1EH8A

Benzylated human o6-alkylguanine-dna alkyltransferase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
175
structure length
165
Chain Sequence
CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O6-ALKYLGUANINE-DNA ALKYLTRANSFERASE
publication title Active and alkylated human AGT structures: a novel zinc site, inhibitor and extrahelical base binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 40
structure length 165
sequence length 175
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2000-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1eh8A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1eh8A01
4M73A 1MJAA 1DDNA 1IN8A 3D0SA 2EJRA 4YFNF 1FZPB 2XKPA 3KLOA 2O0YA 2QQBA 3QRFF 3KP4A 2K86A 2GA2A 3I64A 4KN4X 4XBFA 2OA4A 1KYWA 2K02A 3LSTA 2XUBA 1IF1A 2M1BA 4OMYA 4HF2A 4B09A 2CG4A 3QU6A 1U5TB 4RB0A 3J81Z 1FNNA 1YFHA 4UNOA 3QAHA 2PJPA 3PFIA 4KYWA 2GZWA 4FX0A 4I02A 1ZRFA 1AWCA 3QU3A 1VTNC 2QM3A 3U2RA 1OMIA 4YFXF 5LEJA 5EEHA 3SXYA 1E2XA 2QQAA 1Z1DA 4G6DA 4Y13A 4ESFA 1BIAA 2BEOA 3TQNA 3R61A 4UHTA 4K2EA 4EM1A 2YPRA 4KICA 4LB6B 1GXPA 2R3SA 2RGVA 2IA2A 5LRRA 2Z9OA 2PMHA 2G7HA 5LHIA 4A6DA 3R0AA 1REPC 2IW5A 3KP6A 4MTDA 1FSEA 2IJLA 4BXUA 1O7LA 2W24A 3NRVA 2JPCA 1XGMA 4AWXB 4IHSA 5DV5A 2A3SA 3WTXC 2FA5A 1G3YA 3FHZA 4O6JA 1FC3A 4D0PA 1YQAA 2O6GE 1R58A 4CHUA 3KEOA 4B8XA 5J8CA 2W25A 2P8TA 1HBXG 1ZARA 2KRFA 5D5VB 2V1XA 5IT3A 1GVJA 2XROA 5FD6A 1DUXC 1TTYA 1KQ0A 1ZG1A 2QBYA 2YU3A 3DQVC 1USTA 4MEXF 1P4AA 1QGPA 1W5TA 4S05A 3T8TA 4G6QA 1LDKB 2VBZA 3BPXA 3DF8A 1Q1HA 1XGSA 1KA8A 1T6SA 1ZYRF 1Z05A 3REOA 1UHMA 2IRFG 3J7AO 4O3MA 2J5PA 2HKOA 3P9IA 4Q48A 3HRTA 2L01A 2FMLA 2RC4A 2ISYA 4G8XA 1LB2A 4RGRA 2DK5A 2XKOA 5E17F 2ZNYA 1I6XA 1I27A 1UFMA 1FBQA 1IRGA 5ED4A 1L0OC 3RI4A 2KIMA 2Y48A 3F8NA 3KE2A 2FF4A 4KIFA 5CYVA 4P5OA 1BI1A 5CJ9A 5HS9A 1P92A 1FYMA 4A0ZA 2FQ3A 1SFXA 2Z3YA 1S8NA 5FLXZ 4ASNA 4N0BA 3LAPA 2BBYA 1QZYA 4OIQF 3ZMZA 1J59A 2D1VA 4BHBA 3CO6C 4EGZA 5HDKA 4KDPA 1HKTA 2OAZA 1XMAA 1HKQA 2HYGD 1SD7A 2DQRA 3CUQA 1HXDA 3QP5A 4HQMA 4CYDA 2CQKA 3ZMVA 2Q2EA 5LHHA 5FGMA 3R4KA 4QWQA 1R1TA 1KQ8A 4GXOA 3IRRA 4L0ZB 2KIUA 5DYMA 4MQVA 3L7WA 3WTUC 5L3EA 2STWA 1H9TA 1MZBA 1O3TA 1B9NA 2EV6A 1G3WA 1I1SA 3KFWX 4EM2A 1YIOA 3T8RA 1P4WA 4ESBA 3GZ5A 2EK5A 3MAJA 3LAJA 1LNWA 2Y75A 4PGHA 1XDSA 5DDGA 4LLGF 3LA7A 1FP1D 3ZMSA 3E97A 4ZYGA 2DO7A 2QQ9A 2R7DA 1J5YA 1JXSA 3T0YA 1CGPA 4I0AA 1T2KA 3O6BB 2FBHA 3FXQA 4L0YB 5LGNA 3GYHX 3TKYA 4Q47A 3H92A 4CXFA 1IN7A 4LFUA 1FBUA 2OZUA 4WK8F 3KCCA 3F6VA 4ZYEA 5A2QZ 1YTYA 2WC2A 3BJ6A 3KETA 4HF0A 2WWYA 3WTTC 4G94A 4CZZA 2IP2A 1BJAA 3WGIA 2EFWA 5FB2A 3H3UA 1JGSA 4Z2YA 2XAGA 3I4PA 3JSPA 2G7UA 3EETA 1BC8C 2UZKA 1Z9CA 3FM3A 1BBYA 3JAMZ 1KU2A 3L9FA 4ETSA 4G7OF 5BMZA 3I5UA 3K69A 5LEKA 5DD4A 3O2PE 2HS5A 2V6CA 2BYVE 4LMYA 2AXLA 4EJOA 3V4GA 5ICEA 5E18F 3GFJA 4LJZF 3C1DA 3E5UA 3WGGA 2E7XA 2V9VA 4CICA 2VC1A 3R60A 5LRSA 1WKMA 1J2XA 2O3FA 4HDUA 1YLFA 2KJCA 4LLNA 4IXAA 1LVAA 3PQJA 2F2EA 4FX4A 2XAFA 4HDVA 4ZZLA 2MLKA 1R1VA 2A5YB 3RJPA 1S3JA 2EA4A 3Q9VA 3K1NA 2E7WA 4PCQA 3GEZA 1D3YA 1P4XA 5ILVA 5D5UB 3ZN0A 3ZN1A 1R5HA 4KIBA 4HX4A 2FSWA 2FRHA 1MD0A 4RS8A 5L3GA 3W6JB 4BQAA 3K1PA 3R0JA 2VT3A 3DFGA 3K0LA 1YW9A 3WE3A 2VE8A 1W7PD 3I59A 3RKWA 4HV5A 2H27A 3CUOA 3NEUA 4I01A 1QNTA 4XRFA 2A61A 3V7CA 3FMQA 2BE5F 2FE3A 1RNLA 4U7DA 2QWWA 4ON0A 1OPCA 1UCRA 2HQNA 2PG4A 1TLHB 2YX4A 5L3CA 1XDUA 2D1HA 3ABTA 3GFIA 5ICCA 1F5TA 1U78A 3OOPA 1FT9A 3VB2A 3TOAA 2P5LC 5CVRA 2XIGA 3BPVA 2ELHA 4U88A 1XD7A 5CVIA 5DCFA 4I7HA 3F72A 4BH9A 1DPUA 5AONA 2LKPA 3F8CA 2OU2A 3KP5A 4HYEA 4KFCA 3B73A 1WRJA 2DFIA 3S2WA 4LG0A 2EFOA 2VONA 1R7JA 2V1DA 4M9XA 2CW0F 3V7RA 1G3SA 4LK1F 5L3BA 1PUEE 5DCMA 2HZTA 2ZBKA 2ESHA 2Z33A 2JRTA 1K78A 4A5NA 4GYGA 5HS8A 2FBKA 4U0WA 1I5ZA 1IZ1A 3GUDA 1ONVA 3MQ0A 3IKTA 1OYWA 3WTYC 3HOSA 1TQPA 4OIOF 3L00A 4O5VA 1J0RA 5JR3A 1YYVA 2DLLA 4JBAA 3GXOA 2YX7A 2MH2A 2HQRA 3JSOA 4WF2A 3C18A 3D5LA 4I0BA 2B0LA 4JK1X 1MDMA 5F1RA 1V4RA 3GWZA 3BP8A 3ZQ7A 4ENMA 3TGNA 2ADUA 4IF4A 2VBWA 1O7FA 3E6BA 4RB3C 1K79A 2FNPA 1ZRCA 1SD6A 1FP2A 2MBFA 4TV7A 3HTSB 2KKOA 3SQNA 3ZMDA 3FX3A 4PGGA 2ZXJA 5E1XA 3L09A 1QQIA 1XCBA 2G9WA 1TBXA 3Q9SA 5ILUA 2A6HF 3DEUA 1R36A 4N9HA 5HDGA 3WU1B 2XRNA 3QOPA 1TNTA 4EGYA 2FXAA 3RPQA 3ZP5A 3TOBA 3GVAA 4L9JA 3M1EA 3C7JA 1B4AA 1W7PA 4WXDA 1KU9A 3CUQB 1YW7A 3HRUA 2VE9A 2HKXA 2DAOA 3F3XA 2LSOA 5AIQA 1FBSA 5K5OA 1RIOH 2QVOA 4EM0B 2L4AA 1U2WA 4OIPF 2BV6A 2P6SA 3GFMA 2ZFWA 4LLLA 1JE8A 4M74A 3E5XA 3EDPA 5D6EA 2P6TA 4I2OA 2WTEA 2NNNA 4JQFA 3ISPA 1X3UA 1YS7A 2NS0A 1U5TA 4RGUA 3J81K 4E70A 4YFKF 3ERED 2KJBA 2O61A 5AIPA 4IHTA 3B02A 1ON2A 3M9AA 3BWGA 3F21A 3DKWA 3ML6A 4HW0A 1BM9A 3CUQC 2NNYA 2DTRA 1EH8A 3P9CA 3HSEA 2P5KA 2FU4A 2QUFA 4HZFA 4L9NA 3OV8A 2D45A 1D8JA 4EMSA 4A0XA 2P7CB 2NAZA 2DK8A 4KA4A 2JPBA 1USSA 4F7ZA 2E1CA 1FWZA 5DEQA 2PFBA 5E1ZB 1HW2A 1RUOA 2W85A 2RDPA 3BJAA 4MHGA 2ETHA 1IXSB 3FXUA 1ZHFA 1H9GA 4AIHA 1ULYA 4OIRF 5LBQA 2ZCWA 1IN4A 2OD5A 1DPRA 2QLZA 1HSTA 3RTRA 4P9UA 4RAYA 3QPHA 1BOAA 1KYZA 2CGPA 2VT2A 4BNCA 1MKMA 3FM5A 3WGHA 1U8RA 2RNJA 3KP2A 2HWVA 2M5WA 1W5SA 