4F6MA

Crystal structure of kaiso zinc finger dna binding domain in complex with kaiso binding site dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
116
Chain Sequence
DHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis for recognition of methylated and specific DNA sequences by the zinc finger protein Kaiso.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Transcriptional regulator Kaiso
total genus 28
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6mA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6mA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6mA02
4R2QA 2EPUA 2ENCA 1BB8A 4WSGA 1UN6B 2EMKA 2I13A 2YTQA 2EOEA 4M9VC 1X6FA 5KL3A 1Z1BA 2JP9A 2NABA 1TF3A 2EOFA 3VHTB 2D9HA 2EQ0A 2EMZA 2EM0A 2EN4A 2YTJA 2RPCA 1X6HA 2ENHA 2CT1A 2EM9A 2DMIA 2EM6A 2WBSA 3EPJA 1DGCA 1P47A 1G2DC 2EN3A 2WCC3 2EOMA 1X5WA 2R1FA 2YRKA 4IS1C 2MKNA 2EQ3A 1JK1A 3EPLA 2EOXA 1MEYC 2YU5A 2VRDA 2JPAA 3EPKA 3EPHA 2EM3A 2J7JA 1LLMC 2EOJA 1TF6A 2EORA 4R2CA 2PRTA 1A1JA 5KL4A 2EPZA 3MHHC 2EMAA 2CSHA 2EM2A 2EN1A 2EOOA 2EL6A 2EPXA 4IJDA 2EN8A 2LVHA 2EL5A 2WBUA 2EOSA 2WBTA 2EPAA 2EPPA 1A1HA 3UK3C 2EMGA 2EM4A 2GHFA 1RMDA 4R2RA 1A1IA 4FK5C 2ELYA 2YU8A 2EJ4A 4F2JC 2YTDA 2EMFA 2EM8A 1YUJA 2EM7A 2EOHA 2EP3A 4R2AA 2GLIA 2ELZA 5KL6A 1YUIA 4R2DA 1ZR9A 2DLKA 2YTIA 1YSAC 2EQ1A 2YTNA 2EMCA 2EMXA 2A25A 1ZAAC 2EMBA 1ZU1A 2EMIA 2M9AA 1TN9A 2DRPA 4F6NA 2BB8A 2YRHA 1AAYA 2EMYA 1X3CA 2RSIA 2DLQA 1WJPA 2EN7A 4X9JA 1UBDC 1F2IG 2YTFA 5KL2A 1BBOA 2LO3A 1G2FC 3MHSC 1B69A 2ADRA 2EPRA 1A1KA 2LV2A 1X6EA 2LCEA 2EPCA 2DGCA 2EM5A 2EL4A 2MKDA 2YTOA 4GZNC 1A1LA 1NCSA 1JK2A 1KJKA 2EN2A 5KL7A 2LT7A 2EN6A 3M99B 4F6MA 2HGHA 2CTDA 1A1GA 5KL5A 2ENAA 2YTPA 2YSPA 2YSOA 2EE8A 2EOIA 4R2EA 2E72A 2EMWA 4R2SA 2EOYA 2YTEA 2MDGA 4R2PA 1A1FA 2EMLA 2EOZA 2EMHA 2YTGA 2EOQA 2YRMA
chains in the Genus database with same CATH superfamily
