1EH8A

Benzylated human o6-alkylguanine-dna alkyltransferase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
175
structure length
165
Chain Sequence
CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O6-ALKYLGUANINE-DNA ALKYLTRANSFERASE
publication title Active and alkylated human AGT structures: a novel zinc site, inhibitor and extrahelical base binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 40
structure length 165
sequence length 175
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2000-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1eh8A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1eh8A01
4GGGA 5HLIA 2YR2A 4QLCU 1IRFA 4G6DA 4LK0F 2XRNA 4RB1A 3QU3A 3HHHA 3U2RA 5JI6A 2KJCA 5CVVA 2Z5UA 2K4JA 4UNOA 4KA4A 1S8NA 1ZYRF 2PFBA 3I5UA 2HQNA 2QYOA 1HKQA 2COMA 2HGCA 4XSZF 3VOEA 1Z1DA 3HYIA 1R22A 3FHZA 2DT5A 3HTSB 1G3TA 1BI0A 1ZREA 1D8KA 2VBZA 1KQ0A 4OMYA 1K79A 3M7GA 3RKXA 5E8IA 1BOAA 3E5QA 2RGVA 1C0WA 3I53A 1YQAA 3WGIA 2UXNA 1L0OC 1CF7A 2DU9A 3RJPA 1U78A 3V8KA 1R36A 2HR3A 3F22A 4LB6B 4ZYDA 4YIIA 2HYFA 2UZKA 3BROA 1ZG3A 2QLZA 1BM9A 2F5CA 4IPAA 3P7NA 1O3TA 5D4SA 3VODA 3KEOA 3DF8A 1IN7A 3GF2A 2VT3A 4UV9A 2P8TA 1ZARA 2P6SA 1OYWA 3CTAA 4OOIA 1S3JA 4HAMA 1XSXA 1I27A 1IXRC 1MDMA 5HS8A 4LK1F 1PDNC 1QZZA 1O7FA 1RUNA 3RDIA 2BBYA 4ESBA 5H6QA 1EH6A 1HKSA 5AIPA 2OZUA 1S7AA 2ZKZA 3FMQA 2ETHA 3R0JA 4GCVA 3RKWA 4JK1X 2LKPA 3MCZA 2DQRA 1FBQA 1XCBA 4LLNA 4LLGF 5L3FA 2V79A 4WF2A 4KNYA 2EV5A 3GFJA 4A0ZA 3I59B 1SD5A 4I01A 2FMLA 3ELKA 2E7XA 1OPCA 5DCMB 2RN7A 1OKRA 3Q9SA 2FNAA 5K5RA 1YIOA 3RTRA 3WU1B 3FXQA 3R0AA 1B59A 1KU3A 2GXBA 4EV0A 2VE8A 5F64A 4M6XA 3C18A 3KETA 4AIKA 3GFLA 2W24A 3GW2A 4KUMA 5F1RA 1LDKB 3KZYA 1RIOH 4YIFA 3NQOA 3LA3A 4EVIA 4I02A 1RUOA 1XN7A 1J0RA 2YSRA 5LEKA 1YW7A 2KIUA 2HEOA 1KQ8A 4M6YA 3N4MA 2NNNA 4DNCA 4WK8F 2IA0A 4Q5SF 3CO7C 1SFUA 1DPUA 2BGCA 3WE2A 3EETA 4UHTA 2GA1A 3WTYC 2V9VA 3IC7A 1EH8A 1IW7F 4U7DA 3LWFA 1BI2A 4BHBA 4M9ZA 4MEYF 2P7CB 4IF4A 4H0EA 5K1YA 1QNTA 2BEOA 4HX7A 2FE3A 1UCRA 4BXUA 1XGOA 1USSA 4KMFA 4ZZDA 2RC4A 2JPCA 5BPDA 3JSPA 3VFZA 2XROA 4ENKA 3F21A 3CUQC 5LBQA 2KRFA 4RGRA 1SFXA 2ESNA 1ZRFA 1CGPA 5DDGA 2H6BA 1J59A 2XVCA 2E7WA 4XRFA 1WI9A 2ZO4A 1QGPA 2VN2A 1A04A 2K7LA 2BYVE 5D5UB 4Q48A 2FSWA 1Z6TA 4RB3C 2ZNYA 3ZPLA 2PBIA 2JTVA 1ON2A 1B6AA 1U6GA 2A6EF 2XV4S 3LAPA 3E6MA 3FXRA 2PLYA 1F4KA 4PGHA 2IA2A 2EWNA 1E17A 3K9TA 1PP7U 2Z33A 3Q9VA 3F6OA 3GWZA 3L00A 4QWQA 5H20A 2XAJA 1XSDA 3KP4A 3CO6C 3BPXA 2JPBA 4EQQA 2ELHA 2VBYA 4NB5A 3KP5A 2O6GE 1X3UA 2JT1A 4ENJA 4N0BA 4A12A 1Z91A 1IN4A 3GLXA 4CO8A 4IHSA 1LB2A 3RPUA 2PJPA 2DQLA 2K4BA 4BQAA 5D5XB 1P4AA 2MH9A 3L09A 5ILSA 1TTYA 1YO5C 3JAMK 4WXHA 4A6DA 2VONA 4O5VA 3DKWA 2DTRA 2FOKA 1UHWA 2M87A 3HHGA 2XKPA 2IRFG 1MKMA 3HRMA 1S6LA 2MH2A 4CHUA 3P9IA 3U1DA 3GUDA 3COAC 4P5OA 5J6XA 1J75A 3LFKA 2YX7A 2GAUA 2O61A 1TW2A 3DXJF 3ERED 5EEHA 3F3XA 2XKOA 1FY7A 4KN7X 2FQ3A 1SD6A 3FMRA 4G7ZF 4ESFA 5DYMA 1USTA 2MLGA 4AWXB 1FOKA 3TQNA 1YS6A 1STZA 1ZRCA 4O3MA 1TNTA 2C6YA 3CUOA 5HLGA 2FNPA 1J2XA 1W7PB 5LLQA 2O03A 3EUHA 2CQKA 1ZGAA 1XGMA 3TDZC 2D45A 2J5OA 3GFIA 4YFKF 1SD7A 3I64A 1LDDA 3FF5A 2K27A 4HW0A 2M1BA 4UVAA 2JSCA 1W5SA 3JAMZ 1UHMA 2EFWA 4EJVA 2LF7A 1I6XA 1TLHB 2XUBA 3VEPA 1R5GA 1F1ZA 1ZAOA 3TOAA 3R61A 3RKYA 5BMZA 2OU2A 4ZYHA 1OYYA 1JHFA 2UXXA 1O3RA 3IKTA 3K2ZA 2A07F 1T2KA 5DD4A 3GXOA 4LD5A 4I2OA 5KK1A 5CLSA 3E3VA 3W6JB 4CYDA 1B9MA 2PN6A 2VT2A 3R60A 1O3SA 1ON1A 5FO5A 3CJNA 4KIFA 5KVRA 2W84A 4KYWA 5DUIA 1TQIA 4IJAA 4Y17A 2L4AA 1BC7C 4S04A 3TDUC 1SMYF 3R4KA 3GZ6A 3T8TA 4L5JA 1K78B 3FWEA 3IHUA 3WODF 1QPMA 4ZZLA 2DK5A 5J8FA 1WSUA 1O3QA 4P96A 1XGNA 2Y48A 4U0YA 1HW1A 3LSTA 3M8EA 2CWEA 3V4GA 1V3FA 3QAHA 4PDKA 3HRSA 2ZBKA 1VTNC 5FFXA 4EGZA 4EJOA 3KLOA 2RKHA 1FBUA 4L9TA 4XBFA 3JW4A 4M73A 4MEXF 1B9NA 4BNCA 3DEUA 4LG0B 2A6HF 2VODA 4A0YA 5L3BA 2IVMA 2P5LC 3EQLF 2E1CA 2GIVA 2DO7A 3F8BA 3QPHA 4IRHA 1R23A 1QZYA 1G4DA 4BHCA 5K5OA 2K86A 4IXAA 3TO7A 5A2QK 1BI3A 5ILUA 3NRVA 1KU7A 2G9WA 1K7AA 3GYHX 4L18B 1H9GA 2HYGD 1B1BA 2NS0A 5LHIA 4ENNA 1WRJA 1S7OA 2EV0A 2QENA 3ZN1A 3E6BA 2OZ6A 3DPLC 1O57A 3WU0A 1FPQA 2R3SA 1D3YA 3KLNA 4KT5C 4ASNA 5HVQC 3PFIA 4IRGA 1G6NA 5JVTA 3GO5A 1HBXG 1BIBA 2VBWA 2D1VA 4PCQA 1OYIA 1FC3A 3DV8A 2DPUA 4L9NA 4G8XA 1T39A 2VBXA 1WQ2A 2JRTA 1IN6A 3KP6A 4GO1A 4OINF 2NRAC 3M1EA 2WV0A 3D0SA 4LLLA 3BDDA 3C1DA 3O6BB 1R58A 3SHFA 3IKVA 3KP2A 2OAZA 3K1NA 4ZYEA 4O6JA 1S29A 2RDPA 1YLFA 2W85A 5A2QZ 2NAZA 2DPDA 4WXCA 3J81K 2P5VA 1JGSA 2R7DA 3HRTA 1AOYA 2PQ8A 1JXSA 1SMTA 5LRRA 5E18F 2WTEA 2EV6A 3P9KA 1O7LA 1MD0A 4XSXF 4EJTA 4RAZA 3OV8A 2P4WA 3MAJA 1K78A 3TKYA 3H92A 4EJWA 1FSEA 4XLPF 2X4HA 5L3CA 3WTVC 4A5NA 5LGNA 1FX7A 3DQVC 4AVPA 2ADUA 3F6VA 4HQEA 4G7HF 4IVNA 4EM2A 4TV7A 1KYWA 1J5YA 5FD6A 1DP7P 1L3LA 2ZXJA 3IL2A 2XGXA 2VC0A 2ZFWA 3ZMDA 4HZFA 5H6RA 2FEZA 4Y13A 4CDGA 2E1NA 5HDKA 1XDSA 3E5XA 3KEQA 4EM1A 3FMSA 4B8XA 3J81Z 1R1VA 2OQRA 2FBHA 2Q8KA 3F8CA 2ISZA 5HLHA 1GXPA 5CVJA 4OU0A 2J5PA 2FU4A 3GX4X 1KGSA 4U0WA 1ULYA 2MC3A 1J7KA 3LQRA 5DCFA 5EEGA 2CYYA 3WGHA 2L02A 2RQPA 2W57A 1JHHA 3ZN0A 4BHPA 2KIFA 3QU6A 