2YR2A 2HGCA 1PDNC 5LGUA 4YG2F 3I0TA 5EEGA 3RPUA 2VN2A 1G4DA 2GWRA 1ZREA 5F64A 1S6LA 1YG2A 3SZTA 1EH6A 5JHUA 2GAUA 3F6OA 3TO9A 3LFKA 3I54A 5IT9Z 1ZH5A 2CO5A 1XSXA 4OU0A 3ROUA 2YSRA 2M45A 4I98B 2R7FA 4MGRA 2VODA 2JSCA 2LDUA 1T0FA 1BI2A 3F8MA 1PP7U 1IRFA 3U1DA 3L2CA 4ESJA 4HV6A 4IJAA 1WSUA 5JVTA 2NRAC 3CJNA 2W84A 3I53A 2UWMA 1U6GA 1U3EM 1G6NA 2FNAA 3BY6A 1IXRC 3FF5A 1G3TA 4M6YA 4ENJA 4RAZA 3GX4X 3ELKA 4QLCU 3IWFA 3KP7A 4WWCA 1T38A 1SAXA 1XSVA 2D2WA 4DQ2A 1BI0A 1ZGJA 3JW4A 1IW7F 5FLXK 5H6RA 3KEQA 1ZG5A 1CF7B 3K2ZA 3QPTA 5BQTA 5D6FA 2ESNA 3IHUA 3WTZA 3M7GA 1ON1A 2X4HA 4GCVA 2LF7A 4LGWA 1Z7UA 5HOOA 2NYXA 3GW2A 2JT1A 4LD5A 1BIBA 4NHJA 2X0LA 3LQRA 4HAMA 4LG0B 2LF8A 4XSZF 5L3DA 1SFEA 4XLNF 1JHFA 4AIKA 3WU0A 2GXGA 2DPDA 2F5DA 3FWEA 4L5IA 4N9IA 5HVQC 1K78B 1TNSA 4WCGA 2AS5F 2EFQA 4HA8A 1HQCA 5DD8A 4U0YA 1R00A 4BHCA 1KQ9A 3E3VA 4L9VA 1SD5A 4S04A 1TW3A 3TDZC 4A0YA 3I58A 4FT8A 4PZJA 5IT9K 3E6CC 5K1YA 1O57A 2Q8KA 1K7AA 1BC7C 3HSRA 3R6SA 3BOQA 3G3ZA 4A6EA 3WTWC 4AIJA 3C3WA 2LNBA 2XHKA 2XVCA 5BS6A 1ZN2A 1LQ1A 3MCZA 1F4KA 1IN5A 2EB7A 2DBBA 4G9YA 3MEXA 5HDNA 5E8GA 1IN6A 2STTA 4WXCA 4U7BA 2IT0A 2DPUA 1LJ9A 3WE2A 5A2QK 5TJJA 5HLGA 3V8LA 5JI6A 3ECOA 1QZZA 2PLYA 4WXHA 3KZYA 3IL2A 2MD5A 3DXJF 3ABUA 1XCVA 3LWFA 1GXQA 4M9SA 4KMUX 3JTHA 1OR7A 1B1BA 3GLXA 1W4MA 3J80Z 2OZ6A 3K9TA 3AAFA 3JAMK 4HF1A 1R1UA 1W7PB 3HHHA 1FLIA 2EV0A 2RV8A 4UVCA 2QENA 1UB9A 3GFLA 4KIGA 2XGXA 3IRQA 4CGZA 1SD4A 2Z5UA 3BJOA 3H3ZA 4M6XA 1IAWA 2M30A 5KK1A 5J8FA 3F8BA 3FZVA 2QBYB 3P7NA 1RUNA 4EQQA 5FD5A 5E20A 1ZRDA 5FFXA 2CSOA 4UVAA 5E8IA 3F8FA 4ENNA 5H20A 3DPLC 2W57A 1K6OA 2GA1A 4MEYF 2HYFA 4G7HF 4R79A 3K1MA 3G73A 2H09A 2EFPA 3BDDA 3QP6A 3DV8A 4RB1A 3RIRA 5D8LB 3LQQA 1ZAOA 1FYLA 5L3FA 4RB2C 3I71A 1FOKA 1HW5A 2CFXA 2A68F 3IC7A 2VBYA 3ZMTA 1J7KA 3PQKA 1H0MA 5ICGA 3RKYA 2J5OA 1D5VA 4PDKA 4CDGA 3MFKA 2XAQA 1O3QA 3Q5FA 2K7LA 1D8KA 4UV9A 1RZ4A 1AOYA 5LLQA 3RYRA 4LB5A 2VBXA 4M72A 5CVUA 1Z6RA 4HOBA 1PP8F 4ENKA 4U0VA 2MH9A 2MC3A 4ZZDA 5HLHA 2HEOA 2HTJA 1C0WA 2L54A 4P55A 3IWZA 4MQ9F 1XB4A 2A6EF 5FFZA 4ZYHA 4A2UA 2WV0A 1U5TC 3J80K 4RGXA 5D4SA 2F5EA 5D5WB 4XLPF 2ZMEA 4H0EA 2MA3A 4KN7X 3VEPA 1A04A 3E6DA 3T1BA 4ZH4F 5BPIA 1R23A 2TDXA 1ZGAA 2A07F 1YS6A 2O8XA 4R8HA 4BHPA 1LDDA 1STZA 3WTVC 1J75A 4L18B 3KP3A 3MWMA 4OOIA 1B9MA 1XGOA 1KU7A 2IA1A 4L9TA 1Z91A 1KU3A 5CLSA 1ZLKA 4KMFA 4NQWA 1T98A 4BYYA 3CO7C 4LK0F 3HIFA 4HQEA 3N97A 2PI0A 2VOOA 3HTUA 4CO8A 4KUMA 1FSHA 2PN6A 2UXNA 1MGTA 2H6BA 4EJVA 4UXNA 5ILSA 1WWXA 5BOXA 4KT5C 4I09A 2XAHA 4FHTA 1S29A 3BZ6A 2K4BA 4GGGA 2A69F 2OQGA 1LEAA 2GQQA 4EVIA 3VOEA 5JFRA 1J9IA 3LA2A 2P5VA 4HLXA 4A12A 3N4MA 1XMKA 3M8FA 5LGTA 2HDCA 1V3FA 2DI3A 2Q0OA 5TRDA 2EFNA 2ZNZA 2ZJ2A 2QZ8A 1S7OA 2RN7A 1TQMA 2MLGA 4RGSA 3CLOA 3HSFA 5H6QA 3MZHA 1DP7P 2CWEA 1BN5A 1B59A 4Y15A 3M8EA 3TDUC 3ECHA 2L02A 4YIIA 1EV7A 3O3KA 2HOEA 2DT5A 3F22A 1HW1A 5HS7A 3CTAA 4AD9A 1Y0UA 4P9FA 1MJBA 2O03A 4EJUA 4XSXF 4GO1A 3HOTA 3EYIA 1QBJA 2ZO4A 2CYYA 3U9GA 1L3LA 1E17A 4R1HA 2HTSA 2DU9A 3W6KB 4Y17A 2COMA 3SHFA 1TQIA 4WX9A 3EUHA 4EJWA 1R5GA 2ACJA 3KLNA 5ERIA 5DUIA 4HLYA 4M71A 3CDHA 1FPQA 1HKSA 2RVCA 1O3SA 5F6FA 2QYOA 5J6XA 3SFZA 2RQPA 2EA2A 2F5CA 2M87A 4KNYA 1IXCA 5K5QA 1I1GA 3GF2A 2HR3A 1WI9A 4G7ZF 4MTEA 3I59B 4M9ZA 2XV4S 4OINF 1MJ9A 1OYIA 2EWNA 2EV5A 4EV0A 5D8KB 1XN7A 4NB5A 1P6RA 2ISZA 2PBIA 4EJTA 1SMYF 2JZYA 2IVMA 2OBPA 2P4WA 5CVJA 4ZYDA 2L4MA 1FX7A 3IKVA 3WTSC 5E1WA 2V1UA 3P9KA 1B6AA 4P96A 1SFUA 3MZYA 6PAXA 2FOKA 4AVPA 2ZKZA 1JHHA 3V7SA 2JTVA 1EH7A 3FMSA 1QO0D 1RI7A 1S7AA 5KVRA 1UHWA 1T39A 3HUGA 1NHAA 2VC0A 3COAC 1WQ2A 2M8EA 4Q4ZF 1IUYA 5HLIA 3ZPLA 2DW4A 2L3DA 2VXZA 2HFHA 4BAYA 1FY7A 5DCMB 3VODA 1SMTA 3HRSA 3RDIA 3E5QA 1Z6TA 2GIVA 2VOPA 3HRMA 2K4JA 5FO5A 2C6YA 1ZG3A 2PMUA 4IRGA 1ODDA 4L5JA 2KIFA 3FMRA 2E1NA 4HBLA 4IVNA 2XAJA 3T5XA 3JTGA 3ZMUA 3SZPA 1YW8A 3V8KA 3GO5A 3EYYA 1FYKA 1BI3A 3ULQB 5ICFA 3VFZA 3TO7A 3HHGA 1MDMB 1F1ZA 1TW2A 1XGNA 1QPMA 4MNUA 5BPDA 4Q5SF 3EQLF 3DP7A 2FBIA 1OKRA 1P2FA 3F23A 1KGSA 5D4RA 5D5XB 2Y0MA 3DPTA 2GXBA 1F9NA 1LDJA 1YO5C 2UXXA 5K5RA 3E6MA 2RKHA 3V8JA 1XSDA 4IRIA 2Z99A 3KZZA 3WODF 3FXRA 2F5FA 2H6CA 4DNCA 3LA3A 5LHGA 4YIFA 4OMZA 5CVVA 2P7VB 2PEXA 2XASA 1CF7A 2H94A 4GYIA 2DQLA 2IPQX 4UUVA 1O3RA 3GZ6A 2FMYA 4IRHA 1GHCA 4HX8A 2OQRA 3HYIA 2V79A 3BROA 1LEBA 3WG9A 2BGCA 3TO6A 3NQOA 1HSJA 4UV8A 4HX7A 3RYPA 2ZMEB 1R22A 2PQ8A 4A5MA 2K27A 2FEZA 2IA0A 4UVBA 1OYYA 1ZLJA 5DUKA 4IPAA 3RKXA
chains in the Genus database with same CATH superfamily
