1EH8A

Benzylated human o6-alkylguanine-dna alkyltransferase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
175
structure length
165
Chain Sequence
b'CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O6-ALKYLGUANINE-DNA ALKYLTRANSFERASE
publication title Active and alkylated human AGT structures: a novel zinc site, inhibitor and extrahelical base binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 40
structure length 165
sequence length 175
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2000-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1eh8A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1eh8A01
1BBYA 4N0BA 2PLYA 3T5XA 4CGZA 3E97A 3HSRA 3F22A 1FYMA 1IRFA 2GAUA 5D6FA 4KFCA 1TQPA 3TOAA 3WTZA 5FB2A 3JAMZ 5CVJA 3GEZA 4AVPA 1D8JA 4M71A 6PAXA 4M9ZA 2NYXA 2M30A 3C18A 4UVBA 2VC1A 1EH7A 3T8RA 1I1GA 3HOTA 3TO6A 1JXSA 4OU0A 4XRFA 2MH9A 1W7PA 1F4KA 3BJOA 1SD7A 1TW3A 1R23A 2YX4A 1QNTA 2MA3A 2XAQA 1T98A 4YG2F 2XRNA 4UXNA 4U7DA 2COMA 5IT9K 2XAHA 3HRMA 1R1VA 4BXUA 1R1UA 1DP7P 2IA1A 4Y15A 1LEAA 2P7VB 4RGXA 4L0YB 2QWWA 5D8LB 4RGSA 3F8MA 3K1NA 2IPQX 2M5WA 5EEGA 1OYYA 3DV8A 2BBYA 1T39A 1IN6A 2FMYA 2FNPA 1TNTA 3VEPA 2H94A 4OMZA 4A2UA 1H9TA 4OMYA 4YFNF 5L3FA 3MZHA 4L9JA 1TLHB 3RYPA 3W6KB 4IF4A 4G9YA 4UUVA 3CTAA 3GF2A 2RVCA 5D4SA 1G3TA 1QZYA 4FT8A 2F5FA 3LA2A 5D5WB 4PZJA 1ZG3A 4HF2A 1C0WA 2QVOA 1O7LA 5D8KB 2P6TA 1KU7A 2NS0A 1Z6TA 4MTDA 4BHCA 2WTEA 1XCVA 1LQ1A 1R22A 1J75A 5FFXA 1ZRDA 2IJLA 1S6LA 1KQ8A 5E8GA 2ZMEA 5K5OA 3T8TA 2LKPA 1UHWA 5CVUA 1SAXA 3COAC 3HUGA 4Y13A 3QU6A 1YS7A 5FD6A 3GZ5A 3QOPA 2A68F 1O3RA 3I4PA 3BJ6A 4K2EA 3P9CA 3M7GA 3T0YA 1MD0A 1JE8A 1B59A 4HV5A 1LDDA 4JQFA 1XSDA 1FSHA 4F7ZA 1ZREA 1J7KA 3IWFA 4A0YA 1D5VA 2VT3A 1XSVA 4ENNA 3GFMA 3KP4A 2HKOA 2XAFA 3CUOA 1FP2A 1O3QA 1R00A 2JRTA 4UV9A 3EETA 3GFLA 2XUBA 1FZPB 2QQAA 2HTSA 3G73A 5F64A 3C3WA 4LK0F 4YFKF 3RYRA 1BI0A 2JT1A 1Z7UA 3MZYA 2F5DA 2PQ8A 4A6EA 3DKWA 1SMTA 5HLHA 1PP8F 1XGSA 4A5MA 2NNNA 3KE2A 3ROUA 3LA7A 3FMSA 3PQJA 2YX7A 4KDPA 3M8EA 5HDNA 3J81Z 2O3FA 2MBFA 4EJUA 2KIMA 1J59A 2PG4A 1IN8A 2HZTA 3FMRA 1H0MA 2W24A 4ZZLA 4G7ZF 1R58A 1YW7A 1WI9A 2UWMA 3R4KA 5LEKA 2FRHA 2DAOA 3K9TA 3C7JA 2GIVA 3U2RA 2DPUA 2GQQA 1O7FA 4CHUA 1XD7A 4KYWA 3KEQA 4G7HF 1GXQA 1ZG5A 2FEZA 3BWGA 4L5IA 1LB2A 2P4WA 2ESHA 5DCMB 2DK5A 4BHBA 1YYVA 3I59A 2Y75A 3KETA 1O3SA 4E70A 1G4DA 1RZ4A 5LGNA 3Q9SA 1W7PD 1LJ9A 2EFNA 1KYWA 5LHGA 3F72A 4LK1F 4Q48A 2A61A 1ONVA 3CUQA 2AXLA 1QQIA 2OU2A 1J9IA 1HKQA 2VOOA 3BOQA 1CF7B 2A6HF 4NB5A 3HHGA 1RUNA 3TGNA 3QP6A 1R5GA 3HHHA 2J5PA 2ISYA 5HS7A 1TTYA 4BQAA 1FP1D 4OINF 3N97A 2G7UA 1HKSA 1S8NA 4CDGA 3GVAA 3MWMA 3RPQA 4M6YA 4LLNA 5ERIA 2RN7A 3BY6A 1OMIA 2IVMA 1U5TB 2NAZA 2K4JA 5EEHA 1YQAA 4G7OF 3ZP5A 3K0LA 3CJNA 3HTSB 1ON1A 4L9VA 4M74A 4OIQF 5K5RA 2QQ9A 1QPMA 5DEQA 3JTHA 4PGHA 1YIOA 2BGCA 5K5QA 2XKPA 3FMQA 2FXAA 1B1BA 1EV7A 1IRGA 5E18F 2HS5A 3LAJA 1I5ZA 4B8XA 2VBWA 2FBKA 3K1PA 1F5TA 3O3KA 4ZYEA 1YFHA 3J80K 4XSXF 4JK1X 1BN5A 3GO5A 3QPTA 5DD8A 1STZA 5A2QZ 4L18B 3TDZC 4WF2A 2XROA 2ZNZA 4G94A 1OPCA 2V6CA 1L0OC 2W84A 5J8CA 4L9TA 2IW5A 1FBUA 5KVRA 2DW4A 5J6XA 3KP2A 5JHUA 1U5TC 3NRVA 1O3TA 4HV6A 5LLQA 2M1BA 2L4AA 3FXRA 5E1WA 2CQKA 5L3GA 1IAWA 1K79A 3RDIA 2VODA 3ERED 4XLPF 2BV6A 4EM1A 4RGRA 2X0LA 3I58A 1S29A 4LB6B 3IRQA 4HX4A 1G3SA 4KIFA 2LF8A 3H3UA 1E17A 2JZYA 3H3ZA 2OZUA 4HBLA 2WV0A 2FF4A 3WTWC 2ZKZA 3V4GA 3IL2A 5L3BA 2VBYA 4H0EA 2FBIA 1ZYRF 2ELHA 2PI0A 1HW1A 1MGTA 2VN2A 1W4MA 4IHSA 5CJ9A 3TQNA 2VE9A 3E5XA 5ICGA 2R7FA 4EJVA 2M8EA 1T0FA 2HTJA 3DP7A 2PFBA 5CLSA 5DYMA 5E1XA 4HW0A 3FF5A 3KCCA 4ZYHA 4KUMA 2V79A 1O57A 4M6XA 1PDNC 3GZ6A 5AIPA 5ICCA 2Q0OA 5BMZA 1ZARA 2ISZA 1MJAA 4N9IA 2CW0F 1FYLA 4WXDA 5DCMA 2L01A 2XASA 2YPRA 3IKTA 4I09A 4QLCU 1BI2A 1RIOH 1XGNA 5L3DA 3J81K 2HQRA 4LJZF 3JW4A 2HOEA 5DUKA 3GW2A 3HIFA 4KA4A 1R5HA 1XB4A 4OIPF 3FHZA 5FO5A 3SZPA 4ENJA 3CO7C 4DNCA 2Z33A 3WTXC 2PEXA 3OOPA 3ISPA 4PGGA 1CF7A 2Z99A 2VT2A 5L3EA 1IXSB 1IUYA 1QO0D 3SHFA 1DDNA 2K4BA 4EM2A 3BROA 3TKYA 2DTRA 3U9GA 2QQBA 2ACJA 4AIHA 2PMHA 5BQTA 3J7AO 1TW2A 1E2XA 2L02A 4LGWA 3U1DA 2UXXA 4P5OA 5E20A 5H6RA 3W6JB 3IHUA 2EV0A 1IN5A 2RKHA 1YS6A 1IW7F 2YR2A 2KIUA 4M9XA 4CYDA 5TRDA 1TNSA 2P5KA 5DV5A 3ZMVA 4ESFA 1MJ9A 1S3JA 4JBAA 5BS6A 3FZVA 3GWZA 4ESJA 1VTNC 2ADUA 1Z9CA 2ZBKA 3D0SA 2QM3A 5DUIA 2KJCA 1REPC 1HW5A 2JPBA 2XKOA 5HLGA 1QBJA 3D5LA 2H09A 2FQ3A 3NEUA 2HQNA 2DFIA 4FX0A 1Z6RA 4WWCA 2E1CA 4RGUA 3MAJA 3WGIA 2G9WA 2XAGA 3VFZA 3LFKA 4EGYA 4M73A 2CGPA 3GYHX 5LGUA 1HSTA 5LBQA 3GLXA 3RJPA 1FBSA 4NHJA 4ETSA 4HZFA 3ZMSA 4TV7A 1ZG1A 5DCFA 3ULQB 1I27A 2PBIA 5ICEA 5FLXK 3WE3A 1F1ZA 4LG0B 1WQ2A 4GO1A 5LRSA 3DFGA 1USTA 3VODA 1MDMB 2JSCA 3V8JA 1UHMA 1U6GA 4Q5SF 1OYWA 4YIFA 2FU4A 1YTYA 3I71A 2QUFA 4EJTA 2ZJ2A 4OOIA 2V9VA 4I02A 3HRTA 5BOXA 2DLLA 3QAHA 4D0PA 3S2WA 2V1XA 2PJPA 4WXHA 2HEOA 2ZFWA 2FOKA 4RS8A 3F8BA 1KA8A 1SFXA 1D8KA 2QBYB 2GWRA 1ZH5A 1UFMA 3F21A 4L9NA 1IN7A 5LEJA 4R1HA 1FY7A 3EYYA 1MZBA 2EFOA 4WCGA 4FHTA 5F6FA 2H27A 2OAZA 3G3ZA 1QZZA 1J5YA 1XMKA 2L3DA 3QPHA 4HDUA 4IHTA 1XDSA 3OV8A 4PCQA 2LDUA 4S05A 3TO7A 4BH9A 