2ZJ2A 2P7VB 1T6SA 3QRFF 4G94A 1GVJA 3EYIA 2EB7A 3KFWX 2ZCWA 1XMAA 5ICCA 3M9AA 5JR3A 2QVOA 1I5ZA 4HX4A 4MQVA 1H0MA 3HIFA 4Q4ZF 2L01A 3ZQ7A 4EJUA 5LGTA 3H3ZA 1YG2A 2IT0A 1ZLJA 2ZMEB 3BY6A 5D5VB 3DFGA 3DPTA 1IAWA 2IW5A 4F7ZA 3BWGA 1YFHA 5E17F 4CICA 2HWVA 4EMSA 2H09A 4YFXF 5HOOA 2R7FA 5TJJA 3I59A 3T0YA 5D5WB 3KP7A 2M30A 2X0LA 1FYKA 3SZPA 1R7JA 4N9HA 5D6EA 4B09A 4GYGA 4ZYGA 2VXZA 4GXOA 5DCMA 2JZYA 3IRQA 2XAGA 2A5YB 2GWRA 4HX8A 2M45A 2FBKA 3H3UA 1KU9A 3V8LA 4M72A 4UUVA 3CUQB 1G3SA 2FBIA 1Y0UA 1PP8F 4P55A 2DK8A 1PUEE 3BJ6A 3FM3A 4AD9A 3TOBA 2OBPA 2OD5A 3G73A 4HLYA 2F2EA 3MEXA 3L2CA 3RIRA 3JTGA 2QUFA 1BBYA 3B02A 4A6EA 3OOPA 4KMUX 2RV8A 3LA2A 3W6KB 2QZ8A 3ABUA 2MLKA 2LDUA 1ZH5A 3WGGA 4ESJA 1IZ1A 1LDJA 5BQTA 3ZMZA 3WTZA 3L9FA 4L9JA 1ZGJA 3ULQB 2ACJA 5ICEA 2DI3A 5BOXA 4OIQF 2Z9OA 4DQ2A 3WTSC 2H27A 2F5DA 3JTHA 2A61A 1R1UA 3K0LA 2XHKA 4ETSA 2UWMA 4E70A 1U2WA 3J80K 2FMYA 3V7RA 5ED4A 3HOTA 3V7SA 5AIQA 1KQ9A 3WTWC 2A69F 5LHGA 2FA5A 4N9IA 1U3EM 1G3YA 3F8FA 1Z9CA 2BV6A 5LGUA 2FF4A 3KE2A 5CJ9A 5ICGA 1MDMB 3L7WA 3LA7A 2QM3A 1P2FA 2OA4A 5AONA 4HV5A 3QP5A 4S05A 1ZN2A 4FHTA 3ZMVA 1GHCA 5L3EA 2ZMEA 5ICFA 2ZNZA 3K1PA 2PG4A 3HSEA 3KZZA 4U7BA 4M9SA 4PZJA 1HKTA 1MJ9A 2HKXA 1QQIA 2AS5F 3T5XA 1IXSB 3ZMUA 4HF2A 3QPTA 2VC1A 3WTTC 5CYVA 5LRSA 1XSVA 3WE3A 3C3WA 2RVCA 3ZP5A 3D5LA 1W7PD 3I71A 1BC8C 4HBLA 3LQQA 5JFRA 5FGMA 4A5MA 4YFNF 1MGTA 3J80Z 4YG2F 4EGYA 3ISPA 3GEZA 1MZBA 3JSOA 3N97A 2Z99A 1UB9A 2P5KA 4JBAA 1FNNA 3IWZA 1FWZA 4D0PA 4IRIA 4HV6A 3VB2A 1LNWA 1XD7A 4MTDA 2VOPA 1YTYA 1MJBA 3CDHA 1HSTA 4Q47A 4ENMA 1FT9A 3BOQA 4NHJA 2VE9A 4AIJA 5L3GA 3WG9A 3FM5A 2L54A 1U5TB 1LEBA 2EFPA 4IHTA 3E6DA 5DUKA 4L0ZB 4FX0A 5DD8A 2L4MA 1REPC 1HW2A 1HSJA 3MZYA 1TNSA 5D6FA 1G3WA 1GXQA 1F5TA 2YPRA 3RYPA 1W5TA 1FP1D 3HUGA 2IJLA 2H94A 1WWXA 5D8LB 3QP6A 4LMYA 3TGNA 1W7PA 3CLOA 5CVRA 2KKOA 2B0LA 3FXUA 2QQAA 1P92A 2Q2EA 3C7JA 2D1HA 2CFXA 2TDXA 1E2XA 3GVAA 4NQWA 4G7OF 1FLIA 1BIAA 5BS6A 4RGXA 4I0AA 4LGWA 3SZTA 3MQ0A 5D8KB 2NNYA 1JE8A 1Z05A 5HDGA 1B4AA 1D5VA 1QO0D 3B73A 4RB2C 3ML6A 2AXLA 3I4PA 2CG4A 4Z2YA 5L3DA 1FZPB 2CGPA 5E1WA 2QQBA 2XAQA 2YX4A 3I0TA 5IT9K 1OR7A 2P6TA 3FX3A 5E8GA 3CUQA 1I1GA 1SAXA 5FLXK 1IUYA 4I98B 4G9YA 1T0FA 1YYVA 6PAXA 2FRHA 4M74A 3T8RA 4I09A 2CO5A 1Z7UA 3LAJA 2EA2A 1D8JA 5K5QA 4RB0A 3RPQA 3K1MA 4AIHA 4FT8A 2LF8A 4MGRA 2PI0A 2ISYA 2Z3YA 4K2EA 2EFOA 1YS7A 4XLNF 1IN5A 4MHGA 2G7HA 4LJZF 2GXGA 1HQCA 1Q1HA 2RNJA 4CGZA 1HXDA 2Y0MA 1XB4A 2G7UA 3SXYA 1R5HA 1IRGA 5J8CA 2EFQA 1V4RA 2YU3A 2STTA 5LHHA 3S2WA 1SFEA 3WTUC 3IRRA 4U88A 3G3ZA 2DW4A 3M8FA 5F6FA 1Z6RA 3FZVA 2O3FA 2LNBA 3PQJA 4RGUA 4HYEA 5CVIA 1HW5A 4I7HA 5IT9Z 2KJBA 4LG0A 4HDVA 4HOBA 2HDCA 4CZZA 3QOPA 1KU2A 1U5TA 1KA8A 2NYXA 4RAYA 4CXFA 2Y75A 4R1HA 2HOEA 5FLXZ 3ABTA 3ECHA 4U0VA 4UVBA 4PGGA 5E20A 1QBJA 4HDUA 2MBFA 2M5WA 4JQFA 1BI1A 2MD5A 5E1ZB 5DV5A 4EM0B 3EYYA 2XAFA 3F8MA 2ESHA 4HQMA 2GQQA 2H6CA 2IPQX 1T38A 1MJAA 4WCGA 2QBYB 4P9FA 3U9GA 3O3KA 3TO6A 1P4XA 1R1TA 2OQGA 4KDPA 4LFUA 4KIBA 2QQ9A 4P9UA 3E5UA 4BH9A 3V8JA 1YW9A 4OIOF 2HZTA 4L9VA 4ZH4F 2PMUA 4WWCA 3J7AO 1BJAA 2DLLA 2O0YA 4L0YB 3I58A 2V6CA 3BP8A 4BYYA 2F5EA 5TRDA 2A3SA 3GFMA 1NHAA 4L5IA 3BZ6A 2F5FA 1FYMA 2K02A 1ONVA 1LVAA 3MFKA 1R00A 3V7CA 1TBXA 3BPVA 4FX4A 3IWFA 3F72A 2EJRA 1J9IA 1TQMA 3SQNA 1ZRDA 5CVUA 2A68F 3BJAA 1IXCA 1XGSA 5HDNA 4I0BA 2KIMA 1ZLKA 1P6RA 1LEAA 5E1XA 4ON0A 3GZ5A 4BAYA 3MZHA 4RS8A 2HTSA 1DUXC 1EH7A 3O2PE 4HLXA 1TW3A 2GA2A 4OIPF 4KIGA 3MWMA 4GYIA 3WTXC 1T98A 2BE5F 1LJ9A 4MTEA 3ZMSA 5BPIA 2XASA 4Y15A 1XDUA 1LQ1A 1RZ4A 2QWWA 3DP7A 5ERIA 1H9TA 3I54A 1XMKA 2V1XA 3KP3A 1K6OA 1AWCA 4OMZA 1ODDA 5FB2A 3RI4A 1UFMA 3T1BA 4M71A 3P9CA 4R8HA 3E6CC 4A2UA 2L3DA 2DBBA 2W25A 4WX9A 2DFIA 1YW8A 1U8RA 2IP2A 5FFZA 2HQRA 1RNLA 4G6QA 4UV8A 2IA1A 4UXNA 2M8EA 3HOSA 2O8XA 2EFNA 1IN8A 2WC2A 1CF7B 1DPRA 2Q0OA 1F9NA 4LB5A 5JHUA 4MNUA 5ILVA 3ROUA 3F8NA 4HF1A 4M9XA 3KCCA 1XCVA 2XAHA 3RYRA 2GZWA 2QBYA 1FSHA 2HTJA 1W4MA 2WWYA 3ZMTA 2EA4A 3NEUA 1FP2A 3REOA 4KICA 1BN5A 1EV7A 3PQKA 4WXDA 4HA8A 1WKMA 2EK5A 2PMHA 2DAOA 2FXAA 2STWA 3HRUA 3BJOA 2V1UA 1ZG1A 1IF1A 3HSFA 3R6SA 4UVCA 2HKOA 1FBSA 5FD5A 2CSOA 1OMIA 1RI7A 2HFHA 1SD4A 3ECOA 2PEXA 4KFCA 2VOOA 3HSRA 3Q5FA 1KYZA 4HF0A 4A0XA 5HS7A 5IT3A 1U5TC 3SFZA 5LEJA 1TQPA 3HTUA 3E97A 1I1SA 2CW0F 4KN4X 3F23A 3AAFA 5HS9A 1FYLA 2XIGA 1ZHFA 2HS5A 2D2WA 2V1DA 1P4WA 4RGSA 3TO9A 1DDNA 2MA3A 4OIRF 5D4RA 2LSOA 3EDPA 1ZG5A 5DEQA 3K69A 4R79A 4MQ9F
chains in the Genus database with same CATH superfamily
