4F6MA

Crystal structure of kaiso zinc finger dna binding domain in complex with kaiso binding site dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
116
Chain Sequence
b'DHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulator Kaiso
publication title Molecular basis for recognition of methylated and specific DNA sequences by the zinc finger protein Kaiso.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 28
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6mA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6mA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6mA02
2EORA 2EPUA 2YTPA 1A1LA 2LVHA 2EQ0A 2EOYA 2MDGA 2YRKA 3MHSC 2YTEA 2EMAA 3EPLA 2YRMA 2YSPA 2YTQA 2EPCA 1YUJA 1NCSA 4F6MA 2EM4A 2YSOA 5KL6A 1AAYA 2EN2A 2LV2A 5KL7A 2A25A 2ELYA 2EMWA 2YTNA 2DLQA 2ENCA 2EN1A 3EPKA 2EE8A 1X5WA 5KL4A 4R2AA 2EM7A 1A1HA 2EOXA 4WSGA 2EPZA 2EOEA 4IJDA 2YTDA 3M99B 2EM9A 2EM3A 1A1GA 1ZU1A 2R1FA 2J7JA 2EOZA 2MKDA 1JK1A 1X3CA 1TF3A 2BB8A 2EM6A 1A1KA 3UK3C 2EQ1A 1WJPA 2EOIA 2EMFA 2EMLA 2EM8A 3VHTB 1ZAAC 1A1JA 2DGCA 2EPAA 4IS1C 2JP9A 2EOQA 1F2IG 3MHHC 2I13A 2GLIA 2EOHA 1A1FA 2YTFA 4GZNC 2CSHA 2EMZA 2EL6A 1X6FA 1JK2A 2DRPA 2EN4A 2EMHA 2EJ4A 2EM2A 2EN6A 2EMKA 2EOSA 2EL5A 4R2PA 2WBUA 2EL4A 2MKNA 2ELZA 2EMBA 2VRDA 2YTGA 4FK5C 2EOFA 1G2DC 1P47A 1KJKA 2EOOA 5KL2A 1A1IA 2ENHA 2EOJA 2EPXA 2EMGA 2CTDA 2M9AA 1DGCA 2YU5A 2GHFA 2WCC3 2JPAA 2YTIA 2D9HA 4R2RA 1UBDC 2EQ3A 4M9VC 5KL5A 1UN6B 1BBOA 1LLMC 2EMCA 1BB8A 2DLKA 2YRHA 2YTOA 2WBSA 2EMIA 2E72A 2EP3A 2YTJA 1X6EA 2DMIA 4R2EA 2LCEA 2EMXA 1MEYC 2EPRA 2EPPA 1B69A 4X9JA 1ZR9A 2RSIA 1TN9A 2CT1A 2RPCA 1YSAC 2EN8A 4R2CA 4R2DA 2EOMA 2PRTA 1Z1BA 2EM0A 2EN3A 2LT7A 2NABA 2ENAA 5KL3A 1YUIA 2EN7A 2HGHA 4R2QA 2ADRA 2LO3A 2EM5A 2YU8A 1TF6A 4F6NA 1G2FC 1RMDA 4R2SA 3EPJA 3EPHA 1X6HA 2EMYA 2WBTA 4F2JC
chains in the Genus database with same CATH superfamily