2LH9A 2KZVA 3EPKA 2VQGA 4M73A 5J1RA 1MJAA 2CUZA 3LOCA 1IN8A 3PIPF 1DDNA 3D0SA 2EJRA 2L7ZA 2QF7A 5DS9A 2WA0A 4YFNF 2HVRA 4B3TE 4QIWN 2H36X 1FZPB 2XKPA 2XF6A 3BC8A 3KLOA 3A01A 2O0YA 2QQBA 3QRFF 3KP4A 4M0VA 2X1DA 3BQYA 1X3WB 2K86A 3E7LA 2GA2A 3I64A 4KN4X 4XBFA 1X5WA 2OA4A 1KYWA 3J80C 2ZSHB 2WBUA 2K02A 3LSTA 2LK2A 2V1NA 2XUBA 2M4GA 1OFCX 2R7QA 4A3FJ 1IF1A 2M1BA 2RAEA 1D0ZA 3OIQA 4OMYA 3O8HA 2OTLI 1S7EA 4A3IJ 4HF2A 2DXIA 3AV0A 4ZDLA 4B09A 2CG4A 3QU6A 5IOYA 1U5TB 4DUYE 1VF9A 4RB0A 1RR8C 3J81Z 4YIRX 1FNNA 1YFHA 2N3HA 4UNOA 3QAHA 1DU0A 2JA2A 3W2AA 2PJPA 1RRJA 3PFIA 4KYWA 4Y33A 1DI2A 2GZWA 4FX0A 4I02A 1ZRFA 3J7Yp 2EORA 2F4IA 1AWCA 2EN6A 3QU3A 1X48A 5B66C 3HZJA 1VTNC 2QM3A 5F0FA 1IMUA 1RC7A 5DNYA 2ZMEC 1W0TA 3WHBA 4R2EA 5HLTA 2EMAA 3CZ6A 1WCMJ 3U2RA 1OMIA 3TBIA 4YFXF 5LEJA 1VQKI 1KZHA 2BHZA 2NVTJ 5EZGA 4PJ0C 4XNFA 3RQ4A 4PFPA 5E79C 2EPXA 5EEHA 3SXYA 2CQNA 1E2XA 3CMAI 4UB6C 2QQAA 1Z1DA 1IV6A 2H1KA 4NXNE 4GDFA 2N8GA 4G6DA 2QSGX 5T6JA 2E5ZA 3NARA 4Y13A 4MLOA 1BIAA 4ESFA 2BEOA 3TQNA 3R61A 4UHTA 2M3AA 4K2EA 1IQOA 1YHQI 2L9SA 3RCOA 5FRMA 4EM1A 2YPRA 4KICA 4DR1E 4LB6B 1GXPA 2R3SA 2RGVA 4X66E 2A05A 2DT6A 2IA2A 2EZKA 4HSTA 2EL5A 2DA6A 5LRRA 1WHNA 2Z9OA 2PMHA 1U0JA 3CCQI 1HDDC 2CQQA 1GTKA 2G7HA 3MKLA 1BB8A 5LHIA 2EQ0A 2FTXB 4DR2E 4A6DA 5CPRB 2JWOA 3R0AA 1REPC 2KONA 2IW5A 2DJNA 3KP6A 4MTDA 1JKOC 1FSEA 2W00A 3J7AY 2JA6J 2H1LA 3OR2C 4LFCE 2IJLA 1FIAA 4BXUA 4LF8E 1O7LA 2W24A 3QQAA 1QHGA 3NRVA 3MHSC 2JPCA 2WBTA 1XGMA 2E2JJ 4AWXB 4IHSA 4B1RA 4XONA 5DV5A 3J7ZI 2WB1N 3P1XA 2A3SA 4GKKE 1BW5A 3WTXC 1WI3A 1DP3A 2FA5A 1G3YA 1YRNA 4RLFA 4YY3E 3JREA 3FHZA 4O6JA 1MMNA 4Q35B 1FC3A 2DSYA 2V4JC 3IAS2 4D0PA 5J1YA 1YQAA 2I5UA 2O6GE 2X6XA 4Y4RA 1R58A 4CHUA 1F2IG 3KEOA 4B8XA 1X3ZB 1S9HA 1UZCA 5J8CA 2GXAA 4DV6E 2W25A 2DMUA 4BQNA 2P8TA 1HBXG 1ZARA 2KRFA 5D5VB 2V1XA 2VJ4A 5IT3A 1GVJA 1HLVA 4F9CB 4DR4E 2XROA 3BGHA 2CSHA 5FD6A 3AG4H 1DUXC 3W2WA 4BE1A 4GKJE 1TTYA 2R4GA 4ZTFA 1LKXA 2FD5A 1KQ0A 1ZG1A 1YIJI 2QBYA 5FRNA 2YU3A 3DQVC 4M3FA 1USTA 3BG9A 2EOMA 4MEXF 2EN2A 1P4AA 1QGPA 3K4MA 1W5TA 1OCTC 4S05A 3T8TA 4G6QA 2DTZA 2RTXA 3M1CA 1LDKB 5LL6R 2L2MA 2VBZA 3BPXA 2DOEA 3BG5A 1Q1HA 3A0HC 1XGSA 3DF8A 1KA8A 2LTPA 1T6SA 4QTRA 1YJWI 1ZYRF 2IXSA 2P0WA 3MZ8A 4E4HA 3L2VA 2VB6A 1Z05A 2W82A 4XN3A 1UHMA 3REOA 2EN1A 2XRLA 1NG6A 3DBHB 2IRFG 3BR6A 3J7AO 4O3MA 1HNWE 2J5PA 1OCPA 2HKOA 5A6BD 4BQQA 3C2GA 3P9IA 4Q48A 4AYBA 4F3QA 1Z3XA 2L9NA 3K4BA 4BXXJ 3EUAA 3HRTA 2L01A 2FMLA 3A1YA 2KRCA 3ZRGA 2RC4A 2ISYA 4G8XA 1LB2A 1B8IB 2YWQA 1AAYA 3DJWA 1BL0A 4RGRA 2DK5A 2VJ5A 1TP4A 2XKOA 3F6HA 3DPUA 3G2BA 2OJED 1V55H 2PJRB 5E17F 2ZNYA 3VWBA 1I6XA 1I27A 1UFMA 1FBQA 1IRGA 2F48A 1PDAA 2JA8J 5F0CA 2Y69H 4CZCA 5ED4A 1L0OC 3RI4A 1ZBQA 1Y8QB 1OCZH 2KIMA 2UV1A 2Y48A 3BR2A 3F8NA 3KE2A 2FF4A 4KIFA 1MBKA 4MLQA 1GVDA 5CYVA 4D7NA 4P5OA 1BI1A 2ENAA 2LYCA 1I94E 5F08A 1A1FA 5CJ9A 5HS9A 1WHQA 3A02A 2L7KA 1P92A 1FYMA 4A0ZA 5HODA 1OLTA 2MFZA 5E3LA 2FQ3A 4DZPA 1SFXA 3BG6A 3H1CA 2Z3YA 1S8NA 3OYDA 5FLXZ 4ASNA 4N0BA 3LAPA 3FIGA 2BBYA 1QZYA 4OIQF 3ZMZA 1J59A 3KIOA 3FK7A 2D1VA 5GPAA 2LC2A 4BHBA 3L2RA 3CO6C 3RSNA 4EGZA 2BW3B 5HDKA 5IP6A 1IRZA 4KDPA 2LO3A 3HDDA 1HKTA 3EUHC 2OAZA 5EYRA 1XMAA 1HKQA 2HYGD 2HPIA 2R0QC 2IHR1 4C30A 1A1JA 1SD7A 2D5VA 1AA7A 2DQRA 3CUQA 1HXDA 2ELJA 3QP5A 4BL0B 2E1MA 4EATA 4E7JA 1YYKA 4P78A 4RAFA 2HI3A 4HQMA 4BXFA 4CYDA 2CQKA 1MSEC 1A1IA 4J01A 3ZMVA 3JRDA 2Q2EA 4JX5A 5LHHA 3EQ1A 4XR6A 5FGMA 4ZTJA 3R4KA 4QWQA 1R1TA 1PKPA 1KQ8A 3A0BC 4GXOA 3IRRA 1MBJA 4L0ZB 2KIUA 5DYMA 4MQVA 3H9JA 3CMEI 2EL6A 2LBFB 3VYSB 3PNYA 3L7WA 3HJEA 3IUOA 3QPLA 1ZQ3P 3WTUC 5L3EA 1MNEA 2STWA 1HC8A 1H9TA 1MZBA 3VDXA 1B9NA 5IY5H 1O3TA 1APLC 2EV6A 1G3WA 1A1KA 1YYOA 2YTGA 1I1SA 2V83A 1SC7A 5KCMA 4LF7E 4CCOA 3KFWX 4EM2A 1YIOA 3FIWA 2EM6A 1RKTA 3T8RA 1P4WA 1NCSA 4ESBA 2JUCA 2YTQA 3DTEA 3LSKA 1H88C 4F54A 2K9MA 1G2FC 2YRKA 3GZ5A 4M3EA 2EK5A 3MAJA 2HXIA 5GP9A 4PJJA 3LAJA 1LNWA 2Y75A 4PGHA 3BF2A 1XDSA 5DDGA 1WJEA 2DN0A 4LLGF 2EPNA 3KEYA 3LA7A 1SR9A 1FP1D 3ZMSA 3VYXA 4RM2A 4LF6E 3ZQQA 3E97A 1MMDA 4ZYGA 2DO7A 4L5NC 2QQ9A 2R7DA 2X9DA 3CCYA 1UBDC 4C2MJ 2FOWA 3VSKA 1J5YA 4BGDA 3JRIA 1JXSA 2KIQA 5DTDA 2K9SA 2ZB9A 3HC7A 3T0YA 1CGPA 3HOYJ 1Y56A 2KLOA 4I0AA 3DKYA 1T2KA 2PMZN 5A69A 3O6BB 3KZIC 2B7TA 2FBHA 5C4XJ 3FXQA 3S2DJ 4L0YB 4F2JC 5LGNA 3GYHX 2BY0A 3F6GA 3TKYA 2VJJA 3CDIA 2CQ7A 4Q47A 3WHCA 1G2HA 1Z0XA 3H92A 1PUFB 3BCBA 4CXFA 4OAYA 1POGA 1R49A 1N3GA 1IN7A 2EOHA 3EPJA 4LFUA 1FBUA 1AH5A 2OZUA 4WK8F 3K6GA 1DQUA 3CP2A 3KCCA 2MC6A 1MBFA 5B1BH 3F6VA 4CH7A 4ZYEA 4XKVA 1HNZE 3BG7A 5A2QZ 3HGYA 1YTYA 3JTZA 3MMYB 2WC2A 3K2AA 3ASOH 3BJ6A 4LIUA 4RLQA 2W1OA 3KETA 4IHXA 4HF0A 2WWYA 2L2OA 1N25A 4V2GA 3IP4B 3WTTC 4G94A 1WVRA 4CZZA 2IP2A 4BEHB 1QU3A 2EILH 3G71I 1BJAA 1XMOE 3OS0A 1QZEA 2VJIA 4MO7A 4HEA2 5GAGJ 3WGIA 4DR3E 1MMSA 4A69C 2EFWA 2VLAA 5FB2A 4WFTA 5CKTA 3H3UA 4W97A 5A6BA 1ETQA 4GZNC 1JGSA 4Z2YA 2XAGA 2LREA 2LMZA 1B69A 3I4PA 3JSPA 2G7UA 1VQNI 4IQJA 4CA0A 3E0JB 3EETA 1WXRA 1RETA 4BJ6C 1MNMC 3RQIA 1BC8C 2UZKA 1Z9CA 4XLFA 2MYSA 2OC6A 3FM3A 1BBYA 1IV8A 2DA1A 4II2A 4ETSA 1KU2A 3L9FA 3JAMZ 4G7OF 1O0WA 2JMWA 5IYDJ 3ECRA 1LLMC 5BMZA 3I5UA 3K69A 5LEKA 1PJQA 5DD4A 3O2PE 4B43A 4HNUA 1IBLE 4NXME 2HS5A 3C2HA 2DA4A 2V6CA 1VQ7I 2BYVE 4LMYA 3MHHC 2AXLA 4EJOA 2GLIA 1W0UA 5KL6A 5IYCJ 4BJ5C 3V4GA 5ICEA 3BTLA 2V26A 1BJZA 2QCOA 2X48A 3GFJA 5E18F 4LJZF 5EEAA 3C1DA 2GHFA 2YU8A 2BOLA 3E5UA 4NBQA 3WGGA 4BCAA 4AC0A 4DOZA 5IWAE 4ZDOA 3JRCA 3CCLI 2E7XA 4BE0A 1WJ5A 2V9VA 2LP0A 2MG4A 4CICA 3OS2A 5KL4A 1T4LB 3OYCA 2VC1A 2GOXB 2PRTA 3R60A 2Z1DA 2VQLA 3B6CA 4IX7A 5LRSA 3DEEA 1A1HA 2LRDA 1IGNA 1WKMA 2LE2A 1YPNA 2YS9A 1J2XA 2O3FA 4HDUA 2EPKX 1YLFA 2KJCA 4CCKA 4LLNA 4JOMA 4IXAA 1LVAA 