4F6MA

Crystal structure of kaiso zinc finger dna binding domain in complex with kaiso binding site dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
116
Chain Sequence
DHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulator Kaiso
publication title Molecular basis for recognition of methylated and specific DNA sequences by the zinc finger protein Kaiso.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 28
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6mA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6mA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6mA02
4R2SA 2EM2A 1X6EA 1F2IG 1LLMC 2EM7A 2EMFA 2EOYA 3MHSC 1A1GA 1A1KA 1TN9A 2EM6A 2I13A 2EPCA 3UK3C 1B69A 2EPRA 1MEYC 2BB8A 2JP9A 2EMWA 2M9AA 4R2RA 2EN7A 1A1IA 4GZNC 2YU8A 2EQ3A 2CSHA 2YSPA 1NCSA 2EE8A 4R2CA 2EM8A 4FK5C 1P47A 2EMZA 3M99B 2R1FA 4R2QA 2EMIA 2EL6A 1X3CA 4R2AA 2EJ4A 2WBSA 2EMCA 2EOOA 1A1HA 2WBTA 2NABA 1UN6B 2YRKA 4X9JA 2GLIA 1AAYA 2A25A 1TF6A 1ZAAC 1ZR9A 2EOXA 2EPUA 2EN2A 2CTDA 3EPLA 2ELYA 2J7JA 2EORA 4F2JC 2YTDA 2WBUA 2EOHA 3MHHC 3EPKA 1X6HA 2EMBA 1G2DC 1JK2A 2LVHA 2DLQA 2RPCA 2EPAA 5KL7A 2MDGA 4R2PA 1BBOA 2EM5A 2EOMA 1YUJA 2EOEA 2LT7A 2EMXA 2YSOA 5KL4A 4M9VC 2ENAA 2EOSA 4R2EA 2EOJA 2EOFA 1UBDC 2EN1A 2EN4A 2EN3A 1RMDA 1A1LA 2EPXA 2D9HA 1A1FA 2EN8A 2CT1A 2EPZA 2YTNA 2EOZA 2GHFA 2YTIA 2YTOA 5KL3A 2JPAA 1DGCA 2MKDA 3EPJA 2YTPA 1BB8A 2EM9A 2PRTA 2EQ1A 5KL5A 2DMIA 2EMAA 1X5WA 2YTGA 2RSIA 2YTEA 2EM3A 3VHTB 2YU5A 2LO3A 2LCEA 2EM4A 2DRPA 2LV2A 4F6MA 5KL6A 2EQ0A 2EMHA 1WJPA 2ADRA 2EN6A 2EMLA 2ENCA 2EPPA 1KJKA 4IJDA 2DGCA 5KL2A 4WSGA 4IS1C 1YSAC 2ELZA 2EMYA 2EOQA 2ENHA 3EPHA 1JK1A 1G2FC 1ZU1A 1X6FA 2EMGA 2DLKA 4R2DA 1A1JA 2EOIA 2EMKA 2YRHA 4F6NA 2WCC3 2YTFA 2MKNA 2YTJA 2EP3A 2YTQA 2YRMA 2E72A 2EM0A 1TF3A 2EL4A 2HGHA 1YUIA 2VRDA 1Z1BA 2EL5A
chains in the Genus database with same CATH superfamily