4HEIA 1SR9A 2CPNA 5A69A 1XNQE 2MDGA 2V88A 3FIGA 2YTEA 4J8ZA 4DUYE 3C6MA 2YTQA 1YUJA 3BIDA 2V8QB 4DR2E 2JWOA 5KL6A 1AAYA 2M1SA 5TSEA 2A25A 4KZSA 2EMWA 2DLQA 2E5LE 4KHPE 4B3TE 4JI5E 2EPZA 4BBYA 1T4LB 2B7TA 4IJDA 2L33A 2EM3A 4GKKE 2F8BA 1IQSA 2HHHE 2MKDA 2H36X 1X3CA 4NXME 1WJPA 1ZAAC 2KONA 1PJSA 2DGCA 4R03A 3OMLA 1IMUA 4JYAE 2JP9A 4LFBE 2L2KB 2I13A 2GLIA 3BGHA 4F9CB 2K4VA 2RS7A 4DR5E 2EMZA 4ZYGA 3P1XA 4GEQB 1ZBTA 4DR7E 4ZYDA 2DRPA 1YZ9A 4WXDA 2JOXA 2V89A 2LMZA 1EH7A 5IT9C 4TUIA 3THOB 3KZZA 2EOSA 2LUQA 4O4KA 3LMLA 2L2NA 2WBUA 2EL4A 2VF1A 4JI0E 2F4VE 4DV4E 5AC4A 4FK5C 3C4BA 4Q28A 4WFTA 2N8XA 4DR4E 3F6HA 4O43A 1O0WA 2M9AA 5LMUE 1T38A 5CFFE 2GHFA 3C4TA 2JPAA 1IQOA 4F9BB 2RTXA 4R2RA 4LF9E 4LFAE 2EMCA 4NHRA 2L8TA 2UUBE 2WBSA 1YYKA 2DMIA 4R2EA 2B3TB 2EPPA 3T1HE 1SFEA 2RSIA 1TN9A 2CT1A 4P78A 2FV4B 2JYAA 1HNXE 1XMQE 1BBGA 2UU9E 5A6AA 4WXCA 4LF4E 5KL3A 4NZVA 2HGHA 3C6KA 1PJQA 2YU8A 1RMDA 1PJTA 2L92A 4DR6E 2WBTA 4BHCA 4F2JC 2LUPB 2EORA 3H09A 2L3JA 1QNTA 1DQ3A 4DV6E 2YRKA 5LMNE 3MHSC 4WYQB 2YRMA 4LF8E 2YSPA 4DV3E 2EPCA 3HPSA 3AUZA 4ZYEA 1X47A 4X62E 2EN2A 2ELYA 2FGGA 2EN1A 4WX9A 4R2AA 5A6JA 3HPZA 3VYXA 5IXMB 2G7HA 1A1GA 2R1FA 4JI7E 4L8NA 5AC5A 1JK1A 2M4IA 1TF3A 2EM6A 4DV5E 1A1KA 2EOIA 4DR1E 5AE1A 4DV7E 2VQEE 1A1JA 5AE2A 2R76A 2MC6A 3OTOE 1FJGE 3ADIA 2M7QA 3ADLA 1N34E 3RMPA 3HQ1A 2CSHA 2EPKX 4BMJA 4NXNE 2JVAA 2KOUA 2EZ6A 2EN4A 4BCAA 2JY9A 2EMHA 4ZYHA 2EM2A 2EN6A 2E1MA 3BBGA 1HNZE 3MSWA 3QG5C 2MKNA 2ELZA 3K6QA 2VE7C 1P47A 2UXDE 2UXCE 5KL2A 2FTXB 1IBLE 2EPXA 2EMGA 2CTDA 4BS9A 4X8WA 4JV5E 1DGCA 2UXBE 2GPIA 2WCC3 4DV1E 4RHBB 2EQ3A 5KL5A 2N3GA 2DLKA 3JTZA 3IWBA 4X64E 2YTJA 1X6EA 2LCEA 4X65E 3THNA 2EPRA 4BC9A 1B69A 4DR3E 2EWLA 2JOBA 2JXPA 2EN8A 4R2DA 1QU6A 3IWDA 2EOMA 4WSPA 4OX9E 2YPNA 2EM0A 2LT7A 1HNWE 2NABA 2NUFA 2EN7A 1AH5A 3T1YE 3F6GA 2EM5A 4F6NA 4R2SA 1EH8A 2EPMX 1X6HA 3JAMC 2EPUA 3VYYA 1A1LA 4BC7A 2EQ0A 1UILA 4YHHE 2EMAA 5T6JA 4GKJE 4MLQA 5F3WA 3ZOQB 2EM4A 2LE2A 2YSOA 4BHBA 4F6MA 2LJHA 4RH8A 1T4OA 4HTGA 4LF5E 1N36E 5KL7A 4LF7E 2DIXA 2ODRD 1IBKE 5KL4A 2K7IA 1A1HA 2RSMA 2Q8UA 2RS6A 2YTDA 3HXLA 2EM9A 4WPYA 2ZM6E 3ADJA 2L6MA 