3L7WA 1NHAA 4HQEA 2KKOA 5LGTA 2OBPA 3CO6C 1LDJA 2HYFA 4RB1A 4IRIA 3SFZA 5HDGA 1EH6A 3IRRA 4AIKA 3E5UA 5D5XB 1XN7A 2ZCWA 2EV6A 3QP5A 2GA1A 4EQQA 5BPIA 3HYIA 4U0WA 3P7NA 1U2WA 3R6SA 5IT9Z 4G8XA 1YG2A 2QLZA 1X3UA 3KLNA 2J5OA 3EYIA 1KQ0A 4KN7X 1YO5C 2V1DA 1P4AA 2Y0MA 1CGPA 5D4RA 3BZ6A 3VOEA 2O8XA 2K7LA 3ZN0A 3JAMK 5F1RA 2OQGA 2A5YB 1AWCA 1YW9A 3RKYA 2W25A 4MTEA 1B9NA 3SXYA 3BP8A 4P96A 2P5VA 3F8NA 4PDKA 2VBXA 1KQ9A 3Q5FA 2DU9A 2RC4A 2DQLA 1HBXG 1SMYF 3SQNA 3FXUA 4N9HA 3I0TA 4G6QA 4BNCA 3FWEA 1KU9A 1ZGJA 1TQMA 4ZYDA 2XIGA 5HLIA 2FBHA 4ESBA 2XGXA 5LRRA 4HLXA 1ZGAA 5DD4A 3LA3A 3M9AA 4Z2YA 3LQRA 4HQMA 3PQKA 3E3VA 2LF7A 2CFXA 2M87A 4LB5A 2CO5A 2FSWA 4CO8A 2D1HA 4U7BA 1BM9A 2H6CA 2EB7A 2HGCA 2VXZA 3VB2A 1G3YA 1HQCA 1U8RA 2X4HA 5D5UB 1KU3A 1U3EM 2EV5A 3L00A 2FE3A 3FXQA 1BI1A 4CICA 2K02A 4IVNA 1WKMA 5AIQA 2Y48A 3WTYC 3IWZA 2EFQA 2OQRA 2WWYA 5K1YA 1DPUA 2ZMEB 1HSJA 3REOA 2VC0A 4LG0A 3K69A 1LVAA 3DF8A 2YSRA 1MDMA 3V7CA 2DBBA 3R0AA 3L09A 1R36A 4B09A 1V4RA 4MEXF 5BPDA 4HF0A 2ZNYA 1A04A 4S04A 3F3XA 3WTUC 1W5TA 4HLYA 2QBYA 4MEYF 2KJBA 1SD6A 1FNNA 1IN4A 1ZAOA 2UZKA 4Q47A 3RKWA 4G6DA 2D2WA 3ML6A 5HDKA 3RTRA 1QGPA 3O6BB 1K7AA 1SFUA 2STTA 2Q2EA 4NQWA 1JHHA 3LWFA 5ILVA 5FFZA 1JGSA 3AAFA 2DI3A 1UB9A 3ZN1A 4YFXF 1P4XA 4Q4ZF 4ON0A 4IJAA 5HS8A 3ABTA 4I2OA 2O6GE 4P9UA 3K1MA 3KEOA 3O2PE 3ECOA 3WU1B 4HDVA 3P9KA 3GFIA 2K27A 4XLNF 1J2XA 3ZMTA 1P4WA 4BYYA 4KIBA 4EJOA 1MKMA 2HR3A 4HAMA 3KZZA 4HX7A 3MFKA 2GZWA 3EQLF 2CSOA 2Z5UA 2CYYA 3Q9VA 1XGOA 4LMYA 1TQIA 3R60A 4RAZA 1KYZA 2QYOA 1LEBA 1PUEE 4KICA 3DXJF 2ZO4A 1WSUA 2MLGA 4UVAA 1ZHFA 3IC7A 2O61A 3WTVC 2VE8A 4P55A 1IF1A 3B02A 1R7JA 2CG4A 3HOSA 2FMLA 3QRFF 3JSOA 4RAYA 2PN6A 3I59B 5IT3A 3IKVA 1GHCA 1ZRFA 4OIRF 3HSFA 1RI7A 3FM3A 4EV0A 2EFPA 4I7HA 3H92A 2EA4A 3I54A 4GXOA 2Q8KA 2K86A 3ZMZA 2A69F 1JHFA 2GXGA 2R3SA 1U5TA 1ZN2A 3CUQB 2MH2A 2D1VA 2DO7A 1ON2A 3V7SA 4ASNA 4RB2C 1SFEA 1K6OA 2FNAA 3NQOA 4A5NA 3LQQA 4ENMA 1D3YA 1Q1HA 4KIGA 3ZPLA 4LFUA 4L0ZB 2XAJA 2F5CA 5E1ZB 1YW8A 3GX4X 2D45A 1LNWA 1XSXA 4BHPA 2MD5A 3P9IA 4QWQA 3I64A 1UCRA 3J80Z 4IRGA 1T2KA 4WK8F 3F23A 1V3FA 4MHGA 3ELKA 4O3MA 1BC7C 4U0VA 4GYGA 2DK8A 4LD5A 2CWEA 4I98B 2HWVA 2A6EF 3PFIA 1PP7U 4MQ9F 2YU3A 2HYGD 2HFHA 3ECHA 3ZMDA 5H20A 3BPVA 3I5UA 3LSTA 4GCVA 4P9FA 3B73A 3L2CA 2OD5A 4A0ZA 4OIOF 1ULYA 4UVCA 1ZLKA 3ABUA 3RIRA 2P5LC 3JSPA 3CUQC 3WG9A 3EUHA 1G6NA 4U0YA 3RI4A 3F6OA 2XVCA 2E7WA 5LHIA 4IRHA 2MC3A 4I0AA 3K2ZA 4M9SA 1S7OA 3TOBA 3E6CC 4R79A 4I01A 4O6JA 1FC3A 1L3LA 3WU0A 3I53A 4U88A 2IRFG 1XCBA 1G3WA 2EA2A 5A2QK 5FGMA 3RPUA 1S7AA 2OA4A 4KNYA 1BC8C 4KMFA 1DUXC 5JVTA 1Z1DA 4AIJA 1DPRA 4O5VA 4HOBA 4IPAA 4WXCA 3SZTA 5HVQC 2RNJA 2HDCA 4UHTA 4HX8A 3TO9A 1B4AA 3ZMUA 5CVRA 2QZ8A 4AWXB 1OR7A 2G7HA 3HRSA 1I1SA 3WGHA 3V8LA 1BI3A 4WX9A 1BOAA 3KP5A 4XBFA 2IA0A 3WTTC 1FX7A 5L3CA 3N4MA 4CZZA 2F5EA 3F8FA 1BIBA 4RB3C 2IP2A 2DPDA 4LLGF 1ODDA 4UV8A 3T1BA 3MQ0A 2E1NA 5DDGA 2VBZA 5CVVA 1FLIA 1Z05A 2EJRA 1ZLJA 3M1EA 5ILSA 3R0JA 4ENKA 2MLKA 1K78B 3KP7A 3FX3A 2M45A 1WRJA 1FSEA 2RV8A 1MJBA 2NRAC 3CDHA 3WE2A 2JPCA 4ZYGA 1KU2A 2GA2A 2EFWA 4EJWA 3F8CA 5CVIA 4A0XA 3KP3A 1B6AA 2A3SA 4LLLA 3BJAA 3HTUA 5FD5A 2H6BA 2F2EA 2RDPA 3JTGA 1RNLA 4XSZF 1H9GA 5AONA 1FPQA 1RUOA 1I6XA 1XGMA 1ZRCA 4YIIA 3F6VA 1SD5A 1FYKA 4I0BA 3KZYA 3L9FA 2GXBA 2QENA 1IXRC 5JR3A 3DPLC 1USSA 4FX4A 2P6SA 1W7PB 2XV4S 2KIFA 1KGSA 1FWZA 3M8FA 2R7DA 3KLOA 2IT0A 4KN4X 5D6EA 4A12A 2A07F 2PMUA 4MGRA 1HW2A 4GGGA 4EGZA 3GXOA 4KT5C 1GXPA 1EH8A 2STWA 4AD9A 1AOYA 4UNOA 2RQPA 4HA8A 1F9NA 1FBQA 3DQVC 5TJJA 2OZ6A 3WODF 2DT5A 4HYEA 3RKXA 3DEUA 1BJAA 3MEXA 1B9MA 2B0LA 1XMAA 5JI6A 4MQVA 3WGGA 1IZ1A 4ZZDA 1HXDA 1FT9A 2HKXA 2ETHA 2O0YA 2W57A 3HSEA 3DPTA 1R1TA 2P8TA 1BIAA 1P92A 4Y17A 2VONA 4L5JA 3CLOA 3MCZA 2AS5F 2E7XA 2ESNA 5H6QA 1LDKB 5ILUA 2L54A 2W85A 2KRFA 1Y0UA 2Z3YA 1T38A 3R61A 2O03A 1FOKA 4RB0A 1W5SA 4IXAA 2NNYA 5ED4A 5FLXZ 2XHKA 4DQ2A 5E8IA 2L4MA 4MNUA 4GYIA 1P2FA 5HS9A 2EK5A 4ZH4F 3ZQ7A 2UXNA 4EVIA 2BE5F 3KFWX 2TDXA 3TDUC 3HRUA 3QU3A 3GFJA 1U78A 2FA5A 1YLFA 4EMSA 2RGVA 5J8FA 5KK1A 3E5QA 3KP6A 4EM0B 2JTVA 1P6RA 2Z9OA 5HOOA 3V7RA 3WTSC 3EDPA 2C6YA 2P7CB 2EWNA 3E6MA 2VOPA 3BPXA 2ZXJA 4BAYA 3LAPA 1J0RA 1T6SA 1SD4A 4HF1A 2IA2A 1TBXA 1Z91A 3GUDA 1HKTA 3E6BA 2BEOA 5E17F 1IXCA 3E6DA 3V8KA 5D5VB 4A6DA 3C1DA 5JFRA 2LNBA 2BYVE 4M72A 1GVJA 2LSOA 5CYVA 4R8HA 1XDUA 3BDDA 1OYIA 4KMUX 3FM5A 1K78A 5LHHA 5ICFA 2DQRA 2WC2A 2V1UA 1OKRA 1WWXA 4CXFA
chains in the Genus database with same CATH superfamily