4GGGA 5HLIA 2ME6A 4ABZA 1IO2A 2A5WA 1XNQE 1YYKA 1WJBA 2DA1A 1KYQA 2HJJA 3V42A 4MLOA 2YR2A 4Q28A 4QLCU 2VUMJ 2LBSB 3OR1C 1Z3XA 4XNFA 1IRFA 4G6DA 1RKTA 1HLVA 4LK0F 3CQZJ 3RQIA 2XRNA 4RB1A 3C2GA 2PX9A 2E1MB 3QU3A 3M99B 3HHHA 2DFEA 2CFOA 1WJAA 2MC6A 3DPUA 1V5FA 3U2RA 5JI6A 3JRGA 4UB6C 3AKZA 1XPXA 4PSXA 1AH5A 3ADIA 4X64E 2H8RA 1P7IA 2KJCA 4QSHA 4ZTJA 5CVVA 2Z5UA 4GKJE 3GTPJ 2K4JA 3BCBA 4UNOA 4KA4A 3S14J 1S8NA 1ZYRF 2PFBA 3I5UA 4HNTA 4AYBA 1VF9A 2HQNA 2QYOA 2JVHA 1HKQA 2COMA 2HGCA 4XSZF 4WYQB 2XB0X 1Z1DA 3VOEA 3ADGA 2EMBA 3HYIA 1R22A 2KFDA 1Y6IA 4X8WA 3FHZA 1YRNB 3L1PA 3HEFA 3OYMA 1MMDA 3TP3A 2DT5A 5KL2A 1WHNA 3HTSB 1G3TA 1BI0A 1IBME 1ZREA 1D8KA 4NC7A 2KHMA 4A3JJ 2VBZA 1KQ0A 2RAEA 3D5RC 3GBGA 1U9NA 3S2HJ 3ZR8X 1BL0A 4OMYA 2MC5A 5KL7A 3AL0B 4JI1E 4LF8E 1K79A 3M7GA 3RKXA 5E8IA 1BOAA 2KRCA 4D5CA 3JRBA 4B3TE 4AIDA 3K4JA 1IUFA 4JOMA 3E5QA 2RGVA 1H88C 2N3HA 2L5QA 4IO9F 2V9KA 1V5GA 4AUXA 5HLTA 3I53A 1C0WA 1YQAA 3CC4I 2EN4A 3GTQJ 3WGIA 2UXNA 2EOOA 1L0OC 4XQFA 2KPMA 1CF7A 5J4VA 2DU9A 1DI2A 3FKIJ 3BR3A 3RJPA 1U78A 3V8KA 1R36A 4I8OA 2HR3A 3FDYA 3F22A 4LB6B 2IGOA 2XF5A 3HBLA 4ZYDA 2MFZA 2VKVA 4YIIA 2HYFA 2QEXI 2UZKA 2EN3A 3BROA 4NUBA 4UUTA 2Q8UA 4NXME 1IMUA 1ZG3A 2QLZA 1BJZA 1UZCA 1BM9A 3BTIA 2F5CA 4PFOA 2UUCE 2A25A 4IPAA 5M5XJ 1SVMA 3P7NA 4NBQA 1O3TA 2WCC3 5D4SA 3PUBA 3K2AA 3VODA 4DZPA 3KEOA 2FQ4A 1ETWA 5TGTA 3DF8A 2ZXWH 5F27A 5IV8B 1IN7A 3GF2A 2VT3A 2E34A 4UV9A 2P8TA 1ZARA 2P6SA 1OYWA 3CTAA 4BJ5C 2GM4A 4OOIA 1HR0E 1QU6A 4I76A 4BEHA 1S3JA 4HAMA 1T33A 3S93A 4X62E 1HNXE 4OAYA 1XSXA 1I27A 2I13A 3LOCA 1IXRC 1K4SA 3AV0A 2YZTA 3OYHA 4GZNC 3ESWB 1STUA 2ELKA 1MDMA 2EL4A 3HG9A 2WBMA 1IG7A 3PL8A 5HS8A 4LK1F 2JRMA 2F8BA 3JRHA 1PDNC 1QZZA 1O7FA 2DFFA 4B44A 1RUNA 1SFKA 2NUEA 3RDIA 3ZQHA 3CJQB 1WJCA 4JI8E 2EM2A 2XPVA 4HRIA 2BBYA 4ESBA 4C2TA 3OMLA 1T08B 1X2MA 5H6QA 1EH6A 4RLFA 1HKSA 5AIPA 2OZUA 2AQFA 4XOTA 1S7AA 1VQOI 1IRXA 2ZKZA 3FMQA 4Y33A 2ETHA 3R0JA 4GCVA 1QHHD 3RKWA 3ZQQA 4JK1X 1PJQA 2ZM6E 2LKPA 2QQ8A 4DOZA 3MCZA 2DQRA 2RNGA 1FBQA 1XCBA 5B1AH 4LLNA 3UNGC 2IS1A 1Z77A 4LLGF 5L3FA 2V79A 5CQEA 4WF2A 1MBHA 4PSWA 4KNYA 3S1NJ 2EPNA 2FTXB 3SJMA 2DMPA 4DR3E 3H0GJ 4LTYA 5HNFA 3JU0A 2EV5A 3OSFA 3GFJA 3C2BA 3N05A 4IZZA 2YU8A 4RA2A 1A1GA 1TF3A 4G6TB 4A0ZA 1GV2A 3I59B 5FLMJ 2JMWA 3WHBA 1PUFB 1SD5A 5LMUE 4I01A 4IHVA 3VK6A 3OYEA 1APLC 2FMLA 1WJPA 3IH3A 3ELKA 1DGWY 1MBFA 1JK1A 2E7XA 3HXLA 2Y30A 3I4NJ 2ZSHB 2X85A 1IQOA 2XGEA 1OPCA 4GRIA 5DCMB 2NXNB 3WG7H 2RN7A 3KEYA 1OKRA 4DV4E 2WB1A 4QPQA 3D1NI 2CV2A 2OJED 3S1MJ 3Q9SA 2EPPA 2FNAA 5K5RA 3JAMC 1YIOA 1Z7LA 3RTRA 3WU1B 3DJWA 3BR1A 1A31A 3FXQA 3R0AA 3FBIB 4IHWA 1B59A 1KU3A 2BW3A 2GXBA 4EV0A 1B8IB 1JKQC 4B3AA 2VE8A 5F64A 3DWLE 4M6XA 3C18A 1NK2P 1YX5A 1JKOC 2YS9A 2HHHE 3KETA 4AIKA 4XKVA 3GFLA 2W24A 3GW2A 2NVUB 2JPAA 2F4OB 4B47A 4KUMA 4RHBB 5F1RA 4DJAA 3DEEA 3WU2C 1LDKB 3KZYA 1ITYA 1QVUA 5F04A 1RIOH 2ME0A 1OCCH 4YIFA 5AC5A 3K4NA 3NQOA 3LA3A 3W2WA 2VI6A 4EVIA 1A1FA 5EG0B 2QKMB 4ZDPA 1X1AA 4I02A 1ZBQA 2LV2A 1RUOA 1XN7A 2EQRA 3SYTA 3IWCA 2EOQA 3GTOJ 1J0RA 2CUEA 2HDWA 4R8OA 1ETYA 4MO7A 2QSFX 3IAM2 2DA6A 3OYFA 2YSRA 1XMOE 5LEKA 1OQYA 1LFUP 2HVQA 1YW7A 1VQ9I 1TWGJ 3NAUA 1YYOA 2KIUA 2HEOA 2KONA 3S8PA 2Y0SA 1KQ8A 2JN6A 4HSRA 1TWHJ 2V1NA 4M6YA 3N4MA 2NNNA 1VQ6I 3CCLI 4DNCA 4WK8F 1BBOA 2IA0A 4Q5SF 3IWBA 5E79C 3CO7C 1SFUA 1DPUA 2EQ3A 2VQFE 2BGCA 2A6TA 3F9KA 1QVTA 3WE2A 2Z2SB 3EETA 5JLWA 1A1HA 2K9QA 4RBOA 1ACIA 1S9HA 4UHTA 3JRDA 2GA1A 2KLOA 3H9GA 2EZIA 2QGUA 3PNTA 1BOBA 3WTYC 2ZJRF 2JR1A 1I6HJ 2V9VA 3IC7A 1VQ5I 2RQQA 5B5EC 1EH8A 1IW7F 5GAEJ 2VJ5A 4U7DA 2XRLA 3LWFA 4LG3A 2IHR1 2M7QA 1BI2A 2Y31A 4BMJA 2R1FA 3O8GA 4BHBA 2W7NA 4M9ZA 4MEYF 3DEWA 2P7CB 2MW8A 4IF4A 4H0EA 1ZAAC 2FJ1A 1QNTA 5K1YA 5DS9A 3ZQGA 2BEOA 4HX7A 1MNDA 1TT5B 1UCRA 2FE3A 3RPUD 2B3TB 4BXUA 1XGOA 1USSA 4KMFA 5K7ZA 1VQ4I 4DR6E 4ZZDA 5GTIC 3HOXJ 2DMIA 3BBGA 2RC4A 2RS7A 2JPCA 5BPDA 4IJDA 1NCSA 1WI3A 2EPLX 3BG7A 2F4IA 2H36X 2LLKA 2F5VA 3JSPA 2LREA 4O43A 2HPMA 2NOJB 3VFZA 2EM6A 2XROA 1YJ9I 4ENKA 2W48A 3L2VA 3F21A 1V54H 3CUQC 2WA0A 4B4CA 3A01A 2H8WA 3IAS2 5LBQA 2KRFA 4RGRA 1SFXA 2ESNA 1ZRFA 2LTPA 4BCAA 2G0EA 2GOXB 5DDGA 1CGPA 2H6BA 1J59A 2XVCA 2E7WA 1WH5A 2GLOA 4XRFA 5KAFC 1WI9A 2ZO4A 1QGPA 2YSOA 1AA7A 2VN2A 1Y8RB 1A04A 3CP8A 2L92A 4QIWN 1OCOH 2K85A 3J7AY 2K7LA 2KP6A 4BE2A 3FIGA 2BYVE 5D5UB 4Q48A 1Y39A 2FSWA 3M1CA 3S17J 3JREA 1Z0XA 1Z6TA 2V4JC 4RB3C 3S3OA 2RSMA 2BY3A 3GTLJ 4X65E 2ZNYA 3ZPLA 2PBIA 5A6BD 4A3FJ 2JTVA 2LC2A 1K61A 1ON2A 2X1EA 3JTZA 1B6AA 1U6GA 3JRIA 1BR4A 2A6EF 2L33A 2XV4S 4XKWA 3DBHB 3LAPA 3E6MA 2LY9A 3FXRA 2PLYA 1F4KA 3K7AJ 1GZ6A 2EWLA 4PGHA 3FXMA 1DGRM 2O7OA 2IA2A 2EWNA 1YITI 3B6CA 1E17A 2EMLA 3CDIA 3K9TA 2VASA 2K4VA 4RH8A 3HC7A 1PP7U 2Z33A 3Q9VA 1KZHA 2EPCA 3F6OA 2F4VE 3QYEA 3H35A 4KJZA 3ADLA 2HPIA 4UUSB 3GWZA 2AQEA 4I99C 2DLQA 4FASD 3L00A 4QWQA 5LFAA 4TUGA 5H20A 2XAJA 4IX7A 1XSDA 4KZSA 3KP4A 2EPFA 3CO6C 2JVGA 3BPXA 4I6ZA 4B43A 2EMZA 2JPBA 1AU7A 2ELHA 4EQQA 2VBYA 4NB5A 3J7Yp 2HOTA 3KP5A 2O6GE 4X9JA 2L7FP 2JK3A 2N8XA 1X3UA 2JT1A 4LIUA 4ENJA 2NA2A 5KL3A 1B72A 4N0BA 4A12A 2JA7J 1Z91A 5TISC 1IN4A 4MQ9F 3GLXA 4CO8A 1X1CA 2LO3A 4IHSA 3HTXA 2VRDA 4A3BJ 4M9VC 1LB2A 3CCVI 2BXYA 2M0MA 3RPUA 2CJJA 3BR5A 4XL9A 2PJPA 2DQLA 2K4BA 4BQAA 2DYRH 3FKJA 5D5XB 4GDFA 1P4AA 3H5NA 2MH9A 3L09A 5ILSA 1MEYC 1WZ2A 1TTYA 2HQ5A 4J19A 2EM3A 1YO5C 4JV5E 1OCRH 1UILA 2M9AA 2E2HJ 1E3OC 4FE4A 3JAMK 3PSIA 4C3JJ 3GMEA 1XNRE 2EN2A 4WXHA 4A6DA 2KT0A 2MYSA 1YE9A 4O5VA 2VONA 3DKWA 1FJLA 1FOYA 2VLAA 2DTRA 2DJNA 2D5VA 2FOKA 1A1KA 3FK6A 3EUAA 1UHWA 2M87A 3HHGA 3CCRI 2XKPA 4XLEA 1HF0A 1MKMA 2IRFG 1FTTA 2DA4A 4QPOA 3HRMA 4A3CJ 1WH7A 2Y9ZA 1S6LA 2MH2A 5DM6F 1ZTRA 5B1BH 3J7ZI 4CHUA 1MW7A 4WSGA 