3PQJA 2Q1ZB 2F2EA 2Y30A 1ERDA 4A3EJ 2OUMA 1TT0A 2XAFA 4FX4A 2JA5J 4HDVA 2IGMA 1T56A 4ZZLA 1K83J 3OYJA 2MLKA 1R1VA 2A5YB 3A01B 1LFPA 4B3XA 3RJPA 4DBQA 3HPSA 4GRIA 1S3JA 2EA4A 3Q9VA 4N4RB 2GLOA 3K1NA 2E7WA 2M4IA 4PCQA 2ZJQF 1V54H 2P81A 1J5EE 2YTNA 3GEZA 4CCJA 1D3YA 5KL5A 1R9TJ 1P4XA 5ILVA 5D5UB 4DUZE 2EN7A 3ZN0A 3ZN1A 3K70C 2F4VE 1R5HA 4KIBA 4HX4A 2FSWA 2FRHA 3PO2J 2QGUA 1MD0A 4RS8A 2LY2A 3HEFA 3LSHA 4ABZA 3S3MA 2LVHA 5L3GA 3W6JB 1VQ6I 1NEIA 5IOZA 1MH4A 4BQAA 2K4VA 3K1PA 5M3FJ 2E72A 1R4NB 3R0JA 2VT3A 3DFGA 3K0LA 1YW9A 5FKKA 3WE3A 4X8WA 1ENHA 3MKYB 2VE8A 1H89C 2VQFE 1W7PD 3I59A 3RKWA 2JXPA 3IWCA 4HV5A 2H27A 1ETYA 3T1HE 1TT5B 3CUOA 3NEUA 4I01A 4IOCF 3AG3H 4LFAE 1DGWY 3PM1A 4BY1J 1QNTA 1WH5A 4XRFA 2A61A 2EMFA 4DGWB 3V7CA 2CRGA 3FMQA 2BE5F 4O43A 5EG0A 2CQXA 2FE3A 2PX9A 1RNLA 4U7DA 1YZ9A 4OWRB 2G0EA 3TP0A 5BR8E 4CYCA 2QWWA 4ON0A 1OPCA 1UCRA 2HQNA 1V5GA 2PG4A 1TLHB 2YX4A 1XDUA 2D1HA 3ABTA 5L3CA 3GFIA 3C6MA 5ICCA 2EE8A 1F5TA 3ADIA 2ME6A 2VIXA 4XLCA 3OMLA 4D1QA 1U78A 3OOPA 2BY3A 4JI3E 4O4KA 1FT9A 3VB2A 2R7WA 3TOAA 3DEWA 2P5LC 5CVRA 1QHHD 3BR0A 2XIGA 1NK2P 3BPVA 2ELHA 4U88A 3H3VK 1XD7A 5CVIA 5DCFA 3BZCA 2HOAA 4I7HA 3GTPJ 1L4SA 1JT0A 3F72A 3CJTB 3FXKA 3S3NA 4BH9A 1P7IA 1BR1A 1A6IA 1DPUA 1OJLA 5AONA 1D1AA 2O8KA 2LKPA 3CCSI 3F8CA 3BR5A 5F27A 2EMYA 4DV2E 2OU2A 3DU6A 1RPWA 2X1EA 3KP5A 4C2TA 4XMYA 2A6TA 4HYEA 2MSYA 2DMTA 3OYAA 4KFCA 2X85A 1LE8B 2DYRH 3G4SI 3B73A 1WRJA 2DFIA 1WGXA 3S2WA 3GTJJ 4LG0A 2EFOA 4E6KG 2VONA 1R7JA 1D1BA 2OCCH 3JCUC 1VQMI 1W5CC 4ZC3A 2V1DA 5F3WA 4M9XA 4BQOA 3ASNH 2CW0F 3V7RA 4KHPE 1X58A 3MVPA 2N3GA 1G3SA 1MIJA 1IUFA 3HKZN 4LK1F 5KHDA 5L3BA 1PUEE 5DCMA 3OYFA 2HZTA 2ZBKA 3W6VA 2ESHA 4X1EA 3OIOA 2Z33A 2J7JA 2JRTA 1K78A 2IGOA 4QPOA 4A5NA 4GYGA 2CV1A 3E1SA 4LG3A 5HS8A 2FBKA 3L2QA 3AG2H 4U0WA 4RHBB 3ADLA 2DODA 3DCFA 1I5ZA 1IZ1A 4HEIA 2NABA 3GUDA 2ME0A 1ONVA 3MQ0A 4LFBE 3IKTA 1SVLA 3CJQB 1VZ0A 2R7RA 2WBSA 3PNTA 4XICA 5AE3A 1OYWA 3WTYC 2MDGA 3HOSA 2CJJA 2M8GX 2LJHA 2DLKA 4F52A 2NOJB 4UUSB 2CUEA 3KYCB 2L33A 1TQPA 1TWAJ 4OIOF 3L00A 4ANJA 4O5VA 1J0RA 5JR3A 4NQWB 1N75A 1MNDA 1YYVA 2DLLA 3H5NA 3GXOA 4JBAA 2GPIA 3GZNB 3TEDA 2YX7A 2MH2A 3H0GJ 3N05A 3J7YJ 2LV2A 4PJMA 4XLHA 1HDPA 5CFFE 2HQRA 4G12A 4XRSG 3ZQIA 3JSOA 4WF2A 1ETWA 2X51A 3LSMA 1B72A 3THOB 3MD2A 5TSEA 3C18A 3D5LA 1LFBA 4IL6C 4RDUA 4I0BA 2B0LA 1J09A 4JK1X 4B4CA 2YU5A 2NVYJ 3GMEA 5F1RA 3ZXSA 1MDMA 1V4RA 3GWZA 4JX4A 3BP8A 3EUKL 3PUFA 3ZQ7A 4KITB 4X65E 5K7HA 2D9HA 4ENMA 3TGNA 3ESWB 4JI5E 2JY9A 2ADUA 1U9NA 2E2IJ 2ID3A 4IF4A 4B48A 2VBWA 1O7FA 3E6BA 4RB3C 1K79A 1IRXA 4R03A 4XRMA 5IPAA 1XS9A 5J40A 1VQ4I 2FNPA 1BBOA 1ZRCA 1SD6A 1FP2A 2MBFA 2EPRA 2L5QA 4F9BB 2EPPA 4TV7A 3HTSB 2KKOA 3SQNA 4JI8E 1X47A 2TRTA 3FX3A 3ZMDA 3QYEA 4PGGA 1X3CA 1GUUA 1DQ3A 1X2MA 2ZXJA 2MKDA 5E1XA 3L09A 1QQIA 4R2RA 1XCBA 3RPUD 4DV7E 2G9WA 4IZZA 1TBXA 3HTXA 3Q9SA 5ILUA 1ORKA 2A6HF 3DEUA 3M3YJ 1R36A 2LBSB 2B9DA 1W36D 4XK4A 3AUZA 4N9HA 2L92A 1E3PA 5HDGA 5B1AH 3M4OJ 3WU1B 2I9IA 4DBRA 1ETOA 1UAAA 2IS4A 2E5LE 2XRNA 2QKLB 3QOPA 1TNTA 4EGYA 3ADGA 2FXAA 2EM2A 3RPQA 3ZP5A 3TOBA 1MH3A 3GVAA 2EM3A 2RQLA 2JJ7A 1FKAE 1X4PA 2EMZA 2NXNB 3VPRA 4JI2E 1XMXA 4L9JA 2K9NA 4R2SA 3QODA 4B44A 3L2WA 1GV5A 3C7JA 1B4AA 3M1EA 2YZTA 1W7PA 4F91B 3ZQLA 4WXDA 4XOTA 1KU9A 2QEXI 2HVSA 3CUQB 1YW7A 3HRUA 2VE9A 1JTXA 2E1MB 1GV2A 2DMQA 4DJAA 2HKXA 3VHTB 2DAOA 2DFHA 3F3XA 3WG7H 2JP9A 2LSOA 2WB1A 3LNQA 5AIQA 5EGOA 4IHYA 1FBSA 5K5OA 2Q2EB 3W2VA 1RIOH 1DGCA 2KHMA 2L6MA 4CCNA 2DMPA 5FKMA 2UXBE 3ZQHA 4BKXA 2R7XA 2QVOA 4EM0B 3AKZA 2L4AA 1JKQC 2EMGA 1U2WA 4OIPF 2WV1A 2ZJRF 2B9SA 2BV6A 2P6SA 3GFMA 4A93J 1I3AA 4I8OA 2ZFWA 4LLLA 1JE8A 3OYIA 4X6AJ 4FASD 4MLVA 4IJDA 4M74A 4F93B 4B3RE 3E5XA 3EDPA 1QA6A 5D6EA 2EZIA 2R92J 4NC8A 2L8TA 2M4KA 1A31A 2XPUA 2BXZA 3OIPA 2P6TA 4I2OA 3OYKA 2WTEA 1Y6IA 3Q0VA 2LMDA 2NNNA 3OOUA 4NZVA 4A3LJ 4JQFA 1FTZA 1NTCA 3HPHA 3ISPA 3FKIJ 2IS1A 1X3UA 1YS7A 2AQEA 2DMNA 1X1PA 2NS0A 3H0DA 1U5TA 4XORA 3H5RA 4RGUA 3J81K 4E70A 4YFKF 2I13A 3ERED 2KJBA 2O61A 5AIPA 2WAEA 2CTDA 4IHTA 1EA3A 3B02A 4DZJA 4JI7E 1XMQE 1IDYA 1ON2A 2CV0A 3M9AA 3BWGA 1JT6A 3HQ1A 2RQQA 3F21A 3DKWA 3ML6A 1Z67A 5IYBJ 4HW0A 2X1CA 2UXCE 1R4MB 4D5FA 1BM9A 2YRHA 1T4OA 3CUQC 2NNYA 4RAGA 4AVZA 1N34E 2COBA 2DTRA 1EH8A 2E1MC 3P9CA 3HSEA 2P5KA 2FU4A 3EPLA 2QUFA 1E3HA 4HZFA 4L9NA 3OV8A 2D45A 1D8JA 4EMSA 2XGEA 1IDZA 4ZJZA 4A0XA 2BVLA 3LMLA 4II3A 2NAZA 3M8JA 4C3IJ 2JWTA 2P7CB 4V19K 4BC9A 2HDDA 2DK8A 4KA4A 2JPBA 3LL7A 3UR3C 3HOUJ 1USSA 3SEQA 3UNGC 1G59A 4F7ZA 2E1CA 4A3BJ 1PJSA 1T8IA 2ID6A 1FWZA 3VSLA 5DEQA 2PFBA 5E1ZB 1HW2A 1QPIA 1RUOA 2W85A 3OL3A 2KZGA 2RDPA 3BJAA 4MHGA 2ETHA 1IXSB 1P47A 1JKPC 2EP3A 3FXUA 1ZHFA 2HQAA 2RSIA 2OTJI 1H9GA 2IS2A 3LSJA 2DIXA 2EOJA 4AIHA 1ULYA 4OIRF 2Z16A 2NUEA 2LKXA 4X0GA 3CCUI 4HG2A 3VYYA 2QSFX 5LBQA 1K4TA 1OCRH 3IWDA 3OYBA 2JVHA 3IV5A 1OISA 1K4SA 2KQRA 2LR8A 2R5ZB 1UILA 3M99B 4M2ZA 3ZOBA 3CD6I 2DT7B 1LVKA 5EDNA 2BZTA 2ZCWA 5EJCA 2DJIA 2XB0X 1IN4A 4I99C 3HXLA 2OD5A 1DPRA 3C2BA 2QLZA 1N32E 3FXLA 1HSTA 3RTRA 3D5SC 4A3DJ 2EMWA 3Q3SA 3UK3C 2Y2ZA 4P9UA 4RAYA 1YUJA 1MBEA 3HUGB 3QPHA 