3JRCA 1W36C 1VQ9I 5FLVA 1RPWA 3K6QA 4JI2E 2EMXA 3CZ6A 2VQEE 2L3CA 4Y4RA 2EN4A 1BBYA 5GAGJ 4N0BA 2PLYA 4GKJE 2EPAA 3RQ4A 3T5XA 1NK3P 4CGZA 1DI2A 4F6NA 3CLQA 1ZGWA 2Z16A 1BW5A 2GIZA 3E97A 3HSRA 1LE8A 2V6EA 4Q28A 4WPYA 3F22A 1FYMA 1IRFA 2DODA 2GAUA 2AHQA 5D6FA 3ZXSA 4KFCA 3MVPA 4IO9F 1TQPA 1MBEA 1XS9A 2LREA 4NC6A 3JRAA 3TOAA 2KRHA 3F0CA 4LOCA 3WTZA 2EORA 2YU8A 3PNYA 2XPUA 5FB2A 2EZKA 5EYRA 3JAMZ 4IOAF 2W4SA 3GEZA 5CVJA 4AVPA 4A3MJ 2GXAA 3CC7I 1D8JA 4M71A 6PAXA 3AG4H 4M9ZA 1W0UA 2NYXA 1VQNI 1KJKA 1FKAE 2M30A 3C18A 4UVBA 1X49A 2EE8A 2VC1A 2DYSH 1EH7A 3T8RA 2CQXA 5JLWA 1I1GA 3HOTA 2LJUA 3TO6A 5IY5H 1JKOC 1XMXA 1JXSA 1V5GA 4OU0A 4XRFA 2M9AA 1IDYA 1WJEA 2MH9A 1W7PA 5KL6A 5H2FC 4UB6C 1F4KA 2EOEA 3BJOA 1MEYC 1SD7A 1TW3A 1R23A 2V87A 2WA0A 2YX4A 4JI6E 4J01A 1QNTA 2MA3A 5FKMA 4DJAA 2XAQA 2COBA 4BQOA 1T98A 4YG2F 2XRNA 4UXNA 4U7DA 2CH0A 1VQ6I 2COMA 2JY9A 2JA6J 5IT9K 2XAHA 3HRMA 3LOCA 1R1VA 3PL8A 2KPMA 4BXUA 2CT1A 1R1UA 3BTJA 1DP7P 2IA1A 4Y15A 4E7IA 1LEAA 2BY0A 2P7VB 4RGXA 1POGA 3L2RA 4L0YB 2QWWA 5IWAE 1K6YA 4RGSA 5D8LB 1R4NB 3F8MA 3K1NA 2EQ3A 4X9JA 2IPQX 2M5WA 2DFFA 3ZQCA 3BZCA 2YTPA 1T4NA 5EEGA 3BR6A 2M4GA 1OYYA 3DV8A 1WJAA 2BBYA 1T39A 1IN6A 3GTKJ 2UUCE 2FMYA 2FNPA 1TNTA 3VEPA 2H94A 4OMZA 4A2UA 5DM7F 1H9TA 4OMYA 4WSPA 3A4CA 3PJRA 4YFNF 3S2DJ 2LUQA 1JK1A 5L3FA 2CV2A 3MZHA 1YHQI 1HC8A 4L9JA 2MKNA 5M5YJ 3LSPA 1MNEA 1TLHB 2RREA 1A1KA 4XORA 2XPVA 3RYPA 1YUIA 3W6KB 1L4SA 5FJ8J 4IF4A 4G9YA 2ODRD 2I10A 1BR4A 4UUVA 2E5LE 3CTAA 3GF2A 2A6TA 2RVCA 5D4SA 2VQCA 1G3TA 2HXIA 1QZYA 4FT8A 2F5FA 4NUBA 2JVGA 2EM9A 3LA2A 1YJWI 4Q35B 5D5WB 2M7BA 1VQPI 4PZJA 1ZG3A 4HF2A 2EPNA 4DV3E 1NEIA 1C0WA 2NOGA 2LK2A 2J7JA 2QVOA 2QSHX 1O7LA 2YRHA 1QVTA 5AC5A 3W3CA 3ABKH 2VJ4A 5IP6A 4R2CA 4R2AA 3G71I 5D8KB 2P6TA 1KU7A 1ZBQA 2NS0A 1Z6TA 2E72A 1U9NA 4MTDA 3KX2A 4BHCA 2WTEA 5KL3A 2LY9A 1XCVA 2Y0SN 4WSGA 4HNVA 2MD0A 1H89C 1LQ1A 4BUPA 1R22A 5EGOB 1J75A 2KOUA 4II3A 5FFXA 4PK4A 2DB2A 1ZRDA 2IJLA 1S6LA 4Y7NJ 4HTGA 2XDVA 4BEHB 1NH3A 3CJTB 1KQ8A 5E8GA 2UXDE 4A3JJ 2RSMA 4N4RB 1ZELA 2ZMEA 2EPXA 3BIDA 5K5OA 2V89A 2R7SA 4LU9A 1G2HA 2JK3A 3T8TA 4CA0A 2JWTA 2LKPA 2KDZA 1ZR4A 1P7IA 2ICWG 1UHWA 2X1CA 1UAAA 5CVUA 1TP4A 2BXYA 4D5FA 1SAXA 2OUMA 4C2TA 2VQFE 4D7NA 4HG2A 3HUGA 2BXZA 3COAC 4Y13A 1B69A 3SEQA 3QU6A 1YS7A 2HQAA 5FD6A 3BGHA 2PJRB 3GZ5A 3QOPA 1JTYA 1SR9A 2HVSA 1YSAC 1LVKA 2A68F 5FKKA 1RETA 1O3RA 2R5ZB 3I4PA 3BJ6A 3A0HC 3H35A 4K2EA 2YU9J 4YHHE 4J00A 3P9CA 3M7GA 3T0YA 1MD0A 1BW6A 3CCRI 1JE8A 1B59A 3SEZA 3MHSC 2AO9A 2X85A 4HV5A 1LDDA 1I50J 3TP3A 4JQFA 5FROA 5C4XJ 3MD2A 1XSDA 2XSDC 1FSHA 2ZXIA 3AG2H 3TQMA 4U87A 1N33E 4F7ZA 1ZREA 3BR5A 1X4OA 3GBGA 1J7KA 3IWFA 4N4OB 1T08B 5F27A 4A0YA 2R5YA 1D5VA 3X2QH 1MH3A 2VT3A 1XSVA 2QA4I 4ENNA 1OQYA 3GFMA 3KP4A 2HKOA 4LIUA 2EMFA 3GZNB 5IOZA 4NXNE 4IOCF 2XAFA 2JVAA 1FIAA 3CUOA 3Q0VA 3QYBA 1I6HJ 1FP2A 1O3QA 1R00A 2JRTA 5TGTA 4D7MA 4UV9A 3EETA 2A25A 1XX5A 3HPHA 3GFLA 2XUBA 1FZPB 3M99B 2DIXA 2QQAA 3ZQFA 2HTSA 1U8BA 3G73A 2VQLA 2JRMA 2OTJI 1ETOA 2EWLA 3A03A 1IO2A 4P1WA 4NNJA 5F64A 2DMIA 4BBYA 2H1KA 2KHMA 2L9RA 4PSXA 1YI2I 1NK2P 3C3WA 4LK0F 4YFKF 2F6CA 3RYRA 1YYOA 2NS7A 1VQLI 3KEYA 1BI0A 3DEWA 2E2IJ 2WZOA 2JT1A 1Z7UA 3WU2C 1N77A 1RRJA 3MZYA 2F5DA 2E1OA 3FXOA 4MLOA 3RZDJ 3B6AA 2CS3A 2PQ8A 4A6EA 1TZLA 2JPAA 3DKWA 1I39A 1SMTA 5HLHA 2B3TB 4MFDA 1PP8F 1XGSA 2ENCA 3J7Yp 2RSIA 4B43A 3ZOBA 2E35A 4A5MA 2JR1A 2NNNA 4F6MA 4ZJZA 4A3IJ 2ELYA 4CH7A 4CYCA 3DBLB 3S3NA 3T1HE 3G1OA 3KE2A 2ELKA 3OOUA 3ROUA 2UXBE 3LA7A 3FMSA 3PQJA 1HR0E 2DMQA 1ENHA 2YX7A 4ZDPA 3K7AJ 2R7VA 3IWDA 2BZTA 2LC2A 3M8EA 4KDPA 1HDDC 2BW3B 1GV2A 3MN2A 1Z3XA 5HDNA 3J81Z 2O3FA 2MBFA 3VDXA 4EJUA 4K0KE 2KIMA 3DKYA 3OS1A 1J59A 3S16J 1OFCX 2EPCA 4F91B 2PG4A 4R2PA 1IN8A 2HZTA 1FJGE 3FMRA 3JRDA 1H0MA 2W24A 1T95A 1FOWA 4ZZLA 3BBGA 4G7ZF 3DEEA 1YE9A 3IAS2 1R58A 4XOTA 5KL5A 4OAYA 3S93A 1YW7A 4JI3E 3FISA 1WI9A 5EG0B 2VJJA 4MO7A 3R4KA 2KZGA 2UWMA 2RPCA 4R2EA 1UMQA 4JI7E 5LEKA 1GVDA 2FRHA 2DAOA 5E3LA 3K9TA 1DU0A 3C7JA 3EQ1A 2GIVA 3K70C 3U2RA 3CP2A 3CC2I 3BTIA 1MMSA 4X66E 3UNGC 1H8AC 3HB9A 5GADJ 2DPUA 3CDIA 3LSHA 2YTDA 2CMPA 1AHDP 4J19A 2KHXA 2GQQA 1YUJA 1O7FA 4YEJA 3I56I 4CHUA 4JI5E 1XD7A 2E34A 1X1BA 4KYWA 3KEQA 4G7HF 1GXQA 1ZG5A 2DYRH 3MKWB 2FEZA 3BWGA 4L5IA 4WFTA 1LB2A 2P4WA 2ESHA 3OYFA 2Q8UA 3H09A 4GKKE 5DCMB 2JUCA 2DK5A 3W2WA 2EPPA 2HJJA 2DN0A 4BHBA 1Q1VA 4RLFA 1I3QJ 1YYVA 2F4IA 2Y75A 3I59A 4D1QA 3KETA 2W7NA 2R7RA 1O3SA 4E70A 1HA8A 3C4TA 1G4DA 1RZ4A 4XN0A 5LGNA 4LFCE 2HOSA 3IWCA 3Q9SA 2P0WA 1W7PD 1LJ9A 2ELJA 1BOBA 2EFNA 1KYWA 2E5NA 2XC7A 5LHGA 4A3GJ 3G1LA 2DMYA 2V86A 3OYKA 2MW8A 3BQYA 2KDOA 2XSJC 3A01B 4XRMA 2X6OA 1WGXA 5DNYA 3F72A 5JVGF 2LD5A 2CW7A 2M4KA 1ETVA 4LK1F 1BR2A 4Q48A 1D1AA 4M3BA 4ZTFA 2A61A 1ONVA 2KISA 3CUQA 3OWTA 2EMBA 2L2KB 2AXLA 4CUGA 1Z3YA 3H3VK 5CQEA 1QQIA 4BY1J 1A36A 2OU2A 1OISA 4Y3OA 4DBRA 3ONQA 4PJJA 1J9IA 3VPRA 2JA7J 1HKQA 3H0GJ 2L92A 1XTAA 2FX0A 1ZBTA 5HLTA 3DLAA 2VOOA 1S5LC 3BOQA 4XLHA 3L2UA 1ETYA 1CF7B 4E7SA 1MSEC 5IYCJ 2EM3A 3AL0C 2A6HF 4NB5A 2B63J 2EIMH 2KT0A 3CESA 2VPLA 3HHGA 1RUNA 1QHHD 4FK5C 3HJEA 3TGNA 3QP6A 2E36A 4GEQB 5F0FA 2W00A 1R5GA 2J5PA 3HHHA 4NC8A 2ISYA 3DTKA 5HS7A 2LVHA 4DUZE 1TTYA 4BQAA 1JUPA 1FP1D 2JVHA 4OINF 3N97A 3H5RA 2G7UA 2L7ZA 2EPKX 4YELA 1HKSA 1S8NA 5FRNA 1Y0NA 4CDGA 2JN6A 3GVAA 2ZXWH 3MWMA 3RPQA 4M6YA 4LLNA 5ERIA 1MBHA 5IXMB 2RN7A 1B72A 3BY6A 1OMIA 2IVMA 4LITA 1U5TB 2B7TA 3O8HA 2KLOA 2EOYA 3BTLA 3ZQQA 1UG0A 2NAZA 2JMWA 2K4JA 1HCRA 2DA5A 4F93B 1I94E 3MHHC 5EEHA 2LE2A 1YQAA 4ZYAA 4G7OF 1DGWY 3ZP5A 3K0LA 4F92B 4E7LA 3CJNA 3HTSB 1ON1A 3QYEA 1Z67A 2YUSA 4L9VA 2QQ9A 4M74A 5J1UA 5K5RA 4OIQF 3GLLA 1QPMA 5DEQA 4NHRA 2EM6A 2UU9E 3JTHA 1MMAA 4PGHA 1YIOA 2EOOA 