4R2QA 4WFTA 1J5EE 4WSGA 2I13A 1MGTA 3IWCA 4M9VC 4NXNE 1T4OA 2E1MA 2ODRD 1RC7A 1TF3A 1XMOE 3VHTB 2DIXA 4F9AB 3HXLA 2EN4A 2MC5A 2RPCA 1T4LB 1PJSA 2CT1A 2EM9A 2EM6A 2WBSA 2MC6A 1DGCA 2M1SA 2IHR1 4DMIA 2EOMA 2L2KB 3KZYA 2YRKA 4WXDA 3EQ1A 2L3CA 4LF8E 3EPLA 4DV1E 3T1YE 2N8XA 2L6MA 3F6HA 3EPHA 2KONA 2EOJA 3LMLA 2EORA 4JI5E 5A6BD 1FJGE 1ZBQA 2NUFA 3THOB 5LL6R 2V86A 4DV5E 2EPXA 2RS6A 4AQYE 4JV5E 2EL5A 2WBUA 4BCAA 4ZYHA 4O43A 2EMGA 1EH8A 1EKZA 4BMJA 3C4BA 2BBGA 5A6JA 1RQ0A 2EJ4A 4WSPA 4DR5E 3VYXA 2YTDA 1UILA 2EMFA 1QNTA 2L33A 5A2QC 3BGHA 2RS7A 3VK6A 4RH8A 1ZR9A 2DLKA 2VF1A 2EQ1A 2LRSA 5BR8E 2YTNA 4R03A 2UUBE 2EMBA 1ZU1A 2EMIA 2DRPA 4LF7E 3MSWA 1IMUA 4LF5E 1UBDC 4OOGC 2NUEA 2YTFA 1XNRE 2LO3A 2UU9E 3BF2A 5DNYA 2JOBA 2JXPA 2DMYA 2L2MA 4DV4E 2V89A 1A1LA 1JK2A 5A6BA 2LT7A 5AC4A 3M99B 4OX9E 5IWAE 3HPSA 2YTPA 2JYAA 4KHPE 2EE8A 1DQ3A 1EH6A 4R2EA 2E72A 3BIDA 4R8OA 2CPNA 2EOYA 4N4RB 4R2PA 1A1FA 2L92A 3OTOE 2UUCE 4WYQB 2K4VA 1BB8A 5A6KA 3C6MA 1UN6B 2H36X 2VQEE 3OMLA 2YTQA 5TSEA 1AH5A 4BHCA 2JP9A 3BBGA 3FIGA 2D9HA 2EQ0A 2EM0A 4GKKE 2L8TA 3J7Yp 2YZTA 5IV8B 2VQFE 3TQMA 2L3JA 2V85A 4ZYEA 3EPJA 2LUPB 2WCC3 1T38A 2HJJA 3J81C 3AV0A 2B7VA 5LMNE 1YYOA 1JK1A 2V87A 5IXMB 2EOXA 1MEYC 2EZ6A 2LMZA 3J80C 2JPAA 4X65E 1YYWA 1LLMC 1TF6A 4LFAE 4R2CA 2JY9A 4O24A 4BBYA 4BS9A 1IBME 4JI6E 2V8QB 2LJHA 2M7QA 3K6QA 1IBKE 3MHHC 1NEIA 2EMAA 2FGGA 2EOOA 4O4KA 4IJDA 4DUYE 2EPAA 2EPPA 3T1HE 1A1HA 4JI7E 4DR4E 2LE2A 2HC5A 4YY3E 4R2RA 5AC5A 2JWOA 2EM8A 2EM7A 3P1XA 1WHQA 2EOHA 4GKJE 4R2AA 3J7AG 4TUGA 1L4SA 2LTSA 1HNZE 1YSAC 1DI2A 1ZAAC 4NZVA 1PJTA 4F6NA 4B3SE 2V88A 2M4IA 4DKKA 2RSIA 1G2FC 2ADRA 1A1KA 2EPOA 1KYQA 2EPCA 2DGCA 2EM5A 2EL4A 4YHHE 1KJKA 4GZNC 2UUAE 1N3GA 1SR9A 4B3RE 2CTDA 4Q28A 2YSPA 5FLXC 1WRJA 2DSYA 2EOIA 4WX9A 1QU6A 1UHZA 4DR1E 1WXRA 2L2NA 2KHXA 4LFBE 4KZSA 5A6AA 2EOZA 2YTGA 2R76A 2YRMA 4NHRA 5T6JA 4DR6E 4ZYDA 2EPUA 2EMKA 3HTXA 2Q8UA 1Z1BA 3F6GA 2K7IA 2NABA 5AE3A 2B9DA 3IWDA 2ENHA 4K0KE 2UXDE 1FKAE 2ZM6E 1P47A 3ADLA 4WXCA 1G2DC 2EPMX 4L5NC 1X5WA 2R1FA 2MKNA 2I9IA 2EQ3A 2RSMA 4L8NA 2VE7C 2JOXA 5AE2A 2LBSB 4X66E 1HNWE 2J7JA 3KZZA 4LTYA 1A1JA 4J8ZA 