3OIOA 3LSKA 3P9IA 3U1DA 2ENHA 2DDBA 1F36A 3IH2A 3GUDA 3COAC 4P5OA 5J6XA 5J1YA 1LFPA 1J75A 4XR6A 3LFKA 2R7SA 2Y9YA 3CCQI 5A6BA 2LFBA 2KMUA 2YX7A 2EH3A 5CFFE 3HPZA 4FISA 4BQNA 4RLQA 2GAUA 2CUZA 3SEZA 2O61A 1TW2A 1ZK8A 3BF2A 3DXJF 2V88A 3ERED 5EEHA 2XPUA 3A2KA 3F3XA 1W5CC 4CA0A 3OYGA 2CUFA 2XKOA 2GBYA 3OY9A 1FY7A 4KN7X 2FQ3A 1MSEC 3EPLA 3OSGA 1SD6A 3FMRA 4G7ZF 3HUGB 2M34A 4ESFA 5DYMA 1USTA 2MLGA 4AWXB 2F48A 3TQNA 1YS6A 1FOKA 1STZA 2E35A 1IJWC 1ZRCA 4O3MA 4BE1A 1TNTA 1MBGA 2C6YA 3CUOA 5HLGA 3S32A 1W0TA 3BQZA 2FNPA 1J2XA 2L3CA 3VYRB 1W7PB 5LLQA 2O03A 2FOWA 3EUHA 4DR5E 3TW6A 2CQKA 1T95A 2OTLI 2V85A 1ZGAA 1XGMA 4FCYA 1S5LC 3TDZC 2D45A 2J5OA 2Q2EB 3I3LA 3GFIA 3MHSC 1VNDA 4YFKF 1SD7A 3I64A 2VKHA 2DLKA 1LDDA 3FF5A 2DFHA 2DA2A 2K27A 1X5WA 2LY2A 2MG4A 4HW0A 5J4YA 2CSHA 4A3LJ 2M1BA 4UVAA 2JSCA 3ABLH 3ZOBA 2KZVA 1W5SA 3JAMZ 1UHMA 5M5WJ 1W36D 4OAZA 2EFWA 3HPHA 3T1HE 4EJVA 3BZKA 4YELA 4HSTA 1X1DA 2R7WA 2LF7A 2BHZA 1I6XA 2OF7A 3E0JB 4EEFG 1TLHB 2XUBA 5EDNA 3VEPA 2MC4A 2VIXA 1R5GA 1F1ZA 1ZAOA 3TOAA 1A1LA 4BDYA 4V2GA 1XC5A 5KHDA 1SAUA 3R61A 3RKYA 2YRKA 4DKKA 4DMIA 3FXKA 5BMZA 2OU2A 5FLVA 4ZYHA 1OYYA 1JHFA 1R5ID 2LMDA 3IP4B 5FLXC 2M2EA 2UXXA 1O3RA 3J81C 3IKTA 4GKKE 5DM7F 1QHGA 3HKZN 3K2ZA 3IUOA 4RM3A 3DLLF 2A07F 2HXIA 2QF7A 5CQGA 5DD4A 1T2KA 3GXOA 2FV4B 3OL3A 4ITVA 5AE2A 4LD5A 3DBLB 4I2OA 2OCCH 5KK1A 3UKGA 5CLSA 2YWQA 3E3VA 2I9IA 3W6JB 4CYDA 1T8IA 1B9MA 2PN6A 4F6MA 1I50J 4C30A 1F43A 2LUPB 2VT2A 2K9LA 3R60A 4L5EA 2EZLA 1O3SA 3KWRA 3SEQA 1ON1A 5JLXA 1O4XA 3MD2A 5FO5A 1J5EE 3THNA 3CCJI 3CJNA 4KIFA 2GHFA 2YT4A 5KVRA 1YZ9A 2W84A 1TF6A 1MH3A 4KYWA 5DUIA 4BE0A 1TQIA 4UUSA 2EM7A 4IJAA 1AKHA 4Y17A 2L4AA 3MMYB 1MMGA 2EM5A 1YYWA 3AG2H 1BC7C 1DU0A 2D9HA 4F9AB 4S04A 2VJJA 3AL0C 1E3PA 4HNUA 3QYFA 1SMYF 3TDUC 1F2IG 3R4KA 3SDBA 3GZ6A 1RR8C 3T8TA 4L5JA 3CZ6A 1K78B 2XSJC 1PDAA 3LSIA 2EN6A 3FWEA 3IHUA 3WODF 3J7AG 1QPMA 4ZZLA 4JI6E 4EATA 1JI8A 2DK5A 5J8FA 5C4XJ 2EM8A 1WSUA 2YTQA 1O3QA 4AC0A 1DGCA 3PM1A 2V6EA 1MMNA 3FK7A 2B9SA 1PJTA 4P96A 4IQ4A 1XGNA 2Y48A 4DYRA 4U0YA 1IBLE 1HW1A 1WPKA 3LSTA 2VXDA 3M8EA 2CWEA 4NC6A 4CCKA 3V4GA 1V3FA 2EPRA 4JX6A 1G2HA 3QAHA 4PDKA 1E0EA 1L4SA 3HRSA 2ZBKA 4R2RA 3ONQA 1VTNC 1BR2A 5FFXA 1ERDA 4EGZA 2WBSA 4NNJA 4A3KJ 4EJOA 1VFCA 2YU9J 2CRGA 3KLOA 4B3ME 2NS8A 2RKHA 2MSYA 1FBUA 5F0FA 4L9TA 3FXLA 4XBFA 5C44J 1N3GA 2XF6A 3JW4A 2LJHA 4M73A 5EYRA 4MEXF 4JYAE 1B9NA 4BNCA 3F6HA 2V89A 3DEUA 3DU5A 3HB9A 4LG0B 3DKYA 2A6HF 3PSFA 2X6OA 2VODA 2LRSA 4A0YA 5L3BA 1LVKA 1RETA 2TRTA 1ZU1A 1I39A 2IVMA 2P5LC 3EQLF 4PFPA 2E1CA 2GIVA 2L6MA 2DO7A 5FJ8J 1YX3A 3ZQCA 2VF1A 1RMDA 5AE1A 3F8BA 3HGYA 3QPHA 2VPRA 3DF6A 4IRHA 1R23A 5GP9A 5EGOB 3BT9A 1U8BA 1QZYA 2L9NA 1G4DA 3A0BC 2WB1N 4FETA 4BHCA 2ZB9A 3HOZJ 4W97A 1J09A 5K5OA 2DMNA 2K86A 2K40A 4IXAA 3TO7A 1JJ6C 2K9MA 5A2QK 2X48A 1BI3A 2UUAE 2YTNA 5ILUA 1WCMJ 3NRVA 1KU7A 3DKXA 4XORA 4F6NA 2G9WA 1K7AA 3GYHX 4L18B 1N77A 1H9GA 2HYGD 2M9HA 3G1LA 1B1BA 2IGNA 2NS0A 5LHIA 4ENNA 3CC7I 1WRJA 1S7OA 2EQ1A 2EV0A 2QENA 3ZN1A 4BJ6C 3E6BA 1HC8A 1LE8B 2OZ6A 4BKXA 3DPLC 1O57A 3WU0A 2DA5A 5KCMA 1FPQA 2R3SA 1Z1BA 1D3YA 2YTJA 2CW7A 3KLNA 4KT5C 1ZR2A 2CV1A 3BGHA 1YHQI 1H8AC 4ASNA 5HVQC 3PFIA 4IRGA 3CCEI 3VWBA 1G6NA 3EPHA 1X4PA 2KDZA 2UUZA 3ZGKA 3GO5A 5JVTA 1YIJI 3L2QA 1HBXG 4DV5E 1BIBA 2VBWA 2D1VA 4PCQA 4X6AJ 1TL8A 3CJTB 4F92B 2JVAA 1OYIA 3K4CA 2WAQA 1FC3A 4R2DA 3DTIA 1RPWA 1Y1WJ 3LSHA 3DV8A 2DPUA 1DQUA 4P78A 4L9NA 4ZDOA 4G8XA 1T39A 2VBXA 2WBTA 1B69A 1WQ2A 2JRTA 3H36A 1IN6A 5HODA 2ICWG 2LG4A 3KP6A 4GO1A 2Y0SN 3E1SA 2E60A 3NWTA 5EZGA 1VI0A 2ZSIB 4OINF 1VQNI 2CUJA 2NRAC 5LL6R 2NUGA 3BTJA 3CF2A 4ZTFA 1PKPA 3M1EA 2WV0A 3D0SA 4M3BA 2KDOA 4MFDA 1YPNA 4LLLA 3BDDA 2YRMA 3C1DA 4DV6E 2EQ0A 3QPSA 4F52A 1BW6A 3O6BB 1R58A 3P1XA 4HG2A 3SHFA 3IKVA 2EN8A 3KP2A 3QODA 2OAZA 2W1OA 3K1NA 2HC5A 2UXCE 2BZTA 2CV0A 5GAGJ 3F0CA 1ETOA 1WJFA 4ZYEA 4F9CB 1GV5A 4ANJA 4O6JA 1S29A 2RDPA 1YLFA 2DOFA 2W85A 5A2QZ 2NAZA 2DPDA 2WAFA 3I56I 1LFBA 1PVEA 4WXCA 3J81K 3RMPA 3OYJA 2L8TA 3KYDB 3DTEA 2L2OA 2P5VA 4V19K 2ID3A 1JGSA 1Z3YA 3H5RA 2FX0A 2R7DA 3HRTA 5J1UA 2IS2A 1AOYA 1GUUA 3HOYJ 2PQ8A 4M3GA 1N75A 5JHFA 4XONA 1JXSA 2E72A 1SMTA 5LRRA 1QA6A 5E18F 2EOIA 2JXPA 4MFEA 3ABKH 2WTEA 2EV6A 2LJUA 2XGCA 2LBFA 1M1EB 3P9KA 1O7LA 1MD0A 2EM9A 2LRDA 4XSXF 4XICA 2RPCA 1WJ5A 1A1JA 4EJTA 4RAZA 1VQ7I 2GOMA 4LFAE 3OV8A 3NARA 2P4WA 2EOZA 3MAJA 2L9RA 4LITA 3TKYA 1K78A 4Y52J 2W4SA 3H92A 4LFCE 1WJDA 3QYBA 2QKLB 3M3YJ 1FOXA 4EJWA 2JA2A 3KYCB 1FSEA 4XLPF 4BGDA 5F0HA 4BBSJ 2X4HA 3EUHC 1T4OA 4LIVA 4C3IJ 1EF4A 3M4OJ 4XM3A 2V87A 5L3CA 3WTVC 4A5NA 5LGNA 1G2DC 4DV0E 1X3CA 1FX7A 3DQVC 4AVPA 1RKWA 2ADUA 4BC9A 3F6VA 3FXOA 3K6GA 2E1MA 4HQEA 5B3SH 4G7HF 1DQ3A 2YTPA 1CQTA 1N36E 1G2FC 2IAIA 4IVNA 4EM2A 4TV7A 3S3MA 2M7BA 1VQKI 4JYKA 1KYWA 1J5YA 3QQAA 5E3MA 3VHTB 5FD6A 1DP7P 1L3LA 4PUSA 2ZXJA 2ZXIA 3IL2A 1JKPC 5FKNA 2XGXA 2R7VA 2VC0A 2ZFWA 3ZMDA 5EEAA 3BG9A 2R5YB 4E7HA 2HVSA 1MMAA 4HZFA 1WGXA 2J7JA 4DR7E 2ENAA 2LVSA 4M6VA 5H6RA 2L2NA 2ECCA 3K4BA 2FEZA 1A6QA 2DGCA 4Y13A 1R49A 2JQ7A 4JP0A 2DT6A 2E1NA 1Y8QB 3LL7A 4CDGA 1XDSA 5HDKA 2TCTA 