5DTDA 2V8QB 2BGCA 2LV2A 5J47A 2MABA 2XKPA 2FXAA 3FMQA 5K5QA 1B1BA 1EV7A 1SC7A 1IRGA 5E18F 2HS5A 3JCUC 4PJLA 3LAJA 1YJNI 1I5ZA 4B8XA 1APLC 2VBWA 3E7LA 2BB8A 3ABMH 4DR3E 2FBKA 4FETA 3PSFA 4AUXA 2HVRA 4F9CB 4B3SE 3K1PA 1F5TA 3O3KA 4ZYEA 1YFHA 3J80K 5F3WA 2R5ZA 4XSXF 2DJIA 3PUBA 4JK1X 3PIOF 1BN5A 3GO5A 4A3CJ 3MSWA 3QPTA 1TWGJ 2R93J 1BB8A 3Q0WA 1NTCA 5DD8A 2YSOA 2VB6A 1STZA 5A2QZ 4F52A 4L18B 2FOWA 4RAGA 3BR0A 4WF2A 3TDZC 2XROA 3EPLA 2ZNZA 2HQ5A 4G94A 1OPCA 2V6CA 3IH3A 1L0OC 2WAQA 5C44J 1Y8QB 2W84A 4B47A 5J8CA 2LY2A 4L9TA 2IW5A 2L0KA 1FBUA 5KVRA 4V2FA 1PVEA 3HDDA 2MC4A 4XR6A 1MH4A 2ME0A 2DW4A 5IOYA 1N34E 4BGDA 5J6XA 2ZC2A 1LPQA 3KP2A 5JHUA 2KL4A 1U5TC 3CCUI 3NRVA 1TWCJ 1WJDA 2CRGA 4HPQA 1H88C 3SZGA 1WPKA 2E19A 4PJNA 1O3TA 4HV6A 3RZOJ 5LLQA 4X0GA 5B3SH 1Z7LA 2M1BA 1SAUA 2ME6A 3JRHA 3SYTA 2L4AA 4B44A 3FXRA 2CUFA 2CQKA 5E1WA 5L3GA 1IAWA 1K79A 3HKZA 3RDIA 5GAEJ 1QU3A 2VODA 2N8GA 4XLPF 3ERED 2BV6A 4EM1A 2HPIA 4RGRA 2X0LA 2CV1A 3I58A 1S29A 4LB6B 2IHR1 4DZPA 3IRQA 4IKFA 4IL6C 2L9VA 2BHYA 1PDAA 4HX4A 1G3SA 2F4MB 2P81A 4KIFA 2XGEA 5HODA 3CCLI 1RESA 2Y2ZA 1PJRA 5LD2C 2LF8A 3H3UA 3IWBA 1E17A 2JZYA 3H3ZA 2OZUA 3G6EI 2YTNA 2V26A 3OYAA 2CU7A 4B3XA 2DTZA 2EM8A 2L7MP 3FXLA 5AC4A 1RR7A 4DR5E 3ADGA 1SVMA 2NVXJ 4HBLA 2WV0A 2XPWA 2EN3A 2FF4A 1TL8A 3WTWC 2ZKZA 3V4GA 5GTHC 3IL2A 4CSWA 4PFOA 2ZXHA 5L3BA 1PUFA 4IEJA 2VBYA 4H0EA 1FJLA 2ID3A 4BQQA 2FBIA 1ZYRF 2ELHA 4D9JA 2PI0A 4DV5E 1HW1A 2BW3A 5J4VA 4IX7A 1MGTA 2VN2A 3CF2A 1W4MA 2EPFA 3DBHB 4IHSA 5CJ9A 3TQNA 4JI4E 2VE9A 3BQZA 2OTLI 3E5XA 4F9AB 2E1MB 3NARA 1HDPA 5ICGA 2R7FA 2B7VA 3FBIB 4XLEA 4EJVA 3HL2A 2YPNA 1E3OC 4Z6YA 1QA6A 2LKXA 2M8EA 1T0FA 1S7EA 2YSPA 2HTJA 3DP7A 4O24A 2ZSIB 2HDDA 3J7AG 3HXLA 4JV5E 2PFBA 5CLSA 5J1RA 5EG0A 3QPSA 2DMPA 5DM6F 1FOXA 4XLCA 4DR7E 3FDYA 4XONA 5DYMA 3KYLA 5E1XA 3I4MJ 4HW0A 2R7QA 2XGCA 3M1CA 3JRGA 2NXNB 3EUHC 2LMDA 2HOTA 2EBIA 3FF5A 3KCCA 4ZYHA 3VYXA 4X64E 2TRTA 4KUMA 2V79A 3W6VA 1O57A 4M6XA 4E7KA 3GZ6A 1PDNC 5AIPA 5ICCA 2V7FA 2Q0OA 5J1YA 2EMIA 5F04A 2LT7A 4HNTA 2R4GA 3CCJI 2XB0X 5BMZA 1B8IA 1ZARA 2ISZA 1MJAA 4N9IA 2CW0F 1FYLA 4WXDA 3H9GA 2X1EA 2OC6A 1YITI 1TC3C 1TT0A 4CCNA 3E1SA 3VWBA 5DCMA 2L01A 3A0BC 3MKLA 2IS4A 1IV8A 2XASA 3H5AA 2YPRA 5EZGA 4DV0E 3IKTA 1IUFA 4I09A 4QLCU 1BI2A 2EPLX 1RIOH 2VI6A 1XGNA 3S1RJ 3Q3SA 5L3DA 3J81K 4KITB 2HQRA 4LJZF 3JW4A 2LRDA 1F43A 4DV4E 2E60A 2VLAA 2HOEA 1K4TA 3NWTA 5DUKA 3GW2A 3HIFA 4KA4A 1R5HA 2V9PA 2K9LA 5A69A 2IGKA 1XB4A 4OIPF 3FHZA 3PSIA 5FO5A 3SZPA 2L6MA 3DTIA 5KCMA 2W1OA 2EL4A 4ENJA 2NUFA 1D1BA 4IJDA 1XNQE 3CO7C 2EN7A 4ZC3A 5M5WJ 1X2NA 2E1MC 1FIPA 1OCCH 2XF7A 4DNCA 2Z33A 3WTXC 1VQ7I 2PEXA 1SFOJ 4CCKA 2VJIA 3OY9A 4XQFA 3VYUB 3A1YA 2E2JJ 3OOPA 3ISPA 4PGGA 1WJCA 1K4SA 1OR7C 4ZTJA 2OCCH 1WFXA 2HC5A 1CF7A 1JUMA 3LSJA 5HNHA 2M3AA 3SDBA 1BBOA 2YT4A 2Z99A 2VT2A 5L3EA 5K7ZA 1GQEA 1IXSB 5LFAA 1IUYA 4MLVA 1QO0D 1ZR9A 2XB5A 3KYDB 5EEAA 1AAYA 1AKHB 1ACIA 1R4MB 2XRLA 3SHFA 4HEIA 1DDNA 2K4BA 3OYNA 4XMYA 2EQ0A 2EIKH 2JUGA 3BT9A 4W97A 4EM2A 2MC6A 3THNA 1HNZE 1J26A 3BROA 5B5EC 3HOVJ 3OSFA 2YRMA 2CQQA 1N32E 1A1IA 4M3EA 4OX9E 3TKYA 2DTRA 1E3PA 3U9GA 4J8ZA 2EOJA 4DR4E 2QQBA 2ACJA 3JTZA 4BJ5C 4AIHA 2EOHA 2PMHA 5BQTA 3HOYJ 4QIWN 3J7AO 2I5UA 1IJWC 5KNLA 1MBJA 2JYAA 4AM3A 1ZTRA 2EM7A 4BACA 1TW2A 1TN9A 2RTXA 3PO3J 2EM5A 1E2XA 3PM1A 2L02A 2F4OB 4LGWA 3U1DA 4LTYA 2UXXA 4P5OA 1Z21A 5E20A 5H6RA 4BCAA 3W6JB 4LFBE 3JAMC 5KAIC 2MDRA 3EPZA 3DTEA 3IHUA 2EV0A 1IN5A 2RKHA 2OV7A 1OCTC 3OMLA 5M3FJ 1YS6A 1IW7F 2HHHE 4KHPE 2LBFB 3SJMA 2YR2A 2KIUA 2ZJRF 4IS1C 2Y9ZA 4M9XA 2L2MA 4CYDA 5TRDA 1TNSA 2P5KA 2EINH 4NC7A 5LL6R 2M2EA 1DGRM 1O0WA 1GDTA 1MW7A 5DV5A 2EN6A 1ZKGA 1X47A 3ZMVA 4ESFA 5M5XJ 3ZR8X 2HPMA 1D5YA 5GP9A 1VFCA 2NA2A 1MJ9A 2H8WA 1S3JA 4JBAA 3BZKA 4WYQB 2FD5A 3QPLA 3BLYA 5BS6A 2UUAE 5A6JA 3JRFA 1QU6A 3FZVA 3GWZA 3LSGA 4ESJA 2HDWA 2OF7A 3D5SC 4C30A 1VTNC 4F9BB 2ADUA 1Z9CA 2ZBKA 3D0SA 2QM3A 5DUIA 1W1WE 2KJCA 1REPC 1GLNA 2VL8A 3DWLE 4PJ0C 3DU6A 1HW5A 2JPBA 2XKOA 5HLGA 1QBJA 3D5LA 2H09A 4DV7E 3OIPA 3HEFA 1JUSA 1X4PA 5J4YA 2FQ3A 2K3PA 3NEUA 2HQNA 4RDUA 3K4NA 2DFIA 4C9YA 4FX0A 4FE7A 1LFPA 1Z6RA 2R7TA 4WWCA 2E1CA 2DT6A 3LSMA 2NVTJ 3M3YJ 3I4NJ 2F4VE 4RGUA 2CV0A 3BG9A 3MAJA 3TW6A 3ABLH 3RMPA 3HGYA 4I76A 3WGIA 2HYJA 2G9WA 1M1EB 2XAGA 3VFZA 3LFKA 4EGYA 2ECCA 3FXJA 4M73A 2CGPA 2DA3A 2DA2A 3GYHX 4F54A 1J09A 4AQYE 5LGUA 2EZHA 1HSTA 5LBQA 3L1PA 2WBMA 3GLXA 1IQSA 3RJPA 1EA3A 4X62E 2VKVA 2EN8A 5GAHJ 1UELB 2VIXA 3IAM2 3TEDA 1FBSA 1JKQC 1IBME 4NHJA 2K3FA 4ETSA 3K70D 4HZFA 5J40A 3ZMSA 2VQGA 4TV7A 4RBOA 5DCFA 3Q0UA 3ULQB 1ZG1A 4A3DJ 5J3LA 1I27A 2PBIA 5ICEA 4XKVA 3V42A 5FLXK 3J80C 3OIOA 3WE3A 1F1ZA 3VSLA 4LG0B 2LMZA 2K9SA 1ZAAC 1WQ2A 4GO1A 1P9QC 2YWQA 5LRSA 1ETQA 2BOLA 3DFGA 1USTA 4DV1E 3VODA 2JOXA 2HI3A 2JSCA 1MDMB 3V8JA 3HOUJ 3EPHA 3WHCA 1UHMA 2GOXB 1U6GA 4Y33A 1OYWA 3KZIC 2FU4A 3KIOA 4YIFA 4A3FJ 1YTYA 4Q5SF 3NWSA 1WZ2A 3LNQA 3I71A 2QUFA 4EJTA 2ZJ2A 4OOIA 5FKNA 4B3RE 2V9VA 4I02A 3HRTA 2ODRC 5BOXA 2DLLA 3QAHA 4BJ6C 4D0PA 2L3JA 3S2WA 2GBYA 2V1XA 3LMMA 2PJPA 4WXHA 2HEOA 2ZFWA 2FOKA 5CFFE 4RS8A 4KISA 3GTJJ 2JA8J 