5AC4A 4R2SA 4DV3E 1O0WA 1F2IG 2EM7A 2EOYA 3MHSC 4ZYHA 2HC5A 1HNXE 2RS6A 4JI6E 1SR9A 3VYXA 4P78A 4LTYA 1A1IA 4GKKE 5LMNE 2YSPA 4BHBA 4DV7E 4GKJE 1P47A 2EL6A 3DF6A 2WBSA 1IBME 4M0VA 1QU6A 2EMCA 2JVAA 4KHPE 2VQFE 3HXLA 3AUZA 1UN6B 4X9JA 1AAYA 2VF1A 2E5LE 5ADZA 2EN2A 3FIGA 2ODRC 3LMLA 3EPLA 5CFFE 1GTKA 5IXMB 3THOB 1YYWA 2L33A 4DR1E 3EPKA 1PKPA 1HR0E 1BBGA 4MLQA 2EMBA 3F6GA 2DLQA 2V83A 5KL7A 1EH7A 2EPAA 2MDGA 3KZZA 4NHRA 2EPKX 3OMLA 2EOMA 1T39A 4LF5E 1XNRE 1T38A 4O24A 5A6AA 4B3ME 2EOFA 4O4KA 4DV5E 1FKAE 1J5EE 3C4TA 4BS9A 1STUA 2EPXA 4WXCA 4LFCE 4WPYA 2EOZA 1T4OA 1X49A 2MKDA 3EPJA 2MC5A 4DV1E 2EM9A 2PRTA 4F9BB 1X5WA 4DR7E 2EM3A 4L5NC 5A6BA 2L8TA 4R03A 2V87A 5KL6A 2EQ0A 1WJPA 3QG5C 2ADRA 5AC5A 3LLHA 2HJJA 4IJDA 2RQLA 3HPSA 2RSMA 2EMYA 1YYOA 2LJUA 4NXNE 4J8ZA 1X6FA 1A1JA 4DR6E 4OOGC 4DV4E 2UUAE 2FV4B 3BIDA 2YRHA 4BC9A 4ZYEA 2WCC3 2YTJA 3ECRA 4WXDA 2UXDE 1YUIA 2VRDA 1Z1BA 2V88A 5DNYA 2E1MA 1X6EA 5T6JA 1QNTA 3BGHA 1A1GA 2DSYA 3K6QA 2EM6A 4X64E 2EPMX 4DKKA 3ZOQB 3C6MA 2DMYA 2NUEA 2M9AA 4RHBB 2UU9E 2K4VA 2EE8A 4P7DA 2EM8A 2EMZA 3M99B 4DR3E 1PJTA 4JI1E 4BBYA 1IQSA 3EQ1A 5A6BD 4JI2E 4RH8A 1EKZA 2B9DA 2N3GA 2F8BA 1ZR9A 4O5GA 5BR8E 5IT9C 2EOXA 2CTDA 4LF7E 2L3CA 2ELYA 4JI0E 3MHHC 4M30A 3T1HE 3VK6A 1XNQE 4LF6E 2RPCA 1PJQA 3ADIA 1NEIA 4DR4E 1AH5A 1GQEA 4I8OA 4LU9A 1YUJA 2H36X 2L3JA 3AV0A 1YFHA 2ENAA 4JI5E 4R2EA 2EOJA 4KWYA 5AE3A 2EN1A 5AE1A 4BHCA 2CPNA 2VQEE 1RMDA 4L8NA 2GPIA 1DI2A 2EPZA 2YTOA 3ADGA 2YTIA 1DGCA 2YTPA 2LTSA 4TUIA 1WHQA 4JI8E 2YTGA 2RSIA 2YTEA 3IWBA 2EPLX 2YU5A 4HEIA 2LO3A 2EM4A 2LV2A 4BMJA 4HTGA 1PJSA 2EMHA 2EN6A 3KZYA 1UILA 2ENCA 2L2NA 3J7Yp 4R8OA 1EH6A 1MGTA 2LJHA 4DUYE 2ELZA 1JK1A 1ZU1A 2EMGA 1SFEA 2EOIA 4F6NA 2N3HA 2WZOA 2YTFA 1X47A 3BF2A 2EP3A 1FJGE 2NUFA 2I9IA 2R76A 2V86A 2HGHA 2V8QB 3H09A 2B7TA 2EL5A 3OTOE 3HQ1A 2B7VA 1PDAA 5F3WA 2LE2A 1LLMC 3THNA 1A1KA 1TN9A 3UK3C 2JP9A 2EPRA 2BB8A 2JOXA 1WXRA 2EMWA 2EQ3A 4Q35B 2CSHA 2DIXA 2NUGA 4DMIA 2FGGA 4FK5C 4JI4E 1YPNA 2R1FA 2L92A 2LUQA 1XMQE 2EJ4A 4ZYDA 2EOOA 3J81C 1A1HA 2F4VE 2JOBA 2YRKA 2GLIA 2A25A 2LUPB 2JR1A 4F9AB 2FTXB 2N8XA 2EORA 4F2JC 3JTZA 2EOHA 2NA2A 2EZ6A 2JXPA 2DB2A 3F6HA 2UXCE 4R2PA 2M4IA 3T1YE 1ZBQA 2EM5A 4BC7A 1BBOA 4LFAE 4JI3E 2EOEA 