1X47A 5KL4A 3C4TA 4BC9A 4M30A 2EPZA 2KOUA 2CSHA 2EM2A 1YZ9A 2EL6A 3HPZA 5A69A 3THNA 4LF6E 5CFFE 3UK3C 1YFHA 4LF4E 3L00A 1GTKA 3RMPA 1IBLE 4BHBA 4F54A 4RHBB 4DR7E 3IWBA 1STUA 1A1IA 4FK5C 1HR0E 1I94E 4LFCE 5LMUE 1GQEA 4KWYA 3LLHA 3HQ1A 2HHHE 4JI0E 4LF9E 1YPNA 2EMCA 4JI8E 1WHNA 2EMXA 1TN9A 2M9AA 4Q35B 3JAMC 2YRHA 1AAYA 4B3ME 1PDAA 1X3CA 5LLQA 2NUGA 1WJPA 1T4NA 2MDRA 2N3GA 1BBOA 3VYYA 3MHSC 4DV7E 1B69A 3ZOQB 2LV2A 3JU0A 1X6EA 5AASA 1NCSA 2EN2A 1IQOA 3H09A 2EN6A 1X49A 4F6MA 1X48A 5KL5A 2ENAA 4MLQA 4WPYA 2EMWA 4R2SA 2F4VE 2MDGA 2RQLA 2F8BA 2N3HA 2EOQA 4JYAE 4F9CB 4DUZE 2EPLX 5AE1A 2ENCA 5IT9C 2EPKX 4BC7A 2EOEA 1X6FA 5KL3A 1GZ6A 2EOFA 2RTXA 4HEIA 4X8WA 2EMZA 2YTJA 1N34E 1IQSA 1X6HA 1BBGA 2DMIA 4O5GA 4TUIA 1SFEA 2LTRA 4JI2E 2LUQA 2EN3A 3AUZA 4GEQB 2UXBE 2YPNA 4IS1C 3ADIA 4DV2E 4M2ZA 3DJWA 2FTXB 4B3TE 2YU5A 2VRDA 1EH7A 3EPKA 2EM3A 1T39A 2YWQA 2PRTA 3ADJA 4JI3E 3DF6A 4DV6E 1YYKA 4X62E 2EWLA 3KWRA 2EN1A 1ZBTA 2EN8A 2LVHA 2EOSA 1HNXE 2FV4B 1J26A 2WBTA 4P78A 1PJQA 2ODRC 2EM4A 2JVAA 2G7HA 1XMQE 2GHFA 1RMDA 2B3TB 2JR1A 2ELYA 1O0WA 2LJUA 2YU8A 4P7DA 4F2JC 4DR3E 1N33E 1YUJA 5F3WA 1PKPA 2EP3A 2GLIA 2UXCE 2ELZA 5KL6A 1N36E 1YUIA 4DV0E 4R2DA 4HTGA 2E5LE 2YT4A 2YTIA 2GPIA 2A25A 3C6KA 2EPNA 2BB8A 2EMYA 4MLVA 4LU9A 4NXME 2DB2A 2DLQA 2EN7A 4X9JA 1F2IG 5KL2A 2EPRA 4ZYGA 4DV3E 4DR2E 2LCEA 3QG5C 2V83A 4JI4E 2B7TA 2MKDA 4X64E 2YTOA 2WZOA 3JTZA 5KL7A 4JI1E 1N32E 2HGHA 3ECRA 1A1GA 4I8OA 4M0VA 5ADZA 2YSOA 3ADGA 4F9BB 1XNQE 2YTEA 2EMLA 2EMHA 2NA2A
chains in the Genus database with same CATH topology
4R2QA 2EPUA 2ENCA 1BB8A 4WSGA 1UN6B 2EMKA 2I13A 2YTQA 2EOEA 4M9VC 1X6FA 5KL3A 1Z1BA 2JP9A 2NABA 1TF3A 2EOFA 3VHTB 2D9HA 2EQ0A 2EMZA 2EM0A 2EN4A 2YTJA 2RPCA 1X6HA 2ENHA 2CT1A 2EM9A 2DMIA 2EM6A 2WBSA 3EPJA 1DGCA 1P47A 1G2DC 2EN3A 2WCC3 2EOMA 1X5WA 2R1FA 2YRKA 4IS1C 2MKNA 2EQ3A 1JK1A 3EPLA 2EOXA 1MEYC 2YU5A 2VRDA 2JPAA 3EPKA 3EPHA 2EM3A 2J7JA 1LLMC 2EOJA 1TF6A 2EORA 4R2CA 2PRTA 1A1JA 5KL4A 2EPZA 3MHHC 2EMAA 2CSHA 2EM2A 2EN1A 2EOOA 