4QPQA 1WHQA 3F8BA 1R71A 2EQ1A 3EPKA 1EKEA 1KA8A 1SFXA 3ADIA 2WV1A 1D8KA 2QBYB 2GWRA 2PMZN 4E7JA 1YRNB 1IG7A 5FKOA 2K4VA 1ZH5A 4QPOA 1UFMA 4AYBA 3F21A 4L9NA 1IN7A 2LY1A 3OYBA 2ZSHB 5LEJA 4R1HA 2O7OA 3GMEA 3SFIA 1IRZA 2LO3A 4XM3A 3G2BA 4O43A 1OCPA 5AE2A 2VKHA 4C3JJ 1FY7A 2EL5A 4FCYA 1FEXA 3EYYA 3TW7A 1Y1VJ 2DXIA 1MZBA 2EFOA 4WCGA 2WBSA 4FHTA 5F6FA 2H27A 2BBGA 4FQGA 2OAZA 2KMUA 1HF0A 2Q2EB 4NQWB 4M30A 5BR8E 3W2AA 2GOMA 1T4OA 3G3ZA 1QZZA 1WVRA 3ADLA 2JJ7A 3VYTB 1J5YA 1XMKA 2DCEA 2IGOA 2L3DA 3QPHA 1X2MA 4V2GA 2IS6A 5KL4A 1YJ9I 4JI0E 4HDUA 2WB1N 5KL2A 4TUGA 5LMNE 2CUJA 4IHTA 1XDSA 3F6GA 4GFBA 3OV8A 4B3TE 4II2A 4PCQA 3OR2C 1A6QA 2LDUA 5C4JJ 4BU2A 4S05A 2DOFA 2RS6A 3AL0B 2AQFA 3L7WA 1UJ8A 3OL4A 3TO7A 4BH9A 1NHAA 2IGNA 3K4JA 2KKOA 4HQEA 4R03A 5IP7J 5LGTA 2OBPA 3G1MA 4CZCA 3CO6C 1LDJA 4G6TB 2EN2A 2HYFA 2O5RA 4RB1A 3MKYB 2QSFX 4D5CA 1Y6IA 4XRSG 4IRIA 3SFZA 3CMMA 3MZ8A 1O4XA 4NBQA 1X1DA 3C6MA 5F0HA 5HDGA 4B3AA 3GTGJ 1E3HA 2WY8Q 1G2FC 4LFAE 1X1CA 1EH6A 2DOEA 1WJFA 2L2NA 3IRRA 3ZQLA 2HGHA 4AIKA 3E5UA 4DUYE 5D5XB 3HQ1A 1XN7A 2ZCWA 4X6AJ 5JHFA 1GUUA 1FOYA 2EV6A 1T8IA 2ID6A 3QP5A 2GA1A 4EQQA 5BPIA 3HYIA 2VXDA 3OYEA 2VKEA 4U0WA 3P7NA 1U2WA 3R6SA 2K9MA 5IT9Z 4G8XA 2DT7B 4ZDOA 5CQGA 4BS9A 5KAFC 4A93J 1ERDA 1YG2A 2QLZA 1X3UA 2LTRA 2FQ4A 1WJ5A 1RQ0A 1MMDA 3KLNA 2WY7Q 2J5OA 2BY3A 3C2GA 4XRSA 2X48A 4R2SA 3M4OJ 3EYIA 1KQ0A 2CPNA 2YTEA 1AU7A 2EMCA 4KN7X 3SDGA 1YO5C 3H9QA 5KL7A 2V1DA 3QQAA 3OYHA 2EMWA 1P4AA 2Y0MA 3ASNH 1CGPA 1MBKA 2MKDA 5D4RA 2NUGA 3BZ6A 2CJJA 3VOEA 2O8XA 2K7LA 3ZN0A 1RR8C 3JAMK 5F1RA 4A3BJ 2WADA 3FXKA 2OQGA 3DJWA 1YOVB 2A5YB 1AWCA 3BCAA 3K4BA 2B9DA 1X6HA 1WHNA 2XF6A 1YW9A 3RKYA 4L8NA 3RQIA 1R5ID 2W25A 5DS9A 3J81C 4MTEA 2L8TA 2KIQA 1B9NA 2ELZA 4BDYA 3FIGA 2KZVA 4CCJA 4BDZA 1T4LB 2EOFA 1DQ3A 4MLQA 3SXYA 4I8OA 2DA4A 4Y52J 1MMNA 3BP8A 4P96A 2P5VA 3F8NA 1MSFC 4PDKA 4M9VC 2VF1A 2VBXA 1K83J 3BR3A 3ECRA 4IHWA 2EOXA 1KQ9A 3Q5FA 1CQTA 3FBNB 3PIPF 2DU9A 2RC4A 2DQLA 1BL0A 2K9QA 2BVMA 2ZB9A 2D9HA 3S15J 1LFBA 3HPSA 1HBXG 3ZQGA 1SMYF 3SQNA 3ZOQB 1VZ0A 2M34A 3HBLA 3K6GA 2G0EA 3OIQA 1FTZA 2EOSA 1X1PA 1TWAJ 3FXUA 1AH5A 4N9HA 4DYCA 3I0TA 2LBSB 4BL0B 4G6QA 4BNCA 1D0ZA 2L7KA 1RC9A 1KU9A 3FWEA 1ZGJA 4AIDA 1W0TA 3THOB 2N3HA 1TQMA 4ZYDA 2EILH 2PRTA 2XGDA 3FIWA 2QSGX 2XIGA 5EGOA 2KRCA 3BG5A 3KPHA 1Y1WJ 1BBGA 3DF6A 5HLIA 2FBHA 4ESBA 2X6XA 4I99C 5E79C 4BEHA 4E7HA 2XGXA 3UKGA 5LRRA 4HLXA 3BG3A 1ZGAA 3VSKA 5DD4A 3LA3A 2LUPB 3M9AA 4Z2YA 2M0MA 3LQRA 5FLMJ 1WH5A 3D5RC 4HQMA 2IS2A 3CD6I 3PQKA 3E3VA 3J7YJ 2LF7A 2GM4A 2CFXA 2LYCA 2PJRA 2M87A 4LB5A 2CO5A 4A3EJ 2FSWA 2L2OA 2D1HA 4CO8A 3CJRB 4U7BA 1BM9A 2H6CA 1STUA 2EB7A 2HGCA 2Z1DA 2B9SA 2VXZA 3VB2A 1G3YA 1HQCA 4MFEA 1U8RA 3VYYA 2X4HA 5D5UB 2QKLB 1KU3A 2RS7A 2ECBA 2QQ8A 1U3EM 2K7IA 1S72I 4RM2A 2EV5A 2HXOA 3L00A 2FE3A 2LG4A 2MFZA 2VE7C 4HSRA 4KWYA 3FXQA 2EJ4A 1BI1A 4CICA 2CW8A 3CQZJ 2K02A 4IVNA 2EMYA 3UK3C 1WCMJ 3H36A 4XICA 4ZDLA 1WKMA 2NOJB 2Y48A 5AIQA 3WTYC 3IWZA 3M8JA 1W36D 2KP6A 3G4SI 5F08A 3K2AA 4XKBA 1YX5A 2EFQA 2OQRA 4HSTA 2QKMB 2WWYA 2Y69H 5K1YA 1DPUA 2ZMEB 1HSJA 4RM3A 3REOA 1IQOA 1KYQA 2VC0A 2M1SA 4LG0A 3FHNA 3K69A 1LVAA 3DF8A 2YSRA 3OYJA 5EDNA 3LSIA 1MDMA 1IC8A 5T6JA 3V7CA 3HOXJ 1IBKE 2DBBA 4E4HA 5AASA 3R0AA 4ITVA 3L09A 2R7ZJ 1SVLA 2BY1A 1R36A 2OCEA 2H8RA 1ORKA 4B09A 2O8KA 1V4RA 2I13A 2LFBA 4MEXF 2JA5J 1QHGA 3EPJA 5BPDA 3JRIA 4HF0A 1VQ4I 2ZNYA 1A04A 3OS0A 3DBRB 4IQJA 2NVUB 5EF6A 1DGCA 4S04A 3F3XA 3LFUA 2Y0SA 5TSEA 3WTUC 3GTOJ 1W5TA 1N75A 4HLYA 2QBYA 2ZM6E 1Y8RB 4MEYF 4PJMA 1YRNA 1UHZA 2JWOA 2KJBA 1SD6A 1TWFJ 2MSYA 2EM0A 1FNNA 1IN4A 1PJSA 1ZAOA 2UZKA 3FKJA 4MIMA 1RKWA 2DA1A 2RNGA 4Q47A 1UILA 2LTSA 2K85A 3RKWA 4A3KJ 4G6DA 2D2WA 3MMYB 3DLLF 1HOMA 3ML6A 5FRMA 2V83A 5HDKA 3RTRA 2R7OA 1QGPA 4IZZA 3LSKA 3O6BB 2L5QA 1K7AA 2O9LA 1OCOH 1A1LA 1YX3A 1SFUA 2STTA 5CKTA 2R7WA 2E2HJ 2Q2EA 4NQWA 1JHHA 3LWFA 3BCBA 2L9SA 5ILVA 1PJQA 5FFZA 2EMLA 1JGSA 3CMEI 5FLXC 1VI0A 2X9DA 2GLOA 3AAFA 2DI3A 3OR1C 1UB9A 2MYSA 2V4JC 1IV6A 3ZN1A 4M3GA 4YFXF 1WJPA 5A2QC 2K9NA 3OMYA 1IMUA 3IP4B 4DIQA 1P4XA 4Q4ZF 4ON0A 2ZFUA 4NDLA 4A3LJ 2VPRA 4BXFA 4IJAA 5HS8A 2X51A 2DDBA 2ZMEC 1GZ6A 2V9KA 2VASA 2ZJQF 3BF2A 3ABTA 3BG7A 4I2OA 4ANJA 1JTXA 3QG5C 2O6GE 4P9UA 1JJ6C 4FTHA 1ETXA 3K1MA 4DMIA 3KEOA 2LTPA 4W1UA 3O2PE 3OTOE 1MIJA 4CYCB 1YYWA 3ECOA 3WU1B 3IH4A 2KONA 2YU5A 3QWLA 4HDVA 4UY8I 4QTRA 4L5EA 3P9KA 3GFIA 2K27A 4XLNF 1J2XA 3ZMTA 2DFHA 2EMAA 2MG4A 4NXME 1P4WA 4BYYA 2OPTA 4KIBA 4EJOA 1IDZA 1MKMA 1VF9A 2HR3A 4HAMA 2I9IA 5IP9J 3HPGA 3J7ZI 1R6RA 3KZZA 4HX7A 3MFKA 3VYRB 3DPUA 3ZRGA 2GZWA 3EQLF 2H36X 2DLKA 4X8WA 3ESWB 3OSGA 4IHXA 1XNRE 2CSOA 1OLTA 4M0VA 3S2HJ 2MDGA 2Z5UA 1UHSA 2CYYA 3Q9VA 1ZQ3P 5TISC 3A01A 1XGOA 3P5JA 4LMYA 1TQIA 3S32A 2PMZA 4DOZA 3AUZA 4X65E 2WBTA 1QRYA 1S9HA 3CCVI 3J7AY 2ENHA 4R2QA 3CF5F 2FGGA 1J5EE 3CCYA 2EMZA 3R60A 1G8XA 1TF6A 4RAZA 1KYZA 2QYOA 2JSPA 5E3NA 1LEBA 4BBSJ 3S14J 1PUEE 4DKKA 1BJZA 2JXPA 3C6KA 4KICA 3HPZA 3DXJF 1QVUA 2ZO4A 1R9TJ 2Z2SB 2EM4A 1WSUA 2MLGA 2X1DA 4UVAA 1ZHFA 2EN1A 3OYIA 3IC7A 3DU5A 4DYRA 2R0QC 3WTVC 2O61A 2VE8A 4P55A 1IF1A 2N3GA 4PUSA 