2EMXA 2YSOA 5KL4A 2L6MA 3BBGA 2EPOA 4JV5E 5A69A 4X62E 4WFTA 2YZTA 2EPNA 5A6KA 2EWLA 1RQ0A 1N3GA 1DQ3A 2D9HA 5A2QC 2CT1A 2YTNA 5KL3A 4LFBE 2GHFA 4B3SE 4F54A 4YY3E 4NXME 3HTXA 4O43A 1BB8A 5AASA 5KL5A 2DMIA 2EMAA 2V89A 4DV6E 2LMZA 3VHTB 3VYYA 1YYKA 2V85A 2DRPA 2JYAA 4F6MA 1WRJA 2LTRA 2EMLA 2EPPA 1KJKA 1ZBTA 1N33E 2IHR1 5LL6R 4AQYE 2ODRD 4WSGA 4IS1C 3JU0A 4DR5E 1YSAC 1T4NA 2EOQA 2ENHA 1G2FC 2HHHE 2DLKA 1RC7A 1GZ6A 4B3RE 2BBGA 3KWRA 3ADLA 2UUBE 2YRMA 2E72A 4X66E 4X8WA 2RS7A 1KYQA 1HNWE 2EM2A 1YZ9A 4LF8E 3J80C 2JY9A 2EMFA 4OX9E 5A6JA 2YWQA 4X65E 5TSEA 2I13A 2EPCA 4GEQB 1B69A 2B3TB 1MEYC 3IWDA 4R2RA 1N34E 2EN7A 4GZNC 2YU8A 4DV2E 1L4SA 4WYQB 1NCSA 2YPNA 3L00A 4R2CA 2LRSA 4R2QA 2EMIA 2M1SA 1IQOA 4LF4E 1X3CA 2MDRA 3ADJA 4R2AA 1J26A 2KHXA 4B3TE 2WBTA 2Q8UA 1N32E 2NABA 1ZAAC 1TF6A 3C4BA 2EPUA 2RTXA 2J7JA 2YTDA 2WBUA 1X6HA 1G2DC 2KOUA 1JK2A 2LVHA 3HPZA 3RMPA 2L2KB 2VE7C 2M7QA 2UXBE 5FLXC 1WHNA 4TUGA 3P1XA 4DR2E 2LT7A 1X48A 4K0KE 4M9VC 2YT4A 2EOSA 4WSPA 3J7AG 4DV0E 4N4RB 1UBDC 4WX9A 4M2ZA 2EN4A 1T4LB 2L2MA 2EN3A 1I94E 4KZSA 1IMUA 1A1LA 4ZYGA 5AE2A 4Q28A 5IV8B 4MLVA 2EN8A 1A1FA 2ZM6E 2JPAA 5IWAE 1XMOE 2JWOA 2EQ1A 4NZVA 4JI7E 2LBSB 2LCEA 1IBLE 1EH8A 1UHZA 3DJWA 3C6KA 2G7HA 3IWCA 4F9CB 2DGCA 5KL2A 5LMUE 4LF9E 3TQMA 2UUCE 3EPHA 4R2DA 3MSWA 1IBKE 2EMKA 2KONA 2MKNA 3JAMC 2YTQA 2EM0A 2MC6A 4DUZE 1TF3A 2EL4A 5LLQA 4YHHE 2K7IA 1HNZE 4BCAA 4JYAE 1N36E
chains in the Genus database with same CATH topology
4R2SA 2EM2A 1X6EA 1F2IG 1LLMC 2EM7A 2EMFA 2EOYA 3MHSC 1A1GA 1A1KA 1TN9A 2EM6A 2I13A 2EPCA 3UK3C 1B69A 2EPRA 1MEYC 2BB8A 2JP9A 2EMWA 2M9AA 4R2RA 2EN7A 1A1IA 4GZNC 2YU8A 2EQ3A 2CSHA 2YSPA 1NCSA 2EE8A 4R2CA 2EM8A 4FK5C 1P47A 2EMZA 3M99B 2R1FA 4R2QA 2EMIA 2EL6A 1X3CA 4R2AA 2EJ4A 2WBSA 2EMCA 2EOOA 1A1HA 2WBTA 2NABA 1UN6B 2YRKA 4X9JA 2GLIA 1AAYA 2A25A 1TF6A 1ZAAC 1ZR9A 2EOXA 2EPUA 2EN2A 2CTDA 3EPLA 2ELYA 2J7JA 2EORA 4F2JC 2YTDA 2WBUA 2EOHA 3MHHC 3EPKA 1X6HA 2EMBA 1G2DC 1JK2A 2LVHA 2DLQA 2RPCA 2EPAA 5KL7A 2MDGA 4R2PA 1BBOA 2EM5A 2EOMA 1YUJA 2EOEA 2LT7A 2EMXA 2YSOA 