1ZU1A 2EOZA 3ECRA 2BB8A 2EQ1A 4Q35B 2EMFA 2V86A 2V83A 2EMLA 5BR8E 4LU9A 4AQYE 2EM8A 5DNYA 4JI1E 5LLQA 2EPAA 2UUCE 4K0KE 4IS1C 3LLHA 4DKKA 2L2MA 3MHHC 3DJWA 2EOHA 1J26A 1A1FA 2YTFA 2IHR1 2MDRA 1STUA 2DMYA 4LTYA 1JK2A 4DMIA 1YPNA 4I8OA 4JI4E 4MLVA 1YFHA 1RQ0A 3J7Yp 1FKAE 1XNRE 2EPOA 4B3ME 2DB2A 1XMOE 2EMBA 1KYQA 4JI2E 4F9AB 2EOOA 2ENHA 2YTIA 1EKZA 1BBOA 1WHNA 1BB8A 2EP3A 2DSYA 1HR0E 4N4RB 1WRJA 2B9DA 2EMXA 4KWYA 4X9JA 1ZR9A 3AV0A 2LRSA 2RPCA 4L5NC 4TUGA 1GQEA 1Z1BA 4DV2E 2ADRA 4O5GA 5AE3A 1TF6A 2L3CA 1G2FC 2V87A 2B7VA 3EPJA 3EPHA 2EMYA 1YYWA 1PDAA 2YTPA 3EQ1A 2LVHA 1NEIA 2EOYA 3ADGA 2V85A 4JI8E 1L4SA 1YYOA 2LTRA 3EPLA 2I9IA 2NA2A 2RQLA 3VK6A 1NCSA 2N3HA 4X66E 2LV2A 2YTNA 4M2ZA 5A6KA 2ENCA 3HTXA 1X49A 2EE8A 3EPKA 1X5WA 2KHXA 2EM7A 3JU0A 2EOXA 4WSGA 1UHZA 2EOEA 2MC5A 4OOGC 4LFCE 1PKPA 3M99B 2VQFE 1I94E 1N32E 2J7JA 2LBSB 4O24A 3UK3C 4R8OA 1ZBQA 3VHTB 5A6BA 1X48A 5LL6R 3KWRA 2EOQA 2ODRC 1F2IG 2YWQA 5A6BD 4GZNC 3IWCA 4B3SE 2EL6A 1X6FA 4P7DA 5IWAE 2LTSA 2EJ4A 4B3RE 2EMKA 1WHQA 2EL5A 4R2PA 2EPNA 4LF6E 2NUGA 2VRDA 2YTGA 3BF2A 3TQMA 2EOFA 1G2DC 3J81C 1GTKA 1T4NA 3L00A 1KJKA 4F54A 1A1IA 2EOJA 4DUZE 4JI3E 2BBGA 2NUEA 2YU5A 1RC7A 4YY3E 2D9HA 1UBDC 5A2QC 4M9VC 1UN6B 1LLMC 1T39A 2YRHA 2YTOA 2EPLX 2EMIA 1MGTA 2E72A 1N33E 2WZOA 1IBME 5FLXC 2HJJA 3DF6A 1MEYC 2JR1A 2YZTA 4M0VA 5ADZA 3KZYA 1EH6A 2UUAE 1YSAC 4R2CA 3J7AG 2LJUA 1WXRA 4DV0E 4JI6E 5AASA 2PRTA 5IV8B 2EN3A 2HC5A 4M30A 2ENAA 1YUIA 4R2QA 1DI2A 2LO3A 2YT4A 1J5EE 1GZ6A 1N3GA 3J80C
chains in the Genus database with same CATH topology
2EORA 2EPUA 2YTPA 1A1LA 2LVHA 2EQ0A 2EOYA 2MDGA 2YRKA 3MHSC 2YTEA 2EMAA 3EPLA 2YRMA 2YSPA 2YTQA 2EPCA 1YUJA 1NCSA 4F6MA 2EM4A 2YSOA 5KL6A 1AAYA 2EN2A 2LV2A 5KL7A 2A25A 2ELYA 2EMWA 2YTNA 2DLQA 2ENCA 2EN1A 3EPKA 2EE8A 1X5WA 5KL4A 4R2AA 2EM7A 1A1HA 2EOXA 4WSGA 2EPZA 2EOEA 4IJDA 2YTDA 3M99B 2EM9A 2EM3A 1A1GA 1ZU1A 2R1FA 2J7JA 2EOZA 2MKDA 1JK1A 1X3CA 1TF3A 2BB8A 2EM6A 1A1KA 3UK3C 2EQ1A 1WJPA 2EOIA 2EMFA 2EMLA 2EM8A 3VHTB 1ZAAC 1A1JA 