2EPMX 3B02A 1R7JA 2IXSA 2CG4A 3TMOA 3HOSA 1V5EA 2FMLA 3QRFF 3JSOA 2L9NA 2WB1A 4RAYA 3S1NJ 2PN6A 3I59B 3OYGA 5IT3A 2R7XA 4B4CA 2PX9A 1BR1A 3IKVA 1V55H 2E5ZA 1GHCA 1U0JA 1ZRFA 4OIRF 3BC8A 2CQ7A 3HSFA 1RI7A 3FM3A 4EV0A 2EFPA 4I7HA 3H92A 2EMKA 2EOZA 1DU6A 2EA4A 3EUAA 2EZ6A 3I54A 4GXOA 3L2WA 2Q8KA 3KWRA 2Y9YA 2K86A 4YRVA 5A6AA 3PO2J 3GCMA 4JYKA 3ZMZA 2A69F 1JHFA 2R92J 2GXGA 2R76A 4XOPA 3CMAI 1GV5A 1UZCA 2R3SA 1VQOI 1U5TA 1I3AA 1ZN2A 3OYCA 2NS8A 3CUQB 2MH2A 2D1VA 1A1HA 2QF7A 2EZIA 3I3LA 2DO7A 1ON2A 3AG1H 1V54H 3V7SA 4ASNA 1SFEA 4RB2C 1K6OA 2FNAA 1F2IG 3LLHA 2UUZA 4NZVA 1HNWE 3NQOA 4A5NA 3CJQB 3LQQA 2LH9A 4ENMA 2YZTA 2E71A 1D3YA 3HGGA 1Q1HA 4KIGA 3ZPLA 4LFUA 4L0ZB 2XAJA 2F5CA 5E1ZB 2EMHA 2QGUA 3F9KA 1YW8A 2WAQN 4XN3A 2YS9A 3GX4X 2D45A 3TBIA 2NUEA 1LNWA 1XSXA 3FXMA 3H0DA 2XAUA 2FUG2 4BHPA 2MD5A 3PNTA 3P9IA 3GTQJ 2KQRA 2RAEA 3I64A 1UCRA 4QWQA 4RLQA 2LKSA 3J80Z 4IRGA 2RQLA 1LLMC 1T2KA 4WK8F 3F23A 1V3FA 3JR9A 4MHGA 1ZU1A 2HZDA 3FK6A 3ELKA 4O3MA 1BC7C 1X6EA 4U0VA 3I55I 4IHVA 4GYGA 5GTIC 2DRPA 3N05A 4BMJA 5A6BA 2DK8A 4LD5A 2CWEA 1X19A 3MKZA 3IUOA 3HKZN 2HWVA 2A6EF 4I98B 1B72B 3RSNA 2LCEA 3PFIA 2DA6A 2V1NA 3K4CA 2VUMJ 1X5WA 3QYFA 1PP7U 2CTDA 4MQ9F 2YU3A 5E3OA 2HYGD 3U1KA 4M6VA 2HFHA 3ECHA 1TWHJ 3ZMDA 4JI1E 3OYMA 5H20A 1X58A 2EOQA 4R8OA 3BPVA 5AE3A 3HOZJ 3VK6A 3S1MJ 3I5UA 3HC7A 3LSTA 4GCVA 4P9FA 3B73A 1A6IA 2UXCE 3A02A 3L2CA 2OD5A 4HEA2 4LG3A 4A0ZA 4F3QA 5LMUE 4OIOF 1ULYA 3S3MA 4UVCA 3OYDA 2M4IA 1ZLKA 3ABUA 3RIRA 1N78A 2N8XA 2M9HA 2P5LC 3L2VA 2F5VA 3E0JB 3JSPA 3CUQC 3WG9A 4L5NC 4KJZA 3EUHA 3RKQA 4DGWB 1G6NA 4XIDA 4U0YA 2DSYA 4FE4A 1SANA 3RI4A 3K4LA 3F6OA 2XVCA 4OAZA 1X48A 2E7WA 5LHIA 4IRHA 4RAFA 2MC3A 2BY2A 4I0AA 3K2ZA 2D5VA 2IAIA 4M9SA 5KHDA 1ZK8A 3BR1A 3FKIJ 3P1XA 1S7OA 3TOBA 3E6CC 1RC7A 4R79A 4I01A 4JP0A 4O6JA 2FV4B 5B66C 2LR8A 4IQ4A 4XKWA 1FC3A 1L3LA 3WU0A 3I53A 4U88A 5GPCA 4H4KC 2IRFG 1XCBA 3KYCB 4I6ZA 2JQ7A 1G3WA 1YZ9A 3IV5A 1JT0A 3D1NI 2EA2A 5A2QK 3LL7A 5FGMA 3RPUA 1JKPC 1S7AA 2OA4A 4RA2A 3CMYA 3GTMJ 3I9V2 5CPRB 2LRSA 3S3OA 4KNYA 2NABA 4CCLA 3H5NA 1XPXA 1BC8C 2EQRA 4QSHA 1A1FA 1X1AA 3QOEA 4PFPA 2YTOA 4KMFA 1SFKA 1DUXC 5ADZA 4F2JC 5JVTA 1A31A 4C2UA 3C2BA 1Z1DA 1PYVA 4AIJA 1DPRA 4O5VA 4HOBA 4IPAA 4WXCA 2ENAA 3CCEI 3SZTA 5HVQC 2RNJA 2HDCA 1YYKA 2E1MA 2EPUA 1MMGA 4UHTA 1YPNA 4HX8A 3K10A 2HNHA 3M07A 5A6KA 3TO9A 1B4AA 4M3DA 3ZMUA 1XC5A 5CVRA 1Y56A 1EJ9A 4A69C 4BC9A 2QZ8A 4AWXB 1OR7A 2G7HA 1X3ZB 3HRSA 1R49A 1X3CA 1I1SA 4LF9E 2CUEA 2YTJA 5F0CA 2V85A 3WGHA 2DDAA 2EPRA 2DMUA 3V8LA 2HOAA 1BI3A 4WX9A 1BOAA 1K61A 3KP5A 1QZEA 4XBFA 2IA0A 2WAFA 3CCMI 3WTTC 3AFHA 1FX7A 1XG1A 5L3CA 3N4MA 2V88A 2H1LA 4CZZA 1IRXA 2F5EA 3F8FA 2EOMA 4P78A 4AVZA 3AKZA 2LP0A 1JK2A 2FJ1A 2M8GX 1BIBA 2HU9A 2DA7A 4RB3C 2IP2A 2DPDA 4LLGF 3H9JA 5F1JA 1ODDA 4UV8A 4UUSB 1PUFB 2IBDA 3T1BA 1Y39A 2MC5A 3MQ0A 4LF7E 2E1NA 4B1RA 4DV2E 5DDGA 4R2DA 2VBZA 3HOWJ 2CUZA 4LF6E 1G59A 5CVVA 5M3MJ 1FLIA 4YY3E 5EZHA 1KONA 1Z05A 2EIJH 4PSWA 3BG6A 2DLQA 2EJRA 1ZLJA 3K4KA 1P47A 1U9OA 3M1EA 5ILSA 3R0JA 3F6HA 4ENKA 2IEKA 4DR6E 2Q1ZB 4AC0A 4XLAA 4TUIA 2MLKA 4N4NB 1K78B 1QPIA 3KP7A 3FX3A 4JX5A 2A05A 4KZSA 2M45A 1WRJA 2IGMA 5K7HA 1BA5A 1A1GA 2YTGA 1FSEA 1F36A 2RV8A 3HG9A 1MJBA 2NRAC 4JOMA 3CDHA 3WE2A 1A1JA 2JPCA 4ZYGA 1KU2A 4CCMA 2GA2A 3CCSI 2L7FP 2EFWA 4LF4E 3ERMA 4OOGC 1T33A 1N36E 1A35A 2DGCA 4BE0A 1SEUA 3ZCOA 3HZJA 3ZQIA 4EJWA 2HVQA 3F8CA 5CVIA 3LMLA 4A0XA 1LE8B 1B8IB 3KP3A 1B6AA 1NG7A 1UG2A 2A3SA 4LLLA 3BJAA 3HTUA 4BXXJ 5FD5A 2H6BA 3K4MA 3GTPJ 4HRIA 2NVYJ 3A2KA 2F2EA 2RDPA 3BTCA 1RNLA 4C3IJ 3JTGA 4X1EA 4XSZF 1OCZH 1H9GA 2XF5A 1Z1BA 5AONA 4RH8A 1FPQA 2F8BA 1AKHA 2Y30A 1RUOA 3UR3C 2YTQA 2YTIA 3T1YE 1I6XA 1XGMA 1WH7A 2LLKA 1ZRCA 4YIIA 3F6VA 2EPOA 1SD5A 1FYKA 4I0BA 2X6WA 3PUFA 3KZYA 4JYAE 4LF5E 3L9FA 9ANTA 2GXBA 5B1BH 4O4KA 2QENA 1IXRC 2JA2A 5B1AH 1VQ8I 5JR3A 1KZHA 4CCOA 3DPLC 1USSA 4G12A 1TF3A 4FX4A 2P6SA 1W7PB 2LOOA 3CCQI 2WAEA 4F55A 1RMDA 2JP9A 2XV4S 2KIFA 1KGSA 1A5JA 1EF4A 1FTTA 1FWZA 2RQQA 3HM5A 4EEFG 3M8FA 2R7DA 3KLOA 3DKXA 2IT0A 2EPZA 4KN4X 3JREA 2L33A 5D6EA 4A12A 5AE1A 2A07F 2Y31A 2PMUA 4MGRA 5BNGA 3JRBA 1HW2A 4GGGA 4EGZA 2R7UA 3GXOA 4XK4A 1T0FC 4FISA 4RHBB 3S1QJ 4KT5C 1GXPA 1EH8A 4FASD 2MGQA 5FKLA 3OS2A 2DMTA 3VYSB 2STWA 4ABZA 4AD9A 4UNOA 2RQPA 1AOYA 3C4BA 1PKPA 4HA8A 2LBFA 2F48A 1RKTA 3DCFA 1XMOE 4XLFA 1MBGA 2EOIA 1F9NA 1FBQA 3LSRA 2LJHA 2GPIA 3DQVC 1YIJI 2FTXB 2KFDA 5E3MA 5TJJA 2OZ6A 3HTXA 3WODF 2DT5A 1DP3A 4HYEA 3RKXA 4JX6A 2VRDA 1MNDA 4O5GA 3ASOH 5EJCA 3DEUA 4V19K 1BJAA 3MEXA 1B9MA 1X6FA 2B0LA 2VQHA 1D0YA 1XMAA 5IT9C 5JI6A 4MQVA 1UN6B 1D1CA 2K5CA 2EP3A 2R1FA 4JI8E 1JGGA 3WGGA 1IZ1A 3IH2A 3QODA 4ZZDA 2WCC3 5IYBJ 1Z0XA 1HXDA 1FT9A 1N3GA 4DR2E 2HKXA 2ETHA 2O0YA 2JOBA 4C3HJ 2W57A 3HSEA 3B6CA 4GRIA 4DZJA 3DPTA 1R1TA 4DV6E 5A6BD 2OJED 2P8TA 1BIAA 1P92A 1D0XA 1OJLA 4Y17A 3C2HA 1JKRC 1VQKI 2VONA 1WI3A 5GPAA 1P7JA 4L5JA 3U21A 3CLOA 3L2QA 2GLIA 2CFOA 4HNUA 4XNFA 4BBRJ 3MCZA 4R2RA 4DBQA 2AS5F 3CP8A 1WXRA 2E7XA 2ESNA 5H6QA 4DW6A 1X3WB 1ITYA 1LDKB 4BKXA 1GT0C 3S8PA 5ILUA 2M7QA 1LKXA 3PFYA 2L54A 2W85A 1JI8A 4B48A 4IHYA 