1D 1T2KA 2YX4A 6PAXA 4MTEA 1GXPA 2A69F 2DPDA 1USSA 5H20A 1V3FA 4IRHA 1TBXA 3F22A 3B73A 3LAJA 4G6DA 2WV0A 1QBJA 3WU0A 3CUQA 2HYFA 2F2EA 3WGIA 5CYVA 4L5IA 1QGPA 1TLHB 5FLXK 1BI1A 2L01A 2GXBA 1IUYA 1B4AA 5LGTA 5IT3A 1TNTA 4GCVA 3MFKA 3F8FA 1TTYA 2BBYA 3RIRA 3RKXA 1OKRA 3L2CA 3HOTA 3K9TA 4KMUX 3V8LA 4YFXF 4NHJA 4ZH4F 3IWZA 4LLLA 4KYWA 1R1UA 3L09A 3HHHA 1YYVA 4ZZLA 3G73A 1ZAOA 1BI2A 1SMYF 4IPAA 4ETSA 4HAMA 3J81K 1TW3A 4BQAA 1ZYRF 1FNNA 2A6HF 1W5SA 5DV5A 4WX9A 2KIMA 4CYDA 2RNJA 1RI7A 3TGNA 1K7AA 2PQ8A 1SAXA 3V8JA 3JAMK 2DFIA 3QP6A 4UVAA 1TNSA 3MZHA 3TO6A 4UV9A 2EJRA 4XBFA 3ECOA 4XRFA 1SD6A 1FC3A 2BEOA 3IKVA 3KP7A 3RTRA 1O3TA 1J7KA 4OIPF 1J2XA 2BGCA 4L9TA 4P9FA 2CG4A 3CJNA 4M6XA 4EM1A 2P5VA 2FXAA 4PCQA 3ECHA 1H9GA 4QLCU 2ISYA 1KU2A 4L9JA 1PP7U 1O3RA 4OMZA 1GVJA 4I09A 3WGHA 3TOAA 2EFQA 4O6JA 1XDSA 4D0PA 2HQRA 4IVNA 1HBXG 1R5HA 2QQAA 3WE2A 4IF4A 2XASA 3J7AO 2STWA 3PQKA 4BNCA 1R58A 3D0SA 3GZ6A 2CFXA 4KT5C 4HDVA 5E1XA 1RNLA 5DCMB 2H09A 3HRTA 3KP4A 1YS7A 1J5YA 2STTA 2HEOA 2MD5A 3SHFA 3EETA 1F4KA 1K79A 1BIBA 3IL2A 4I2OA 3F72A 2GA2A 5EEGA 3LQQA 2KJCA 4AIKA 4L0YB 2V9VA 1FWZA 1U5TC 2ZCWA 4RGXA 1WRJA 2FBIA 3GFIA 3GUDA 4M73A 3CUQB 4IRGA 5D6EA 2J5PA 1O3QA 3I64A 2VBWA 5K5QA 3WTZA 5IT9Z 1FLIA 2LNBA 2XAJA 3U9GA 2VT3A 3HRSA 1D8KA 4M9XA 1IXRC 4HA8A 5ICEA 2AS5F 2ETHA 4HW0A 1BI3A 3K0LA 3FMRA 3ZMSA 3EUHA 4HF1A 1R22A 2O03A 4G6QA 4EVIA 2EFPA 5FFXA 3KCCA 3PFIA 2VBXA 2EFOA 1IRGA 1P4AA 4P96A 4IXAA 4QWQA 2DI3A 3C18A 5ED4A 5AONA 3FM5A 5HS7A 2Y0MA 1O7LA 1FY7A 3REOA 1IXCA 2V1XA 1IXSB 4G7HF 4R1HA 3NQOA 3JSPA 3EYYA 2DU9A 1K6OA 3ZN0A 2HQNA 2BE5F 1HKTA 4MHGA 1LQ1A 1KU3A 3WODF 3SZPA 4TV7A 1DUXC 2WC2A 4IRIA 4BHBA 3DPTA 3DKWA 2ADUA 3CUOA 3BPVA 5D5XB 5D4SA 2Z99A 5LRRA 3KP2A 2GZWA 2FU4A 2CQKA 1XSXA 2J5OA 1OYIA 3VB2A 1VTNC 4A12A 5DCFA 4EM0B 4CZZA 4NB5A 4M72A 4KDPA 2RV8A 2XV4S 2ZKZA 4RB1A 2O0YA 3I4PA 1W4MA 1HSTA 1YW7A 5BS6A 3DV8A 4WWCA 4LLGF 3E3VA 4OMYA 2EA2A 4KN7X 1BC7C 1SFXA 3ULQB 1Z91A 4YG2F 2X4HA 1SFEA 1H0MA 4F7ZA 4Q5SF 1WWXA 5D5WB 5F64A 1XSVA 3GYHX 1YW8A 1ZRCA 4UVBA 2QQ9A 2HR3A 1SD5A 1XMKA 1IW7F 1SMTA 1E2XA 1ZG5A 2A6EF 2BV6A 2DLLA 4HV5A 2K27A 4UVCA 1U78A 3ZMDA 2FA5A 1B59A 2HGCA 2FNPA 3F6OA 1IN4A 4YIIA 1MKMA 3GEZA 1L0OC 3VODA 4A6EA 2RGVA 2VODA 1D8JA 3I58A 3E5QA 4A2UA 3QAHA 4RB0A 4R79A 1K78B 1DPUA 2PN6A 3F3XA 1ZLKA 4BAYA 2MH2A 4ZYDA 3I53A 3ML6A 3BOQA 3BROA 2O6GE 2Q8KA 4ASNA 2DW4A 1WQ2A 2M45A 1IN7A 1MJAA 1F5TA 4L18B 2ELHA 2FRHA 5ICCA 2JSCA 2R7DA 3KLOA 2W84A 4DQ2A 3K2ZA 3T1BA 2ZMEA 3F8MA 1BI0A 2QZ8A 3CO6C 1B6AA 4RS8A 5E8IA 3QU3A 4HYEA 3JSOA 5E20A 5AIPA 2Y48A 4N0BA 4FX4A 4RGUA 2H6CA 1OMIA 2P6TA 4ESFA 3TKYA 1XB4A 4GO1A 5CVIA 3GFJA 3RPUA 2UXNA 3F8NA 2G9WA 2JT1A 3MZYA 2MH9A 1S8NA 1IAWA 3GFMA 2A68F 1T0FA 3FM3A 2PLYA 4XLNF 4MEXF 2W85A 4EV0A 1O3SA 1XGNA 3WE3A 1ONVA 1I5ZA 5LRSA 2XHKA 1I1GA 3DPLC 4G9YA 2E1CA 3EYIA 1S7OA 2GAUA 3WTSC 4U0WA 2LKPA 2MLGA 2BYVE 4KNYA 1FP2A 1XGSA 3TO7A 2NNNA 1U2WA 3E5XA 3QRFF 2R3SA 5ICGA 3T5XA 3O3KA 4KUMA 4UXNA 1XMAA 4EJWA 2A3SA 2FF4A 2FE3A 4HF0A 2IA0A 1IN8A 2KRFA 2QBYA 5LHHA 1F1ZA 1XCBA 4GXOA 4Y17A 4LG0A 5D8LB 5FD6A 3U1DA 1FBSA 1FSEA 4WCGA 5E1WA 2O3FA 1FYKA 2QWWA 1LVAA 4MTDA 3SXYA 4GGGA 2FBKA 2CWEA 2OD5A 5BOXA 2HWVA 2IPQX 2QYOA 2VC0A 2P4WA 3HOSA 4IJAA 2PEXA 4ENJA 3SQNA 5DD8A 3ROUA 2VOPA 4MEYF 2OQGA 2XROA 1YQAA 3ISPA 4I0AA 3JTHA 1RIOH 3MQ0A 4CO8A 5LHGA 5HS9A 1DPRA 3K1NA 3IRRA 2JPBA 2ZBKA 2C6YA 1P2FA 5DDGA 3BP8A 2H27A 3KP3A 2YSRA 1G3TA 4B8XA 1HKSA 1YO5C 1UFMA 3ERED 3RDIA 3HTUA 4RAYA 2GWRA 2ZMEB 4HLYA 4ESBA 5KK1A 1JGSA 3DF8A 4B09A 4LJZF 4XLPF 5L3CA 4KIBA 2IW5A 1B9MA 4ZYGA 1YIOA 3HRMA 4BHCA 5A2QK 4KFCA 5FGMA 4HX4A 5HDGA 3ZMTA 3L9FA 3M8EA 3V7SA 4Q4ZF 3BJOA 2F5FA 1H9TA 1O57A 1FYLA 4Q47A 3TQNA 5LLQA 3ZMZA 4S04A 1ZG3A 2ISZA 4OIQF 1Z05A 1OYYA 3Q5FA 2COMA 3HYIA 1P92A 2VBYA 3W6JB 4LMYA 2L4AA 3LFKA 5BPDA 1BM9A 5L3EA 2Q2EA 4XSZF 4A5MA 4G7ZF 5JR3A 2XIGA 3F21A 3WGGA 2ZNYA 3QPTA 3WTXC 3T8TA 3NEUA 4UHTA 4ENMA 5CLSA 1QO0D 3M7GA 4AIHA 2QBYB 1JHFA 4WF2A 3RPQA 1AWCA 2UZKA 4L9VA 5FLXZ 2RDPA 4LG0B 4A5NA 2P5KA 1MDMA 5LGUA 1XDUA 4GYGA 1KA8A 3IWFA 4N9IA 2M8EA 4HZFA 2CO5A 1MGTA 2KIFA 3GW2A 5D5VB 3O2PE 1BOAA 2KKOA 1J0RA 3CUQC 5K5RA 1LB2A 1K78A 4EGYA 3QP5A 1G3WA 4M9ZA 4KMFA 5F6FA 3E6CC 5E8GA 3J81Z 1HW1A 5H6QA 5L3BA 1T98A 2LF8A 2VN2A 3FMQA 4PZJA 5ICFA 3JAMZ 3KLNA 1IN5A 4LGWA 1ZRDA 3Q9SA 2M87A 1AOYA 5CVRA 2A61A 5LEJA 4L9NA 2WTEA 1XGMA 2K86A 4WK8F 4ENNA 3KEOA 2ACJA 3T8RA 4YFKF 2DK8A 2XAQA 2E1NA 3E5UA 2JTVA 4U0VA 2DQLA 1FT9A 1XGOA 5L3FA 1OYWA 4HBLA 3FXUA 5A2QZ 4R8HA 5J8FA 3ZPLA 4BHPA 2EV0A 2WWYA 4EMSA 4MNUA 4KIFA 1J59A 3WTVC 3GWZA 4K2EA 1T6SA 1NHAA 1XN7A 2H6BA 4P5OA 4AD9A 3R60A 1YW9A 3COAC 4M6YA 3BZ6A 4HQEA 2LSOA 1RUNA 4G8XA 4LFUA 3S2WA 2HTJA 3DFGA 3I71A 5JI6A 1Z6TA 4LD5A 4JBAA 2DQRA 5D8KB 3RKYA 3V7RA 2ZFWA 4RB2C 1LDJA 5E1ZB 3F8CA 2FOKA 1LJ9A 2M1BA 4UV8A 1ZGAA 5HDNA 3P9KA 1ZLJA 2ZO4A 3W6KB 4EJTA 4EM2A 1A04A 4HF2A 2OZ6A 3M8FA 3E6BA 2HOEA 