2DGCA 2EPAA 4IS1C 2JP9A 2EOQA 1F2IG 3MHHC 2I13A 2GLIA 2EOHA 1A1FA 2YTFA 4GZNC 2CSHA 2EMZA 2EL6A 1X6FA 1JK2A 2DRPA 2EN4A 2EMHA 2EJ4A 2EM2A 2EN6A 2EMKA 2EOSA 2EL5A 4R2PA 2WBUA 2EL4A 2MKNA 2ELZA 2EMBA 2VRDA 2YTGA 4FK5C 2EOFA 1G2DC 1P47A 1KJKA 2EOOA 5KL2A 1A1IA 2ENHA 2EOJA 2EPXA 2EMGA 2CTDA 2M9AA 1DGCA 2YU5A 2GHFA 2WCC3 2JPAA 2YTIA 2D9HA 4R2RA 1UBDC 2EQ3A 4M9VC 5KL5A 1UN6B 1BBOA 1LLMC 2EMCA 1BB8A 2DLKA 2YRHA 2YTOA 2WBSA 2EMIA 2E72A 2EP3A 2YTJA 1X6EA 2DMIA 4R2EA 2LCEA 2EMXA 1MEYC 2EPRA 2EPPA 1B69A 4X9JA 1ZR9A 2RSIA 1TN9A 2CT1A 2RPCA 1YSAC 2EN8A 4R2CA 4R2DA 2EOMA 2PRTA 1Z1BA 2EM0A 2EN3A 2LT7A 2NABA 2ENAA 5KL3A 1YUIA 2EN7A 2HGHA 4R2QA 2ADRA 2LO3A 2EM5A 2YU8A 1TF6A 4F6NA 1G2FC 1RMDA 4R2SA 3EPJA 3EPHA 1X6HA 2EMYA 2WBTA 4F2JC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOR A;  2EPU A;  2YTP A;  1A1L A;  2LVH A;  2EQ0 A;  2EOY A;  2MDG A;  2YRK A;  3MHS C;  2YTE A;  2EMA A;  3EPL A;  2YRM A;  2YSP A;  2YTQ A;  2EPC A;  1YUJ A;  1NCS A;  4F6M A;  2EM4 A;  2YSO A;  5KL6 A;  1AAY A;  2EN2 A;  2LV2 A;  5KL7 A;  2A25 A;  2ELY A;  2EMW A;  2YTN A;  2DLQ A;  2ENC A;  2EN1 A;  3EPK A;  2EE8 A;  1X5W A;  5KL4 A;  4R2A A;  2EM7 A;  1A1H A;  2EOX A;  4WSG A;  2EPZ A;  2EOE A;  4IJD A;  2YTD A;  3M99 B;  2EM9 A;  2EM3 A;  1A1G A;  1ZU1 A;  2R1F A;  2J7J A;  2EOZ A;  2MKD A;  1JK1 A;  1X3C A;  1TF3 A;  2BB8 A;  2EM6 A;  1A1K A;  3UK3 C;  2EQ1 A;  1WJP A;  2EOI A;  2EMF A;  2EML A;  2EM8 A;  3VHT B;  1ZAA C;  1A1J A;  2DGC A;  2EPA A;  4IS1 C;  2JP9 A;  2EOQ A;  1F2I G;  3MHH C;  2I13 A;  2GLI A;  2EOH A;  1A1F A;  2YTF A;  4GZN C;  2CSH A;  2EMZ A;  2EL6 A;  1X6F A;  1JK2 A;  2DRP A;  2EN4 A;  2EMH A;  2EJ4 A;  2EM2 A;  2EN6 A;  2EMK A;  2EOS A;  2EL5 A;  4R2P A;  2WBU A;  2EL4 A;  2MKN A;  2ELZ A;  2EMB A;  2VRD A;  2YTG A;  4FK5 C;  2EOF A;  1G2D C;  1P47 A;  1KJK A;  2EOO A;  5KL2 A;  1A1I A;  2ENH A;  2EOJ A;  2EPX A;  2EMG A;  2CTD A;  2M9A A;  1DGC A;  2YU5 A;  2GHF A;  2WCC 3;  2JPA A;  2YTI A;  2D9H A;  