2EL6A 2EPXA 4IJDA 2EN8A 2LVHA 2EL5A 2WBUA 2EOSA 2WBTA 2EPAA 2EPPA 1A1HA 3UK3C 2EMGA 2EM4A 2GHFA 1RMDA 4R2RA 1A1IA 4FK5C 2ELYA 2YU8A 2EJ4A 4F2JC 2YTDA 2EMFA 2EM8A 1YUJA 2EM7A 2EOHA 2EP3A 4R2AA 2GLIA 2ELZA 5KL6A 1YUIA 4R2DA 1ZR9A 2DLKA 2YTIA 1YSAC 2EQ1A 2YTNA 2EMCA 2EMXA 2A25A 1ZAAC 2EMBA 1ZU1A 2EMIA 2M9AA 1TN9A 2DRPA 4F6NA 2BB8A 2YRHA 1AAYA 2EMYA 1X3CA 2RSIA 2DLQA 1WJPA 2EN7A 4X9JA 1UBDC 1F2IG 2YTFA 5KL2A 1BBOA 2LO3A 1G2FC 3MHSC 1B69A 2ADRA 2EPRA 1A1KA 2LV2A 1X6EA 2LCEA 2EPCA 2DGCA 2EM5A 2EL4A 2MKDA 2YTOA 4GZNC 1A1LA 1NCSA 1JK2A 1KJKA 2EN2A 5KL7A 2LT7A 2EN6A 3M99B 4F6MA 2HGHA 2CTDA 1A1GA 5KL5A 2ENAA 2YTPA 2YSPA 2YSOA 2EE8A 2EOIA 4R2EA 2E72A 2EMWA 4R2SA 2EOYA 2YTEA 2MDGA 4R2PA 1A1FA 2EMLA 2EOZA 2EMHA 2YTGA 2EOQA 2YRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2Q A;  2EPU A;  2ENC A;  1BB8 A;  4WSG A;  1UN6 B;  2EMK A;  2I13 A;  2YTQ A;  2EOE A;  4M9V C;  1X6F A;  5KL3 A;  1Z1B A;  2JP9 A;  2NAB A;  1TF3 A;  2EOF A;  3VHT B;  2D9H A;  2EQ0 A;  2EMZ A;  2EM0 A;  2EN4 A;  2YTJ A;  2RPC A;  1X6H A;  2ENH A;  2CT1 A;  2EM9 A;  2DMI A;  2EM6 A;  2WBS A;  3EPJ A;  1DGC A;  1P47 A;  1G2D C;  2EN3 A;  2WCC 3;  2EOM A;  1X5W A;  2R1F A;  2YRK A;  4IS1 C;  2MKN A;  2EQ3 A;  1JK1 A;  3EPL A;  2EOX A;  1MEY C;  2YU5 A;  2VRD A;  2JPA A;  3EPK A;  3EPH A;  2EM3 A;  2J7J A;  1LLM C;  2EOJ A;  1TF6 A;  2EOR A;  4R2C A;  2PRT A;  1A1J A;  5KL4 A;  2EPZ A;  3MHH C;  2EMA A;  2CSH A;  2EM2 A;  2EN1 A;  2EOO A;  2EL6 A;  2EPX A;  4IJD A;  2EN8 A;  2LVH A;  2EL5 A;  2WBU A;  2EOS A;  2WBT A;  2EPA A;  2EPP A;  1A1H A;  3UK3 C;  2EMG A;  2EM4 A;  2GHF A;  1RMD A;  4R2R A;  1A1I A;  4FK5 C;  2ELY A;  2YU8 A;  2EJ4 A;  4F2J C;  2YTD A;  2EMF A;  2EM8 A;  1YUJ A;  2EM7 A;  2EOH A;  2EP3 A;  4R2A A;  2GLI A;  2ELZ A;  5KL6 A;  1YUI A;  4R2D A;  1ZR9 A;  2DLK A;  2YTI A;  1YSA C;  2EQ1 A;  2YTN A;  2EMC A;  2EMX A;  2A25 A;  1ZAA C;  2EMB A;  1ZU1 A;  2EMI A;  2M9A A;  1TN9 A;  2DRP A;  4F6N A;  2BB8 A;  2YRH A;  