4BYYA 3I59A 1YTYA 3OV8A 1KQ0A 2Z9OA 3PQJA 3GZ5A 4CXFA 4AVPA 4EGZA 3K1PA 3ZMUA 2DBBA 2P5LC 4AWXB 2GXGA 2P6SA 3KP6A 2R7FA 2M30A 5CVVA 1Q1HA 1MDMB 3LAPA 4OINF 3V7CA 3Q9VA 3K69A 3ELKA 3WTWC 1W7PD 3GFLA 1IN6A 2PBIA 2EB7A 4LK1F 1BBYA 1BN5A 2EA4A 2XUBA 1L3LA 4ZYHA 1MZBA 2MBFA 1P4XA 5BQTA 4U7DA 4JK1X 4KICA 2PI0A 3WG9A 2W25A 3KP5A 5FD5A 3R0JA 1GHCA 3WTTC 1LEAA 3RYPA 1R36A 1R1VA 3BJAA 2Y75A 5JVTA 4WXHA 1P6RA 1V4RA 1W7PA 2D45A 1IRFA 2VT2A 1MD0A 4RGSA 4LB5A 5CVUA 2NYXA 4ESJA 2H94A 2L3DA 1BIAA 2IA1A 3KZYA 2XAHA 1TW2A 4PGHA 1C0WA 3KE2A 1WKMA 3HTSB 1LDDA 3SFZA 3U2RA 1USTA 2OQRA 2XVCA 1ON2A 5E18F 3WU1B 4CGZA 5BMZA 5FB2A 2PMUA 2PMHA 3RI4A 5HS8A 3R6SA 1QZZA 4OOIA 3N4MA 1Z7UA 5FO5A 1I27A 2LF7A 2EWNA 1OPCA 3FHZA 1CF7A 1Z1DA 3FMSA 1ZGJA 2YPRA 3H3UA 2UWMA 1ZG1A 3HIFA 4S05A 1R7JA 2QVOA 4FX0A 5HDKA 2XKPA 4HV6A 2VONA 3FWEA 3L7WA 3I54A 2PG4A 1IF1A 2VBZA 5ILUA 3I59B 1I1SA 2RKHA 4OU0A 1P4WA 2RC4A 5KVRA 4JQFA 2FMYA 4LK0F 1S29A 1FBQA 1U5TA 3GO5A 3ZMVA 2HDCA 2O61A 4BXUA 1W5TA 1S7AA 1RZ4A 4RB3C 3MWMA 1ZN2A 1S6LA 5DEQA 3R0AA 2K7LA 4L0ZB 3SZTA 1QPMA 3VFZA 3CDHA 1FOKA 4GYIA 3AAFA 2L02A 4A0YA 4M71A 1EV7A 2XAFA 2DPUA 1FX7A 1T38A 5D5UB 2HS5A 4UUVA 2GA1A 2XGXA 3LA7A 2TDXA 2YX7A 1MJ9A 2PJPA 3QOPA 5IT9K 1B9NA 3ZQ7A 3H3ZA 1Y0UA 3GX4X 4U88A 3RYRA 2KIUA 3I0TA 5ERIA 2UXXA 2HTSA 1KGSA 3BY6A 4I02A 1TQIA 3TOBA 1QQIA 3BPXA 1W7PB 4FHTA 4HOBA 4UNOA 4ON0A 2MC3A 3R61A 2W24A 1ZREA 5DUKA 3VEPA 4IHSA 5F1RA 3IC7A 3KFWX 3IKTA 3KEQA 4PGGA 5E17F 3LA2A 4ZYEA 3K1MA 2NS0A 3P9IA 2M5WA 4I01A 1G4DA 1XD7A 3QPHA 2CGPA 2HYGD 3FZVA 2B0LA 2F5CA 3CO7C 3P7NA 1PP8F 4KIGA 5HVQC 1HW2A 1R00A 1BC8C 4AIJA 1Z9CA 1HQCA 2RN7A 4Y15A 2HFHA 2D2WA 2IJLA 1ON1A 1UHMA 5DUIA 4EJOA 2JRTA 2XRNA 3EQLF 3N97A 1XSDA 5LBQA 1ZRFA 3MEXA 2FBHA 1MJBA 1PUEE 5CVJA 1ZH5A 2L54A 1SFUA 1WSUA 2NRAC 1STZA 4I7HA 2QENA 1EH8A 1HSJA 4LLNA 1UB9A 2EK5A 2QLZA 2V1DA 1YS6A 2OZUA 3CLOA 1CF7B 4HLXA 1X3UA 2HKOA 3GLXA 3J80K 1KYZA 3BJ6A 3VOEA 2K02A 4A0XA 2E7WA 5K5OA 1R5GA 3ZN1A 5AIQA 1FSHA 3T0YA 2V79A 5FFZA 2G7UA 5CJ9A 1ULYA 4HX8A 5L3DA 2ESNA 4MGRA 4OIRF 1U5TB 1PDNC 2G7HA 4Y13A 4CHUA 3B02A 2VC1A 1SD4A 2A5YB 2CYYA 5HLGA 1KU9A 4P55A 4M9SA 4ENKA 1T39A 4A6DA 3ABTA 2K4JA 3MAJA 3JTGA 1YFHA 4L5JA 3FX3A 3M1EA 1HW5A 4YFNF 4CDGA 2OAZA 2HKXA 3HUGA 2P8TA 3LQRA 4P9UA 2FNAA 2FSWA 1F9NA 1R23A 2EV6A 2QM3A 1JE8A 3HSEA 2E7XA 3QU6A 3IHUA 2FMLA 1CGPA 3KETA 4M74A 5ILSA 4G94A 1YLFA 5ILVA 3R4KA 1IZ1A 4O5VA 3HHGA 2IVMA 3NRVA 5TRDA 2YR2A 1D5VA 3M9AA 2DT5A 2VE9A 2ZXJA 5D6FA 2EFWA 4MQ9F 2VOOA 3FF5A 2XAGA 1FZPB 1KQ9A 2EV5A 2JZYA 2VE8A 1LEBA 2X0LA 3ABUA 2NNYA 3HSFA 1B1BA 5J8CA 5TJJA 5LGNA 2DK5A 3F23A 1FPQA 3G3ZA 1WI9A 5BPIA 2P7CB 5JHUA 1BJAA 1JHHA 3EDPA 3DQVC 1DP7P 4Q48A 3LSTA 2QUFA 2CSOA 1XCVA 3LA3A 2ESHA 2YU3A 2ZJ2A 4CICA 2A07F 4EJUA 2GQQA 2Z3YA 5HLHA 2OBPA 4U0YA 4G7OF 3OOPA 1HKQA 2VXZA 2RQPA 3TDZC 1E17A 5K1YA 2MLKA 2XKOA 1I6XA 4LB6B 4U7BA 4I98B 3HRUA 3J80Z 3GF2A 4KA4A 3V8KA 2Z5UA 1U8RA 4EQQA 3DP7A 2F5EA 3E6MA 4EJVA 4RGRA 2O8XA 2MA3A 3DXJF 3D5LA 3C7JA 5DD4A 3H92A 5H6RA 1G3SA 2DO7A 2NAZA 2D1VA 2KJBA 3F6VA 3MCZA 2Q0OA 3E97A 1EH7A 1ZARA 5L3GA 1KYWA 4PDKA 4WXDA 2F5DA 1G3YA 3C3WA 4H0EA 3CTAA 1QNTA 4BH9A 2GIVA 1G6NA 4MQVA 3O6BB 4ZZDA 3GVAA
chains in the Genus database with same CATH superfamily
2W1OA 5DM7F 3FBNB 4AQYE 3P9CA 4F9BB 1TQPA 2IA2A 2ZXHA 2DN0A 1YG2A 1ODDA 3HUGB 2FEZA 5K7ZA 4XIDA 1JXSA 4DBQA 1UELB 3CESA 1VQOI 1LNWA 3MKLA 1Y39A 3VSLA 2GIZA 3AG1H 1UHWA 2BY2A 4R2RA 2DA2A 3H5RA 3CC4I 4HDUA 2JJ7A 4X64E 4XNFA 4O3MA 2E5ZA 2D1HA 3FXRA 5F0HA 3I5UA 5FKNA 4E70A 4BACA 4E4HA 1KQ8A 3ZP5A 1AAYA 1LDKB 3A4CA 2HZTA 1SANA 3JCUC 1BL0A 1B69A 3BWGA 3TDUC 2UUBE 1FBUA 2FQ3A 3V4GA 2IT0A 2ZNZA 4JI8E 2CTDA 2WAEA 4D7NA 5J4YA 2K9NA 4CCNA 3F9KA 4HQMA 1JKOC 3CCVI 2EM6A 1J75A 1U0JA 2LC2A 4NQWA 1Z6RA 3BG7A 1NH3A 1YYKA 1RPWA 1RUOA 2R5ZA 1EJ9A 2XSDC 1IBKE 3FXKA 4BEHA 2ECCA 3FBIB 1REPC 1MNDA 1J9IA 3HPSA 1WJDA 1T08B 3ABLH 2AXLA 3IRQA 4EEFG 4XONA 4DV0E 2B3TB 1X1PA 1U6GA 2P7VB 1G2FC 3OYLA 4R2CA 2CW0F 3L00A 1TQMA 3P5JA 4XKVA 1FYMA 4I0BA 4RAZA 2KZVA 1T4LB 4KT6A 3WTUC 2BY0A 5EEHA 3JU0A 1EH6A 5LEKA 4HX7A 1JTXA 2IP2A 2X6WA 1Y1WJ 2V8QB 2LDUA 2Z33A 1GXQA 2M4KA 2DTRA 2OU2A 2JPCA 2LOOA 3SDBA 2LH9A 2CQXA 3LNQA 2RVCA 4DV2E 4KN4X 3BR3A 4F9CB 1S3JA 2K3FA 2QQBA 3C1DA 3OWTA 1IG7A 2M3AA 4AIDA 3WTYC 1A1FA 4JI0E 2W7NA 3C2BA 4AYBN 2PFBA 2VLAA 3E6DA 4R2DA 2OCCH 3F8BA 3FXQA 4DGWB 1K4SA 5JLXA 5D4RA 3DEUA 5DYMA 2IRFG 2O9LA 2HI3A 2LD5A 1PDAA 1G2HA 4YIFA 3GXOA 4KITB 3GTMJ 2VPRA 2DYRH 2W57A 1YX5A 1B72B 1SD7A 1DGRM 4B3ME 3RJPA 2V1UA 1KZHA 1O7FA 3K4BA 4GEQB 4B3XA 4GRIA 1QHHD 4IHTA 2MYSA 3ESWB 3PSIA 4WYQB 2V6CA 2DRPA 3PM1A 3LOCA 2ZJQF 3SJMA 4WXCA 1QZYA 2DAOA 2FTXB 5LHIA 5F04A 1HXDA 4A0ZA 2K4BA 4FCYA 3JRAA 4DNCA 3LWFA 3CMYA 1D3YA 2DA3A 5C44J 4XSXF 1R1TA 4LIUA 4ZJZA 2EWLA 2L4MA 3EPJA 4KISA 5J3LA 2EFNA 4FASD 1OCPA 1UCRA 2GBYA 2PRTA 3KZZA 1ZHFA 3BDDA 3JW4A 4IOCF 3AFHA 2EMIA 5CQGA 3HG9A 1VQMI 