4R2R A;  1UBD C;  2EQ3 A;  4M9V C;  5KL5 A;  1UN6 B;  1BBO A;  1LLM C;  2EMC A;  1BB8 A;  2DLK A;  2YRH A;  2YTO A;  2WBS A;  2EMI A;  2E72 A;  2EP3 A;  2YTJ A;  1X6E A;  2DMI A;  4R2E A;  2LCE A;  2EMX A;  1MEY C;  2EPR A;  2EPP A;  1B69 A;  4X9J A;  1ZR9 A;  2RSI A;  1TN9 A;  2CT1 A;  2RPC A;  1YSA C;  2EN8 A;  4R2C A;  4R2D A;  2EOM A;  2PRT A;  1Z1B A;  2EM0 A;  2EN3 A;  2LT7 A;  2NAB A;  2ENA A;  5KL3 A;  1YUI A;  2EN7 A;  2HGH A;  4R2Q A;  2ADR A;  2LO3 A;  2EM5 A;  2YU8 A;  1TF6 A;  4F6N A;  1G2F C;  1RMD A;  4R2S A;  3EPJ A;  3EPH A;  1X6H A;  2EMY A;  2WBT A;  4F2J C; 
#chains in the Genus database with same CATH topology
 4HEI A;  1SR9 A;  2CPN A;  5A69 A;  1XNQ E;  2MDG A;  2V88 A;  3FIG A;  2YTE A;  4J8Z A;  4DUY E;  3C6M A;  2YTQ A;  1YUJ A;  3BID A;  2V8Q B;  4DR2 E;  2JWO A;  5KL6 A;  1AAY A;  2M1S A;  5TSE A;  2A25 A;  4KZS A;  2EMW A;  2DLQ A;  2E5L E;  4KHP E;  4B3T E;  4JI5 E;  2EPZ A;  4BBY A;  1T4L B;  2B7T A;  4IJD A;  2L33 A;  2EM3 A;  4GKK E;  2F8B A;  1IQS A;  2HHH E;  2MKD A;  2H36 X;  1X3C A;  4NXM E;  1WJP A;  1ZAA C;  2KON A;  1PJS A;  2DGC A;  4R03 A;  3OML A;  1IMU A;  4JYA E;  2JP9 A;  4LFB E;  2L2K B;  2I13 A;  2GLI A;  3BGH A;  4F9C B;  2K4V A;  2RS7 A;  4DR5 E;  2EMZ A;  4ZYG A;  3P1X A;  4GEQ B;  1ZBT A;  4DR7 E;  4ZYD A;  2DRP A;  1YZ9 A;  4WXD A;  2JOX A;  2V89 A;  2LMZ A;  1EH7 A;  5IT9 C;  4TUI A;  3THO B;  3KZZ A;  2EOS A;  2LUQ A;  4O4K A;  3LML A;  2L2N A;  2WBU A;  2EL4 A;  2VF1 A;  4JI0 E;  2F4V E;  4DV4 E;  5AC4 A;  4FK5 C;  3C4B A;  4Q28 A;  4WFT A;  2N8X A;  4DR4 E;  3F6H A;  4O43 A;  1O0W A;  2M9A A;  5LMU E;  1T38 A;  5CFF E;  2GHF A;  3C4T A;  2JPA A;  1IQO A;  4F9B B;  2RTX A;  4R2R A;  4LF9 E;  4LFA E;  2EMC A;  4NHR A;  2L8T A;  2UUB E;  2WBS A;  1YYK A;  2DMI A;  4R2E A;  2B3T B;  2EPP A;  3T1H E;  1SFE A;  2RSI A;  1TN9 A;  2CT1 A;  4P78 A;  2FV4 B;  2JYA A;  1HNX E;  1XMQ E;  1BBG A;  2UU9 E;  5A6A A;  4WXC A;  4LF4 E;  5KL3 A;  4NZV A;  