1AAY A;  2EMY A;  1X3C A;  2RSI A;  2DLQ A;  1WJP A;  2EN7 A;  4X9J A;  1UBD C;  1F2I G;  2YTF A;  5KL2 A;  1BBO A;  2LO3 A;  1G2F C;  3MHS C;  1B69 A;  2ADR A;  2EPR A;  1A1K A;  2LV2 A;  1X6E A;  2LCE A;  2EPC A;  2DGC A;  2EM5 A;  2EL4 A;  2MKD A;  2YTO A;  4GZN C;  1A1L A;  1NCS A;  1JK2 A;  1KJK A;  2EN2 A;  5KL7 A;  2LT7 A;  2EN6 A;  3M99 B;  4F6M A;  2HGH A;  2CTD A;  1A1G A;  5KL5 A;  2ENA A;  2YTP A;  2YSP A;  2YSO A;  2EE8 A;  2EOI A;  4R2E A;  2E72 A;  2EMW A;  4R2S A;  2EOY A;  2YTE A;  2MDG A;  4R2P A;  1A1F A;  2EML A;  2EOZ A;  2EMH A;  2YTG A;  2EOQ A;  2YRM A; 
#chains in the Genus database with same CATH topology
 4R2Q A;  4WFT A;  1J5E E;  4WSG A;  2I13 A;  1MGT A;  3IWC A;  4M9V C;  4NXN E;  1T4O A;  2E1M A;  2ODR D;  1RC7 A;  1TF3 A;  1XMO E;  3VHT B;  2DIX A;  4F9A B;  3HXL A;  2EN4 A;  2MC5 A;  2RPC A;  1T4L B;  1PJS A;  2CT1 A;  2EM9 A;  2EM6 A;  2WBS A;  2MC6 A;  1DGC A;  2M1S A;  2IHR 1;  4DMI A;  2EOM A;  2L2K B;  3KZY A;  2YRK A;  4WXD A;  3EQ1 A;  2L3C A;  4LF8 E;  3EPL A;  4DV1 E;  3T1Y E;  2N8X A;  2L6M A;  3F6H A;  3EPH A;  2KON A;  2EOJ A;  3LML A;  2EOR A;  4JI5 E;  5A6B D;  1FJG E;  1ZBQ A;  2NUF A;  3THO B;  5LL6 R;  2V86 A;  4DV5 E;  2EPX A;  2RS6 A;  4AQY E;  4JV5 E;  2EL5 A;  2WBU A;  4BCA A;  4ZYH A;  4O43 A;  2EMG A;  1EH8 A;  1EKZ A;  4BMJ A;  3C4B A;  2BBG A;  5A6J A;  1RQ0 A;  2EJ4 A;  4WSP A;  4DR5 E;  3VYX A;  2YTD A;  1UIL A;  2EMF A;  1QNT A;  2L33 A;  5A2Q C;  3BGH A;  2RS7 A;  3VK6 A;  4RH8 A;  1ZR9 A;  2DLK A;  2VF1 A;  2EQ1 A;  2LRS A;  5BR8 E;  2YTN A;  4R03 A;  2UUB E;  2EMB A;  1ZU1 A;  2EMI A;  2DRP A;  4LF7 E;  3MSW A;  1IMU A;  4LF5 E;  1UBD C;  4OOG C;  2NUE A;  2YTF A;  1XNR E;  2LO3 A;  2UU9 E;  3BF2 A;  5DNY A;  2JOB A;  2JXP A;  2DMY A;  2L2M A;  4DV4 E;  2V89 A;  1A1L A;  1JK2 A;  5A6B A;  2LT7 A;  5AC4 A;  3M99 B;  4OX9 E;  5IWA E;  3HPS A;  2YTP A;  2JYA A;  4KHP E;  2EE8 A;  1DQ3 A;  1EH6 A;  4R2E A;  2E72 A;  3BID A;  4R8O A;  