1U3EM 3OSFA 3BBGA 3MKWB 4F54A 3RKWA 2WAQA 1DDNA 2KQRA 3UK3C 2HPMA 4FT8A 1KU7A 2OA4A 1OR7A 5J6XA 4X62E 5DCMA 3HSRA 4XKBA 2E2IJ 5HOOA 2CMPA 4CZCA 4Z2YA 3TO9A 1JUMA 1SFOJ 1X1BA 2M0MA 1WJFA 4N9HA 4OIOF 5JFRA 4IOAF 5HLIA 1FP1D 4Y4RA 3C2GA 4DOZA 3S93A 3BIDA 1T2KA 4LFAE 3DKXA 2L2MA 2YX4A 6PAXA 3GLLA 3BR2A 3DKYA 4MTEA 1GXPA 4KHPE 2A69F 2DPDA 1PJTA 1USSA 2L3JA 3A01B 5H20A 3A2KA 1V3FA 4OAZA 1ZTRA 4HSRA 4IRHA 2ZB9A 3CCJI 3OIPA 1X58A 2DSYA 1TBXA 3F22A 3B73A 1D1AA 4G6DA 3LAJA 2WV0A 3ZQGA 1UMQA 3G1MA 1QBJA 3WU0A 3CUQA 5TGTA 3ABKH 2HYFA 2JN6A 2F2EA 3WGIA 1X47A 2KIQA 3NWTA 5CYVA 2M9AA 3K4CA 4L5IA 3PUBA 3HPHA 1QGPA 1MSFC 4IS1C 2ID3A 1TLHB 5A6AA 5FLXK 1DU0A 2EM2A 5J40A 5DS9A 1BI1A 2L01A 2KL4A 5E3OA 2BXZA 2ICWG 3O8HA 4DYRA 3ZXSA 3KZIC 2GXBA 2JXPA 5T6JA 5EGOB 1IUYA 1B4AA 5LGTA 4B3RE 2EZ6A 2EIJH 5IT3A 4O24A 1MNEA 3OYJA 4ZDLA 1TNTA 4CCJA 4GCVA 3D5RC 3OYKA 3I9V2 2DMNA 3MFKA 2KONA 1W0TA 3EUKL 4X0GA 1A6IA 2HVRA 3CC2I 3F8FA 1TTYA 1G8XA 2BBYA 3RIRA 3RKXA 1OKRA 2JMWA 5GAGJ 3MKYB 3L2CA 2JA5J 3HOTA 1J5EE 3K9TA 4KMUX 3V8LA 4R2AA 4YFXF 4NHJA 3I55I 3ASOH 1UZCA 3IWZA 4ZH4F 3GTGJ 4LLLA 4KYWA 1R1UA 3L09A 3HHHA 1YYVA 4ZZLA 3G73A 3PSFA 2BZTA 1ZAOA 2LJUA 2AXTC 1BI2A 1SMYF 4PSXA 2OUMA 4IPAA 4HAMA 4ETSA 2QA4I 3J81K 3L2UA 1IRZA 1TW3A 1QPIA 4NQWB 3S2HJ 4F92B 2R5ZB 3H9GA 1ZYRF 4BQAA 1FNNA 2A6HF 2EN3A 3ADLA 1X19A 4BEHB 1W5SA 5DV5A 4WX9A 4KZSA 3OMLA 2HVQA 3K6QA 2KIMA 4CYDA 2MG4A 2RNJA 1RI7A 2RAEA 4LF9E 3TGNA 3G1OA 1LLMC 1K7AA 2PQ8A 3VWBA 1SAXA 5JLWA 3V8JA 3BCBA 3JAMK 2DFIA 3QP6A 2X1EA 4UVAA 1FKAE 2CQ7A 1TNSA 3MZHA 3AG2H 3TO6A 4UV9A 2DTZA 2EJRA 3SEQA 4CCLA 3BTLA 3IH3A 4XBFA 3ECOA 4XRFA 1SD6A 1B8IA 1FC3A 2BEOA 2ENAA 3IKVA 3KP7A 2YS9A 3RTRA 2LBSB 1O3TA 2NVTJ 1UG0A 1J7KA 4HPQA 4OIPF 4BU2A 1X3ZB 5JVGF 4E6KG 1J2XA 1N34E 1DGCA 1IDZA 2ZFUA 1JUPA 2BGCA 4L9TA 4JX6A 4P9FA 3W2VA 2EPPA 2CG4A 4UB8C 1GZ6A 1PJQA 4DMIA 3CJNA 1BOBA 1X2NA 4M6XA 4EM1A 4DIQA 2ZSHB 2P5VA 4IHXA 1N3GA 2FXAA 2ZXWH 2R5YA 4PCQA 3ECHA 1H9GA 4QLCU 2LUQA 2ISYA 3FISA 5IY5H 4D5CA 2DOEA 1KU2A 4P1WA 4L9JA 2EOSA 1PP7U 2J7JA 1O3RA 4OMZA 1GVJA 3KYCB 4I09A 1Q1VA 3WGHA 2HVSA 1YX3A 2K7IA 2R1FA 4BJ5C 2E72A 1IBLE 4MO7A 3C6KA 1QVTA 1D0ZA 2MC4A 4JOMA 3RCOA 3HEFA 3S32A 3TOAA 1MMSA 2R7XA 2EPKX 1MEYC 2EFQA 4O6JA 1LFBA 4DYQA 1YI2I 1PKPA 1XDSA 3HKZN 4LIVA 4D0PA 2FOWA 2HQRA 4IVNA 4HRIA 1HBXG 1R5HA 2QQAA 4BY1J 3WE2A 4IF4A 4IHWA 2XASA 3J7AO 2M7BA 4UUTA 2STWA 2AQFA 3FXMA 2LY1A 2OF7A 3RQIA 2UXBE 3WU2C 1D0XA 4J19A 4R2PA 3PQKA 4BNCA 1R58A 2R7TA 3RZDJ 3MKZA 1E3HA 3D0SA 2CFXA 3GZ6A 1MMGA 2EIKH 1Y6IA 4KT5C 2GOXB 2EQRA 4BJTA 4IZZA 4HDVA 4X8WA 3ASNH 5E1XA 2ADRA 1RNLA 4U87A 2H09A 5DCMB 4BXXJ 1FJGE 2FD5A 3HRTA 3KP4A 1YS7A 3FXJA 1J5YA 1N33E 1R6RA 2STTA 3DLAA 4HNVA 2HEOA 2FUG2 4RA2A 1YSAC 4PUSA 2MD5A 3SHFA 2VJ4A 3LSIA 3EETA 3HXLA 1MMNA 4Y7NJ 4R2QA 3ZOQB 5KCMA 1F4KA 4XOPA 1FMWA 4M3FA 1XC5A 1K79A 2EM4A 3VHTB 1BIBA 3IL2A 2G0EA 4I2OA 3F72A 2GA2A 5EEGA 3LQQA 5KNLA 2KJCA 4AIKA 2ZSIB 2V9VA 4L0YB 2XPUA 1FWZA 1U5TC 1Z21A 3LL7A 2ZCWA 4RGXA 4E7ZA 2EL5A 1WRJA 1V55H 2AQEA 2FBIA 3GFIA 2EMCA 3GUDA 4M73A 2MABA 3CUQB 1GQEA 4BDZA 2YPNA 3ERMA 3BQYA 2M2EA 4IRGA 2VF1A 1A1LA 5D6EA 3Q3SA 1IJWC 5B1AH 4HEIA 5FLMJ 4AM3A 2KDOA 2J5PA 2EPRA 1O3QA 3I64A 3K70D 1QU6A 2VBWA 5K5QA 3WTZA 4J00A 5IT9Z 1FLIA 2LNBA 2XAJA 2EPCA 2LRSA 2JVHA 1XNQE 1JKRC 3U9GA 3NWSA 3H5NA 4V19K 1JKPC 5J4VA 2YSOA 4DR1E 3F0CA 3CCYA 4EATA 2VT3A 1E0EA 2HPIA 1NG7A 3HRSA 4DKKA 1D8KA 1CQTA 2EQ3A 3CQZJ 4IQJA 2XB0X 4M9XA 1IXRC 4HA8A 1JI8A 1BJZA 1TC3C 1X49A 2VB6A 1XMOE 2WAQN 5ICEA 2YU5A 2AS5F 1VQ7I 2YU9J 2EPNA 4FETA 1UHSA 2ETHA 1BW5A 1I94E 3JRCA 1BA5A 4HW0A 4PFOA 1BI3A 3K0LA 3FMRA 3ZMSA 1YYOA 3D1NI 3EUHA 4HF1A 2RQQA 1ETKA 1R22A 4RBOA 1S7EA 1OCTC 2V88A 2O03A 4G6QA 4EVIA 4XICA 1POGA 1JT0A 2EFPA 3OR1C 5FFXA 2EM7A 3JRFA 3KCCA 1T8IA 4BE0A 4B3TE 4NNJA 3TQMA 3PFIA 2B7TA 2VBXA 4I8OA 4PJJA 2EFOA 2BY1A 4A3MJ 4A93J 1IRGA 1P4AA 1PJSA 4P96A 3PUFA 3OR2C 3FXLA 1WH7A 1T33A 3I3LA 2N8GA 3L2RA 3M07A 4IXAA 4CCKA 4A3IJ 4E7HA 4QWQA 2IS4A 3VYSB 2DI3A 3C18A 5ED4A 1UHZA 2CUJA 5AONA 1GT0C 3FM5A 5HS7A 2A6TA 2XPWA 5LL6R 1IBME 2ZJPF 1MBEA 3BR1A 5K7HA 1ETVA 2H8RA 2Y0MA 1ENHA 5CKTA 1O7LA 3LSKA 1HCRA 1FY7A 3BR0A 2XB5A 2DMIA 3W6VA 4V2GA 3GTKJ 5M5YJ 3REOA 3L2VA 2HXIA 4F3QA 1B8IB 2CU7A 1IXCA 2V1XA 1IXSB 2HOSA 3S8PA 4PJ0C 2BB8A 4WFTA 2Z2SB 1Y0NA 4G7HF 3BLYA 3BQZA 1VQNI 3FKJA 2PJRA 4L5EA 3BG3A 4R1HA 2EPLX 3W2AA 4B47A 4LF4E 4N4NB 3NQOA 3JSPA 3ZQLA 3EYYA 2DU9A 5C3EJ 4C3IJ 1K6OA 4M0VA 3ZN0A 1YYWA 2HQNA 4DZPA 3OYFA 4DR6E 3GZNB 2BE5F 2ELZA 1VQ8I 4MHGA 1LQ1A 1HKTA 2B7VA 4B48A 2DLQA 4HTGA 2R5YB 3TBIA 2WA0A 3ECRA 1MBKA 1KONA 1KU3A 1I3QJ 3WODF 4AUXA 2JVGA 3SZPA 4TV7A 1DUXC 2EMWA 2WC2A 4IRIA 2EMAA 4BHBA 3DPTA 1T95A 3DKWA 2ADUA 2E35A 3CUOA 1N25A 3BPVA 2MD0A 5D5XB 1S5LC 5D4SA 2Z99A 2RS7A 2JUGA 4XN0A 5LRRA 4BUPA 4BC9A 2XGCA 3KEYA 4B1RA 3KP2A 5K7FA 2GZWA 2EOFA 1APLC 2BY3A 2FU4A 2NUGA 1K83J 1LUJB 1ZGWA 2CQKA 3BG9A 1XSXA 2J5OA 