2K5CA 1BOAA 4RBOA 2HOTA 1YYWA 1KYZA 1ZU1A 5IXMB 2CGPA 1V5EA 2VT2A 1KJKA 3PO3J 4BNCA 4Y7NJ 1MKMA 3CLQA 1N78A 2GOMA 3QOEA 4DV1E 3FM5A 3WGHA 4R2AA 1U8RA 1T0FC 2KFDA 2RNJA 3KP2A 1Y1VJ 2HWVA 2UU9E 2EQ1A 1UELB 3S93A 2M5WA 1W5SA 1TL8A 1QVTA 2V6EA 2YR2A 3S16J 3LSGA 2ODRD 2HGCA 1PDNC 5LGUA 4JI6E 4YG2F 3I0TA 5J47A 3HB9A 5EEGA 4IHWA 3RPUA 3G6EI 2VN2A 3U1KA 1G4DA 2BBGA 4A3GJ 3KWRA 4FQGA 2E1OA 5E3MA 2GWRA 2XPWA 1ZREA 2ELYA 3GLLA 2DA3A 5F64A 1S6LA 1YG2A 3SZTA 1EH6A 1A35A 5JHUA 4DV4E 2GAUA 2IEKA 5AE1A 3HOXJ 3L1PA 3BIDA 3F6OA 3TO9A 4DR5E 3LFKA 4UY8I 4I76A 3I54A 5B5EC 3OSGA 5IT9Z 4F6NA 1ZH5A 2YSPA 2CO5A 1STUA 1XSXA 1UG0A 3BLYA 4OU0A 2YSRA 3ROUA 1VQ9I 2LUPB 2NUGA 2QQ8A 3MSWA 2M45A 3U21A 4I98B 4E7SA 2R7FA 5AC5A 4MGRA 2VODA 2JSCA 4JX6A 2LDUA 4FISA 1T0FA 1BI2A 1X49A 2I10A 3F8MA 2CV2A 2XDVA 3CC7I 1PP7U 1IRFA 2K85A 1JGGA 1S5LC 3U1DA 1WHUA 1P7JA 3L2CA 4ESJA 4HV6A 4IJAA 4BE2A 3CC2I 1WSUA 2BHYA 5JVTA 1MMAA 3RKQA 2M2EA 4C2UA 4IOAF 2XAUA 2NRAC 1GDTA 3HBLA 3CJNA 2LG4A 2EM0A 2PMZA 4BBYA 2VRDA 1WJCA 2EIMH 2W84A 3QYFA 3Q0WA 3I53A 2UWMA 1U6GA 2XSJC 1U3EM 2PJRA 1P9QC 1G6NA 5KL2A 2FNAA 2KPMA 1RMDA 3K4JA 3JRGA 3BY6A 3S17J 1IXRC 1I39A 1AKHA 3FF5A 3SFIA 1G3TA 3M07A 4M6YA 2WCC3 3ZR8X 4A3MJ 5GAHJ 3MKZA 4ENJA 4RAZA 1XNQE 3AFHA 3GX4X 2KMUA 3ELKA 5EG0B 1MW7A 4QLCU 3IWFA 3KP7A 1V5FA 4XLEA 4A3JJ 2MKNA 4WWCA 2WY7Q 4WSPA 1Y39A 2MD0A 5E3OA 1T38A 1X1AA 1SAXA 2CMPA 4UB8C 3P5JA 3RZOJ 1XSVA 4OOGC 4YHHE 4DYQA 3H35A 1E0EA 2D2WA 4DQ2A 3A2KA 1NG7A 1BI0A 1ZGJA 1I6HJ 3JW4A 1IW7F 4ZYAA 3ABMH 5FLXK 2M7AA 2MC4A 4XOPA 5H6RA 1X4OA 3KEQA 1ZG5A 1U8BA 1CF7B 4NC6A 1TC3C 2EQRA 1VI0A 3K2ZA 4B3ME 3S15J 1FJGE 5DM6F 1N36E 2FGGA 4BY7J 3QPTA 4U87A 2BW3A 5BQTA 5D6FA 5FJ8J 3K6QA 1SFKA 2ESNA 2WADA 1ZR9A 3T1YE 3IHUA 4XRSA 1FJLA 1BBGA 2RREA 2WAQN 4N4NB 3WTZA 2F4OB 5J4VA 2UUCE 3M7GA 1ON1A 1S72I 2X4HA 2X6WA 2V8QB 2EOZA 4GCVA 4XM3A 4J00A 2LF7A 4LGWA 3TW6A 3HOVJ 1LUJB 1Z7UA 5HOOA 4IEJA 4FETA 4W1UA 2B7EA 2NYXA 2VI6A 3GW2A 3FXJA 2JT1A 1ETKA 2Z2SB 3K4CA 4LD5A 1BIBA 2JVAA 3S2HJ 4NHJA 5JLWA 2L0KA 2X0LA 3LQRA 4HAMA 2IGNA 4LG0B 2LF8A 4XSZF 5L3DA 5A2QC 1SFEA 4AIDA 2VF1A 4B47A 4XLNF 2BY1A 1JHFA 4AUXA 4AIKA 3WU0A 3I56I 2H8WA 2GXGA 5E3NA 4BU2A 4DV0E 2DPDA 2F5DA 3FWEA 4L5IA 5H2FC 4N9IA 2R7ZJ 1KONA 1YE9A 2L2KB 2ADRA 1VQPI 5HVQC 2LLKA 3HGGA 1FTTA 1K78B 1TNSA 2LY1A 4WCGA 2EFQA 1X2NA 4HA8A 3JRFA 2AS5F 1HQCA 5DD8A 4BDZA 3A4CA 2R5YA 2F8BA 5JHFA 4U0YA 1YI2I 1ZAAC 1R00A 3QWLA 2NVXJ 4BHCA 1KQ9A 3E3VA 4L9VA 1SD5A 2V89A 4S04A 2YPNA 1TW3A 3DLLF 1XTAA 2DMYA 3TDZC 2JVGA 3DKXA 4A0YA 2YT4A 3BZKA 2CH0A 3I58A 4DW6A 3JAMC 4FT8A 4DR6E 4PZJA 5FLVA 5IT9K 3IWBA 2QA4I 2XPVA 4Y3OA 3S8PA 2YTDA 3BBGA 3E6CC 2EOEA 5K1YA 1O57A 5CQGA 2Q8KA 4V2FA 1K7AA 1WJPA 1BC7C 3HSRA 4XN0A 2X6YA 1QVUA 3R6SA 3RZDJ 3BOQA 1R71A 3FK6A 5M5XJ 3G3ZA 3AG1H 3HL2A 3HOWJ 4A6EA 4AM3A 1EF4A 2AXTC 3WTWC 4AIJA 2EOIA 1RKWA 3PSFA 5C3EJ 3C3WA 2LNBA 2CUJA 1T95A 2YU9J 2XHKA 1B72B 1ZR2A 2XVCA 5BS6A 3F0CA 1YJNI 2CPNA 1ZN2A 1LQ1A 3MCZA 1F4KA 1IN5A 1D5YA 2EB7A 2QSHX 4BS9A 2M7BA 2H8RA 2VL8A 2HQ5A 2LKSA 2NS7A 3SEZA 2DBBA 3IH2A 4G9YA 3THNA 2M34A 3MEXA 4BBSJ 4JP0A 2EOQA 1PUFA 5HDNA 5E8GA 1JJ6C 1IN6A 3KYLA 3ZQGA 4DR7E 2EPFA 2STTA 3GBGA 4WXCA 4JYAE 3ABKH 4U7BA 2IT0A 2DPUA 4KWYA 3VYTB 3A03A 2LCEA 2CS3A 1K61A 2B7VA 4FCYA 2ELKA 1LJ9A 3PUBA 3WE2A 1XX5A 1ACIA 4J8ZA 2KDOA 3TQMA 4JI0E 3OWTA 5A2QK 5A6JA 5TJJA 3JRAA 5A6AA 1A36A 5HLGA 2YTEA 1ITYA 2DDAA 2EIJH 3V8LA 5LFAA 5LD2C 2V85A 5JI6A 1PVEA 3BCAA 1ETXA 4BJTA 2EWLA 3ECOA 1QZZA 4X64E 2PLYA 4WXHA 2VASA 2E36A 3KZYA 4PJLA 4BEHA 3IL2A 3VYRB 2MD5A 1YX3A 5C4JJ 2AHQA 4S0HB 3DXJF 2LVSA 1BR2A 1JUSA 2EPMX 3BG3A 3ABUA 3G1MA 1XCVA 3LWFA 1GXQA 4M9SA 5FKNA 5TISC 1XG1A 4KMUX 4J19A 1GT0C 1VQ5I 3JTHA 1OR7A 2BVMA 1B1BA 2TCTA 2DCEA 3GLXA 4K0KE 4DMIA 5M5YJ 1W4MA 3J80Z 1SANA 2OZ6A 4C3HJ 3K9TA 4LITA 5F04A 4JI1E 5DM7F 3QPSA 2R1FA 3BTCA 3AAFA 1IC8A 2QKMB 4AU7A 5GPCA 3JAMK 1MBHA 2NUFA 2EOYA 4HF1A 2V9PA 3AL0B 1R1UA 1W7PB 1VQOI 2L3JA 4E7KA 3HHHA 1FLIA 1YRNB 1HNXE 2EV0A 2RV8A 4UVCA 3WU2C 2QENA 4M6VA 1CQTA 1UB9A 3GFLA 4KIGA 5JLXA 2XGXA 3IAM2 1FMVA 1A6QA 3IRQA 3K4NA 4CGZA 2JYAA 2M1SA 3CCJI 2ZJPF 2EM9A 2LOOA 5EGOB 1SD4A 2Z5UA 3BJOA 5EF6A 3S32A 2MW8A 2VPLA 2LJUA 1F36A 1TWCJ 5AC4A 3GTOJ 1RQ0A 2CW8A 3H3ZA 1FOYA 2M0MA 1ZBTA 1FIPA 3ADJA 4M6XA 1PYVA 4JYKA 1WZ2A 3OTOE 4YRVA 1U9OA 4R2DA 3HKZA 1WJAA 1IAWA 4BMJA 2M30A 1R6RA 5J3LA 2LFBA 5KK1A 5J8FA 1IG7A 1YSAC 3F8BA 1XC5A 2DYSH 3FZVA 2ENHA 2E34A 2DGCA 4XKBA 2QBYB 3I55I 5AASA 3P7NA 1RUNA 2EIKH 4EQQA 5FD5A 3S3OA 2EPOA 1OCCH 5E20A 3JRHA 5HNHA 2FX0A 1ZRDA 2JOBA 4IQ4A 2L9RA 4D7MA 3CC4I 5FFXA 5CQEA 3MKWB 2OPTA 1Y8RB 2NS8A 1UN6B 1DGRM 3BQZA 3LMMA 2CSOA 2VQHA 4UVAA 5E8IA 4HRIA 3KPHA 2EQ3A 2HC5A 3F8FA 4ENNA 3FDYA 5H20A 1BW6A 3PFYA 3DPLC 2W57A 1GQEA 2EL4A 1K6OA 4N4OB 2GA1A 5KNLA 1WFXA 1YX5A 5GTIC 4YEJA 4MEYF 2HYFA 1PJRA 1IBKE 2A5WA 5EZHA 2LRSA 2UXDE 4TUGA 4G7HF 2ENCA 2K9QA 5HNFA 2RS6A 1I50J 3CDLA 1T08B 2VPRA 4PJNA 4R79A 3D5RC 1LFUP 2IBDA 3ZCOA 4F6MA 4A3CJ 3K1MA 3AL0C 2LTRA 3G73A 2H09A 4M3GA 3H9QA 1Z77A 2EFPA 3BDDA 3QP6A 4MIMA 3DV8A 2XSDC 1TWHJ 2JR1A 2KOUA 4RB1A 4EEFG 