2CPN A;  2EOY A;  4N4R B;  4R2P A;  1A1F A;  2L92 A;  3OTO E;  2UUC E;  4WYQ B;  2K4V A;  1BB8 A;  5A6K A;  3C6M A;  1UN6 B;  2H36 X;  2VQE E;  3OML A;  2YTQ A;  5TSE A;  1AH5 A;  4BHC A;  2JP9 A;  3BBG A;  3FIG A;  2D9H A;  2EQ0 A;  2EM0 A;  4GKK E;  2L8T A;  3J7Y p;  2YZT A;  5IV8 B;  2VQF E;  3TQM A;  2L3J A;  2V85 A;  4ZYE A;  3EPJ A;  2LUP B;  2WCC 3;  1T38 A;  2HJJ A;  3J81 C;  3AV0 A;  2B7V A;  5LMN E;  1YYO A;  1JK1 A;  2V87 A;  5IXM B;  2EOX A;  1MEY C;  2EZ6 A;  2LMZ A;  3J80 C;  2JPA A;  4X65 E;  1YYW A;  1LLM C;  1TF6 A;  4LFA E;  4R2C A;  2JY9 A;  4O24 A;  4BBY A;  4BS9 A;  1IBM E;  4JI6 E;  2V8Q B;  2LJH A;  2M7Q A;  3K6Q A;  1IBK E;  3MHH C;  1NEI A;  2EMA A;  2FGG A;  2EOO A;  4O4K A;  4IJD A;  4DUY E;  2EPA A;  2EPP A;  3T1H E;  1A1H A;  4JI7 E;  4DR4 E;  2LE2 A;  2HC5 A;  4YY3 E;  4R2R A;  5AC5 A;  2JWO A;  2EM8 A;  2EM7 A;  3P1X A;  1WHQ A;  2EOH A;  4GKJ E;  4R2A A;  3J7A G;  4TUG A;  1L4S A;  2LTS A;  1HNZ E;  1YSA C;  1DI2 A;  1ZAA C;  4NZV A;  1PJT A;  4F6N A;  4B3S E;  2V88 A;  2M4I A;  4DKK A;  2RSI A;  1G2F C;  2ADR A;  1A1K A;  2EPO A;  1KYQ A;  2EPC A;  2DGC A;  2EM5 A;  2EL4 A;  4YHH E;  1KJK A;  4GZN C;  2UUA E;  1N3G A;  1SR9 A;  4B3R E;  2CTD A;  4Q28 A;  2YSP A;  5FLX C;  1WRJ A;  2DSY A;  2EOI A;  4WX9 A;  1QU6 A;  1UHZ A;  4DR1 E;  1WXR A;  2L2N A;  2KHX A;  4LFB E;  4KZS A;  5A6A A;  2EOZ A;  2YTG A;  2R76 A;  2YRM A;  4NHR A;  5T6J A;  4DR6 E;  4ZYD A;  2EPU A;  2EMK A;  3HTX A;  2Q8U A;  1Z1B A;  3F6G A;  2K7I A;  2NAB A;  5AE3 A;  2B9D A;  3IWD A;  2ENH A;  4K0K E;  2UXD E;  1FKA E;  2ZM6 E;  1P47 A;  3ADL A;  4WXC A;  1G2D C;  2EPM X;  4L5N C;  1X5W A;  2R1F A;  2MKN A;  2I9I A;  2EQ3 A;  2RSM A;  4L8N A;  2VE7 C;  2JOX A;  5AE2 A;  2LBS B;  4X66 E;  1HNW E;  2J7J A;  3KZZ A;  4LTY A;  1A1J A;  4J8Z A;  1X47 A;  5KL4 A;  3C4T A;  4BC9 A;  4M30 A;  2EPZ A;  2KOU A;  2CSH A;  2EM2 A;  1YZ9 A;  2EL6 A;  3HPZ A;  5A69 A;  3THN A;  4LF6 E;  5CFF E;  3UK3 C;  