2CW8A 4R8OA 1OYIA 2K40A 3VB2A 1VTNC 4A12A 2CV2A 2NVQJ 1WVRA 4B4CA 4AC0A 5DCFA 4EM0B 4CZZA 4NB5A 2F4MB 4M72A 3OYAA 4KDPA 2RV8A 1WI3A 1TF6A 2XV4S 1UILA 2QGUA 2ZKZA 4RB1A 1ZKGA 3G4SI 2O0YA 3I4PA 1W4MA 1HSTA 4O5GA 3QODA 1YW7A 5BS6A 2NUFA 1G2DC 3DV8A 1FOWA 2VRDA 4WWCA 4LLGF 3E3VA 4OMYA 2EA2A 4KN7X 4JI1E 5EZGA 1BC7C 1SFXA 2MSYA 3AL0B 3ZQQA 3ULQB 1Z91A 3DTKA 2X4HA 4YG2F 1RESA 1SFEA 1H0MA 4F7ZA 4Q5SF 1WWXA 2EMXA 5D5WB 3S3MA 1RC9A 3C2HA 5F64A 5GPAA 1XSVA 4F91B 2HOAA 3GYHX 1YW8A 1ZRCA 4QTRA 4UVBA 2LG4A 3HOZJ 4LFCE 2Y69H 4RH8A 1FJLA 2IGMA 2VI6A 2VQLA 3HTXA 3AL0C 2EN4A 2QQ9A 4B43A 4BGDA 2HR3A 2JY9A 1SD5A 2L7MP 1XMKA 4NC6A 1IW7F 2Q8UA 1SMTA 1E2XA 1R9TJ 1ZG5A 2A6EF 2BV6A 2MKDA 2DLLA 4HV5A 5IYDJ 3DF6A 1TF3A 5IYBJ 2K27A 4UVCA 1U78A 3ZMDA 2FA5A 1B59A 2HGCA 2FNPA 5GPCA 2K9QA 2ODRD 3A0BC 3CJRB 3F6OA 3DJWA 4PK4A 3BR5A 2X6OA 2KZGA 1IN4A 4YIIA 4LU9A 1MKMA 2RREA 2IXSA 2MDRA 4XM3A 3GEZA 1L0OC 3VODA 4A6EA 3SFIA 2EN2A 2X9DA 2M0CA 3GBGA 2RGVA 2VODA 2LKSA 1D8JA 2FGGA 3I58A 3TW6A 3E5QA 2KPMA 2JQ7A 4A2UA 4N4OB 3QAHA 4RB0A 1YITI 4R79A 1K78B 2EPXA 2NS7A 1DPUA 3RKQA 3PNTA 2YSPA 2PN6A 3F3XA 3WHCA 1ZLKA 2QQ8A 4BAYA 2MH2A 2CRGA 4JX5A 1GV2A 4R03A 4ZYDA 3I53A 4FQGA 3ML6A 1IGNA 3DBRB 2YTPA 3BOQA 1S9HA 3BROA 4A3JJ 2O6GE 2Q8KA 1XMXA 4ASNA 1IUFA 3BTIA 2DW4A 1ZQ3P 1WQ2A 2M45A 1IN7A 4C3HJ 1MJAA 1F5TA 4L18B 2ELHA 2FRHA 4QPOA 2DJIA 2JSCA 2R7DA 3HKZA 5ICCA 4YIRX 4V2FA 2CT1A 3H36A 3KLOA 1WJCA 2EOMA 3PNYA 1QVUA 3RPUD 2HC5A 1W5CC 2W84A 4DQ2A 3K2ZA 3T1BA 2NA2A 3CCSI 3DU5A 2ZMEA 3EUHC 3F8MA 3LSGA 1BI0A 1X5WA 1MSEC 2LO3A 2QZ8A 1LE8A 3CO6C 2I10A 1ZU1A 5HLTA 1B6AA 3HBLA 4RS8A 1OCCH 4Z6YA 1IC8A 2EMBA 5E8IA 3EQ1A 4BCAA 2JOBA 3QU3A 4HYEA 3JSOA 5E20A 3K70C 3ADGA 4B44A 1QZEA 5AIPA 2Y48A 3H9QA 4N0BA 3LLHA 1ETXA 3M99B 4FX4A 5KL6A 2GM4A 3EPKA 3W2WA 3HPZA 2DT7B 4RGUA 5M3FJ 2XRLA 5EF6A 2H6CA 1MBJA 2B63J 3L2WA 1BB8A 4YRVA 2UXDE 1OMIA 1LKXA 2LTPA 2P6TA 3B6AA 2ME6A 3OS0A 2M7QA 1HA8A 3TL4X 4DZJA 4ESFA 3TKYA 1GUUA 5J1YA 1XB4A 4GO1A 5F0CA 2PJRB 5CVIA 4NZVA 1H89C 1VQ4I 4RLQA 2YRKA 3GFJA 2Z16A 3RPUA 1WXRA 3QPSA 2UXNA 3F8NA 2VXDA 4BDYA 2G9WA 2JT1A 3MZYA 2MH9A 1S8NA 3SYTA 1IAWA 3CP8A 3GFMA 2LV2A 2A68F 1OCZH 2BVLA 2DB2A 4F2JC 4JP0A 1T0FA 3FM3A 4BBYA 1YZ9A 2F4OB 2PLYA 2A25A 4XLNF 1PVEA 1PJRA 4ZC3A 3AG4H 1ETOA 4MEXF 2VQFE 2V7FA 2W85A 4EV0A 1O3SA 2IGOA 1XGNA 3WE3A 2JUCA 1ONVA 2YTQA 2VIXA 2K9LA 2DLKA 1I5ZA 5LRSA 2XHKA 1I1GA 3DPLC 4G9YA 3OS2A 2H1KA 1XPXA 2E1CA 4XORA 1EKZA 3OYDA 3EYIA 1S7OA 3MD2A 2GAUA 3WTSC 2OTLI 4BXFA 4U0WA 2E5NA 3HL2A 2LKPA 2MLGA 2NXNB 1A1GA 2VQGA 2BYVE 3GTLJ 4KNYA 1WHUA 1Y1VJ 1FP2A 1XGSA 4JI7E 3TO7A 3S14J 4C9YA 2NNNA 1U2WA 2DOFA 3E5XA 1QRYA 3IAS2 3QRFF 2EOQA 4IQ4A 2R3SA 4DR3E 2GPIA 1VQPI 5ICGA 3T5XA 3BF2A 4MFDA 2R7OA 3O3KA 4KUMA 4UXNA 1XMAA 4EJWA 2L5QA 2EOJA 3G2BA 2A3SA 2FF4A 3DEWA 2R7WA 2FE3A 1Z67A 4HF0A 2IA0A 1IN8A 3CCUI 2KRFA 3ZGKA 2QBYA 5LHHA 3KYLA 3CC7I 1A36A 2JYAA 1OISA 5FKOA 3HZJA 4LF8E 4XQFA 2JWOA 1F1ZA 4BMJA 3I56I 1XCBA 4GXOA 4Y17A 4LG0A 5D8LB 1IV6A 2WCC3 1T4OA 5EDNA 5FD6A 3U1DA 1FBSA 4XLHA 1FSEA 4E7JA 4WCGA 1HNWE 4Y33A 5E1WA 2O3FA 5GTIC 1FYKA 2QWWA 1BW6A 4M3EA 4QPQA 1LVAA 4HNUA 2WAFA 3PO2J 2IS1A 4MTDA 3SXYA 4GGGA 2FBKA 2CWEA 2OD5A 5BOXA 2MC6A 2V9KA 2HWVA 2IPQX 2QYOA 2VC0A 3ZQIA 3HQ1A 2P4WA 3OY9A 1MW7A 3HOSA 4IJAA 4UUSA 2XDVA 2PEXA 2QF7A 4ENJA 1VQ5I 3SQNA 5E79C 5DD8A 3ROUA 4I99C 2VOPA 2KISA 2Y2ZA 4MEYF 2D5VA 1BR2A 2OQGA 2AHQA 1YQAA 2XROA 2K5CA 2LR8A 3OYEA 3S1NJ 3ISPA 3PIOF 4J8ZA 2EORA 4I0AA 3JTHA 1RIOH 1Y8QB 3MQ0A 4RAGA 4XLCA 5FRMA 1X6HA 2R7QA 4CO8A 5FKKA 5LHGA 2EZKA 5HS9A 1DGWY 1DPRA 3K1NA 4A3CJ 1BBGA 2YT4A 5A6JA 3L2QA 5EYRA 3IRRA 1A1JA 1PYVA 2JPBA 1EA3A 2A05A 2VKEA 5TISC 4CA0A 2ELKA 5M3MJ 2ZBKA 2L7KA 3HGGA 1UAAA 3DBHB 2DMYA 4QIWN 1IRXA 2C6YA 4MLVA 1VI0A 4BQNA 5B5EC 1R71A 1P2FA 5DDGA 5FROA 3BP8A 2H27A 3GTQJ 3KP3A 4NUBA 1UBDC 4XOTA 2DMPA 2YSRA 1G3TA 3T1YE 4IX7A 2OJED 1Z3YA 4B8XA 1HKSA 1YO5C 1UFMA 5C4JJ 2OPTA 3ERED 1RMDA 3DPUA 4IHVA 3RDIA 2KT0A 3HTUA 4B3SE 4RAYA 4QSHA 2GWRA 2ZMEB 4L8NA 5BNGA 5HNHA 2UU9E 3GTJJ 3CJQB 2X1CA 4HLYA 2OV7A 1LE8B 4ESBA 4CSWA 5KK1A 3HC7A 1VQKI 4NXME 1JGSA 2ODRC 3DF8A 1GDTA 4B09A 4LJZF 2DA1A 4XLPF 3JRDA 1TT5B 1RC7A 4GZNC 1SR9A 1XMQE 5L3CA 5JHFA 3FDYA 2ZMEC 3K4JA 3QYFA 4KIBA 2P81A 2IW5A 4ZTFA 1XS9A 1B9MA 4ZYGA 1OFCX 1H88C 1MIJA 1UG2A 4LF5E 2PX9A 2OCEA 1YIOA 2LY2A 3HRMA 4BHCA 5A2QK 2EMKA 4KFCA 2V87A 2CSHA 3CCQI 5FGMA 4HX4A 1N78A 5HDGA 4BJ6C 2L9SA 3ZMTA 4MIMA 3L9FA 3M8EA 3A1YA 2QKLB 3EUAA 3V7SA 2HGHA 1A35A 4Q4ZF 1DP3A 3BJOA 2F5FA 4ZDPA 2YU8A 1H9TA 2YTNA 2EBIA 4IHYA 1ZK8A 1JT6A 1O57A 3IH4A 2P0WA 4PJNA 1FYLA 4MFEA 4Q47A 2EM9A 2KFDA 3TEDA 3TQNA 3X2QH 5LLQA 1E3OC 2CS3A 3OYIA 3ZMZA 4S04A 1ZG3A 5IXMB 3H35A 4HSTA 4PSWA 3VDXA 1X6EA 2E71A 1IO2A 2Q1ZB 2ISZA 4OIQF 3OYCA 5F0FA 3VYYA 4BQOA 1Z05A 4JYKA 5A69A 4S0HB 2EZIA 2RQLA 1OYYA 3Q5FA 2BXYA 2COMA 3BG6A 3HYIA 1P92A 2VBYA 3UR3C 3W6JB 4LMYA 3A03A 2L4AA 2HZDA 2HHHE 3LFKA 