3OYBA 1JJ8C 3MKLA 2BY0A 3E5XA 1UN6B 3KEQA 4BC7A 4EM1A 1DP3A 2O5RA 3FMSA 4FE7A 3MKZA 1ZBTA 2HI3A 1UJ8A 4B8XA 3J81Z 1LLMC 1R1VA 3W2AA 2K3FA 3OL4A 2OQRA 2XF7A 3D5SC 2EBIA 2FBHA 2Q8KA 4V2FA 2RQLA 2UXDE 4BQQA 2QA4I 4IL6C 3F8CA 3MKYB 2ISZA 3UR3C 5HLHA 4D1QA 1GXPA 2YTIA 4C9YA 5CVJA 4OU0A 3J80C 5CKTA 2J5PA 2FU4A 3GX4X 1KGSA 1EJ9A 2R92J 4U0WA 1ULYA 2MC3A 1WVRA 2VKDA 3P5JA 1S7EA 2NS7A 1J7KA 2OV7A 3A0HC 3LQRA 1ZGWA 2K7IA 4DV1E 1LKXA 5E3LA 4HEIA 4M3EA 2LY1A 3SFIA 1LE8A 3PO2J 2R7QA 5DCFA 3B6AA 4XN0A 5EEGA 3CLQA 3LSRA 4RAGA 2CYYA 3WGHA 2LH9A 2EOFA 3O8HA 2L02A 2XB5A 3JRAA 2VJ4A 1YUJA 3RCOA 2DA3A 2RQPA 2CPNA 1IC8A 2B9DA 3QG5C 5J3LA 3OS1A 2W57A 1JHHA 3FIWA 5ADZA 2CS3A 3ZN0A 3A03A 4BHPA 4DV2E 3ZQLA 3BTLA 2KIFA 3QU6A 2ZJ2A 2P7VB 4XLHA 1T6SA 2EOSA 3QRFF 2JYAA 4G94A 1GVJA 4LF6E 2VQCA 3LSGA 4YHHE 3C2HA 3EYIA 2EB7A 2IS6A 3KFWX 3BG6A 2ZCWA 3Q3SA 1TT0A 2EIMH 1XMAA 3ASNH 3UK3C 3K4KA 5ICCA 2WBUA 3M9AA 5JR3A 2QVOA 4JI3E 1I5ZA 4HX4A 4MQVA 2R7RA 1H0MA 2KOUA 4CYCB 3HIFA 4Q4ZF 1SC7A 1W36C 2EMYA 2NOGA 4OOGC 4OX9E 5EZHA 2L01A 1I3AA 2JUCA 3ZQ7A 2PMZA 4EJUA 4KITB 1NTCA 5LGTA 3H3ZA 1YG2A 2BY2A 2IT0A 4P1WA 3CMYA 1ZLJA 2DA7A 2ZMEB 2X1DA 4CCNA 1HOMA 3BY6A 4J01A 3A4CA 4FK5C 5D5VB 3DFGA 3DPTA 4XKCA 1SEUA 2V26A 1YJWI 1IAWA 2IW5A 4F7ZA 3BWGA 1YFHA 2N8GA 5E17F 3LSJA 2HWVA 4CICA 3PIPF 4IOAF 1SFOJ 4EMSA 3ABMH 1W0UA 3MN2A 3ZQIA 3K70C 2H09A 2R76A 4K0KE 1X48A 4YFXF 5HOOA 4R2AA 3ADJA 1ETVA 2R7FA 3A1YA 5TJJA 1DU6A 3I59A 3T0YA 4R2QA 1MBEA 5D5WB 1PUFA 3G4SI 2XPWA 2M30A 3KP7A 3VSLA 1SANA 4DZJA 2X0LA 1FYKA 3SZPA 2MKNA 3JRFA 1P9QC 1R7JA 2FD5A 2HNHA 4N9HA 5D6EA 4BS9A 3OYLA 2KL4A 4B09A 2EZ6A 4GYGA 4ZYGA 2VXZA 2CMPA 1Z67A 4GXOA 2IBDA 2ZFUA 4U87A 2JZYA 5DCMA 3IRQA 2XAGA 2A5YB 2GWRA 2DXIA 4HTGA 1FOWA 2WV1A 2VQHA 2MDGA 3LFUA 4HX8A 4PJMA 4LF7E 2EMWA 5FROA 2M45A 2FBKA 4IHXA 2LKSA 3H3UA 2EE8A 1KU9A 3V8LA 2L2KB 1B8IA 3Q0UA 2X6XA 1X3ZB 1JGGA 2K9NA 3QWLA 4M72A 4F91B 4UUVA 3CUQB 3GTMJ 5KNLA 1G3SA 5A6KA 2FBIA 1Y0UA 5A69A 3G1MA 1PP8F 4N4RB 3TMOA 4P55A 3W3CA 1E3HA 2DK8A 3J7YJ 4BDZA 2LE2A 1PUEE 3BJ6A 3FM3A 1FKAE 1LPQA 1ZKGA 3PUFA 4AD9A 2JA5J 3TOBA 2OBPA 1X1PA 2OD5A 1WXRA 3ZQFA 3G73A 4HLYA 4DUYE 4RAFA 2F2EA 2M4KA 4BACA 4D5FA 5EG0A 1MBJA 4AM3A 2EMAA 3MEXA 3OS0A 3PJRA 2K3PA 3L2CA 3RIRA 3VDXA 1IQSA 2CW8A 3GCMA 3JTGA 1BW5A 2R5ZB 2HOAA 2QUFA 4JX5A 3OYKA 1BBYA 2B63J 3B02A 1UG2A 1D0XA 4Y4RA 2LR8A 3BQYA 4A6EA 3OOPA 2ODRC 1TWFJ 5EF6A 4KMUX 4IHYA 1YI2I 2EMHA 2DMQA 4W1UA 2RV8A 3LA2A 2DSYA 2EMCA 5F1JA 3W6KB 2QZ8A 3ABUA 1MNEA 2GLIA 2MLKA 4B3RE 2LDUA 1X47A 1ZH5A 3WGGA 4DBRA 3GTJJ 4LF4E 4ESJA 2DIXA 1IZ1A 5FKLA 4LOCA 2O8KA 1ZQ3P 1JUSA 4XLFA 1LDJA 5BQTA 3TEDA 1YOVB 1I3QJ 3ZMZA 1MH4A 3WTZA 4MLQA 1XX5A 3L9FA 2JY9A 1JTXA 1KJKA 5LMNE 4L9JA 1ZGJA 2CTDA 2JOBA 2EOXA 3ULQB 2HYJA 2ACJA 5ICEA 3S1QJ 3OIQA 2DI3A 5BOXA 4OIQF 3LNQA 2Z9OA 1FIAA 1X6HA 4DQ2A 4XRSA 3WTSC 3S1RJ 2F5DA 2H27A 2B7EA 4Y3OA 4C2UA 1A36A 3OR2C 2WADA 2WY7Q 3JTHA 3VYSB 4JI5E 1OCTC 3OYCA 4LF9E 2A61A 1R1UA 3K0LA 3L2WA 4NQWB 2XHKA 3ZCOA 3L2RA 4ETSA 1RR7A 2YPNA 1HNZE 2UWMA 4AYBN 2AO9A 4E70A 1X6EA 1U2WA 3J80K 3X2QH 2FMYA 2YSPA 3V7RA 5FRMA 3I4MJ 5ED4A 2EL6A 5A6AA 2EJ4A 3HOTA 2QCOA 2X1CA 5IYBJ 3CCSI 3V7SA 2OTJI 5AIQA 1IBKE 4JX4A 1KQ9A 2CU7A 1T4NA 3WTWC 2A69F 5LHGA 2MKDA 1G59A 3RSNA 2FA5A 1X1BA 4N9IA 4A3GJ 1U3EM 1G3YA 4E7ZA 3F8FA 1FMWA 2MABA 5IT9C 1VZ0A 2COBA 1Z9CA 1IGNA 5BR8E 2BV6A 2DRPA 1Y0NA 5LGUA 2FF4A 2EZHA 1VQPI 3M07A 2DB2A 2H1LA 4G12A 1MIJA 3KE2A 5CJ9A 4DYQA 5ICGA 1MDMB 2JA8J 2E1MC 3L7WA 2N3GA 2YTOA 2K5CA 5KL5A 2ECBA 3H5AA 3LA7A 1IRZA 3AG1H 3K70D 2QM3A 3PNVA 1P2FA 2OA4A 4DYCA 5AONA 4HV5A 2UU9E 3ERMA 2X6WA 2NVTJ 3QP5A 5IY5H 4S05A 4KISA 2JWTA 1ETQA 3AUZA 2XDVA 1ZN2A 4FHTA 3ZMVA 1GHCA 1P47A 2EM0A 5L3EA 2BBGA 2ZMEA 5ICFA 3CCUI 1QPIA 2ZNZA 1BA5A 3K1PA 2K9SA 2PG4A 3ZRGA 3HSEA 5HNHA 3KZZA 3QOEA 5TSEA 2LT7A 4U7BA 4M9SA 4PZJA 2JOXA 1HKTA 4JI2E 2LMZA 1MJ9A 2HKXA 1QQIA 1NEIA 3VYUB 2AS5F 3T5XA 2BB8A 1IXSB 3ZMUA 2DTZA 3QPTA 4XRMA 2VC1A 3WTTC 5CYVA 4HF2A 5T6JA 5LRSA 3H0DA 3F6GA 1XSVA 3KIOA 3WE3A 5GAHJ 2EINH 3C3WA 5DTDA 2RVCA 3ZP5A 3CMEI 3D5LA 2RREA 1W7PD 3EUKL 3I71A 1BC8C 4HBLA 4R79A 3LQQA 4BXXJ 3FISA 2GXAA 1AAYA 5JFRA 1WFXA 3BTCA 2LTSA 5FGMA 1PJRA 5K7FA 2VQEE 2M1SA 3CCYA 1MNMC 4A5MA 4YFNF 1MGTA 1A1IA 4L8NA 3J80Z 1TZLA 2VQGA 4IQJA 2CQQA 4YG2F 4EGYA 3ISPA 3GEZA 1MZBA 3JSOA 2JSPA 3N97A 4JI0E 2Z99A 3VPRA 4AU7A 1UB9A 2LYCA 2P5KA 3FXJA 1R6RA 4JBAA 1FNNA 2W00A 3IWZA 2BW3B 1FWZA 2WAEA 3SZGA 3BLYA 3JCUC 3OWTA 1IDYA 4HEA2 4D0PA 2FUG2 4IRIA 1PJSA 4RDUA 5E3NA 3HOWJ 4HV6A 4WSPA 3VB2A 3QPLA 1BBGA 1LNWA 1XD7A 4MTDA 2ODRD 3W6VA 4J00A 1YTYA 4CH7A 2HOSA 2VOPA 4LFBE 3CD6I 2Q1ZB 1MJBA 2OCEA 2JJ7A 1HSTA 1X2NA 3CDHA 4Q47A 3DCFA 4PJNA 2LCEA 2I8DA 1UAAA 4DR1E 4DR4E 2EZKA 1RQ0A 4NHRA 5A6JA 3EPKA 1FTZA 3LSMA 4ENMA 1FT9A 3A02A 3BOQA 4NHJA 2VE9A 4AIJA 1X3WB 5L3GA 4X66E 2M0CA 3WG9A 3FM5A 2L54A 2B7TA 2DDAA 1U5TB 3CJRB 2HQAA 4CCMA 2EILH 1LEBA 2EFPA 2R5ZA 4XN3A 4IHTA 1OISA 3E6DA 5DUKA 2KISA 4Y7NJ 3HJEA 4L0ZB 3EPZA 4FX0A 4E7SA 5DD8A 4CCLA 2L4MA 1REPC 1HW2A 2YU5A 1HSJA 3MZYA 1TNSA 1ENHA 5D6FA 1EKEA 4TUIA 1G3WA 1GXQA 1F5TA 