4DR1E 2W48A 4GZNC 2KRFA 1GTKA 3TP0A 1Y0UA 2EM2A 1MNMC 1LUJB 1UBDC 1V5FA 2Z3YA 1T38A 3R61A 1W5CC 4E7ZA 2YRKA 2O03A 1FOKA 2EMGA 4RB0A 1W5SA 4IXAA 2NNYA 5ED4A 2YTFA 3WG7H 2XHKA 5FLXZ 2I8DA 1TT5B 4DQ2A 2ADRA 4AYBN 5E8IA 2L4MA 4M3FA 4MNUA 4BJTA 4EATA 4GYIA 4GDFA 1P2FA 2AQEA 5HS9A 2EL6A 1OCRH 1AA7A 2CQNA 2BHZA 2AXTC 3HUGB 3WHBA 2CSHA 2EK5A 2W82A 2IS1A 4BY7J 4ZH4F 3ZQ7A 4BC7A 2VJ5A 2UXNA 4EVIA 2BE5F 3TL4X 2X6YA 3KFWX 1EKZA 2TDXA 3TDUC 4E6KG 1HLVA 3HRUA 3OL3A 3CDLA 3QU3A 3GFJA 1U78A 4AU7A 3RPUD 2DJNA 2TCTA 1ETWA 2FA5A 1YLFA 4EMSA 2RGVA 1E0EA 5J8FA 1XMQE 4DYQA 5KK1A 5K7FA 3E5QA 5JLXA 3KP6A 4EM0B 2JTVA 1Z77A 1P6RA 2Z9OA 5HOOA 1MBFA 3V7RA 3WTSC 4BQNA 1SVOA 1WJBA 3EDPA 5IPAA 2B7EA 4B3ME 1VQMI 4KT6A 2C6YA 1PJTA 1WHUA 3CC4I 2R5YB 1T56A 4M2ZA 1IBLE 4P7DA 3ZGKA 1IGNA 2P7CB 3EUKL 4C2MJ 2EWNA 3E6MA 2VOPA 3BPXA 1G2DC 4S0HB 2ZXJA 5IYDJ 2M0CA 3H1CA 4BAYA 3AG3H 1ZR2A 3S17J 1HNXE 3LAPA 2ZJPF 1VNDA 3JU0A 3AV0A 2K40A 1J0RA 5IV8B 1T6SA 1SD4A 4HF1A 3PNVA 4YIRX 2IA2A 3FK7A 1TBXA 1Z91A 1JT6A 1FMWA 3GUDA 4BE2A 1HKTA 3E6BA 1N25A 2BEOA 5E17F 4JX4A 2UUBE 2GHFA 2M7AA 1IXCA 1LFUP 4UUSA 3ADJA 3E6DA 1NCSA 3V8KA 5D5VB 4LIVA 4A6DA 3C1DA 5JFRA 1NG6A 2LNBA 4UUTA 2QEXI 3GTLJ 2BYVE 3ZQHA 2UV1A 1DQUA 1FMVA 1GVJA 2LSOA 4M72A 2WBUA 2LVSA 2VKDA 2DFEA 3O8GA 2QCOA 2DMNA 2EZLA 4R8HA 5CYVA 4BE1A 5C3EJ 1XDUA 3VHTB 2BVLA 4LF8E 3BDDA 3RCOA 1OYIA 4KMUX 2NVQJ 2DOAA 3FM5A 2A5WA 1K78A 5HNFA 1ETKA 3W2VA 5ICFA 3BR2A 5LHHA 2DQRA 2WC2A 2EH3A 1VQ5I 2V1UA 1JJ8C 4XL9A 4XKCA 4OWRB 1OKRA 3OYLA 1WWXA 4UB8C 4CXFA 3NAUA 4RMNA
chains in the Genus database with same CATH topology
1BBYA 4N0BA 2PLYA 3T5XA 4CGZA 3E97A 3HSRA 3F22A 1FYMA 1IRFA 2GAUA 5D6FA 4KFCA 1TQPA 3TOAA 3WTZA 5FB2A 3JAMZ 5CVJA 3GEZA 4AVPA 1D8JA 4M71A 6PAXA 4M9ZA 2NYXA 2M30A 3C18A 4UVBA 2VC1A 1EH7A 3T8RA 1I1GA 3HOTA 3TO6A 1JXSA 4OU0A 4XRFA 2MH9A 1W7PA 1F4KA 3BJOA 1SD7A 1TW3A 1R23A 2YX4A 1QNTA 2MA3A 2XAQA 1T98A 4YG2F 2XRNA 4UXNA 4U7DA 2COMA 5IT9K 2XAHA 3HRMA 1R1VA 4BXUA 1R1UA 1DP7P 2IA1A 4Y15A 1LEAA 2P7VB 4RGXA 4L0YB 2QWWA 5D8LB 4RGSA 3F8MA 3K1NA 2IPQX 2M5WA 5EEGA 1OYYA 3DV8A 2BBYA 1T39A 1IN6A 2FMYA 2FNPA 1TNTA 3VEPA 2H94A 4OMZA 4A2UA 1H9TA 4OMYA 4YFNF 5L3FA 3MZHA 4L9JA 1TLHB 3RYPA 3W6KB 4IF4A 4G9YA 4UUVA 3CTAA 3GF2A 2RVCA 5D4SA 1G3TA 1QZYA 4FT8A 2F5FA 3LA2A 5D5WB 4PZJA 1ZG3A 4HF2A 1C0WA 2QVOA 1O7LA 5D8KB 2P6TA 1KU7A 2NS0A 1Z6TA 4MTDA 4BHCA 2WTEA 1XCVA 1LQ1A 1R22A 1J75A 5FFXA 1ZRDA 2IJLA 1S6LA 1KQ8A 5E8GA 2ZMEA 5K5OA 3T8TA 2LKPA 1UHWA 5CVUA 1SAXA 3COAC 3HUGA 4Y13A 3QU6A 1YS7A 5FD6A 3GZ5A 3QOPA 2A68F 1O3RA 3I4PA 3BJ6A 4K2EA 3P9CA 3M7GA 3T0YA 1MD0A 1JE8A 1B59A 4HV5A 1LDDA 4JQFA 1XSDA 1FSHA 4F7ZA 1ZREA 1J7KA 3IWFA 4A0YA 1D5VA 2VT3A 1XSVA 4ENNA 3GFMA 3KP4A 2HKOA 2XAFA 3CUOA 1FP2A 1O3QA 1R00A 2JRTA 4UV9A 3EETA 3GFLA 2XUBA 1FZPB 2QQAA 2HTSA 3G73A 5F64A 3C3WA 4LK0F 4YFKF 3RYRA 1BI0A 2JT1A 1Z7UA 3MZYA 2F5DA 2PQ8A 4A6EA 3DKWA 1SMTA 5HLHA 1PP8F 1XGSA 4A5MA 2NNNA 3KE2A 3ROUA 3LA7A 3FMSA 3PQJA 2YX7A 4KDPA 3M8EA 5HDNA 3J81Z 2O3FA 2MBFA 4EJUA 2KIMA 1J59A 2PG4A 1IN8A 2HZTA 3FMRA 1H0MA 2W24A 4ZZLA 4G7ZF 1R58A 1YW7A 1WI9A 2UWMA 3R4KA 5LEKA 2FRHA 2DAOA 3K9TA 3C7JA 2GIVA 3U2RA 2DPUA 2GQQA 1O7FA 4CHUA 1XD7A 4KYWA 3KEQA 4G7HF 1GXQA 1ZG5A 2FEZA 3BWGA 4L5IA 1LB2A 2P4WA 2ESHA 5DCMB 2DK5A 4BHBA 1YYVA 3I59A 2Y75A 3KETA 1O3SA 4E70A 1G4DA 1RZ4A 5LGNA 3Q9SA 1W7PD 1LJ9A 2EFNA 1KYWA 5LHGA 3F72A 4LK1F 4Q48A 2A61A 1ONVA 3CUQA 2AXLA 1QQIA 2OU2A 1J9IA 1HKQA 2VOOA 3BOQA 1CF7B 2A6HF 4NB5A 3HHGA 1RUNA 3TGNA 3QP6A 1R5GA 3HHHA 2J5PA 2ISYA 5HS7A 1TTYA 4BQAA 1FP1D 4OINF 3N97A 2G7UA 1HKSA 1S8NA 4CDGA 3GVAA 3MWMA 3RPQA 4M6YA 4LLNA 5ERIA 2RN7A 3BY6A 1OMIA 2IVMA 1U5TB 2NAZA 2K4JA 5EEHA 1YQAA 4G7OF 3ZP5A 3K0LA 3CJNA 3HTSB 1ON1A 4L9VA 4M74A 4OIQF 5K5RA 2QQ9A 1QPMA 5DEQA 3JTHA 4PGHA 1YIOA 2BGCA 5K5QA 2XKPA 3FMQA 2FXAA 1B1BA 1EV7A 1IRGA 5E18F 2HS5A 3LAJA 1I5ZA 4B8XA 2VBWA 2FBKA 3K1PA 1F5TA 3O3KA 4ZYEA 1YFHA 3J80K 4XSXF 4JK1X 1BN5A 3GO5A 3QPTA 5DD8A 1STZA 5A2QZ 4L18B 3TDZC 4WF2A 2XROA 2ZNZA 4G94A 1OPCA 2V6CA 1L0OC 2W84A 5J8CA 4L9TA 2IW5A 1FBUA 5KVRA 2DW4A 5J6XA 3KP2A 5JHUA 1U5TC 3NRVA 1O3TA 4HV6A 5LLQA 2M1BA 2L4AA 3FXRA 5E1WA 2CQKA 5L3GA 1IAWA 1K79A 3RDIA 2VODA 3ERED 4XLPF 2BV6A 4EM1A 4RGRA 2X0LA 3I58A 1S29A 4LB6B 3IRQA 4HX4A 1G3SA 4KIFA 2LF8A 3H3UA 1E17A 2JZYA 3H3ZA 2OZUA 4HBLA 2WV0A 2FF4A 3WTWC 2ZKZA 3V4GA 3IL2A 5L3BA 2VBYA 4H0EA 2FBIA 1ZYRF 2ELHA 2PI0A 1HW1A 1MGTA 2VN2A 1W4MA 4IHSA 5CJ9A 3TQNA 2VE9A 3E5XA 5ICGA 2R7FA 4EJVA 2M8EA 1T0FA 2HTJA 3DP7A 2PFBA 5CLSA 5DYMA 5E1XA 4HW0A 3FF5A 3KCCA 4ZYHA 4KUMA 2V79A 1O57A 4M6XA 1PDNC 3GZ6A 5AIPA 5ICCA 2Q0OA 5BMZA 1ZARA 2ISZA 1MJAA 4N9IA 2CW0F 1FYLA 4WXDA 5DCMA 2L01A 2XASA 2YPRA 3IKTA 4I09A 4QLCU 1BI2A 1RIOH 1XGNA 5L3DA 3J81K 2HQRA 4LJZF 3JW4A 2HOEA 5DUKA 3GW2A 3HIFA 4KA4A 1R5HA 1XB4A 4OIPF 3FHZA 5FO5A 3SZPA 4ENJA 3CO7C 4DNCA 2Z33A 3WTXC 2PEXA 3OOPA 3ISPA 4PGGA 1CF7A 2Z99A 2VT2A 5L3EA 1IXSB 1IUYA 1QO0D 3SHFA 1DDNA 2K4BA 4EM2A 3BROA 3TKYA 2DTRA 3U9GA 2QQBA 2ACJA 4AIHA 2PMHA 5BQTA 3J7AO 1TW2A 1E2XA 2L02A 4LGWA 3U1DA 2UXXA 4P5OA 5E20A 5H6RA 3W6JB 3IHUA 2EV0A 1IN5A 