4I6ZA 4B3AA 4ITVA 1UJ8A 1YJNI 9ANTA 2Y0SA 2LJHA 1SC7A 2E19A 5BPDA 1BM9A 5L3EA 4PJMA 2Q2EA 4XSZF 5AE3A 2F5VA 1X1CA 3CMEI 4R2EA 4NC7A 3CZ6A 4A5MA 4G7ZF 3K6GA 2ELYA 1ETYA 2QSGX 5JR3A 2X48A 2XIGA 2V83A 3F21A 1HDPA 3WGGA 4C2MJ 3LSJA 4X9JA 2ZNYA 1X1DA 3QPTA 3WTXC 2VQCA 1V5EA 3PFYA 4OOGC 2GXAA 4RHBB 4FTHA 3T8TA 1XX5A 3I4MJ 4BS9A 1DQ3A 3NEUA 4UHTA 4H4KC 1I39A 2VKHA 4ENMA 2BOLA 5CLSA 2L9NA 5J1RA 1QO0D 4XRMA 5J47A 2XF7A 3HB9A 4FE7A 2EMFA 3M7GA 1OR7C 4OWRB 4LG3A 2B7EA 2YUSA 1KYQA 3M1CA 4AIHA 1D1BA 2DFEA 2QBYB 1JHFA 3M4OJ 4LFBE 4YY3E 4WF2A 3RPQA 1AWCA 5BR8E 2YTDA 2UZKA 4XRSG 4L9VA 5E3NA 4A69C 2RDPA 5FLXZ 4LG0B 2DMUA 4BE2A 4A5NA 2P5KA 1MDMA 2LMZA 1R4NB 5LGUA 3HOXJ 4JI3E 1XDUA 5DNYA 4GYGA 1KA8A 3IWFA 2Z1DA 4N9IA 2M8EA 4X65E 4XRSA 1I3AA 4HZFA 5B3SH 4D9JA 3JRGA 2CO5A 4A3BJ 2H36X 1SVOA 1MGTA 2N3GA 2KIFA 3GW2A 5IPAA 5D5VB 3O2PE 2L92A 1BOAA 2EILH 2KKOA 1J0RA 3CUQC 4UUSB 2LT7A 1F43A 3OIQA 2DJNA 3OOUA 5K5RA 1LB2A 4EGYA 1K78A 3QP5A 3ZOBA 1G3WA 4M9ZA 3KYDB 4KMFA 5F6FA 2LUPB 4L5NC 2EQ0A 4P7DA 1WPKA 3E6CC 2L3CA 2MKNA 1FIAA 4C2TA 3AV0A 1L4SA 4M3DA 1HLVA 5KL2A 1FEXA 5E8GA 4BBRJ 3J81Z 1HW1A 1LFUP 1WJBA 3E7LA 2WB1A 3HPGA 5FRNA 2I13A 5H6QA 1D1CA 5L3BA 1NK2P 1T98A 5E3MA 4MLQA 2LF8A 3M8JA 4DV7E 2F8BA 3PL8A 4NHRA 2EN1A 2EPOA 2KLOA 2F48A 2VN2A 4XN3A 2EPUA 1P47A 1WH5A 3FMQA 2H1LA 2M1SA 2E34A 3V42A 3QWLA 4PZJA 1WGXA 2HU9A 4OAYA 4DR4E 5ICFA 5GAEJ 4BL0B 3JAMZ 2DA7A 3KLNA 1WCMJ 1IN5A 4LGWA 3ZQFA 1ZRDA 3Q9SA 2M87A 4DJAA 1AOYA 5CVRA 2A61A 2W4SA 2PMZA 5LEJA 2F4IA 1IV8A 4L9NA 3EPZA 2WTEA 1RQ0A 3PNVA 1XGMA 2V6EA 2Y30A 3K7AJ 3OL4A 2K86A 4ZTJA 2RTXA 4WK8F 4ENNA 1SFKA 3FK6A 3KEOA 1LPQA 2QKMB 4F6MA 4E7SA 2JPAA 2NOJB 5C4XJ 2BW3A 1WZ2A 1OCRH 3T8RA 1RKWA 2E60A 2DK8A 2XAQA 3BCAA 4YFKF 2ACJA 2EOOA 2E1NA 3E5UA 2JTVA 1V5FA 4U0VA 1DU6A 2DQLA 2EMZA 1FT9A 2O5RA 1XGOA 2EPAA 1JK2A 5L3FA 1OYWA 4HBLA 3FXUA 5A2QZ 1VQ9I 2YRMA 4R8HA 5J8FA 3ZPLA 4RLFA 2LTRA 2DFHA 4BHPA 2EV0A 2WWYA 4EMSA 2R0QC 1P7IA 4MNUA 1O0WA 4KIFA 1J59A 3MZ8A 3WTVC 2EN7A 2ZJRF 3RQ4A 3GWZA 3D5SC 4KWYA 4K2EA 1ORKA 2HQ5A 2B9SA 5E3LA 1GV5A 1FOXA 5AE1A 1ZR9A 1TP4A 3H0GJ 2L2OA 1T6SA 1SVLA 2I9IA 1NHAA 1XN7A 2H6BA 4P5OA 4AD9A 3R60A 2EIMH 4II2A 5IT9C 1G59A 1YW9A 3COAC 4M6YA 3BZ6A 5GADJ 2LSOA 4HQEA 1RUNA 2CUZA 4G8XA 5AASA 1E3PA 4LFUA 3S2WA 4IEJA 2HTJA 3DFGA 3I71A 2IBDA 1R5ID 2EH3A 5JI6A 4BC7A 4DUZE 3BC8A 4JI4E 2CQNA 1Z6TA 2DXIA 1U9OA 4LD5A 2L2NA 4JBAA 4FE4A 2DQRA 2VKDA 5D8KB 3RKYA 3QYEA 2ZFWA 3V7RA 1LDJA 5E1ZB 3H5AA 1TWGJ 1YOVB 3F8CA 4RMNA 4RB2C 1WHNA 2TCTA 5GP9A 2E1OA 4ANJA 2FOKA 1IDYA 1LJ9A 2EM5A 2M1BA 2DMTA 1QU3A 2EMGA 4UV8A 2F4VE 2L7FP 4G6TB 1ZGAA 2VASA 5HDNA 3P9KA 2CFOA 3NARA 1ZLJA 4E7IA 2ZO4A 5A6KA 2WBSA 3W6KB 3ZRGA 4EM2A 3OYHA 4EJTA 3PO3J 1A04A 2Q2EB 4HF2A 3JREA 2OZ6A 3M8FA 1ZELA 3K4NA 3HDDA 3E6BA 2HOEA 2IHR1 4BYYA 1FMVA 2W48A 3Q0WA 3I59A 1AHDP 1AH5A 1YTYA 3OV8A 1KQ0A 2Z9OA 4GDFA 4Y52J 3PQJA 3GZ5A 1BR1A 4IJDA 4E7KA 4JI6E 4CXFA 4DV3E 2K9SA 4AVPA 1HF0A 1H8AC 2R4GA 4EGZA 2DA6A 3K1PA 3ZMUA 4CCOA 2HDWA 2V4JC 4DV4E 2CV0A 1DI2A 1JUSA 1X4PA 3ONQA 2DBBA 1YJWI 2P5LC 1D0YA 2ECBA 2HYJA 4AWXB 2GXGA 4XKWA 2P6SA 1AKHA 4CYCA 3KP6A 2R7FA 5IWAE 5HODA 2M30A 4M30A 5CVVA 1Q1HA 4F93B 1WJ5A 1YIJI 1MDMB 3LAPA 2MDGA 2VKVA 1RETA 4OINF 3V7CA 5CFFE 3Q9VA 1MMAA 3UKGA 3TMOA 3K69A 3SEZA 1ZBQA 3ELKA 3WTWC 1W7PD 3GFLA 1IN6A 2PBIA 4DYCA 2W82A 2EB7A 2X51A 3I4NJ 4LK1F 1BBYA 3ABMH 1OQYA 1BN5A 2EL4A 1K61A 3S1MJ 2EA4A 1I6HJ 2XUBA 3QYBA 3U21A 1L3LA 4ZYHA 1MZBA 2Y0SN 1WJAA 2Y9ZA 2KOUA 5GTHC 2MBFA 5LFAA 1P4XA 5BQTA 4U7DA 4KJZA 2NABA 4LF7E 5LMNE 5FLVA 4JK1X 4KICA 2OC6A 2PI0A 3WG9A 4JI5E 2O7OA 2LP0A 2W25A 3DTEA 2IS6A 2WBTA 3KP5A 2BHYA 4PJLA 5FD5A 1YRNA 2GLIA 2DDAA 3R0JA 1GHCA 3WTTC 1A6QA 3FKIJ 1LEAA 3CLQA 3J80C 3CF2A 3RYPA 1VF9A 2R7ZJ 5AC4A 1LVKA 2N3HA 1R36A 2EL6A 2EOIA 2MC5A 1R1VA 3BJAA 2LE2A 4DV6E 2Y75A 3DBLB 5JVTA 4WXHA 3LSRA 1K4TA 1ETQA 1GVDA 1P6RA 1ACIA 1OLTA 2ELJA 1V4RA 1W7PA 2D45A 3GTOJ 1IRFA 4X1EA 4YHHE 3VSKA 4HNTA 3VYRB 2FV4B 4BQQA 3OIOA 2EOYA 3ADJA 1Z1BA 4M3BA 2VT2A 4ZYAA 1MD0A 1VFCA 4ZDOA 2K85A 2HDDA 4XLFA 1HDDC 3NAUA 4RGSA 1XG1A 2NVUB 4LB5A 5CVUA 2LREA 2NYXA 4ESJA 4XR6A 2H94A 2BW3B 1I50J 1BIAA 2EZHA 2L3DA 3A0HC 4A3FJ 3AG3H 2XF5A 4AVZA 4JV5E 5IV8B 2W00A 4YEJA 2IA1A 3KZYA 1GTKA 2XAHA 2ZC2A 3LSPA 1TW2A 4PGHA 1C0WA 2M4IA 1W36D 2YWQA 3KE2A 3BR6A 1WKMA 3CDIA 3HTSB 1LDDA 1X48A 3SFZA 3U2RA 1USTA 3OYGA 2OQRA 4HG2A 1DQUA 5J1UA 4RAFA 3OYMA 2XVCA 3AUZA 2WY7Q 4LOCA 1PUFA 4AU7A 1ON2A 5E18F 3WU1B 3S3NA 3K2AA 4CH7A 5IOYA 4CGZA 5BMZA 1FOYA 2WB1N 2WZOA 5FB2A 1Z7LA 2LVHA 2YZTA 4K0KE 2JA8J 1FTZA 4DUYE 2PMUA 2M7AA 2R93J 3J7YJ 4Q28A 2YTFA 1A31A 1XNRE 2KMUA 2PMHA 5KHDA 3RI4A 1M1EB 5HS8A 1P7JA 2F6CA 3A02A 3S1RJ 3R6SA 2LVSA 1F36A 2ID6A 3H09A 5AE2A 3DU6A 1QZZA 1TWCJ 3HM5A 4OOIA 2RS6A 3N4MA 2CQQA 1Z7UA 4JX4A 5FO5A 2DIXA 1I27A 3K4KA 4M6VA 2LF7A 2M4GA 2PMZN 3Q0UA 1ZR2A 1TN9A 3E1SA 1HOMA 2EWNA 1OPCA 3S16J 1Z0XA 3FHZA 1TT0A 2EMYA 3PIPF 1CF7A 