4KT6A 3RIRA 5D8LB 3TMOA 3LQQA 1T4NA 2UUZA 1ZAOA 1FYLA 2EM5A 1HR0E 5FKOA 5L3FA 3HPZA 1TZLA 4RB2C 1JK2A 3I4NJ 3I71A 1FOKA 1XPXA 1HW5A 2CFXA 2M9HA 1SVOA 2NA2A 2A68F 3GTKJ 3IC7A 2WBMA 2VBYA 3ZMTA 1J7KA 3PQKA 1N33E 2WZOA 4LF9E 1AU7A 1H0MA 3OR1C 5ICGA 3RKYA 2J5OA 2L7FP 1X1CA 2EZLA 4QPQA 2CU7A 1D5VA 3FBNB 2EOOA 4PDKA 3J81C 4CDGA 3MFKA 3CESA 2XAQA 1O3QA 4F92B 2E2HJ 2EMHA 3BTJA 5M3MJ 2YTFA 3Q5FA 2EMBA 2K7LA 3NWSA 1D8KA 3I3LA 1RZ4A 4PK4A 4UV9A 1AOYA 2O7OA 5LLQA 3RYRA 2GM4A 4LB5A 1PJTA 2VBXA 2V88A 4M72A 1JKRC 5F1JA 5CVUA 1Z6RA 4HOBA 1PP8F 4ENKA 4U0VA 2LUQA 4JV5E 2MH9A 2MC3A 4ZZDA 5HLHA 2FJ1A 2HEOA 5K7ZA 2HTJA 1C0WA 2L54A 4PUSA 4P55A 3IWZA 2KISA 1XB4A 2A6EF 4MQ9F 4PSXA 5FFZA 4ZYHA 5GTHC 3CCMI 4HTGA 4A2UA 2WV0A 1X19A 2HOSA 1U5TC 1FMWA 3V42A 3J80K 2HHHE 3SJMA 2HNHA 2VKEA 3H5AA 2MC5A 4RGXA 5D4SA 2F5EA 3K7AJ 5D5WB 4XLPF 1G8XA 4X9JA 1UHSA 2ZMEA 1LE8A 4H0EA 4LF5E 1RR7A 2MA3A 4KN7X 3TW7A 2ZXIA 2Y9ZA 4X62E 3VEPA 1A04A 3E6DA 3T1BA 1UMQA 4ZH4F 5BPIA 2MGQA 2JA7J 1R23A 4D5CA 2DOFA 2CW7A 2JRMA 2NOGA 2CFOA 4XLAA 4Y52J 2EOSA 2UUBE 3X2QH 2TDXA 3I9V2 2Q8UA 1ZGAA 1JTYA 1JK1A 2A07F 1D0YA 1YS6A 2O8XA 4R8HA 1X6FA 4IS1C 4BHPA 2JOXA 3F9KA 2M9AA 1LDDA 2NVQJ 1STZA 3WTVC 3OS1A 4XQFA 1ZGWA 2R7OA 1J75A 2F6CA 2Y0SN 4L18B 2EMCA 3KP3A 3Q0UA 2L3CA 3MWMA 4OOIA 1B9MA 1Q1VA 1XGOA 3OYNA 1KU7A 2IA1A 2XB5A 3C4BA 1VFCA 2M7QA 3K10A 1VQ8I 1ZK8A 2KT0A 4DIQA 5IP9J 2Y0SA 4UUSA 4L9TA 1Z91A 1KU3A 5CLSA 1ZLKA 2VKHA 1WPKA 3K4KA 4KMFA 2RNGA 4NQWA 2W4SA 1T98A 3FBIB 4BYYA 2K3FA 3CO7C 4AYBN 3NAUA 4LK0F 1VQLI 3CMYA 2EMIA 4O24A 3HIFA 4HNTA 4FE4A 4HQEA 2YTOA 3N97A 2PI0A 2VOOA 2R7VA 3HTUA 2N8XA 3CCEI 4E7LA 2EM4A 3K4LA 2YSOA 4M30A 3GCMA 1RC9A 2IS6A 4CO8A 2JK3A 3ZQFA 1DU6A 4KUMA 1FSHA 2PN6A 2KL4A 2UXNA 4LTYA 4DYCA 3EPHA 1MGTA 2H6BA 3OYEA 3BR1A 3FHNA 4EJVA 5TGTA 4UXNA 1UG2A 1SFOJ 1SVMA 3B6AA 4L5EA 3KX2A 1NK3P 4RH8A 4F55A 5ILSA 2FQ4A 1RESA 3OY9A 1JI8A 2HVQA 2OV7A 2MABA 1WWXA 5BOXA 1FOXA 2VE7C 2GBYA 3H36A 1AKHB 4KT5C 4FK5C 4I09A 2XAHA 4ZDPA 3LSRA 3CF5F 1MMGA 2E19A 4BACA 2K9LA 4FHTA 1S29A 2GIZA 3BZ6A 1Z3YA 3IH4A 2EPLX 3GTMJ 2K4BA 4GGGA 3D1NI 3UKGA 2A69F 2OQGA 2VXDA 1X1DA 3FKJA 2XC7A 2O9LA 5ADZA 3ZQCA 3CJRB 1W36C 1LEAA 2GQQA 2DRPA 4B3AA 4EVIA 3VOEA 3G1OA 2ZXHA 4YELA 5JFRA 1ETVA 3W3CA 5FLMJ 1J9IA 3LA2A 2P5VA 4HLXA 4A12A 1MSFC 3GTLJ 3N4MA 1XMKA 3ONQA 3M8FA 3DLAA 1QRYA 4NDLA 5LGTA 4KISA 2HDCA 1YUIA 3S1QJ 2LTSA 1BR4A 1V3FA 1JUPA 1Z7LA 4BDYA 2DI3A 2Q0OA 5TRDA 2EFNA 3DBLB 4LIVA 3SDBA 1X1BA 2ZNZA 2RSMA 3JU0A 2ZJ2A 2QZ8A 1S7OA 4DKKA 4DV3E 2YUSA 4DV5E 2CT1A 2RN7A 2ZSIB 1HCRA 1TQMA 2B3TB 2MLGA 4RGSA 1UJ8A 3CLOA 3FXOA 3HSFA 5H6QA 1SAUA 2I8DA 3OL4A 2DMIA 3MZHA 1DP7P 2CWEA 2RS7A 1BN5A 1B59A 4Y15A 2ICWG 3SYTA 2EOFA 3M8EA 4PSWA 3TDUC 5J4YA 2AQFA 5IP7J 3ECHA 3VK6A 3FISA 2L02A 2LY9A 2VKDA 4KZSA 4YIIA 1EV7A 4DYRA 3O3KA 2K3PA 2L9VA 2HOEA 2EOXA 2DT5A 2EZHA 4CSWA 3F22A 1HW1A 5HS7A 2EM7A 5FLXC 2HZDA 4NHRA 4C9YA 3CTAA 4E7HA 4AD9A 1A5JA 4P7DA 1Y0UA 4AQYE 4P9FA 1MJBA 1IBME 2O03A 4EJUA 1IO2A 4XSXF 4GO1A 3HOTA 2ECBA 3EYIA 1QBJA 5A6KA 2JQ7A 5B3SH 2ZO4A 2LD5A 2DOAA 2HJJA 2CYYA 4HSRA 1HF0A 3U9GA 1OQYA 4FTHA 1L3LA 4A3KJ 3DTKA 1E17A 4R1HA 2HTSA 2DU9A 4LF4E 3W6KB 3ZOQB 1OCOH 4Y17A 2VQEE 3CF2A 3LFUA 2CUFA 4ITVA 2COMA 2R5YB 4IKFA 1M1EB 2R7TA 3SHFA 1TQIA 2VKVA 4WX9A 3EUHA 4P1WA 3SZGA 4EJWA 3ABLH 1R5GA 2MDRA 2ACJA 3KLNA 5ERIA 5DUIA 5LMNE 2E71A 2DB2A 4HLYA 3G1LA 1KYQA 4M71A 3OYHA 2DA2A 3CDHA 1FPQA 1HKSA 2B63J 4M3BA 2RVCA 1O3SA 4M9VC 5F6FA 2QYOA 4RM3A 1TN9A 2IGKA 5J6XA 3CMMA 2DA7A 3K70D 2O5RA 3SFZA 2RQPA 1B8IA 2EA2A 1YOVB 2BXYA 2F5CA 5LMUE 3EPZA 2M87A 2Y9YA 4XIDA 4KNYA 1IXCA 5K5QA 3BR3A 1K6YA 4CCLA 2XF7A 5C44J 2EMKA 1I1GA 3GF2A 2HR3A 1WI9A 4G7ZF 2EPUA 4MTEA 2WY8Q 2E5NA 1D1CA 3I59B 4M9ZA 2XV4S 4I6ZA 2EINH 4OINF 1MJ9A 1OYIA 2EWNA 1W1WE 2M0CA 2EV5A 4EV0A 1TF6A 1D0XA 4D9JA 4OX9E 3DU5A 3ERMA 3HM5A 5D8KB 5JVGF 1XN7A 4NB5A 1Z21A 1P6RA 4BC7A 2ISZA 2EH3A 2F5VA 2DLQA 2OCEA 2PBIA 4CYCB 4MFDA 1ZELA 5IT9C 1YITI 1SMYF 2JZYA 5KAIC 5BNGA 4EJTA 2YTPA 2IVMA 2OBPA 2W7NA 4E7ZA 2YRMA 3GTGJ 2P4WA 5CVJA 4ZYDA 2L4MA 2R76A 3O8GA 4XKCA 1FX7A 3LSPA 3IKVA 4HPQA 3PJRA 3WTSC 5E1WA 4B3SE 4H4KC 2V1UA 2ZM6E 3P9KA 3CCVI 3JRBA 1B6AA 4TUIA 4PFOA 3DWLE 4XL9A 2R5ZA 5M5WJ 4P96A 4M3DA 1SFUA 4Q28A 2WAFA 3MZYA 3KYDB 6PAXA 2FOKA 4AVPA 2EN8A 4WPYA 2ZKZA 1JHHA 2XGCA 2JTVA 3V7SA 3MN2A 3QYBA 1EH7A 2JSPA 2V9KA 3LLHA 2FUG2 3LSIA 3FMSA 2NVUB 1QO0D 2RPCA 2DFFA 2L7MP 1RI7A 1S7AA 5KVRA 3NWTA 4R2PA 4CCMA 4BBRJ 1FOWA 1UHWA 5KL7A 3PIOF 2WAQA 1ZR4A 1T39A 3HUGA 3S1NJ 2UUAE 1NHAA 2VC0A 4GFBA 1TF3A 3COAC 4E7IA 1JJ8C 4IO9F 2K7IA 1WJFA 5IV8B 1EKZA 1J26A 1WQ2A 3CP8A 1R5ID 2EZ6A 2M8EA 3PSIA 3ZGKA 4Q4ZF 1IUYA 3C6KA 5HLIA 4JI4E 2HDWA 2XF5A 1AHDP 3ZPLA 2DW4A 4G6TB 2EM8A 1X6EA 2LBFA 2ODRC 2L3DA 2VXZA 2HFHA 3SDGA 1X6HA 4BAYA 1FY7A 2KHXA 2VUMJ 3GTQJ 5DCMB 3VODA 2L2NA 2HU9A 1FEXA 1SMTA 3QG5C 5J1UA 1Z1BA 3H09A 1WJBA 3HRSA 3RDIA 3E5QA 2EPCA 1Z6TA 2GIVA 2VOPA 5AE2A 3HRMA 2K4JA 5FO5A 2EN4A 2C6YA 2DA5A 1F43A 2DDBA 1ZG3A 2EBIA 2PMUA 4IRGA 3CQZJ 4KJZA 2R93J 1ODDA 1HA8A 1HOMA 5F0HA 4O5GA 4FE7A 4L5JA 3TL4X 4WYQB 2KIFA 3BTIA 3FMRA 