2RKHA 1YS6A 1IW7F 2YR2A 2KIUA 4M9XA 4CYDA 5TRDA 1TNSA 2P5KA 5DV5A 3ZMVA 4ESFA 1MJ9A 1S3JA 4JBAA 5BS6A 3FZVA 3GWZA 4ESJA 1VTNC 2ADUA 1Z9CA 2ZBKA 3D0SA 2QM3A 5DUIA 2KJCA 1REPC 1HW5A 2JPBA 2XKOA 5HLGA 1QBJA 3D5LA 2H09A 2FQ3A 3NEUA 2HQNA 2DFIA 4FX0A 1Z6RA 4WWCA 2E1CA 4RGUA 3MAJA 3WGIA 2G9WA 2XAGA 3VFZA 3LFKA 4EGYA 4M73A 2CGPA 3GYHX 5LGUA 1HSTA 5LBQA 3GLXA 3RJPA 1FBSA 4NHJA 4ETSA 4HZFA 3ZMSA 4TV7A 1ZG1A 5DCFA 3ULQB 1I27A 2PBIA 5ICEA 5FLXK 3WE3A 1F1ZA 4LG0B 1WQ2A 4GO1A 5LRSA 3DFGA 1USTA 3VODA 1MDMB 2JSCA 3V8JA 1UHMA 1U6GA 4Q5SF 1OYWA 4YIFA 2FU4A 1YTYA 3I71A 2QUFA 4EJTA 2ZJ2A 4OOIA 2V9VA 4I02A 3HRTA 5BOXA 2DLLA 3QAHA 4D0PA 3S2WA 2V1XA 2PJPA 4WXHA 2HEOA 2ZFWA 2FOKA 4RS8A 3F8BA 1KA8A 1SFXA 1D8KA 2QBYB 2GWRA 1ZH5A 1UFMA 3F21A 4L9NA 1IN7A 5LEJA 4R1HA 1FY7A 3EYYA 1MZBA 2EFOA 4WCGA 4FHTA 5F6FA 2H27A 2OAZA 3G3ZA 1QZZA 1J5YA 1XMKA 2L3DA 3QPHA 4HDUA 4IHTA 1XDSA 3OV8A 4PCQA 2LDUA 4S05A 3TO7A 4BH9A 3L7WA 1NHAA 4HQEA 2KKOA 5LGTA 2OBPA 3CO6C 1LDJA 2HYFA 4RB1A 4IRIA 3SFZA 5HDGA 1EH6A 3IRRA 4AIKA 3E5UA 5D5XB 1XN7A 2ZCWA 2EV6A 3QP5A 2GA1A 4EQQA 5BPIA 3HYIA 4U0WA 3P7NA 1U2WA 3R6SA 5IT9Z 4G8XA 1YG2A 2QLZA 1X3UA 3KLNA 2J5OA 3EYIA 1KQ0A 4KN7X 1YO5C 2V1DA 1P4AA 2Y0MA 1CGPA 5D4RA 3BZ6A 3VOEA 2O8XA 2K7LA 3ZN0A 3JAMK 5F1RA 2OQGA 2A5YB 1AWCA 1YW9A 3RKYA 2W25A 4MTEA 1B9NA 3SXYA 3BP8A 4P96A 2P5VA 3F8NA 4PDKA 2VBXA 1KQ9A 3Q5FA 2DU9A 2RC4A 2DQLA 1HBXG 1SMYF 3SQNA 3FXUA 4N9HA 3I0TA 4G6QA 4BNCA 3FWEA 1KU9A 1ZGJA 1TQMA 4ZYDA 2XIGA 5HLIA 2FBHA 4ESBA 2XGXA 5LRRA 4HLXA 1ZGAA 5DD4A 3LA3A 3M9AA 4Z2YA 3LQRA 4HQMA 3PQKA 3E3VA 2LF7A 2CFXA 2M87A 4LB5A 2CO5A 2FSWA 4CO8A 2D1HA 4U7BA 1BM9A 2H6CA 2EB7A 2HGCA 2VXZA 3VB2A 1G3YA 1HQCA 1U8RA 2X4HA 5D5UB 1KU3A 1U3EM 2EV5A 3L00A 2FE3A 3FXQA 1BI1A 4CICA 2K02A 4IVNA 1WKMA 5AIQA 2Y48A 3WTYC 3IWZA 2EFQA 2OQRA 2WWYA 5K1YA 1DPUA 2ZMEB 1HSJA 3REOA 2VC0A 4LG0A 3K69A 1LVAA 3DF8A 2YSRA 1MDMA 3V7CA 2DBBA 3R0AA 3L09A 1R36A 4B09A 1V4RA 4MEXF 5BPDA 4HF0A 2ZNYA 1A04A 4S04A 3F3XA 3WTUC 1W5TA 4HLYA 2QBYA 4MEYF 2KJBA 1SD6A 1FNNA 1IN4A 1ZAOA 2UZKA 4Q47A 3RKWA 4G6DA 2D2WA 3ML6A 5HDKA 3RTRA 1QGPA 3O6BB 1K7AA 1SFUA 2STTA 2Q2EA 4NQWA 1JHHA 3LWFA 5ILVA 5FFZA 1JGSA 3AAFA 2DI3A 1UB9A 3ZN1A 4YFXF 1P4XA 4Q4ZF 4ON0A 4IJAA 5HS8A 3ABTA 4I2OA 2O6GE 4P9UA 3K1MA 3KEOA 3O2PE 3ECOA 3WU1B 4HDVA 3P9KA 3GFIA 2K27A 4XLNF 1J2XA 3ZMTA 1P4WA 4BYYA 4KIBA 4EJOA 1MKMA 2HR3A 4HAMA 3KZZA 4HX7A 3MFKA 2GZWA 3EQLF 2CSOA 2Z5UA 2CYYA 3Q9VA 1XGOA 4LMYA 1TQIA 3R60A 4RAZA 1KYZA 2QYOA 1LEBA 1PUEE 4KICA 3DXJF 2ZO4A 1WSUA 2MLGA 4UVAA 1ZHFA 3IC7A 2O61A 3WTVC 2VE8A 4P55A 1IF1A 3B02A 1R7JA 2CG4A 3HOSA 2FMLA 3QRFF 3JSOA 4RAYA 2PN6A 3I59B 5IT3A 3IKVA 1GHCA 1ZRFA 4OIRF 3HSFA 1RI7A 3FM3A 4EV0A 2EFPA 4I7HA 3H92A 2EA4A 3I54A 4GXOA 2Q8KA 2K86A 3ZMZA 2A69F 1JHFA 2GXGA 2R3SA 1U5TA 1ZN2A 3CUQB 2MH2A 2D1VA 2DO7A 1ON2A 3V7SA 4ASNA 4RB2C 1SFEA 1K6OA 2FNAA 3NQOA 4A5NA 3LQQA 4ENMA 1D3YA 1Q1HA 4KIGA 3ZPLA 4LFUA 4L0ZB 2XAJA 2F5CA 5E1ZB 1YW8A 3GX4X 2D45A 1LNWA 1XSXA 4BHPA 2MD5A 3P9IA 4QWQA 3I64A 1UCRA 3J80Z 4IRGA 1T2KA 4WK8F 3F23A 1V3FA 4MHGA 3ELKA 4O3MA 1BC7C 4U0VA 4GYGA 2DK8A 4LD5A 2CWEA 4I98B 2HWVA 2A6EF 3PFIA 1PP7U 4MQ9F 2YU3A 2HYGD 2HFHA 3ECHA 3ZMDA 5H20A 3BPVA 3I5UA 3LSTA 4GCVA 4P9FA 3B73A 3L2CA 2OD5A 4A0ZA 4OIOF 1ULYA 4UVCA 1ZLKA 3ABUA 3RIRA 2P5LC 3JSPA 3CUQC 3WG9A 3EUHA 1G6NA 4U0YA 3RI4A 3F6OA 2XVCA 2E7WA 5LHIA 4IRHA 2MC3A 4I0AA 3K2ZA 4M9SA 1S7OA 3TOBA 3E6CC 4R79A 4I01A 4O6JA 1FC3A 1L3LA 3WU0A 3I53A 4U88A 2IRFG 1XCBA 1G3WA 2EA2A 5A2QK 5FGMA 3RPUA 1S7AA 2OA4A 4KNYA 1BC8C 4KMFA 1DUXC 5JVTA 1Z1DA 4AIJA 1DPRA 4O5VA 4HOBA 4IPAA 4WXCA 3SZTA 5HVQC 2RNJA 2HDCA 4UHTA 4HX8A 3TO9A 1B4AA 3ZMUA 5CVRA 2QZ8A 4AWXB 1OR7A 2G7HA 3HRSA 1I1SA 3WGHA 3V8LA 1BI3A 4WX9A 1BOAA 3KP5A 4XBFA 2IA0A 3WTTC 1FX7A 5L3CA 3N4MA 4CZZA 2F5EA 3F8FA 1BIBA 4RB3C 2IP2A 2DPDA 4LLGF 1ODDA 4UV8A 3T1BA 3MQ0A 2E1NA 5DDGA 2VBZA 5CVVA 1FLIA 1Z05A 2EJRA 1ZLJA 3M1EA 5ILSA 3R0JA 4ENKA 2MLKA 1K78B 3KP7A 3FX3A 2M45A 1WRJA 1FSEA 2RV8A 1MJBA 2NRAC 3CDHA 3WE2A 2JPCA 4ZYGA 1KU2A 2GA2A 2EFWA 4EJWA 3F8CA 5CVIA 4A0XA 3KP3A 1B6AA 2A3SA 4LLLA 3BJAA 3HTUA 5FD5A 2H6BA 2F2EA 2RDPA 3JTGA 1RNLA 4XSZF 1H9GA 5AONA 1FPQA 1RUOA 1I6XA 1XGMA 1ZRCA 4YIIA 3F6VA 1SD5A 1FYKA 4I0BA 3KZYA 3L9FA 2GXBA 2QENA 1IXRC 5JR3A 3DPLC 1USSA 4FX4A 2P6SA 1W7PB 2XV4S 2KIFA 1KGSA 1FWZA 3M8FA 2R7DA 3KLOA 2IT0A 4KN4X 5D6EA 4A12A 2A07F 2PMUA 4MGRA 1HW2A 4GGGA 4EGZA 3GXOA 4KT5C 1GXPA 1EH8A 2STWA 4AD9A 1AOYA 4UNOA 2RQPA 4HA8A 1F9NA 1FBQA 3DQVC 5TJJA 2OZ6A 3WODF 2DT5A 4HYEA 3RKXA 3DEUA 1BJAA 3MEXA 1B9MA 2B0LA 1XMAA 5JI6A 4MQVA 3WGGA 1IZ1A 4ZZDA 1HXDA 1FT9A 2HKXA 2ETHA 2O0YA 2W57A 3HSEA 3DPTA 1R1TA 2P8TA 1BIAA 1P92A 4Y17A 2VONA 4L5JA 3CLOA 3MCZA 2AS5F 2E7XA 2ESNA 5H6QA 1LDKB 5ILUA 2L54A 2W85A 2KRFA 1Y0UA 2Z3YA 1T38A 3R61A 2O03A 1FOKA 4RB0A 1W5SA 4IXAA 2NNYA 5ED4A 5FLXZ 2XHKA 4DQ2A 5E8IA 2L4MA 4MNUA 4GYIA 1P2FA 5HS9A 2EK5A 4ZH4F 3ZQ7A 2UXNA 4EVIA 2BE5F 3KFWX 2TDXA 3TDUC 3HRUA 3QU3A 3GFJA 1U78A 2FA5A 1YLFA 4EMSA 2RGVA 5J8FA 5KK1A 3E5QA 3KP6A 4EM0B 2JTVA 1P6RA 2Z9OA 5HOOA 3V7RA 3WTSC 3EDPA 2C6YA 2P7CB 2EWNA 3E6MA 2VOPA