1Z1DA 3CJTB 3FMSA 1ZGJA 2YPRA 3H3UA 3J7AY 1JK1A 2UWMA 1ZG1A 3HIFA 5GAHJ 1S72I 4GKKE 4S05A 1MBGA 3LFUA 1R7JA 5DM6F 4XLAA 2QVOA 5KL7A 5LD2C 4FX0A 4G12A 1VQ6I 1NEIA 2LLKA 4HV6A 2XKPA 5HDKA 2JOXA 4NBQA 2VONA 3FWEA 1OCOH 3L7WA 3S2DJ 3C4BA 3I54A 2QEXI 2DA5A 2IAIA 2PG4A 3K10A 1IF1A 2VBZA 5ILUA 5H2FC 4ABZA 3I59B 2D9HA 1I1SA 2RKHA 4OU0A 5HNFA 1P4WA 2RC4A 5KVRA 1Y56A 1JKQC 3BG5A 4JQFA 4A3DJ 3C6MA 2FMYA 3SZGA 2UUAE 4LK0F 1T4NA 3FIWA 1S29A 1FBQA 1U5TA 3GO5A 3QPLA 3ZMVA 2HDCA 2O61A 1X6FA 4BXUA 2L6MA 1W5TA 4JYAE 1S7AA 2I5UA 1QA6A 2XPVA 1RZ4A 4RB3C 3F6HA 5F27A 3MWMA 1ZN2A 2NOGA 2JA6J 4J01A 2EJ4A 4D7MA 1GLNA 1S6LA 5DEQA 4DV1E 2X6XA 2RNGA 3R0AA 3W3CA 3ZQCA 4CYCB 2K7LA 1AKHB 4RM3A 2E1MA 1TWFJ 4L0ZB 2MGQA 2V86A 3SZTA 3OSGA 5DTDA 3G1LA 1QPMA 2DYSH 3C4TA 5EZHA 2HOTA 3VFZA 3CDHA 5ADZA 5M5XJ 4GYIA 1FOKA 3QG5C 3AAFA 4GKJE 3GMEA 2JR1A 2L02A 4OX9E 4A0YA 4M71A 1EV7A 5CPRB 4UB6C 2IGKA 2JSPA 5A6BD 4TUGA 3IAM2 5EJCA 3EPHA 2XAFA 2DPUA 3LMMA 1FX7A 1T38A 3HOWJ 2EN6A 1RR7A 2WBUA 1X4OA 3U1KA 4PFPA 5D5UB 1V5GA 2EM0A 1JGGA 2YTGA 2HS5A 1WFXA 2XGDA 4UUVA 2GA1A 2XGXA 3LA7A 2TDXA 2YX7A 1MJ9A 2DODA 2PJPA 2V89A 3QOPA 1W0UA 5IT9K 1B9NA 3ZQ7A 1SEUA 5F3WA 4A3LJ 1WJPA 3H3ZA 3CCMI 2R7RA 4IO9F 3MN2A 1Y0UA 4FISA 3GX4X 4U88A 3BZKA 3RYRA 3MMYB 3F6GA 2XC7A 3IWCA 2KIUA 1YRNB 3I0TA 3CP2A 5ERIA 2TRTA 4W97A 2UXXA 1NG6A 4RM2A 1TWAJ 2HTSA 2V85A 3IUOA 1KGSA 2IEKA 3GCMA 3BY6A 4I02A 2KDZA 2CW7A 1BR4A 3OS1A 1TQIA 3MHSC 3TOBA 1QQIA 4HEA2 5A6BA 1D5YA 3BPXA 1W7PB 4FHTA 3DLLF 4HOBA 4UNOA 4ON0A 1YE9A 2MC3A 1JJ6C 3R61A 2W24A 1ZREA 5DUKA 3VEPA 4IHSA 3ADIA 4N4RB 5F1RA 3IC7A 3KFWX 3IP4B 2EMHA 3IKTA 5KAIC 5IOZA 2V1NA 4NXNE 2VE7C 3KEQA 2R7VA 1V54H 5B1BH 1O4XA 4P78A 4PGGA 3TP0A 5E17F 5KL3A 3LA2A 2L2KB 1A5JA 4I76A 3KX2A 4ZYEA 4CCMA 3E0JB 2LY9A 3K1MA 3FK7A 2NS0A 3DTIA 3JRIA 2K3PA 3P9IA 4UY8I 2M9HA 1ZBTA 2QSHX 3CMMA 1X3CA 2LTSA 4XL9A 5AC5A 2CUFA 2R7SA 2JWTA 3CDLA 1AU7A 3CF5F 3JR9A 2L7ZA 4C30A 3EPLA 1HR0E 2R76A 2L0KA 2OTJI 2EOZA 2M5WA 4I01A 1G4DA 2V26A 1XD7A 3QPHA 2CGPA 2IS2A 2HYGD 3ZCOA 3VK6A 2Y31A 2B0LA 3FZVA 4JI2E 2F5CA 3CO7C 3O8GA 3P7NA 1YHQI 2CH0A 1N36E 1PP8F 1NK3P 5M5WJ 3J7AG 2UUZA 1X1AA 3PJRA 4F55A 1JTYA 3HJEA 1MH4A 1PUFB 4KIGA 5HVQC 1HW2A 2DA4A 1R00A 2GOMA 3DEEA 1BC8C 2IGNA 4GFBA 2XF6A 5FKLA 4AIJA 1Z9CA 1HQCA 2RN7A 2DFFA 2E36A 4Y15A 2HFHA 4D1QA 2D2WA 2IJLA 1ON1A 1UHMA 4XLEA 5DUIA 4EJOA 4XKCA 1K6YA 2M8GX 3ZR8X 3HOYJ 4WSPA 2JRTA 1LFPA 2XRNA 2BVMA 3EQLF 2EQ1A 1TL8A 1EKEA 3N97A 1XSDA 1RR8C 5LBQA 1ZRFA 3MEXA 2FBHA 1MJBA 1W1WE 2ENHA 1PUEE 2NUEA 1T0FC 5CVJA 1ZH5A 2L54A 2V9PA 1SFUA 1WSUA 2NRAC 1STZA 3QQAA 4M3GA 2LKXA 3B6CA 2ENCA 4I7HA 1YUIA 3TW7A 2QENA 1MH3A 2WY8Q 1EH8A 4DV5E 1HSJA 4LLNA 1UB9A 2EK5A 4C3JJ 2QLZA 3IV5A 1R4MB 2V1DA 1YS6A 2OZUA 3CLOA 4DBRA 1CF7B 4FK5C 4HLXA 2EMLA 1A1IA 2RPCA 1X3UA 2YTOA 2HKOA 3GLXA 5EG0A 3J80K 1KYZA 3M3YJ 3S15J 2XSJC 2ZM6E 3BJ6A 3VOEA 2K02A 2LRDA 4A0XA 2YRHA 1SAUA 1W36C 2E7WA 1NTCA 4BKXA 1R5GA 1Z3XA 5K5OA 1TZLA 4A3GJ 3BTCA 3ZN1A 2E5LE 1YPNA 5KL5A 3LSMA 5AIQA 1HNZE 1STUA 2X85A 3WHBA 1FSHA 3IWDA 3T0YA 2V79A 3HGYA 5FFZA 2DMQA 2G7UA 2EPFA 5KL4A 3UNGC 1J26A 5CJ9A 1XTAA 1Y8RB 2EZLA 3RSNA 3FIGA 1ULYA 4HX8A 4BBSJ 5L3DA 2ESNA 4MGRA 2JA2A 2H8WA 4OIRF 3S3OA 1U5TB 2MFZA 1PDNC 2GLOA 2G7HA 4Y13A 1TWHJ 1KJKA 1AA7A 3H9JA 4CHUA 2KRCA 3CD6I 1ZAAC 3ZQHA 2WADA 2VL8A 2UXCE 4LTYA 3B02A 2VC1A 2KP6A 2LCEA 4DR2E 2LMDA 3S1QJ 3CCEI 5TSEA 1SD4A 3MVPA 4LF6E 2A5YB 2CYYA 5HLGA 1KU9A 4P55A 4M9SA 2E1MB 3FXOA 4ENKA 1T39A 4A6DA 2LBFA 3KPHA 3ABTA 2K4JA 3MAJA 1WHQA 1ITYA 3JTGA 1YFHA 2L8TA 4L5JA 3FX3A 5FJ8J 3M1EA 3BGHA 2JRMA 1HW5A 4YFNF 1SVMA 2VJ5A 2WBMA 3BT9A 3OL3A 4CDGA 1BBOA 2CPNA 2OAZA 2EOHA 2HKXA 3HUGA 2JVAA 2P8TA 3IH2A 2E1MC 1RRJA 1R49A 2UUCE 5F08A 4R2SA 3TP3A 2VQEE 4M9VC 1P9QC 3LQRA 2NVXJ 4AYBA 2E2JJ 4M2ZA 4P9UA 2B9DA 2FNAA 2FSWA 2RSMA 1F9NA 4IKFA 2NVYJ 3T1HE 1R23A 2FX0A 3CCRI 2EV6A 2RSIA 2K4VA 1VZ0A 2QM3A 3HSEA 4BY7J 2E7XA 1JE8A 5KAFC 3QU6A 3IHUA 2QCOA 2FMLA 1CGPA 3KETA 3BTJA 4LITA 4M74A 5ILSA 2MW8A 4G94A 1YLFA 2VUMJ 1U9NA 5ILVA 2CV1A 1IMUA 2HNHA 3R4KA 1ERDA 1IZ1A 4O5VA 3OMYA 2EM3A 2DDBA 3HHGA 1A1HA 1QHGA 1NCSA 2IVMA 4C2UA 4F9AB 4X66E 3IWBA 4YELA 1X3WB 5FKMA 3VYTB 2I8DA 3DCFA 3NRVA 3MHHC 3OTOE 2HXOA 3KIOA 5TRDA 2YR2A 1D5VA 1FIPA 5EEAA 2CJJA 2K9MA 3M9AA 2EN8A 1N75A 2DT5A 2O8KA 3CMAI 2UV1A 4NDLA 3JTZA 2VE9A 2ZXJA 5D6FA 1N77A 2EFWA 2A5WA 4MQ9F 1HC8A 3CCLI 2VOOA 2EM8A 3FF5A 2XAGA 1FZPB 1KQ9A 2EV5A 2JZYA 2VE8A 3SDGA 2JP9A 3LSHA 1LEBA 1F2IG 2X0LA 2M34A 3ABUA 2NNYA 1IQOA 3HSFA 3BZCA 2BHZA 3N05A 2YTJA 4WSGA 1ZR4A 1B1BA 5J8CA 4NC8A 2VJJA 2JK3A 5TJJA 5LGNA 2YTIA 1RKTA 2DK5A 2AO9A 3F23A 1FPQA 3RMPA 2EOXA 3HOUJ 4Y3OA 3G3ZA 2COBA 1WI9A 5FLXC 1VQLI 3K4MA 4D5FA 5BPIA 2EPZA 2L9RA 4TUIA 2P7CB 2DOAA 5JHUA 1BJAA 1JHHA 3EDPA 3G6EI 1MBHA 2NS8A 2FQ4A 3DQVC 1DP7P 3J7ZI 4Q48A 3LSTA 2LFBA 2CUEA 3OYBA 4XK4A 2QUFA 1YJ9I 3HOVJ 2CSOA 1XCVA 3LA3A 1B72A 2X1DA 2ESHA 2R92J 2YU3A 2ZJ2A 4CICA 