2Y31A 4NNJA 1I3QJ 4R2CA 5FROA 2E1NA 2JUGA 1GLNA 1IQSA 4HBLA 1Y0NA 4IVNA 2VQCA 1LPQA 2A25A 2HYJA 1T33A 2ZXWH 2XAJA 4CUGA 3T5XA 3JTGA 4IHVA 5FKLA 2HGHA 3S1RJ 1VNDA 3J7AG 2KRHA 1A1GA 2EPAA 2ZFUA 1UHZA 3ZMUA 5GADJ 3SZPA 3C4TA 1MBGA 2V7FA 1YW8A 2LT7A 4L8NA 3V8KA 3GO5A 1A1LA 2ECCA 3EYYA 2F4MB 2IAIA 1OR7C 4GEQB 1FYKA 1BI3A 2V87A 3BT9A 3ULQB 2EMLA 2HPMA 3PL8A 3DBRB 5ICFA 3VFZA 3H9GA 3TO7A 1Y1WJ 3HHGA 1SEUA 1MDMB 2OF7A 1F1ZA 2FV4B 4R8OA 1TW2A 1XGNA 2E35A 3VYUB 3DTIA 1QPMA 4MNUA 5BPDA 4Q5SF 1G2DC 4BUPA 3OYGA 2ELZA 2DFEA 3RMPA 3OYLA 1WJDA 4RMNA 1TWFJ 2JN6A 5GAEJ 3EQLF 3DP7A 1TWGJ 2KDZA 2FBIA 1QU6A 4RA2A 2V86A 1BOBA 1OKRA 1P2FA 1O4XA 1KGSA 5D4RA 3F23A 5D5XB 2Y0MA 3DPTA 2GXBA 1F9NA 4C3JJ 2EPZA 1EJ9A 1LDJA 2EN3A 1YO5C 3PNVA 2UXXA 2W48A 3HG9A 5K5RA 2HXOA 2E60A 3E6MA 2RKHA 3V8JA 1XSDA 4IRIA 3JR9A 2EJ4A 4Z6YA 2Z99A 5KAFC 4R2QA 4NUBA 2EMXA 2BY2A 9ANTA 2X6OA 1BA5A 3KZZA 1IJWC 3WODF 3FXRA 1MEYC 2F5FA 2H6CA 4XKWA 1GZ6A 3HPGA 1ZTRA 4DNCA 3LA3A 5LHGA 1JUMA 3OMYA 4OMZA 4YIFA 5CVVA 2P7VB 4HNVA 2R7UA 2PEXA 3OYMA 2XASA 3FXMA 1CF7A 2H94A 2R7SA 1N77A 3I4MJ 4GYIA 2ZC2A 1ZKGA 2DQLA 3CCRI 2IPQX 4UUVA 5K7FA 1O3RA 3DF6A 1YJ9I 4F9AB 3GZ6A 1H8AC 2FMYA 4IRHA 1GHCA 1WH7A 4QSHA 4HX8A 4MFEA 2OQRA 3HYIA 3S14J 2V79A 3BROA 1LEBA 3WG9A 2JPAA 2YTJA 5KL3A 2BGCA 3TO6A 1NH3A 2K40A 3NQOA 1HSJA 4UV8A 2KP6A 4OAZA 3OSFA 1XNRE 2AO9A 4HX7A 3RYPA 3HOZJ 2ZMEB 4UUTA 1R22A 2PQ8A 4A5MA 3IH3A 4LU9A 2K27A 2YTIA 4NC7A 2XGDA 2FEZA 2IA0A 4UVBA 1OYYA 1ZLJA 2BB8A 4LOCA 5DUKA 4IPAA 3S1MJ 3TP3A 1E3OC 1EKEA 4WSGA 3RKXA 3L2UA
chains in the Genus database with same CATH topology
4M73A 1MJAA 1DDNA 1IN8A 3D0SA 2EJRA 4YFNF 1FZPB 2XKPA 3KLOA 2O0YA 2QQBA 3QRFF 3KP4A 2K86A 2GA2A 3I64A 4KN4X 4XBFA 2OA4A 1KYWA 2K02A 3LSTA 2XUBA 1IF1A 2M1BA 4OMYA 4HF2A 4B09A 2CG4A 3QU6A 1U5TB 4RB0A 3J81Z 1FNNA 1YFHA 4UNOA 3QAHA 2PJPA 3PFIA 4KYWA 2GZWA 4FX0A 4I02A 1ZRFA 1AWCA 3QU3A 1VTNC 2QM3A 3U2RA 1OMIA 4YFXF 5LEJA 5EEHA 3SXYA 1E2XA 2QQAA 1Z1DA 4G6DA 4Y13A 4ESFA 1BIAA 2BEOA 3TQNA 3R61A 4UHTA 4K2EA 4EM1A 2YPRA 4KICA 4LB6B 1GXPA 2R3SA 2RGVA 2IA2A 5LRRA 2Z9OA 2PMHA 2G7HA 5LHIA 4A6DA 3R0AA 1REPC 2IW5A 3KP6A 4MTDA 1FSEA 2IJLA 4BXUA 1O7LA 2W24A 3NRVA 2JPCA 1XGMA 4AWXB 4IHSA 5DV5A 2A3SA 3WTXC 2FA5A 1G3YA 3FHZA 4O6JA 1FC3A 4D0PA 1YQAA 2O6GE 1R58A 4CHUA 3KEOA 4B8XA 5J8CA 2W25A 2P8TA 1HBXG 1ZARA 2KRFA 5D5VB 2V1XA 5IT3A 1GVJA 2XROA 5FD6A 1DUXC 1TTYA 1KQ0A 1ZG1A 2QBYA 2YU3A 3DQVC 1USTA 4MEXF 1P4AA 1QGPA 1W5TA 4S05A 3T8TA 4G6QA 1LDKB 2VBZA 3BPXA 3DF8A 1Q1HA 1XGSA 1KA8A 1T6SA 1ZYRF 1Z05A 3REOA 1UHMA 2IRFG 3J7AO 4O3MA 2J5PA 2HKOA 3P9IA 4Q48A 3HRTA 2L01A 2FMLA 2RC4A 2ISYA 4G8XA 1LB2A 4RGRA 2DK5A 2XKOA 5E17F 2ZNYA 1I6XA 1I27A 1UFMA 1FBQA 1IRGA 5ED4A 1L0OC 3RI4A 2KIMA 2Y48A 3F8NA 3KE2A 2FF4A 4KIFA 5CYVA 4P5OA 1BI1A 5CJ9A 5HS9A 1P92A 1FYMA 4A0ZA 2FQ3A 1SFXA 2Z3YA 1S8NA 5FLXZ 4ASNA 4N0BA 3LAPA 2BBYA 1QZYA 4OIQF 3ZMZA 1J59A 2D1VA 4BHBA 3CO6C 4EGZA 5HDKA 4KDPA 1HKTA 2OAZA 1XMAA 1HKQA 2HYGD 1SD7A 2DQRA 3CUQA 1HXDA 3QP5A 4HQMA 4CYDA 2CQKA 3ZMVA 2Q2EA 5LHHA 5FGMA 3R4KA 4QWQA 1R1TA 1KQ8A 4GXOA 3IRRA 4L0ZB 2KIUA 5DYMA 4MQVA 3L7WA 3WTUC 5L3EA 2STWA 1H9TA 1MZBA 1O3TA 1B9NA 2EV6A 1G3WA 1I1SA 3KFWX 4EM2A 1YIOA 3T8RA 1P4WA 4ESBA 3GZ5A 2EK5A 3MAJA 3LAJA 1LNWA 2Y75A 4PGHA 1XDSA 5DDGA 4LLGF 3LA7A 1FP1D 3ZMSA 3E97A 4ZYGA 2DO7A 2QQ9A 2R7DA 1J5YA 1JXSA 3T0YA 1CGPA 4I0AA 1T2KA 3O6BB 2FBHA 3FXQA 4L0YB 5LGNA 3GYHX 3TKYA 4Q47A 3H92A 4CXFA 1IN7A 4LFUA 1FBUA 2OZUA 4WK8F 3KCCA 3F6VA 4ZYEA 5A2QZ 1YTYA 2WC2A 3BJ6A 3KETA 4HF0A 2WWYA 3WTTC 4G94A 4CZZA 2IP2A 1BJAA 3WGIA 2EFWA 5FB2A 3H3UA 1JGSA 4Z2YA 2XAGA 3I4PA 3JSPA 2G7UA 3EETA 1BC8C 2UZKA 1Z9CA 3FM3A 1BBYA 3JAMZ 1KU2A 3L9FA 4ETSA 4G7OF 5BMZA 3I5UA 3K69A 5LEKA 5DD4A 3O2PE 2HS5A 2V6CA 2BYVE 4LMYA 2AXLA 4EJOA 3V4GA 5ICEA 5E18F 3GFJA 4LJZF 3C1DA 3E5UA 3WGGA 2E7XA 2V9VA 4CICA 2VC1A 3R60A 5LRSA 1WKMA 1J2XA 2O3FA 4HDUA 1YLFA 2KJCA 4LLNA 4IXAA 1LVAA 3PQJA 2F2EA 4FX4A 2XAFA 4HDVA 4ZZLA 2MLKA 1R1VA 2A5YB 3RJPA 1S3JA 2EA4A 3Q9VA 3K1NA 2E7WA 4PCQA 3GEZA 1D3YA 1P4XA 5ILVA 5D5UB 3ZN0A 3ZN1A 1R5HA 4KIBA 4HX4A 2FSWA 2FRHA 1MD0A 4RS8A 5L3GA 3W6JB 4BQAA 3K1PA 3R0JA 2VT3A 3DFGA 3K0LA 1YW9A 3WE3A 2VE8A 1W7PD 3I59A 3RKWA 4HV5A 2H27A 3CUOA 3NEUA 4I01A 1QNTA 4XRFA 2A61A 3V7CA 3FMQA 2BE5F 2FE3A 1RNLA 4U7DA 2QWWA 4ON0A 1OPCA 1UCRA 2HQNA 2PG4A 1TLHB 2YX4A 5L3CA 1XDUA 2D1HA 3ABTA 3GFIA 5ICCA 1F5TA 1U78A 3OOPA 1FT9A 3VB2A 3TOAA 2P5LC 5CVRA 2XIGA 3BPVA 2ELHA 4U88A 1XD7A 5CVIA 5DCFA 4I7HA 3F72A 4BH9A 1DPUA 5AONA 2LKPA 3F8CA 2OU2A 3KP5A 4HYEA 4KFCA 3B73A 1WRJA 2DFIA 3S2WA 4LG0A 2EFOA 2VONA 1R7JA 2V1DA 4M9XA 2CW0F 3V7RA 1G3SA 4LK1F 5L3BA 1PUEE 5DCMA 2HZTA 2ZBKA 2ESHA 2Z33A 2JRTA 1K78A 4A5NA 4GYGA 5HS8A 2FBKA 4U0WA 1I5ZA 1IZ1A 3GUDA 1ONVA 3MQ0A 3IKTA 1OYWA 3WTYC 3HOSA 1TQPA 4OIOF 3L00A 4O5VA 1J0RA 5JR3A 1YYVA 2DLLA 4JBAA 3GXOA 2YX7A 2MH2A 2HQRA 3JSOA 4WF2A 3C18A 3D5LA 4I0BA 2B0LA 4JK1X 1MDMA 5F1RA 1V4RA 3GWZA 3BP8A 3ZQ7A 4ENMA 3TGNA 2ADUA 4IF4A 2VBWA 1O7FA 3E6BA 4RB3C 1K79A 2FNPA 1ZRCA 1SD6A 1FP2A 2MBFA 4TV7A 3HTSB 2KKOA 3SQNA 3ZMDA 3FX3A 4PGGA 2ZXJA 5E1XA 3L09A 1QQIA 