2HGH A;  3C6K A;  1PJQ A;  2YU8 A;  1RMD A;  1PJT A;  2L92 A;  4DR6 E;  2WBT A;  4BHC A;  4F2J C;  2LUP B;  2EOR A;  3H09 A;  2L3J A;  1QNT A;  1DQ3 A;  4DV6 E;  2YRK A;  5LMN E;  3MHS C;  4WYQ B;  2YRM A;  4LF8 E;  2YSP A;  4DV3 E;  2EPC A;  3HPS A;  3AUZ A;  4ZYE A;  1X47 A;  4X62 E;  2EN2 A;  2ELY A;  2FGG A;  2EN1 A;  4WX9 A;  4R2A A;  5A6J A;  3HPZ A;  3VYX A;  5IXM B;  2G7H A;  1A1G A;  2R1F A;  4JI7 E;  4L8N A;  5AC5 A;  1JK1 A;  2M4I A;  1TF3 A;  2EM6 A;  4DV5 E;  1A1K A;  2EOI A;  4DR1 E;  5AE1 A;  4DV7 E;  2VQE E;  1A1J A;  5AE2 A;  2R76 A;  2MC6 A;  3OTO E;  1FJG E;  3ADI A;  2M7Q A;  3ADL A;  1N34 E;  3RMP A;  3HQ1 A;  2CSH A;  2EPK X;  4BMJ A;  4NXN E;  2JVA A;  2KOU A;  2EZ6 A;  2EN4 A;  4BCA A;  2JY9 A;  2EMH A;  4ZYH A;  2EM2 A;  2EN6 A;  2E1M A;  3BBG A;  1HNZ E;  3MSW A;  3QG5 C;  2MKN A;  2ELZ A;  3K6Q A;  2VE7 C;  1P47 A;  2UXD E;  2UXC E;  5KL2 A;  2FTX B;  1IBL E;  2EPX A;  2EMG A;  2CTD A;  4BS9 A;  4X8W A;  4JV5 E;  1DGC A;  2UXB E;  2GPI A;  2WCC 3;  4DV1 E;  4RHB B;  2EQ3 A;  5KL5 A;  2N3G A;  2DLK A;  3JTZ A;  3IWB A;  4X64 E;  2YTJ A;  1X6E A;  2LCE A;  4X65 E;  3THN A;  2EPR A;  4BC9 A;  1B69 A;  4DR3 E;  2EWL A;  2JOB A;  2JXP A;  2EN8 A;  4R2D A;  1QU6 A;  3IWD A;  2EOM A;  4WSP A;  4OX9 E;  2YPN A;  2EM0 A;  2LT7 A;  1HNW E;  2NAB A;  2NUF A;  2EN7 A;  1AH5 A;  3T1Y E;  3F6G A;  2EM5 A;  4F6N A;  4R2S A;  1EH8 A;  2EPM X;  1X6H A;  3JAM C;  2EPU A;  3VYY A;  1A1L A;  4BC7 A;  2EQ0 A;  1UIL A;  4YHH E;  2EMA A;  5T6J A;  4GKJ E;  4MLQ A;  5F3W A;  3ZOQ B;  2EM4 A;  2LE2 A;  2YSO A;  4BHB A;  4F6M A;  2LJH A;  4RH8 A;  1T4O A;  4HTG A;  4LF5 E;  1N36 E;  5KL7 A;  4LF7 E;  2DIX A;  2ODR D;  1IBK E;  5KL4 A;  2K7I A;  1A1H A;  2RSM A;  2Q8U A;  2RS6 A;  2YTD A;  3HXL A;  2EM9 A;  4WPY A;  2ZM6 E;  3ADJ A;  2L6M A;  1ZU1 A;  2EOZ A;  3ECR A;  2BB8 A;  2EQ1 A;  4Q35 B;  2EMF A;  2V86 A;  2V83 A;  2EML A;  5BR8 E;  4LU9 A;  4AQY E;  2EM8 A;  5DNY A;  4JI1 E;  5LLQ A;  