3JRBA 2A07F 4EJUA 2GQQA 5IP6A 2Z3YA 4CUGA 5HLHA 2OBPA 3VYUB 3VYXA 2LK2A 2EPMX 3DWLE 4XMYA 3H3VK 4U0YA 2EE8A 4BE1A 3THOB 4G7OF 2ME0A 3RZOJ 2N8XA 4DW6A 2EOEA 3K4LA 3OOPA 1HKQA 2HQAA 1T56A 1JJ8C 1OJLA 2VXZA 2RQPA 2KHMA 3TDZC 1HNXE 3OYNA 2EP3A 1E17A 2VPLA 5K1YA 4O43A 2WV1A 3J81C 1MNMC 2MLKA 3J7Yp 2XKOA 3VPRA 4F52A 3H1CA 1I6XA 1WJEA 4LB6B 2L33A 1YUJA 4U7BA 4I98B 3G71I 3MSWA 2EINH 3HRUA 3J80Z 3GF2A 4IL6C 4W1UA 3WG7H 4KA4A 2DCEA 5IP7J 1U8BA 2YTEA 5F1JA 4A3EJ 3V8KA 3GTPJ 2Z5UA 2HJJA 2XGEA 2E2HJ 1U8RA 4EQQA 4X6AJ 5IP9J 1Z77A 3DP7A 2R7UA 1J09A 2VJIA 2F5EA 2JA7J 3JAMC 4O4KA 3E6MA 2QSFX 5EG0B 4DR5E 3JRHA 2KHXA 4EJVA 5B66C 4RGRA 3LMLA 3QOEA 3L1PA 2O8XA 1FTTA 2XAUA 2MA3A 2FJ1A 1MBFA 3DXJF 1EF4A 3D5LA 4MLOA 3C7JA 5DD4A 3H92A 2LYCA 5H6RA 1VNDA 1IQSA 1G3SA 4DR7E 2DO7A 2NAZA 2X6YA 2BBGA 3KWRA 3A01A 4Q35B 2VQHA 2D1VA 2KJBA 3F6VA 3MCZA 4A3KJ 2Q0OA 5IYCJ 3THNA 1X2MA 3E97A 1EH7A 1ZARA 4E7LA 4RDUA 5A2QC 1MMDA 5L3GA 3Q0VA 1KYWA 2L9VA 4PDKA 4WXDA 2DGCA 3S17J 2F5DA 5CQEA 1G3YA 2ZXIA 3C3WA 2Y9YA 4F6NA 4WPYA 3H0DA 4H0EA 3CTAA 1QNTA 2KRHA 2GIVA 4BH9A 3AKZA 4II3A 1G6NA 1ETWA 4MQVA 5LMUE 1A1KA 2LBFB 3P1XA 3O6BB 1N32E 1UN6B 4ZZDA 3FHNA 3GVAA 2DT6A 5EGOA 2GHFA
chains in the Genus database with same CATH topology
3P9CA 1TQPA 2IA2A 1JXSA 1YG2A 1ODDA 2FEZA 1LNWA 1UHWA 4HDUA 4O3MA 2D1HA 3FXRA 1KQ8A 3I5UA 4E70A 3ZP5A 1LDKB 2HZTA 3BWGA 3TDUC 1FBUA 2FQ3A 3V4GA 2IT0A 2ZNZA 4HQMA 1J75A 4NQWA 1Z6RA 1RUOA 1REPC 1J9IA 3IRQA 2AXLA 1U6GA 2P7VB 2CW0F 3L00A 1TQMA 1FYMA 4I0BA 4RAZA 3WTUC 5EEHA 1EH6A 5LEKA 4HX7A 2IP2A 2LDUA 2Z33A 1GXQA 2DTRA 2OU2A 2JPCA 2RVCA 4KN4X 1S3JA 3C1DA 2QQBA 3WTYC 2PFBA 3E6DA 3F8BA 3FXQA 5D4RA 3DEUA 5DYMA 2IRFG 4YIFA 3GXOA 2W57A 1SD7A 3RJPA 2V1UA 1O7FA 4IHTA 2V6CA 4WXCA 1QZYA 2DAOA 5LHIA 4A0ZA 1HXDA 2K4BA 4DNCA 3LWFA 1D3YA 4XSXF 1R1TA 2L4MA 2EFNA 1UCRA 3KZZA 1ZHFA 3BDDA 3JW4A 1U3EM 3RKWA 1DDNA 4FT8A 1KU7A 2OA4A 1OR7A 5J6XA 5DCMA 3HSRA 5HOOA 4Z2YA 3TO9A 4N9HA 4OIOF 5JFRA 5HLIA 1FP1D 1T2KA 2YX4A 6PAXA 4MTEA 1GXPA 2A69F 2DPDA 1USSA 5H20A 1V3FA 4IRHA 1TBXA 3F22A 3B73A 3LAJA 4G6DA 2WV0A 1QBJA 3WU0A 3CUQA 2HYFA 2F2EA 3WGIA 5CYVA 4L5IA 1QGPA 1TLHB 5FLXK 1BI1A 2L01A 2GXBA 1IUYA 1B4AA 5LGTA 5IT3A 1TNTA 4GCVA 3MFKA 3F8FA 1TTYA 2BBYA 3RIRA 3RKXA 1OKRA 3L2CA 3HOTA 3K9TA 4KMUX 3V8LA 4YFXF 4NHJA 4ZH4F 3IWZA 4LLLA 4KYWA 1R1UA 3L09A 3HHHA 1YYVA 4ZZLA 3G73A 1ZAOA 1BI2A 1SMYF 4IPAA 4ETSA 4HAMA 3J81K 1TW3A 4BQAA 1ZYRF 1FNNA 2A6HF 1W5SA 5DV5A 4WX9A 2KIMA 4CYDA 2RNJA 1RI7A 3TGNA 1K7AA 2PQ8A 1SAXA 3V8JA 3JAMK 2DFIA 3QP6A 4UVAA 1TNSA 3MZHA 3TO6A 4UV9A 2EJRA 4XBFA 3ECOA 4XRFA 1SD6A 1FC3A 2BEOA 3IKVA 3KP7A 3RTRA 1O3TA 1J7KA 4OIPF 1J2XA 2BGCA 4L9TA 4P9FA 2CG4A 3CJNA 4M6XA 4EM1A 2P5VA 2FXAA 4PCQA 3ECHA 1H9GA 4QLCU 2ISYA 1KU2A 4L9JA 1PP7U 1O3RA 4OMZA 1GVJA 4I09A 3WGHA 3TOAA 2EFQA 4O6JA 1XDSA 4D0PA 2HQRA 4IVNA 1HBXG 1R5HA 2QQAA 3WE2A 4IF4A 2XASA 3J7AO 2STWA 3PQKA 4BNCA 1R58A 3D0SA 3GZ6A 2CFXA 4KT5C 4HDVA 5E1XA 1RNLA 5DCMB 2H09A 3HRTA 3KP4A 1YS7A 1J5YA 2STTA 2HEOA 2MD5A 3SHFA 3EETA 1F4KA 1K79A 1BIBA 3IL2A 4I2OA 3F72A 2GA2A 5EEGA 3LQQA 2KJCA 4AIKA 4L0YB 2V9VA 1FWZA 1U5TC 2ZCWA 4RGXA 1WRJA 2FBIA 3GFIA 3GUDA 4M73A 3CUQB 4IRGA 5D6EA 2J5PA 1O3QA 3I64A 2VBWA 5K5QA 3WTZA 5IT9Z 1FLIA 2LNBA 2XAJA 3U9GA 2VT3A 3HRSA 1D8KA 4M9XA 1IXRC 4HA8A 5ICEA 2AS5F 2ETHA 4HW0A 1BI3A 3K0LA 3FMRA 3ZMSA 3EUHA 4HF1A 1R22A 2O03A 4G6QA 4EVIA 2EFPA 5FFXA 3KCCA 3PFIA 2VBXA 2EFOA 1IRGA 1P4AA 4P96A 4IXAA 4QWQA 2DI3A 3C18A 5ED4A 5AONA 3FM5A 5HS7A 2Y0MA 1O7LA 1FY7A 3REOA 1IXCA 2V1XA 1IXSB 4G7HF 4R1HA 3NQOA 3JSPA 3EYYA 2DU9A 1K6OA 3ZN0A 2HQNA 2BE5F 1HKTA 4MHGA 1LQ1A 1KU3A 3WODF 3SZPA 4TV7A 1DUXC 2WC2A 4IRIA 4BHBA 3DPTA 3DKWA 2ADUA 3CUOA 3BPVA 5D5XB 5D4SA 2Z99A 5LRRA 3KP2A 2GZWA 2FU4A 2CQKA 1XSXA 2J5OA 1OYIA 3VB2A 1VTNC 4A12A 5DCFA 4EM0B 4CZZA 4NB5A 4M72A 4KDPA 2RV8A 2XV4S 2ZKZA 4RB1A 2O0YA 3I4PA 1W4MA 1HSTA 1YW7A 5BS6A 3DV8A 4WWCA 4LLGF 3E3VA 4OMYA 2EA2A 4KN7X 1BC7C 1SFXA 3ULQB 1Z91A 4YG2F 2X4HA 1SFEA 1H0MA 4F7ZA 4Q5SF 1WWXA 5D5WB 5F64A 1XSVA 3GYHX 1YW8A 1ZRCA 4UVBA 2QQ9A 2HR3A 1SD5A 1XMKA 1IW7F 1SMTA 1E2XA 1ZG5A 2A6EF 2BV6A 2DLLA 4HV5A 2K27A 4UVCA 1U78A 3ZMDA 2FA5A 1B59A 2HGCA 2FNPA 3F6OA 1IN4A 4YIIA 1MKMA 3GEZA 1L0OC 3VODA 4A6EA 2RGVA 2VODA 1D8JA 3I58A 3E5QA 4A2UA 3QAHA 4RB0A 4R79A 1K78B 1DPUA 2PN6A 3F3XA 1ZLKA 4BAYA 2MH2A 4ZYDA 3I53A 3ML6A 3BOQA 3BROA 2O6GE 2Q8KA 4ASNA 2DW4A 1WQ2A 2M45A 1IN7A 1MJAA 1F5TA 4L18B 2ELHA 2FRHA 5ICCA 2JSCA 2R7DA 3KLOA 2W84A 4DQ2A 3K2ZA 3T1BA 2ZMEA 3F8MA 1BI0A 2QZ8A 3CO6C 1B6AA 4RS8A 5E8IA 3QU3A 4HYEA 3JSOA 5E20A 5AIPA 2Y48A 4N0BA 4FX4A 4RGUA 2H6CA 1OMIA 2P6TA 4ESFA 3TKYA 1XB4A 4GO1A 5CVIA 3GFJA 3RPUA 2UXNA 3F8NA 2G9WA 2JT1A 3MZYA 2MH9A 1S8NA 1IAWA 3GFMA 2A68F 1T0FA 3FM3A 2PLYA 4XLNF 4MEXF 2W85A 4EV0A 1O3SA 1XGNA 3WE3A 1ONVA 1I5ZA 5LRSA 2XHKA 1I1GA 3DPLC 4G9YA 2E1CA 3EYIA 1S7OA 2GAUA 3WTSC 4U0WA 2LKPA 2MLGA 2BYVE 4KNYA 1FP2A 1XGSA 3TO7A 