2YPRA 3RYPA 1W5TA 2EP3A 2KRHA 2DMUA 1FP1D 2KHXA 1TWAJ 1NH3A 4M0VA 5KL4A 2UUBE 3HUGA 4MIMA 2IJLA 3G2BA 2BVLA 2H94A 4BQOA 1JUPA 1WWXA 4N4OB 4BXFA 3G71I 3RKQA 3RZDJ 1RRJA 5D8LB 3QP6A 1K83J 3ECRA 3OIPA 4LMYA 3TGNA 1P7JA 3HKZA 1W7PA 3CLOA 3EPJA 1A6IA 5CVRA 3U1KA 2KKOA 2B0LA 1VQLI 3FXUA 2LTRA 4YRVA 5JVGF 1JT6A 2QSHX 4X1EA 2QQAA 4UY8I 4LU9A 3DBRB 2CQNA 1P92A 2KZGA 2Q2EA 2R7OA 3C7JA 2D1HA 4PK4A 2YTDA 2IEKA 2OPTA 2CFXA 4CSWA 4UB8C 2TDXA 1E2XA 3GVAA 3CCMI 4NQWA 1GTKA 4G7OF 1VQMI 1FLIA 1BIAA 5BS6A 2V8QB 4RGXA 5C4JJ 4I0AA 4LGWA 3SZTA 2VB6A 3MQ0A 2VL8A 5D8KB 1T56A 4B48A 2NNYA 4A3EJ 4CCOA 3K4LA 1HNWE 2EIJH 2EM4A 1YRNA 4BL0B 1O0WA 2DOEA 1JE8A 1Z05A 2L7ZA 2A05A 1VQ8I 3A01B 5HDGA 1NG7A 3S2DJ 1B4AA 1D5VA 1QO0D 1R4NB 2DCEA 3B73A 1JT0A 4RB2C 2JP9A 3ML6A 4BBYA 2AXLA 2DODA 3I4PA 2CG4A 4Z2YA 3G6EI 5L3DA 2GPIA 4BJTA 1FZPB 2IS4A 2CGPA 3AG4H 5E1WA 1X49A 4JI4E 1FJGE 2QQBA 2XAQA 2R0QC 2E5ZA 2YX4A 3I0TA 4PJ0C 4D7MA 5IT9K 1OR7A 2JWOA 2EMGA 2P6TA 3TBIA 4Q35B 3FX3A 2X9DA 5E8GA 3C4TA 1V55H 2NVQJ 1I1GA 3BR6A 1SAXA 2HGHA 3CDLA 2LD5A 5FLXK 4M3FA 4I98B 4B3XA 1IUYA 4G9YA 3PO3J 1T0FA 2ZXHA 3RQ4A 5IP7J 5IYCJ 3AG3H 2CQXA 1YYVA 3HPGA 1TN9A 4BY1J 1N32E 2IXSA 1UELB 1OCPA 5AC4A 1RC9A 1XG1A 2L2MA 4R03A 4E7LA 3OYDA 6PAXA 2FRHA 2VPLA 4M74A 3T8RA 4JI7E 3L2UA 1R71A 2M4GA 4I09A 2CO5A 1Z7UA 1MMSA 2NUFA 2EOMA 4S0HB 3LAJA 2EA2A 1D8JA 3OMYA 3KX2A 2HZDA 4ZC3A 5K5QA 2AXTC 4RB0A 4M2ZA 3RPQA 2Z1DA 3MHHC 4ZYAA 3K1MA 4AIHA 4R2EA 2L3JA 1OLTA 4FT8A 2LF8A 4MGRA 2PI0A 2R93J 1D0ZA 2ISYA 1XMQE 2Z3YA 5F0CA 1MSFC 2OC6A 5IP6A 4FQGA 4K2EA 1UHZA 4X0GA 2EFOA 1B72B 5IXMB 1YS7A 4XLNF 1IN5A 4MHGA 2G7HA 3GLLA 4LJZF 2ADRA 2LK2A 1BR1A 5IOYA 4A3IJ 1A35A 2PMZN 4IKFA 3G1OA 3CF5F 2GXGA 4NDLA 1HQCA 1Q1HA 2RNJA 4CGZA 1HXDA 1QZEA 1HA8A 4B3SE 2Y0MA 2EN1A 1I94E 1K6YA 1XB4A 2G7UA 3SXYA 1R5HA 1H89C 1IRGA 5J8CA 2DT7B 2EFQA 1V4RA 2YU3A 2STTA 3RZOJ 2EMIA 3BG5A 5LHHA 3S2WA 1SFEA 3WTUC 3IRRA 4U88A 3G3ZA 2E19A 3IV5A 4KWYA 2DW4A 3M8FA 4E7KA 5F6FA 1Z6RA 3H1CA 2ELJA 3FZVA 2MD0A 2O3FA 2LNBA 2HDDA 4XKBA 2EPAA 1U9OA 2DN0A 3PQJA 4RGUA 4HYEA 5CVIA 4E7IA 1HW5A 4I7HA 5IT9Z 4BBRJ 3CESA 4DW6A 4II2A 2KJBA 4LG0A 4HDVA 4L5NC 4HOBA 2HDCA 4CZZA 3C6KA 3QOPA 3H09A 1KU2A 1PYVA 1U5TA 1KA8A 2NYXA 4RAYA 4CXFA 4II3A 2Y75A 4R1HA 2HOEA 3K6QA 4DV7E 5FLXZ 1D5YA 4F9BB 3GTGJ 3ABTA 3ECHA 5M3FJ 4P7DA 2ID6A 2L0KA 4U0VA 4UVBA 2UXBE 4PGGA 5E20A 4DIQA 3C4BA 3BC8A 4XIDA 5EGOA 1QBJA 4HDUA 2MBFA 3TL4X 2EOJA 1T4LB 2M5WA 3BR2A 4JQFA 2ZMEC 2HU9A 1WJEA 2QSGX 3FBNB 1BI1A 2E5LE 2MD5A 5E1ZB 5DV5A 2EOYA 2Y69H 4M3DA 2L9VA 4A93J 4EM0B 3EYYA 1IV8A 1ETKA 3E7LA 4YIRX 3HL2A 2XAFA 3F8MA 2ESHA 4HQMA 2ZJQF 2GQQA 2H6CA 2IPQX 2M3AA 1T38A 2CH0A 2R7ZJ 1NG6A 1MJAA 4WCGA 2QBYB 4P9FA 3OYNA 2P81A 1BB8A 3U9GA 3BCAA 4BUPA 2BHYA 4F54A 2E1OA 2FGGA 3O3KA 2EORA 1Z21A 3TO6A 1P4XA 1GLNA 1R1TA 2Y2ZA 2YTGA 2OQGA 3OYIA 4KDPA 4LFUA 4F55A 2HVRA 2B7VA 1TWCJ 5EJCA 5FKOA 1OCZH 2YUSA 4F2JC 1N78A 4KIBA 2F4MB 5F3WA 3KZIC 2QQ9A 2EN7A 2VJIA 2PJRB 3BIDA 2OUMA 2VKEA 2E2IJ 3ASOH 4P9UA 3K10A 3HDDA 3E5UA 1X19A 4BH9A 3HQ1A 4PJJA 3V8JA 1YW9A 3CMMA 3FHNA 4OIOF 2HZTA 4L9VA 3Q0WA 4GEQB 4ZH4F 2PMUA 1IV6A 4WWCA 4HPQA 2DJIA 1W1WE 1BJAA 3J7AO 4IS1C 1AHDP 2DLLA 2V9PA 2O0YA 4XMYA 4L0YB 3VSKA 1HDDC 3H9QA 2V6CA 3I58A 4C3HJ 3HGGA 2L7KA 2RS6A 3OOUA 3TQMA 2BXZA 4E6KG 2YRHA 1QU3A 3BP8A 4BYYA 2F5EA 1FMVA 5TRDA 5CPRB 2I10A 2A3SA 4XLCA 5E3OA 3GFMA 1NHAA 2ENCA 4D9JA 4L5IA 3BZ6A 2F5FA 4OWRB 4C2MJ 2JA6J 1FYMA 3JR9A 3BG3A 2K02A 2V7FA 2MGQA 2Z16A 1ONVA 1K4TA 1SR9A 4M30A 1LVAA 1YUIA 1V5EA 4KT6A 3MFKA 3VYXA 1ZELA 2EMKA 1R00A 4RM2A 1S72I 2XSDC 3DTKA 3OS2A 2RSIA 3PIOF 3V7CA 1TBXA 3BPVA 4XK4A 4HNVA 4FX4A 2VE7C 3IWFA 4XLAA 4PJLA 2EOEA 3F72A 3H3VK 4H4KC 3H9JA 1R9TJ 2R7XA 1WHUA 4WFTA 2EJRA 1JUMA 1XS9A 1J9IA 3Q0VA 1TQMA 3SQNA 1AKHB 1ZRDA 4GFBA 4CZCA 1OFCX 2L9SA 2A68F 5CVUA 3LSPA 2YTEA 3BJAA 2O9LA 2V86A 4F93B 3HZJA 5IWAE 2ZJPF 2LKXA 1IXCA 1XGSA 2DOAA 5HDNA 2XGDA 3THOB 3I55I 4DUZE 4NZVA 4I0BA 3T1YE 2KIMA 1ZLKA 1P6RA 3AFHA 1LUJB 1LEAA 3NWSA 2DMTA 3MKWB 2IGKA 3W2VA 4NC8A 4ZJZA 2NVXJ 5E1XA 4ON0A 3GZ5A 1POGA 4J8ZA 4BAYA 5IPAA 3GTKJ 3MZHA 4RS8A 4AQYE 1X6FA 2PRTA 1X58A 1GT0C 2HTSA 1R4MB 1XMXA 2M4IA 4E7JA 1DUXC 2E2JJ 5FKMA 1GVDA 1EH7A 3O2PE 4HLXA 2AHQA 4CCJA 5C3EJ 1TW3A 2GA2A 4OIPF 4KIGA 1KONA 3MWMA 4GYIA 3WTXC 2EPOA 4F3QA 1T98A 2E71A 1J26A 1MBKA 2JUGA 2EPXA 2E36A 2BE5F 1LJ9A 4MTEA 3ZMSA 5BPIA 2XASA 4O5GA 3S16J 2R4GA 1ZR4A 4Y15A 2W82A 2X51A 1XDUA 1LQ1A 1RZ4A 2QWWA 2EIKH 3DP7A 5ERIA 5F08A 5IP9J 1H9TA 3I54A 3HOVJ 3EQ1A 4IOCF 2RTXA 1XMKA 2LVHA 2R5YA 2V1XA 3KP3A 1K6OA 1AWCA 1RC7A 4OMZA 4B1RA 1YSAC 3VYTB 1ODDA 1A5JA 2EPZA 1D0YA 5FB2A 3RI4A 3PNYA 1UFMA 3T1BA 4FTHA 4M71A 3P9CA 2NABA 3LLHA 1FIPA 1ORKA 4R8HA 5A2QC 3E6CC 4A2UA 2L3DA 2DBBA 2W25A 2BY1A 4WX9A 2DFIA 1GQEA 3U21A 4RMNA 1YW8A 1U8RA 1NK3P 4CUGA 4YEJA 4WPYA 4O4KA 2IP2A 5FFZA 4R2SA 1OR7C 9ANTA 3LMMA 3BR0A 3MZ8A 2HQRA 1RNLA 4G6QA 2BOLA 4Z6YA 1IDZA 4LF5E 3I9V2 4UV8A 1Y1VJ 2IA1A 4UXNA 1D1CA 2M8EA 5KAIC 5K7HA 3HOSA 2ELZA 2O8XA 1N34E 2EFNA 1IN8A 1SVOA 2WC2A 4DGWB 1CF7B 1TC3C 1RESA 3KPHA 1DPRA 2Q0OA 3DU6A 5M3MJ 1F9NA 4LB5A 