2EPA A;  2UUC E;  4K0K E;  4IS1 C;  3LLH A;  4DKK A;  2L2M A;  3MHH C;  3DJW A;  2EOH A;  1J26 A;  1A1F A;  2YTF A;  2IHR 1;  2MDR A;  1STU A;  2DMY A;  4LTY A;  1JK2 A;  4DMI A;  1YPN A;  4I8O A;  4JI4 E;  4MLV A;  1YFH A;  1RQ0 A;  3J7Y p;  1FKA E;  1XNR E;  2EPO A;  4B3M E;  2DB2 A;  1XMO E;  2EMB A;  1KYQ A;  4JI2 E;  4F9A B;  2EOO A;  2ENH A;  2YTI A;  1EKZ A;  1BBO A;  1WHN A;  1BB8 A;  2EP3 A;  2DSY A;  1HR0 E;  4N4R B;  1WRJ A;  2B9D A;  2EMX A;  4KWY A;  4X9J A;  1ZR9 A;  3AV0 A;  2LRS A;  2RPC A;  4L5N C;  4TUG A;  1GQE A;  1Z1B A;  4DV2 E;  2ADR A;  4O5G A;  5AE3 A;  1TF6 A;  2L3C A;  1G2F C;  2V87 A;  2B7V A;  3EPJ A;  3EPH A;  2EMY A;  1YYW A;  1PDA A;  2YTP A;  3EQ1 A;  2LVH A;  1NEI A;  2EOY A;  3ADG A;  2V85 A;  4JI8 E;  1L4S A;  1YYO A;  2LTR A;  3EPL A;  2I9I A;  2NA2 A;  2RQL A;  3VK6 A;  1NCS A;  2N3H A;  4X66 E;  2LV2 A;  2YTN A;  4M2Z A;  5A6K A;  2ENC A;  3HTX A;  1X49 A;  2EE8 A;  3EPK A;  1X5W A;  2KHX A;  2EM7 A;  3JU0 A;  2EOX A;  4WSG A;  1UHZ A;  2EOE A;  2MC5 A;  4OOG C;  4LFC E;  1PKP A;  3M99 B;  2VQF E;  1I94 E;  1N32 E;  2J7J A;  2LBS B;  4O24 A;  3UK3 C;  4R8O A;  1ZBQ A;  3VHT B;  5A6B A;  1X48 A;  5LL6 R;  3KWR A;  2EOQ A;  2ODR C;  1F2I G;  2YWQ A;  5A6B D;  4GZN C;  3IWC A;  4B3S E;  2EL6 A;  1X6F A;  4P7D A;  5IWA E;  2LTS A;  2EJ4 A;  4B3R E;  2EMK A;  1WHQ A;  2EL5 A;  4R2P A;  2EPN A;  4LF6 E;  2NUG A;  2VRD A;  2YTG A;  3BF2 A;  3TQM A;  2EOF A;  1G2D C;  3J81 C;  1GTK A;  1T4N A;  3L00 A;  1KJK A;  4F54 A;  1A1I A;  2EOJ A;  4DUZ E;  4JI3 E;  2BBG A;  2NUE A;  2YU5 A;  1RC7 A;  4YY3 E;  2D9H A;  1UBD C;  5A2Q C;  4M9V C;  1UN6 B;  1LLM C;  1T39 A;  2YRH A;  2YTO A;  2EPL X;  2EMI A;  1MGT A;  2E72 A;  1N33 E;  2WZO A;  1IBM E;  5FLX C;  2HJJ A;  3DF6 A;  1MEY C;  2JR1 A;  2YZT A;  4M0V A;  5ADZ A;  3KZY A;  1EH6 A;  2UUA E;  1YSA C;  4R2C A;  3J7A G;  2LJU A;  1WXR A;  4DV0 E;  4JI6 E;  5AAS A;  2PRT A;  5IV8 B;  2EN3 A;  2HC5 A;  4M30 A;  2ENA A;  1YUI A;  4R2Q A;  1DI2 A;  2LO3 A;  2YT4 A;  1J5E E;  1GZ6 A;  1N3G A;  3J80 C; 