1YFH A;  4LF4 E;  3L00 A;  1GTK A;  3RMP A;  1IBL E;  4BHB A;  4F54 A;  4RHB B;  4DR7 E;  3IWB A;  1STU A;  1A1I A;  4FK5 C;  1HR0 E;  1I94 E;  4LFC E;  5LMU E;  1GQE A;  4KWY A;  3LLH A;  3HQ1 A;  2HHH E;  4JI0 E;  4LF9 E;  1YPN A;  2EMC A;  4JI8 E;  1WHN A;  2EMX A;  1TN9 A;  2M9A A;  4Q35 B;  3JAM C;  2YRH A;  1AAY A;  4B3M E;  1PDA A;  1X3C A;  5LLQ A;  2NUG A;  1WJP A;  1T4N A;  2MDR A;  2N3G A;  1BBO A;  3VYY A;  3MHS C;  4DV7 E;  1B69 A;  3ZOQ B;  2LV2 A;  3JU0 A;  1X6E A;  5AAS A;  1NCS A;  2EN2 A;  1IQO A;  3H09 A;  2EN6 A;  1X49 A;  4F6M A;  1X48 A;  5KL5 A;  2ENA A;  4MLQ A;  4WPY A;  2EMW A;  4R2S A;  2F4V E;  2MDG A;  2RQL A;  2F8B A;  2N3H A;  2EOQ A;  4JYA E;  4F9C B;  4DUZ E;  2EPL X;  5AE1 A;  2ENC A;  5IT9 C;  2EPK X;  4BC7 A;  2EOE A;  1X6F A;  5KL3 A;  1GZ6 A;  2EOF A;  2RTX A;  4HEI A;  4X8W A;  2EMZ A;  2YTJ A;  1N34 E;  1IQS A;  1X6H A;  1BBG A;  2DMI A;  4O5G A;  4TUI A;  1SFE A;  2LTR A;  4JI2 E;  2LUQ A;  2EN3 A;  3AUZ A;  4GEQ B;  2UXB E;  2YPN A;  4IS1 C;  3ADI A;  4DV2 E;  4M2Z A;  3DJW A;  2FTX B;  4B3T E;  2YU5 A;  2VRD A;  1EH7 A;  3EPK A;  2EM3 A;  1T39 A;  2YWQ A;  2PRT A;  3ADJ A;  4JI3 E;  3DF6 A;  4DV6 E;  1YYK A;  4X62 E;  2EWL A;  3KWR A;  2EN1 A;  1ZBT A;  2EN8 A;  2LVH A;  2EOS A;  1HNX E;  2FV4 B;  1J26 A;  2WBT A;  4P78 A;  1PJQ A;  2ODR C;  2EM4 A;  2JVA A;  2G7H A;  1XMQ E;  2GHF A;  1RMD A;  2B3T B;  2JR1 A;  2ELY A;  1O0W A;  2LJU A;  2YU8 A;  4P7D A;  4F2J C;  4DR3 E;  1N33 E;  1YUJ A;  5F3W A;  1PKP A;  2EP3 A;  2GLI A;  2UXC E;  2ELZ A;  5KL6 A;  1N36 E;  1YUI A;  4DV0 E;  4R2D A;  4HTG A;  2E5L E;  2YT4 A;  2YTI A;  2GPI A;  2A25 A;  3C6K A;  2EPN A;  2BB8 A;  2EMY A;  4MLV A;  4LU9 A;  4NXM E;  2DB2 A;  2DLQ A;  2EN7 A;  4X9J A;  1F2I G;  5KL2 A;  2EPR A;  4ZYG A;  4DV3 E;  4DR2 E;  2LCE A;  3QG5 C;  2V83 A;  4JI4 E;  2B7T A;  2MKD A;  4X64 E;  2YTO A;  2WZO A;  3JTZ A;  5KL7 A;  4JI1 E;  1N32 E;  2HGH A;  3ECR A;  1A1G A;  4I8O A;  4M0V A;  5ADZ A;  2YSO A;  3ADG A;  4F9B B;  1XNQ E;  2YTE A;  2EML A;  2EMH A;  2NA2 A; 