1T0FC 5JHUA 4MNUA 5ILVA 3DLAA 4IEJA 3ROUA 4MLVA 2P0WA 1UG0A 3OTOE 2EPUA 1D1BA 4E4HA 4DR2E 2EPKX 3F8NA 4HF1A 1EKZA 3PFYA 1XTAA 2E5NA 4M9XA 3KCCA 1XCVA 2XAHA 3RYRA 1SVLA 2GZWA 2QBYA 1FSHA 2R7TA 3HPSA 2HTJA 1W4MA 2UV1A 2XAUA 2WWYA 3ZMTA 5FRNA 2EA4A 5IOZA 2LUQA 2CQ7A 3K4MA 5DNYA 3ZXSA 2XC7A 2WZOA 3IWDA 3WHCA 2EMXA 3NEUA 2X6YA 5AE3A 2EL5A 1FP2A 3REOA 4KICA 2H1KA 1BN5A 5J1RA 1JK2A 1EV7A 3PQKA 5BNGA 2ELYA 1QRYA 2EPMX 4WXDA 4XRSG 1U0JA 1N25A 2HXOA 4HA8A 4BEHB 2PJRA 2IGMA 5J47A 5B66C 1WKMA 2EK5A 2PMHA 2DAOA 3CMAI 2FXAA 2STWA 5LD2C 3HRUA 1Q1VA 1HDPA 3BJOA 4QTRA 5H2FC 5GADJ 1JKRC 1D1AA 1JTYA 1OJLA 2V1UA 4A3DJ 1WHQA 5GTHC 1ZG1A 1IF1A 4CYCA 4A3MJ 2R7UA 1UHSA 3JRCA 3HSFA 3R6SA 3M8JA 3MVPA 3CP2A 2KIQA 4UVCA 2WY8Q 5GPAA 4DBQA 2HKOA 1FBSA 3HOUJ 5FD5A 3KYLA 2CSOA 1OMIA 3BZCA 1UMQA 1RI7A 2HFHA 3TP0A 1SD4A 3ECOA 1X4OA 2PEXA 5IYDJ 2CT1A 4KFCA 2M7AA 2F6CA 5J40A 1HCRA 2V83A 3HM5A 1YJNI 2VOOA 3HSRA 2EMFA 4N4NB 3Q5FA 1KYZA 1Y56A 1TP4A 4HF0A 4A0XA 5HS7A 1GDTA 5IT3A 3S3NA 2NVYJ 3TW7A 3C6MA 5KL6A 5GPCA 1U5TC 4R2CA 3CC2I 4D7NA 5FKKA 2LP0A 2VQLA 3SDGA 3MSWA 3SFZA 2DYSH 1FEXA 4ZDLA 5LEJA 4A69C 1TQPA 4BU2A 1ETXA 3HTUA 2WAQN 1EA3A 3OYAA 3S15J 2GIZA 3E97A 4R2PA 3LMLA 1I1SA 1N33E 2CW0F 4XOPA 4YY3E 3IH4A 4KN4X 3F23A 5HS9A 3AAFA 3VYYA 1FYLA 2XIGA 2M8GX 4O24A 3GZNB 4KHPE 2LOOA 4NXNE 1ZR9A 4DV3E 1ZHFA 2LBFB 2HS5A 2DMYA 2D2WA 2L7MP 2EOHA 5AASA 2V1DA 1P4WA 4RGSA 2KQRA 1UBDC 2I5UA 3ZOQB 1G8XA 2BVMA 3TO9A 1DDNA 2MDRA 2MA3A 4OIRF 5D4RA 2YTFA 2ZC2A 2LSOA 4BY7J 3EDPA 5M5YJ 1ZG5A 5DEQA 3K69A 4AVZA 3CUQA
chains in the Genus database with same CATH topology
4GGGA 5HLIA 2YR2A 4QLCU 1IRFA 4G6DA 4LK0F 2XRNA 4RB1A 3QU3A 3HHHA 3U2RA 5JI6A 2KJCA 5CVVA 2Z5UA 2K4JA 4UNOA 4KA4A 1S8NA 1ZYRF 2PFBA 3I5UA 2HQNA 2QYOA 1HKQA 2COMA 2HGCA 4XSZF 3VOEA 1Z1DA 3HYIA 1R22A 3FHZA 2DT5A 3HTSB 1G3TA 1BI0A 1ZREA 1D8KA 2VBZA 1KQ0A 4OMYA 1K79A 3M7GA 3RKXA 5E8IA 1BOAA 3E5QA 2RGVA 1C0WA 3I53A 1YQAA 3WGIA 2UXNA 1L0OC 1CF7A 2DU9A 3RJPA 1U78A 3V8KA 1R36A 2HR3A 3F22A 4LB6B 4ZYDA 4YIIA 2HYFA 2UZKA 3BROA 1ZG3A 2QLZA 1BM9A 2F5CA 4IPAA 3P7NA 1O3TA 5D4SA 3VODA 3KEOA 3DF8A 1IN7A 3GF2A 2VT3A 4UV9A 2P8TA 1ZARA 2P6SA 1OYWA 3CTAA 4OOIA 1S3JA 4HAMA 1XSXA 1I27A 1IXRC 1MDMA 5HS8A 4LK1F 1PDNC 1QZZA 1O7FA 1RUNA 3RDIA 2BBYA 4ESBA 5H6QA 1EH6A 1HKSA 5AIPA 2OZUA 1S7AA 2ZKZA 3FMQA 2ETHA 3R0JA 4GCVA 3RKWA 4JK1X 2LKPA 3MCZA 2DQRA 1FBQA 1XCBA 4LLNA 4LLGF 5L3FA 2V79A 4WF2A 4KNYA 2EV5A 3GFJA 4A0ZA 3I59B 1SD5A 4I01A 2FMLA 3ELKA 2E7XA 1OPCA 5DCMB 2RN7A 1OKRA 3Q9SA 2FNAA 5K5RA 1YIOA 3RTRA 3WU1B 3FXQA 3R0AA 1B59A 1KU3A 2GXBA 4EV0A 2VE8A 5F64A 4M6XA 3C18A 3KETA 4AIKA 3GFLA 2W24A 3GW2A 4KUMA 5F1RA 1LDKB 3KZYA 1RIOH 4YIFA 3NQOA 3LA3A 4EVIA 4I02A 1RUOA 1XN7A 1J0RA 2YSRA 5LEKA 1YW7A 2KIUA 2HEOA 1KQ8A 4M6YA 3N4MA 2NNNA 4DNCA 4WK8F 2IA0A 4Q5SF 3CO7C 1SFUA 1DPUA 2BGCA 3WE2A 3EETA 4UHTA 2GA1A 3WTYC 2V9VA 3IC7A 1EH8A 1IW7F 4U7DA 3LWFA 1BI2A 4BHBA 4M9ZA 4MEYF 2P7CB 4IF4A 4H0EA 5K1YA 1QNTA 2BEOA 4HX7A 2FE3A 1UCRA 4BXUA 1XGOA 1USSA 4KMFA 4ZZDA 2RC4A 2JPCA 5BPDA 3JSPA 3VFZA 2XROA 4ENKA 3F21A 3CUQC 5LBQA 2KRFA 4RGRA 1SFXA 2ESNA 1ZRFA 1CGPA 5DDGA 2H6BA 1J59A 2XVCA 2E7WA 4XRFA 1WI9A 2ZO4A 1QGPA 2VN2A 1A04A 2K7LA 2BYVE 5D5UB 4Q48A 2FSWA 1Z6TA 4RB3C 2ZNYA 3ZPLA 2PBIA 2JTVA 1ON2A 1B6AA 1U6GA 2A6EF 2XV4S 3LAPA 3E6MA 3FXRA 2PLYA 1F4KA 4PGHA 2IA2A 2EWNA 1E17A 3K9TA 1PP7U 2Z33A 3Q9VA 3F6OA 3GWZA 3L00A 4QWQA 5H20A 2XAJA 1XSDA 3KP4A 3CO6C 3BPXA 2JPBA 4EQQA 2ELHA 2VBYA 4NB5A 3KP5A 2O6GE 1X3UA 2JT1A 4ENJA 4N0BA 4A12A 1Z91A 1IN4A 3GLXA 4CO8A 4IHSA 1LB2A 3RPUA 2PJPA 2DQLA 2K4BA 4BQAA 5D5XB 1P4AA 2MH9A 3L09A 5ILSA 1TTYA 1YO5C 3JAMK 4WXHA 4A6DA 2VONA 4O5VA 3DKWA 2DTRA 2FOKA 1UHWA 2M87A 3HHGA 2XKPA 2IRFG 1MKMA 3HRMA 1S6LA 2MH2A 4CHUA 3P9IA 3U1DA 3GUDA 3COAC 4P5OA 5J6XA 1J75A 3LFKA 2YX7A 2GAUA 2O61A 1TW2A 3DXJF 3ERED 5EEHA 3F3XA 2XKOA 1FY7A 4KN7X 2FQ3A 1SD6A 3FMRA 4G7ZF 4ESFA 5DYMA 1USTA 2MLGA 4AWXB 1FOKA 3TQNA 1YS6A 1STZA 1ZRCA 4O3MA 1TNTA 2C6YA 3CUOA 5HLGA 2FNPA 1J2XA 1W7PB 5LLQA 2O03A 3EUHA 2CQKA 1ZGAA 1XGMA 3TDZC 2D45A 2J5OA 3GFIA 4YFKF 1SD7A 3I64A 1LDDA 3FF5A 2K27A 4HW0A 2M1BA 4UVAA 2JSCA 1W5SA 3JAMZ 1UHMA 2EFWA 4EJVA 2LF7A 1I6XA 1TLHB 2XUBA 3VEPA 1R5GA 1F1ZA 1ZAOA 3TOAA 3R61A 3RKYA 5BMZA 2OU2A 4ZYHA 1OYYA 1JHFA 2UXXA 1O3RA 3IKTA 3K2ZA 2A07F 1T2KA 5DD4A 3GXOA 4LD5A 4I2OA 5KK1A 5CLSA 3E3VA 3W6JB 4CYDA 1B9MA 2PN6A 2VT2A 3R60A 1O3SA 1ON1A 5FO5A 3CJNA 4KIFA 5KVRA 2W84A 4KYWA 5DUIA 1TQIA 4IJAA 4Y17A 2L4AA 1BC7C 4S04A 3TDUC 1SMYF 3R4KA 3GZ6A 3T8TA 4L5JA 1K78B 3FWEA 3IHUA 3WODF 1QPMA 4ZZLA 2DK5A 5J8FA 1WSUA 1O3QA 4P96A 1XGNA 2Y48A 4U0YA 1HW1A 3LSTA 3M8EA 2CWEA 3V4GA 1V3FA 3QAHA 4PDKA 3HRSA 2ZBKA 1VTNC 5FFXA 4EGZA 4EJOA 3KLOA 2RKHA 1FBUA 4L9TA 4XBFA 3JW4A 4M73A 4MEXF 1B9NA 4BNCA 3DEUA 4LG0B 2A6HF 2VODA 4A0YA 5L3BA 2IVMA 2P5LC 3EQLF 2E1CA 2GIVA 2DO7A 3F8BA 3QPHA 4IRHA 1R23A 1QZYA 1G4DA 4BHCA 5K5OA 2K86A 4IXAA 3TO7A 5A2QK 1BI3A 5ILUA 3NRVA 1KU7A 2G9WA 1K7AA 3GYHX 4L18B 1H9GA 2HYGD 1B1BA 2NS0A 5LHIA 4ENNA 1WRJA 1S7OA 2EV0A 2QENA 3ZN1A 3E6BA 2OZ6A 3DPLC 1O57A 3WU0A 1FPQA 2R3SA 1D3YA 3KLNA 4KT5C 