1XCBA 2G9WA 1TBXA 3Q9SA 5ILUA 2A6HF 3DEUA 1R36A 4N9HA 5HDGA 3WU1B 2XRNA 3QOPA 1TNTA 4EGYA 2FXAA 3RPQA 3ZP5A 3TOBA 3GVAA 4L9JA 3M1EA 3C7JA 1B4AA 1W7PA 4WXDA 1KU9A 3CUQB 1YW7A 3HRUA 2VE9A 2HKXA 2DAOA 3F3XA 2LSOA 5AIQA 1FBSA 5K5OA 1RIOH 2QVOA 4EM0B 2L4AA 1U2WA 4OIPF 2BV6A 2P6SA 3GFMA 2ZFWA 4LLLA 1JE8A 4M74A 3E5XA 3EDPA 5D6EA 2P6TA 4I2OA 2WTEA 2NNNA 4JQFA 3ISPA 1X3UA 1YS7A 2NS0A 1U5TA 4RGUA 3J81K 4E70A 4YFKF 3ERED 2KJBA 2O61A 5AIPA 4IHTA 3B02A 1ON2A 3M9AA 3BWGA 3F21A 3DKWA 3ML6A 4HW0A 1BM9A 3CUQC 2NNYA 2DTRA 1EH8A 3P9CA 3HSEA 2P5KA 2FU4A 2QUFA 4HZFA 4L9NA 3OV8A 2D45A 1D8JA 4EMSA 4A0XA 2P7CB 2NAZA 2DK8A 4KA4A 2JPBA 1USSA 4F7ZA 2E1CA 1FWZA 5DEQA 2PFBA 5E1ZB 1HW2A 1RUOA 2W85A 2RDPA 3BJAA 4MHGA 2ETHA 1IXSB 3FXUA 1ZHFA 1H9GA 4AIHA 1ULYA 4OIRF 5LBQA 2ZCWA 1IN4A 2OD5A 1DPRA 2QLZA 1HSTA 3RTRA 4P9UA 4RAYA 3QPHA 1BOAA 1KYZA 2CGPA 2VT2A 4BNCA 1MKMA 3FM5A 3WGHA 1U8RA 2RNJA 3KP2A 2HWVA 2M5WA 1W5SA 2YR2A 2HGCA 1PDNC 5LGUA 4YG2F 3I0TA 5EEGA 3RPUA 2VN2A 1G4DA 2GWRA 1ZREA 5F64A 1S6LA 1YG2A 3SZTA 1EH6A 5JHUA 2GAUA 3F6OA 3TO9A 3LFKA 3I54A 5IT9Z 1ZH5A 2CO5A 1XSXA 4OU0A 3ROUA 2YSRA 2M45A 4I98B 2R7FA 4MGRA 2VODA 2JSCA 2LDUA 1T0FA 1BI2A 3F8MA 1PP7U 1IRFA 3U1DA 3L2CA 4ESJA 4HV6A 4IJAA 1WSUA 5JVTA 2NRAC 3CJNA 2W84A 3I53A 2UWMA 1U6GA 1U3EM 1G6NA 2FNAA 3BY6A 1IXRC 3FF5A 1G3TA 4M6YA 4ENJA 4RAZA 3GX4X 3ELKA 4QLCU 3IWFA 3KP7A 4WWCA 1T38A 1SAXA 1XSVA 2D2WA 4DQ2A 1BI0A 1ZGJA 3JW4A 1IW7F 5FLXK 5H6RA 3KEQA 1ZG5A 1CF7B 3K2ZA 3QPTA 5BQTA 5D6FA 2ESNA 3IHUA 3WTZA 3M7GA 1ON1A 2X4HA 4GCVA 2LF7A 4LGWA 1Z7UA 5HOOA 2NYXA 3GW2A 2JT1A 4LD5A 1BIBA 4NHJA 2X0LA 3LQRA 4HAMA 4LG0B 2LF8A 4XSZF 5L3DA 1SFEA 4XLNF 1JHFA 4AIKA 3WU0A 2GXGA 2DPDA 2F5DA 3FWEA 4L5IA 4N9IA 5HVQC 1K78B 1TNSA 4WCGA 2AS5F 2EFQA 4HA8A 1HQCA 5DD8A 4U0YA 1R00A 4BHCA 1KQ9A 3E3VA 4L9VA 1SD5A 4S04A 1TW3A 3TDZC 4A0YA 3I58A 4FT8A 4PZJA 5IT9K 3E6CC 5K1YA 1O57A 2Q8KA 1K7AA 1BC7C 3HSRA 3R6SA 3BOQA 3G3ZA 4A6EA 3WTWC 4AIJA 3C3WA 2LNBA 2XHKA 2XVCA 5BS6A 1ZN2A 1LQ1A 3MCZA 1F4KA 1IN5A 2EB7A 2DBBA 4G9YA 3MEXA 5HDNA 5E8GA 1IN6A 2STTA 4WXCA 4U7BA 2IT0A 2DPUA 1LJ9A 3WE2A 5A2QK 5TJJA 5HLGA 3V8LA 5JI6A 3ECOA 1QZZA 2PLYA 4WXHA 3KZYA 3IL2A 2MD5A 3DXJF 3ABUA 1XCVA 3LWFA 1GXQA 4M9SA 4KMUX 3JTHA 1OR7A 1B1BA 3GLXA 1W4MA 3J80Z 2OZ6A 3K9TA 3AAFA 3JAMK 4HF1A 1R1UA 1W7PB 3HHHA 1FLIA 2EV0A 2RV8A 4UVCA 2QENA 1UB9A 3GFLA 4KIGA 2XGXA 3IRQA 4CGZA 1SD4A 2Z5UA 3BJOA 3H3ZA 4M6XA 1IAWA 2M30A 5KK1A 5J8FA 3F8BA 3FZVA 2QBYB 3P7NA 1RUNA 4EQQA 5FD5A 5E20A 1ZRDA 5FFXA 2CSOA 4UVAA 5E8IA 3F8FA 4ENNA 5H20A 3DPLC 2W57A 1K6OA 2GA1A 4MEYF 2HYFA 4G7HF 4R79A 3K1MA 3G73A 2H09A 2EFPA 3BDDA 3QP6A 3DV8A 4RB1A 3RIRA 5D8LB 3LQQA 1ZAOA 1FYLA 5L3FA 4RB2C 3I71A 1FOKA 1HW5A 2CFXA 2A68F 3IC7A 2VBYA 3ZMTA 1J7KA 3PQKA 1H0MA 5ICGA 3RKYA 2J5OA 1D5VA 4PDKA 4CDGA 3MFKA 2XAQA 1O3QA 3Q5FA 2K7LA 1D8KA 4UV9A 1RZ4A 1AOYA 5LLQA 3RYRA 4LB5A 2VBXA 4M72A 5CVUA 1Z6RA 4HOBA 1PP8F 4ENKA 4U0VA 2MH9A 2MC3A 4ZZDA 5HLHA 2HEOA 2HTJA 1C0WA 2L54A 4P55A 3IWZA 4MQ9F 1XB4A 2A6EF 5FFZA 4ZYHA 4A2UA 2WV0A 1U5TC 3J80K 4RGXA 5D4SA 2F5EA 5D5WB 4XLPF 2ZMEA 4H0EA 2MA3A 4KN7X 3VEPA 1A04A 3E6DA 3T1BA 4ZH4F 5BPIA 1R23A 2TDXA 1ZGAA 2A07F 1YS6A 2O8XA 4R8HA 4BHPA 1LDDA 1STZA 3WTVC 1J75A 4L18B 3KP3A 3MWMA 4OOIA 1B9MA 1XGOA 1KU7A 2IA1A 4L9TA 1Z91A 1KU3A 5CLSA 1ZLKA 4KMFA 4NQWA 1T98A 4BYYA 3CO7C 4LK0F 3HIFA 4HQEA 3N97A 2PI0A 2VOOA 3HTUA 4CO8A 4KUMA 1FSHA 2PN6A 2UXNA 1MGTA 2H6BA 4EJVA 4UXNA 5ILSA 1WWXA 5BOXA 4KT5C 4I09A 2XAHA 4FHTA 1S29A 3BZ6A 2K4BA 4GGGA 2A69F 2OQGA 1LEAA 2GQQA 4EVIA 3VOEA 5JFRA 1J9IA 3LA2A 2P5VA 4HLXA 4A12A 3N4MA 1XMKA 3M8FA 5LGTA 2HDCA 1V3FA 2DI3A 2Q0OA 5TRDA 2EFNA 2ZNZA 2ZJ2A 2QZ8A 1S7OA 2RN7A 1TQMA 2MLGA 4RGSA 3CLOA 3HSFA 5H6QA 3MZHA 1DP7P 2CWEA 1BN5A 1B59A 4Y15A 3M8EA 3TDUC 3ECHA 2L02A 4YIIA 1EV7A 3O3KA 2HOEA 2DT5A 3F22A 1HW1A 5HS7A 3CTAA 4AD9A 1Y0UA 4P9FA 1MJBA 2O03A 4EJUA 4XSXF 4GO1A 3HOTA 3EYIA 1QBJA 2ZO4A 2CYYA 3U9GA 1L3LA 1E17A 4R1HA 2HTSA 2DU9A 3W6KB 4Y17A 2COMA 3SHFA 1TQIA 4WX9A 3EUHA 4EJWA 1R5GA 2ACJA 3KLNA 5ERIA 5DUIA 4HLYA 4M71A 3CDHA 1FPQA 1HKSA 2RVCA 1O3SA 5F6FA 2QYOA 5J6XA 3SFZA 2RQPA 2EA2A 2F5CA 2M87A 4KNYA 1IXCA 5K5QA 1I1GA 3GF2A 2HR3A 1WI9A 4G7ZF 4MTEA 3I59B 4M9ZA 2XV4S 4OINF 1MJ9A 1OYIA 2EWNA 2EV5A 4EV0A 5D8KB 1XN7A 4NB5A 1P6RA 2ISZA 2PBIA 4EJTA 1SMYF 2JZYA 2IVMA 2OBPA 2P4WA 5CVJA 4ZYDA 2L4MA 1FX7A 3IKVA 3WTSC 5E1WA 2V1UA 3P9KA 1B6AA 4P96A 1SFUA 3MZYA 6PAXA 2FOKA 4AVPA 2ZKZA 1JHHA 3V7SA 2JTVA 1EH7A 3FMSA 1QO0D 1RI7A 1S7AA 5KVRA 1UHWA 1T39A 3HUGA 1NHAA 2VC0A 3COAC 1WQ2A 2M8EA 4Q4ZF 1IUYA 5HLIA 3ZPLA 2DW4A 2L3DA 2VXZA 2HFHA 4BAYA 1FY7A 5DCMB 3VODA 1SMTA 3HRSA 3RDIA 3E5QA 1Z6TA 2GIVA 2VOPA 3HRMA 2K4JA 5FO5A 2C6YA 1ZG3A 2PMUA 4IRGA 1ODDA 4L5JA 2KIFA 3FMRA 2E1NA 4HBLA 4IVNA 2XAJA 3T5XA 3JTGA 3ZMUA 3SZPA 1YW8A 3V8KA 3GO5A 3EYYA 1FYKA 1BI3A 3ULQB 5ICFA 3VFZA 3TO7A 3HHGA 1MDMB 1F1ZA 1TW2A 1XGNA 1QPMA 4MNUA 5BPDA 4Q5SF 3EQLF 3DP7A 2FBIA 1OKRA 1P2FA 3F23A 1KGSA 5D4RA 5D5XB 2Y0MA 3DPTA 2GXBA 1F9NA 1LDJA 1YO5C 2UXXA 5K5RA 3E6MA 2RKHA 3V8JA 1XSDA 4IRIA 2Z99A 3KZZA 3WODF 3FXRA 2F5FA 2H6CA 4DNCA 3LA3A 5LHGA