#chains in the Genus database with same CATH homology
 4R2Q A;  2EPU A;  2ENC A;  1BB8 A;  4WSG A;  1UN6 B;  2EMK A;  2I13 A;  2YTQ A;  2EOE A;  4M9V C;  1X6F A;  5KL3 A;  1Z1B A;  2JP9 A;  2NAB A;  1TF3 A;  2EOF A;  3VHT B;  2D9H A;  2EQ0 A;  2EMZ A;  2EM0 A;  2EN4 A;  2YTJ A;  2RPC A;  1X6H A;  2ENH A;  2CT1 A;  2EM9 A;  2DMI A;  2EM6 A;  2WBS A;  3EPJ A;  1DGC A;  1P47 A;  1G2D C;  2EN3 A;  2WCC 3;  2EOM A;  1X5W A;  2R1F A;  2YRK A;  4IS1 C;  2MKN A;  2EQ3 A;  1JK1 A;  3EPL A;  2EOX A;  1MEY C;  2YU5 A;  2VRD A;  2JPA A;  3EPK A;  3EPH A;  2EM3 A;  2J7J A;  1LLM C;  2EOJ A;  1TF6 A;  2EOR A;  4R2C A;  2PRT A;  1A1J A;  5KL4 A;  2EPZ A;  3MHH C;  2EMA A;  2CSH A;  2EM2 A;  2EN1 A;  2EOO A;  2EL6 A;  2EPX A;  4IJD A;  2EN8 A;  2LVH A;  2EL5 A;  2WBU A;  2EOS A;  2WBT A;  2EPA A;  2EPP A;  1A1H A;  3UK3 C;  2EMG A;  2EM4 A;  2GHF A;  1RMD A;  4R2R A;  1A1I A;  4FK5 C;  2ELY A;  2YU8 A;  2EJ4 A;  4F2J C;  2YTD A;  2EMF A;  2EM8 A;  1YUJ A;  2EM7 A;  2EOH A;  2EP3 A;  4R2A A;  2GLI A;  2ELZ A;  5KL6 A;  1YUI A;  4R2D A;  1ZR9 A;  2DLK A;  2YTI A;  1YSA C;  2EQ1 A;  2YTN A;  2EMC A;  2EMX A;  2A25 A;  1ZAA C;  2EMB A;  1ZU1 A;  2EMI A;  2M9A A;  1TN9 A;  2DRP A;  4F6N A;  2BB8 A;  2YRH A;  1AAY A;  2EMY A;  1X3C A;  2RSI A;  2DLQ A;  1WJP A;  2EN7 A;  4X9J A;  1UBD C;  1F2I G;  2YTF A;  5KL2 A;  1BBO A;  2LO3 A;  1G2F C;  3MHS C;  1B69 A;  2ADR A;  2EPR A;  1A1K A;  2LV2 A;  1X6E A;  2LCE A;  2EPC A;  2DGC A;  2EM5 A;  2EL4 A;  2MKD A;  2YTO A;  4GZN C;  1A1L A;  1NCS A;  1JK2 A;  1KJK A;  2EN2 A;  5KL7 A;  2LT7 A;  2EN6 A;  3M99 B;  4F6M A;  2HGH A;  2CTD A;  1A1G A;  5KL5 A;  2ENA A;  2YTP A;  2YSP A;  2YSO A;  2EE8 A;  2EOI A;  4R2E A;  2E72 A;  2EMW A;  4R2S A;  2EOY A;  2YTE A;  2MDG A;  4R2P A;  1A1F A;  2EML A;  2EOZ A;  2EMH A;  2YTG A;  2EOQ A;  2YRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...