4ASNA 5HVQC 3PFIA 4IRGA 1G6NA 5JVTA 3GO5A 1HBXG 1BIBA 2VBWA 2D1VA 4PCQA 1OYIA 1FC3A 3DV8A 2DPUA 4L9NA 4G8XA 1T39A 2VBXA 1WQ2A 2JRTA 1IN6A 3KP6A 4GO1A 4OINF 2NRAC 3M1EA 2WV0A 3D0SA 4LLLA 3BDDA 3C1DA 3O6BB 1R58A 3SHFA 3IKVA 3KP2A 2OAZA 3K1NA 4ZYEA 4O6JA 1S29A 2RDPA 1YLFA 2W85A 5A2QZ 2NAZA 2DPDA 4WXCA 3J81K 2P5VA 1JGSA 2R7DA 3HRTA 1AOYA 2PQ8A 1JXSA 1SMTA 5LRRA 5E18F 2WTEA 2EV6A 3P9KA 1O7LA 1MD0A 4XSXF 4EJTA 4RAZA 3OV8A 2P4WA 3MAJA 1K78A 3TKYA 3H92A 4EJWA 1FSEA 4XLPF 2X4HA 5L3CA 3WTVC 4A5NA 5LGNA 1FX7A 3DQVC 4AVPA 2ADUA 3F6VA 4HQEA 4G7HF 4IVNA 4EM2A 4TV7A 1KYWA 1J5YA 5FD6A 1DP7P 1L3LA 2ZXJA 3IL2A 2XGXA 2VC0A 2ZFWA 3ZMDA 4HZFA 5H6RA 2FEZA 4Y13A 4CDGA 2E1NA 5HDKA 1XDSA 3E5XA 3KEQA 4EM1A 3FMSA 4B8XA 3J81Z 1R1VA 2OQRA 2FBHA 2Q8KA 3F8CA 2ISZA 5HLHA 1GXPA 5CVJA 4OU0A 2J5PA 2FU4A 3GX4X 1KGSA 4U0WA 1ULYA 2MC3A 1J7KA 3LQRA 5DCFA 5EEGA 2CYYA 3WGHA 2L02A 2RQPA 2W57A 1JHHA 3ZN0A 4BHPA 2KIFA 3QU6A 2ZJ2A 2P7VB 1T6SA 3QRFF 4G94A 1GVJA 3EYIA 2EB7A 3KFWX 2ZCWA 1XMAA 5ICCA 3M9AA 5JR3A 2QVOA 1I5ZA 4HX4A 4MQVA 1H0MA 3HIFA 4Q4ZF 2L01A 3ZQ7A 4EJUA 5LGTA 3H3ZA 1YG2A 2IT0A 1ZLJA 2ZMEB 3BY6A 5D5VB 3DFGA 3DPTA 1IAWA 2IW5A 4F7ZA 3BWGA 1YFHA 5E17F 4CICA 2HWVA 4EMSA 2H09A 4YFXF 5HOOA 2R7FA 5TJJA 3I59A 3T0YA 5D5WB 3KP7A 2M30A 2X0LA 1FYKA 3SZPA 1R7JA 4N9HA 5D6EA 4B09A 4GYGA 4ZYGA 2VXZA 4GXOA 5DCMA 2JZYA 3IRQA 2XAGA 2A5YB 2GWRA 4HX8A 2M45A 2FBKA 3H3UA 1KU9A 3V8LA 4M72A 4UUVA 3CUQB 1G3SA 2FBIA 1Y0UA 1PP8F 4P55A 2DK8A 1PUEE 3BJ6A 3FM3A 4AD9A 3TOBA 2OBPA 2OD5A 3G73A 4HLYA 2F2EA 3MEXA 3L2CA 3RIRA 3JTGA 2QUFA 1BBYA 3B02A 4A6EA 3OOPA 4KMUX 2RV8A 3LA2A 3W6KB 2QZ8A 3ABUA 2MLKA 2LDUA 1ZH5A 3WGGA 4ESJA 1IZ1A 1LDJA 5BQTA 3ZMZA 3WTZA 3L9FA 4L9JA 1ZGJA 3ULQB 2ACJA 5ICEA 2DI3A 5BOXA 4OIQF 2Z9OA 4DQ2A 3WTSC 2H27A 2F5DA 3JTHA 2A61A 1R1UA 3K0LA 2XHKA 4ETSA 2UWMA 4E70A 1U2WA 3J80K 2FMYA 3V7RA 5ED4A 3HOTA 3V7SA 5AIQA 1KQ9A 3WTWC 2A69F 5LHGA 2FA5A 4N9IA 1U3EM 1G3YA 3F8FA 1Z9CA 2BV6A 5LGUA 2FF4A 3KE2A 5CJ9A 5ICGA 1MDMB 3L7WA 3LA7A 2QM3A 1P2FA 2OA4A 5AONA 4HV5A 3QP5A 4S05A 1ZN2A 4FHTA 3ZMVA 1GHCA 5L3EA 2ZMEA 5ICFA 2ZNZA 3K1PA 2PG4A 3HSEA 3KZZA 4U7BA 4M9SA 4PZJA 1HKTA 1MJ9A 2HKXA 1QQIA 2AS5F 3T5XA 1IXSB 3ZMUA 4HF2A 3QPTA 2VC1A 3WTTC 5CYVA 5LRSA 1XSVA 3WE3A 3C3WA 2RVCA 3ZP5A 3D5LA 1W7PD 3I71A 1BC8C 4HBLA 3LQQA 5JFRA 5FGMA 4A5MA 4YFNF 1MGTA 3J80Z 4YG2F 4EGYA 3ISPA 3GEZA 1MZBA 3JSOA 3N97A 2Z99A 1UB9A 2P5KA 4JBAA 1FNNA 3IWZA 1FWZA 4D0PA 4IRIA 4HV6A 3VB2A 1LNWA 1XD7A 4MTDA 2VOPA 1YTYA 1MJBA 3CDHA 1HSTA 4Q47A 4ENMA 1FT9A 3BOQA 4NHJA 2VE9A 4AIJA 5L3GA 3WG9A 3FM5A 2L54A 1U5TB 1LEBA 2EFPA 4IHTA 3E6DA 5DUKA 4L0ZB 4FX0A 5DD8A 2L4MA 1REPC 1HW2A 1HSJA 3MZYA 1TNSA 5D6FA 1G3WA 1GXQA 1F5TA 2YPRA 3RYPA 1W5TA 1FP1D 3HUGA 2IJLA 2H94A 1WWXA 5D8LB 3QP6A 4LMYA 3TGNA 1W7PA 3CLOA 5CVRA 2KKOA 2B0LA 3FXUA 2QQAA 1P92A 2Q2EA 3C7JA 2D1HA 2CFXA 2TDXA 1E2XA 3GVAA 4NQWA 4G7OF 1FLIA 1BIAA 5BS6A 4RGXA 4I0AA 4LGWA 3SZTA 3MQ0A 5D8KB 2NNYA 1JE8A 1Z05A 5HDGA 1B4AA 1D5VA 1QO0D 3B73A 4RB2C 3ML6A 2AXLA 3I4PA 2CG4A 4Z2YA 5L3DA 1FZPB 2CGPA 5E1WA 2QQBA 2XAQA 2YX4A 3I0TA 5IT9K 1OR7A 2P6TA 3FX3A 5E8GA 3CUQA 1I1GA 1SAXA 5FLXK 1IUYA 4I98B 4G9YA 1T0FA 1YYVA 6PAXA 2FRHA 4M74A 3T8RA 4I09A 2CO5A 1Z7UA 3LAJA 2EA2A 1D8JA 5K5QA 4RB0A 3RPQA 3K1MA 4AIHA 4FT8A 2LF8A 4MGRA 2PI0A 2ISYA 2Z3YA 4K2EA 2EFOA 1YS7A 4XLNF 1IN5A 4MHGA 2G7HA 4LJZF 2GXGA 1HQCA 1Q1HA 2RNJA 4CGZA 1HXDA 2Y0MA 1XB4A 2G7UA 3SXYA 1R5HA 1IRGA 5J8CA 2EFQA 1V4RA 2YU3A 2STTA 5LHHA 3S2WA 1SFEA 3WTUC 3IRRA 4U88A 3G3ZA 2DW4A 3M8FA 5F6FA 1Z6RA 3FZVA 2O3FA 2LNBA 3PQJA 4RGUA 4HYEA 5CVIA 1HW5A 4I7HA 5IT9Z 2KJBA 4LG0A 4HDVA 4HOBA 2HDCA 4CZZA 3QOPA 1KU2A 1U5TA 1KA8A 2NYXA 4RAYA 4CXFA 2Y75A 4R1HA 2HOEA 5FLXZ 3ABTA 3ECHA 4U0VA 4UVBA 4PGGA 5E20A 1QBJA 4HDUA 2MBFA 2M5WA 4JQFA 1BI1A 2MD5A 5E1ZB 5DV5A 4EM0B 3EYYA 2XAFA 3F8MA 2ESHA 4HQMA 2GQQA 2H6CA 2IPQX 1T38A 1MJAA 4WCGA 2QBYB 4P9FA 3U9GA 3O3KA 3TO6A 1P4XA 1R1TA 2OQGA 4KDPA 4LFUA 4KIBA 2QQ9A 4P9UA 3E5UA 4BH9A 3V8JA 1YW9A 4OIOF 2HZTA 4L9VA 4ZH4F 2PMUA 4WWCA 3J7AO 1BJAA 2DLLA 2O0YA 4L0YB 3I58A 2V6CA 3BP8A 4BYYA 2F5EA 5TRDA 2A3SA 3GFMA 1NHAA 4L5IA 3BZ6A 2F5FA 1FYMA 2K02A 1ONVA 1LVAA 3MFKA 1R00A 3V7CA 1TBXA 3BPVA 4FX4A 3IWFA 3F72A 2EJRA 1J9IA 1TQMA 3SQNA 1ZRDA 5CVUA 2A68F 3BJAA 1IXCA 1XGSA 5HDNA 4I0BA 2KIMA 1ZLKA 1P6RA 1LEAA 5E1XA 4ON0A 3GZ5A 4BAYA 3MZHA 4RS8A 2HTSA 1DUXC 1EH7A 3O2PE 4HLXA 1TW3A 2GA2A 4OIPF 4KIGA 3MWMA 4GYIA 3WTXC 1T98A 2BE5F 1LJ9A 4MTEA 3ZMSA 5BPIA 2XASA 4Y15A 1XDUA 1LQ1A 1RZ4A 2QWWA 3DP7A 5ERIA 1H9TA 3I54A 1XMKA 2V1XA 3KP3A 1K6OA 1AWCA 4OMZA 1ODDA 5FB2A 3RI4A 1UFMA 3T1BA 4M71A 3P9CA 4R8HA 3E6CC 4A2UA 2L3DA 2DBBA 2W25A 4WX9A 2DFIA 1YW8A 1U8RA 2IP2A 5FFZA 2HQRA 1RNLA 4G6QA 4UV8A 2IA1A 4UXNA 2M8EA 3HOSA 2O8XA 2EFNA 1IN8A 2WC2A 1CF7B 1DPRA 2Q0OA 1F9NA 4LB5A 5JHUA 4MNUA 5ILVA 3ROUA 3F8NA 4HF1A 4M9XA 3KCCA 1XCVA 2XAHA 3RYRA 2GZWA 2QBYA 1FSHA 2HTJA 1W4MA 2WWYA 3ZMTA 2EA4A 3NEUA 1FP2A 3REOA 4KICA 1BN5A 1EV7A 3PQKA 4WXDA 4HA8A 1WKMA 2EK5A 2PMHA 2DAOA 2FXAA 2STWA 3HRUA 3BJOA 2V1UA 1ZG1A 1IF1A 3HSFA 3R6SA 4UVCA 2HKOA 1FBSA 5FD5A 2CSOA 1OMIA 1RI7A 2HFHA