#chains in the Genus database with same CATH homology
 2EOR A;  2EPU A;  2YTP A;  1A1L A;  2LVH A;  2EQ0 A;  2EOY A;  2MDG A;  2YRK A;  3MHS C;  2YTE A;  2EMA A;  3EPL A;  2YRM A;  2YSP A;  2YTQ A;  2EPC A;  1YUJ A;  1NCS A;  4F6M A;  2EM4 A;  2YSO A;  5KL6 A;  1AAY A;  2EN2 A;  2LV2 A;  5KL7 A;  2A25 A;  2ELY A;  2EMW A;  2YTN A;  2DLQ A;  2ENC A;  2EN1 A;  3EPK A;  2EE8 A;  1X5W A;  5KL4 A;  4R2A A;  2EM7 A;  1A1H A;  2EOX A;  4WSG A;  2EPZ A;  2EOE A;  4IJD A;  2YTD A;  3M99 B;  2EM9 A;  2EM3 A;  1A1G A;  1ZU1 A;  2R1F A;  2J7J A;  2EOZ A;  2MKD A;  1JK1 A;  1X3C A;  1TF3 A;  2BB8 A;  2EM6 A;  1A1K A;  3UK3 C;  2EQ1 A;  1WJP A;  2EOI A;  2EMF A;  2EML A;  2EM8 A;  3VHT B;  1ZAA C;  1A1J A;  2DGC A;  2EPA A;  4IS1 C;  2JP9 A;  2EOQ A;  1F2I G;  3MHH C;  2I13 A;  2GLI A;  2EOH A;  1A1F A;  2YTF A;  4GZN C;  2CSH A;  2EMZ A;  2EL6 A;  1X6F A;  1JK2 A;  2DRP A;  2EN4 A;  2EMH A;  2EJ4 A;  2EM2 A;  2EN6 A;  2EMK A;  2EOS A;  2EL5 A;  4R2P A;  2WBU A;  2EL4 A;  2MKN A;  2ELZ A;  2EMB A;  2VRD A;  2YTG A;  4FK5 C;  2EOF A;  1G2D C;  1P47 A;  1KJK A;  2EOO A;  5KL2 A;  1A1I A;  2ENH A;  2EOJ A;  2EPX A;  2EMG A;  2CTD A;  2M9A A;  1DGC A;  2YU5 A;  2GHF A;  2WCC 3;  2JPA A;  2YTI A;  2D9H A;  4R2R A;  1UBD C;  2EQ3 A;  4M9V C;  5KL5 A;  1UN6 B;  1BBO A;  1LLM C;  2EMC A;  1BB8 A;  2DLK A;  2YRH A;  2YTO A;  2WBS A;  2EMI A;  2E72 A;  2EP3 A;  2YTJ A;  1X6E A;  2DMI A;  4R2E A;  2LCE A;  2EMX A;  1MEY C;  2EPR A;  2EPP A;  1B69 A;  4X9J A;  1ZR9 A;  2RSI A;  1TN9 A;  2CT1 A;  2RPC A;  1YSA C;  2EN8 A;  4R2C A;  4R2D A;  2EOM A;  2PRT A;  1Z1B A;  2EM0 A;  2EN3 A;  2LT7 A;  2NAB A;  2ENA A;  5KL3 A;  1YUI A;  2EN7 A;  2HGH A;  4R2Q A;  2ADR A;  2LO3 A;  2EM5 A;  2YU8 A;  1TF6 A;  4F6N A;  1G2F C;  1RMD A;  4R2S A;  3EPJ A;  3EPH A;  1X6H A;  2EMY A;  2WBT A;  4F2J C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...