2NNNA 1U2WA 3E5XA 3QRFF 2R3SA 5ICGA 3T5XA 3O3KA 4KUMA 4UXNA 1XMAA 4EJWA 2A3SA 2FF4A 2FE3A 4HF0A 2IA0A 1IN8A 2KRFA 2QBYA 5LHHA 1F1ZA 1XCBA 4GXOA 4Y17A 4LG0A 5D8LB 5FD6A 3U1DA 1FBSA 1FSEA 4WCGA 5E1WA 2O3FA 1FYKA 2QWWA 1LVAA 4MTDA 3SXYA 4GGGA 2FBKA 2CWEA 2OD5A 5BOXA 2HWVA 2IPQX 2QYOA 2VC0A 2P4WA 3HOSA 4IJAA 2PEXA 4ENJA 3SQNA 5DD8A 3ROUA 2VOPA 4MEYF 2OQGA 2XROA 1YQAA 3ISPA 4I0AA 3JTHA 1RIOH 3MQ0A 4CO8A 5LHGA 5HS9A 1DPRA 3K1NA 3IRRA 2JPBA 2ZBKA 2C6YA 1P2FA 5DDGA 3BP8A 2H27A 3KP3A 2YSRA 1G3TA 4B8XA 1HKSA 1YO5C 1UFMA 3ERED 3RDIA 3HTUA 4RAYA 2GWRA 2ZMEB 4HLYA 4ESBA 5KK1A 1JGSA 3DF8A 4B09A 4LJZF 4XLPF 5L3CA 4KIBA 2IW5A 1B9MA 4ZYGA 1YIOA 3HRMA 4BHCA 5A2QK 4KFCA 5FGMA 4HX4A 5HDGA 3ZMTA 3L9FA 3M8EA 3V7SA 4Q4ZF 3BJOA 2F5FA 1H9TA 1O57A 1FYLA 4Q47A 3TQNA 5LLQA 3ZMZA 4S04A 1ZG3A 2ISZA 4OIQF 1Z05A 1OYYA 3Q5FA 2COMA 3HYIA 1P92A 2VBYA 3W6JB 4LMYA 2L4AA 3LFKA 5BPDA 1BM9A 5L3EA 2Q2EA 4XSZF 4A5MA 4G7ZF 5JR3A 2XIGA 3F21A 3WGGA 2ZNYA 3QPTA 3WTXC 3T8TA 3NEUA 4UHTA 4ENMA 5CLSA 1QO0D 3M7GA 4AIHA 2QBYB 1JHFA 4WF2A 3RPQA 1AWCA 2UZKA 4L9VA 5FLXZ 2RDPA 4LG0B 4A5NA 2P5KA 1MDMA 5LGUA 1XDUA 4GYGA 1KA8A 3IWFA 4N9IA 2M8EA 4HZFA 2CO5A 1MGTA 2KIFA 3GW2A 5D5VB 3O2PE 1BOAA 2KKOA 1J0RA 3CUQC 5K5RA 1LB2A 1K78A 4EGYA 3QP5A 1G3WA 4M9ZA 4KMFA 5F6FA 3E6CC 5E8GA 3J81Z 1HW1A 5H6QA 5L3BA 1T98A 2LF8A 2VN2A 3FMQA 4PZJA 5ICFA 3JAMZ 3KLNA 1IN5A 4LGWA 1ZRDA 3Q9SA 2M87A 1AOYA 5CVRA 2A61A 5LEJA 4L9NA 2WTEA 1XGMA 2K86A 4WK8F 4ENNA 3KEOA 2ACJA 3T8RA 4YFKF 2DK8A 2XAQA 2E1NA 3E5UA 2JTVA 4U0VA 2DQLA 1FT9A 1XGOA 5L3FA 1OYWA 4HBLA 3FXUA 5A2QZ 4R8HA 5J8FA 3ZPLA 4BHPA 2EV0A 2WWYA 4EMSA 4MNUA 4KIFA 1J59A 3WTVC 3GWZA 4K2EA 1T6SA 1NHAA 1XN7A 2H6BA 4P5OA 4AD9A 3R60A 1YW9A 3COAC 4M6YA 3BZ6A 4HQEA 2LSOA 1RUNA 4G8XA 4LFUA 3S2WA 2HTJA 3DFGA 3I71A 5JI6A 1Z6TA 4LD5A 4JBAA 2DQRA 5D8KB 3RKYA 3V7RA 2ZFWA 4RB2C 1LDJA 5E1ZB 3F8CA 2FOKA 1LJ9A 2M1BA 4UV8A 1ZGAA 5HDNA 3P9KA 1ZLJA 2ZO4A 3W6KB 4EJTA 4EM2A 1A04A 4HF2A 2OZ6A 3M8FA 3E6BA 2HOEA 4BYYA 3I59A 1YTYA 3OV8A 1KQ0A 2Z9OA 3PQJA 3GZ5A 4CXFA 4AVPA 4EGZA 3K1PA 3ZMUA 2DBBA 2P5LC 4AWXB 2GXGA 2P6SA 3KP6A 2R7FA 2M30A 5CVVA 1Q1HA 1MDMB 3LAPA 4OINF 3V7CA 3Q9VA 3K69A 3ELKA 3WTWC 1W7PD 3GFLA 1IN6A 2PBIA 2EB7A 4LK1F 1BBYA 1BN5A 2EA4A 2XUBA 1L3LA 4ZYHA 1MZBA 2MBFA 1P4XA 5BQTA 4U7DA 4JK1X 4KICA 2PI0A 3WG9A 2W25A 3KP5A 5FD5A 3R0JA 1GHCA 3WTTC 1LEAA 3RYPA 1R36A 1R1VA 3BJAA 2Y75A 5JVTA 4WXHA 1P6RA 1V4RA 1W7PA 2D45A 1IRFA 2VT2A 1MD0A 4RGSA 4LB5A 5CVUA 2NYXA 4ESJA 2H94A 2L3DA 1BIAA 2IA1A 3KZYA 2XAHA 1TW2A 4PGHA 1C0WA 3KE2A 1WKMA 3HTSB 1LDDA 3SFZA 3U2RA 1USTA 2OQRA 2XVCA 1ON2A 5E18F 3WU1B 4CGZA 5BMZA 5FB2A 2PMUA 2PMHA 3RI4A 5HS8A 3R6SA 1QZZA 4OOIA 3N4MA 1Z7UA 5FO5A 1I27A 2LF7A 2EWNA 1OPCA 3FHZA 1CF7A 1Z1DA 3FMSA 1ZGJA 2YPRA 3H3UA 2UWMA 1ZG1A 3HIFA 4S05A 1R7JA 2QVOA 4FX0A 5HDKA 2XKPA 4HV6A 2VONA 3FWEA 3L7WA 3I54A 2PG4A 1IF1A 2VBZA 5ILUA 3I59B 1I1SA 2RKHA 4OU0A 1P4WA 2RC4A 5KVRA 4JQFA 2FMYA 4LK0F 1S29A 1FBQA 1U5TA 3GO5A 3ZMVA 2HDCA 2O61A 4BXUA 1W5TA 1S7AA 1RZ4A 4RB3C 3MWMA 1ZN2A 1S6LA 5DEQA 3R0AA 2K7LA 4L0ZB 3SZTA 1QPMA 3VFZA 3CDHA 1FOKA 4GYIA 3AAFA 2L02A 4A0YA 4M71A 1EV7A 2XAFA 2DPUA 1FX7A 1T38A 5D5UB 2HS5A 4UUVA 2GA1A 2XGXA 3LA7A 2TDXA 2YX7A 1MJ9A 2PJPA 3QOPA 5IT9K 1B9NA 3ZQ7A 3H3ZA 1Y0UA 3GX4X 4U88A 3RYRA 2KIUA 3I0TA 5ERIA 2UXXA 2HTSA 1KGSA 3BY6A 4I02A 1TQIA 3TOBA 1QQIA 3BPXA 1W7PB 4FHTA 4HOBA 4UNOA 4ON0A 2MC3A 3R61A 2W24A 1ZREA 5DUKA 3VEPA 4IHSA 5F1RA 3IC7A 3KFWX 3IKTA 3KEQA 4PGGA 5E17F 3LA2A 4ZYEA 3K1MA 2NS0A 3P9IA 2M5WA 4I01A 1G4DA 1XD7A 3QPHA 2CGPA 2HYGD 3FZVA 2B0LA 2F5CA 3CO7C 3P7NA 1PP8F 4KIGA 5HVQC 1HW2A 1R00A 1BC8C 4AIJA 1Z9CA 1HQCA 2RN7A 4Y15A 2HFHA 2D2WA 2IJLA 1ON1A 1UHMA 5DUIA 4EJOA 2JRTA 2XRNA 3EQLF 3N97A 1XSDA 5LBQA 1ZRFA 3MEXA 2FBHA 1MJBA 1PUEE 5CVJA 1ZH5A 2L54A 1SFUA 1WSUA 2NRAC 1STZA 4I7HA 2QENA 1EH8A 1HSJA 4LLNA 1UB9A 2EK5A 2QLZA 2V1DA 1YS6A 2OZUA 3CLOA 1CF7B 4HLXA 1X3UA 2HKOA 3GLXA 3J80K 1KYZA 3BJ6A 3VOEA 2K02A 4A0XA 2E7WA 5K5OA 1R5GA 3ZN1A 5AIQA 1FSHA 3T0YA 2V79A 5FFZA 2G7UA 5CJ9A 1ULYA 4HX8A 5L3DA 2ESNA 4MGRA 4OIRF 1U5TB 1PDNC 2G7HA 4Y13A 4CHUA 3B02A 2VC1A 1SD4A 2A5YB 2CYYA 5HLGA 1KU9A 4P55A 4M9SA 4ENKA 1T39A 4A6DA 3ABTA 2K4JA 3MAJA 3JTGA 1YFHA 4L5JA 3FX3A 3M1EA 1HW5A 4YFNF 4CDGA 2OAZA 2HKXA 3HUGA 2P8TA 3LQRA 4P9UA 2FNAA 2FSWA 1F9NA 1R23A 2EV6A 2QM3A 1JE8A 3HSEA 2E7XA 3QU6A 3IHUA 2FMLA 1CGPA 3KETA 4M74A 5ILSA 4G94A 1YLFA 5ILVA 3R4KA 1IZ1A 4O5VA 3HHGA 2IVMA 3NRVA 5TRDA 2YR2A 1D5VA 3M9AA 2DT5A 2VE9A 2ZXJA 5D6FA 2EFWA 4MQ9F 2VOOA 3FF5A 2XAGA 1FZPB 1KQ9A 2EV5A 2JZYA 2VE8A 1LEBA 2X0LA 3ABUA 2NNYA 3HSFA 1B1BA 5J8CA 5TJJA 5LGNA 2DK5A 3F23A 1FPQA 3G3ZA 1WI9A 5BPIA 2P7CB 5JHUA 1BJAA 1JHHA 3EDPA 3DQVC 1DP7P 4Q48A 3LSTA 2QUFA 2CSOA 1XCVA 3LA3A 2ESHA 2YU3A 2ZJ2A 4CICA 2A07F 4EJUA 2GQQA 2Z3YA 5HLHA 2OBPA 4U0YA 4G7OF 3OOPA 1HKQA 2VXZA 2RQPA 3TDZC 1E17A 5K1YA 2MLKA 2XKOA 1I6XA 4LB6B 4U7BA 4I98B 3HRUA 3J80Z 3GF2A 4KA4A 3V8KA