5KL4A 4M9VC 2ENAA 2EOSA 4R2EA 2EOJA 2EOFA 1UBDC 2EN1A 2EN4A 2EN3A 1RMDA 1A1LA 2EPXA 2D9HA 1A1FA 2EN8A 2CT1A 2EPZA 2YTNA 2EOZA 2GHFA 2YTIA 2YTOA 5KL3A 2JPAA 1DGCA 2MKDA 3EPJA 2YTPA 1BB8A 2EM9A 2PRTA 2EQ1A 5KL5A 2DMIA 2EMAA 1X5WA 2YTGA 2RSIA 2YTEA 2EM3A 3VHTB 2YU5A 2LO3A 2LCEA 2EM4A 2DRPA 2LV2A 4F6MA 5KL6A 2EQ0A 2EMHA 1WJPA 2ADRA 2EN6A 2EMLA 2ENCA 2EPPA 1KJKA 4IJDA 2DGCA 5KL2A 4WSGA 4IS1C 1YSAC 2ELZA 2EMYA 2EOQA 2ENHA 3EPHA 1JK1A 1G2FC 1ZU1A 1X6FA 2EMGA 2DLKA 4R2DA 1A1JA 2EOIA 2EMKA 2YRHA 4F6NA 2WCC3 2YTFA 2MKNA 2YTJA 2EP3A 2YTQA 2YRMA 2E72A 2EM0A 1TF3A 2EL4A 2HGHA 1YUIA 2VRDA 1Z1BA 2EL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2S A;  2EM2 A;  1X6E A;  1F2I G;  1LLM C;  2EM7 A;  2EMF A;  2EOY A;  3MHS C;  1A1G A;  1A1K A;  1TN9 A;  2EM6 A;  2I13 A;  2EPC A;  3UK3 C;  1B69 A;  2EPR A;  1MEY C;  2BB8 A;  2JP9 A;  2EMW A;  2M9A A;  4R2R A;  2EN7 A;  1A1I A;  4GZN C;  2YU8 A;  2EQ3 A;  2CSH A;  2YSP A;  1NCS A;  2EE8 A;  4R2C A;  2EM8 A;  4FK5 C;  1P47 A;  2EMZ A;  3M99 B;  2R1F A;  4R2Q A;  2EMI A;  2EL6 A;  1X3C A;  4R2A A;  2EJ4 A;  2WBS A;  2EMC A;  2EOO A;  1A1H A;  2WBT A;  2NAB A;  1UN6 B;  2YRK A;  4X9J A;  2GLI A;  1AAY A;  2A25 A;  1TF6 A;  1ZAA C;  1ZR9 A;  2EOX A;  2EPU A;  2EN2 A;  2CTD A;  3EPL A;  2ELY A;  2J7J A;  2EOR A;  4F2J C;  2YTD A;  2WBU A;  2EOH A;  3MHH C;  3EPK A;  1X6H A;  2EMB A;  1G2D C;  1JK2 A;  2LVH A;  2DLQ A;  2RPC A;  2EPA A;  5KL7 A;  2MDG A;  4R2P A;  1BBO A;  2EM5 A;  2EOM A;  1YUJ A;  2EOE A;  2LT7 A;  2EMX A;  2YSO A;  5KL4 A;  4M9V C;  2ENA A;  2EOS A;  4R2E A;  2EOJ A;  2EOF A;  1UBD C;  2EN1 A;  2EN4 A;  2EN3 A;  1RMD A;  1A1L A;  2EPX A;  2D9H A;  1A1F A;  2EN8 A;  2CT1 A;  2EPZ A;  2YTN A;  2EOZ A;  2GHF A;  2YTI A;  2YTO A;  5KL3 A;  2JPA A;  1DGC A;  2MKD A;  3EPJ A;  2YTP A;  1BB8 A;  2EM9 A;  2PRT A;  2EQ1 A;  5KL5 A;  2DMI A;  2EMA A;  1X5W A;  2YTG A;  2RSI A;  2YTE A;  2EM3 A;  3VHT B;  2YU5 A;  2LO3 A;  2LCE A;  2EM4 A;  2DRP A;  2LV2 A;  4F6M A;  5KL6 A;  2EQ0 A;  2EMH A;  1WJP A;  2ADR A;  2EN6 A;  2EML A;  2ENC A;  2EPP A;  1KJK A;  4IJD A;  2DGC A;  5KL2 A;  4WSG A;  4IS1 C;  1YSA C;  2ELZ A;  2EMY A;  2EOQ A;  2ENH A;  3EPH A;  1JK1 A;  1G2F C;  1ZU1 A;  1X6F A;  2EMG A;  2DLK A;  4R2D A;  1A1J A;  2EOI A;  2EMK A;  2YRH A;  4F6N A;  2WCC 3;  2YTF A;  2MKN A;  2YTJ A;  2EP3 A;  2YTQ A;  2YRM A;  2E72 A;  2EM0 A;  1TF3 A;  2EL4 A;  2HGH A;  1YUI A;  2VRD A;  1Z1B A;  2EL5 A; 
#chains in the Genus database with same CATH topology
 5AC4 A;  4R2S A;  4DV3 E;  1O0W A;  1F2I G;  2EM7 A;  2EOY A;  3MHS C;  4ZYH A;  2HC5 A;  1HNX E;  2RS6 A;  4JI6 E;  1SR9 A;  3VYX A;  4P78 A;  4LTY A;  1A1I A;  4GKK E;  5LMN E;  2YSP A;  4BHB A;  4DV7 E;  4GKJ E;  1P47 A;  2EL6 A;  3DF6 A;  2WBS A;  1IBM E;  4M0V A;  1QU6 A;  2EMC A;  2JVA A;  4KHP E;  2VQF E;  3HXL A;  3AUZ A;  1UN6 B;  4X9J A;  1AAY A;  2VF1 A;  2E5L E;  5ADZ A;  2EN2 A;  3FIG A;  2ODR C;  3LML A;  3EPL A;  5CFF E;  1GTK A;  5IXM B;  3THO B;  1YYW A;  2L33 A;  4DR1 E;  3EPK A;  1PKP A;  1HR0 E;  1BBG A;  4MLQ A;  2EMB A;  3F6G A;  2DLQ A;  2V83 A;  5KL7 A;  1EH7 A;  2EPA A;  2MDG A;  3KZZ A;  4NHR A;  2EPK X;  3OML A;  2EOM A;  1T39 A;  4LF5 E;  1XNR E;  1T38 A;  4O24 A;  5A6A A;  4B3M E;  2EOF A;  4O4K A;  4DV5 E;  1FKA E;  1J5E E;  3C4T A;  4BS9 A;  1STU A;  2EPX A;  4WXC A;  4LFC E;  4WPY A;  2EOZ A;  1T4O A;  1X49 A;  2MKD A;  3EPJ A;  2MC5 A;  4DV1 E;  2EM9 A;  2PRT A;  4F9B B;  1X5W A;  4DR7 E;  2EM3 A;  4L5N C;  5A6B A;  2L8T A;  4R03 A;  2V87 A;  5KL6 A;  2EQ0 A;  1WJP A;  3QG5 C;  2ADR A;  5AC5 A;  3LLH A;  2HJJ A;  4IJD A;  2RQL A;  3HPS A;  2RSM A;  2EMY A;  1YYO A;  2LJU A;  4NXN E;  4J8Z A;  1X6F A;  1A1J A;  4DR6 E;  4OOG C;  4DV4 E;  2UUA E;  2FV4 B;  3BID A;  2YRH A;  4BC9 A;  4ZYE A;  2WCC 3;  2YTJ A;  3ECR A;  4WXD A;  2UXD E;  1YUI A;  2VRD A;  1Z1B A;  2V88 A;  5DNY A;  2E1M A;  1X6E A;  5T6J A;  1QNT A;  3BGH A;  1A1G A;  2DSY A;  3K6Q A;  2EM6 A;  4X64 E;  2EPM X;  4DKK A;  3ZOQ B;  3C6M A;  2DMY A;  2NUE A;  2M9A A;  4RHB B;  2UU9 E;  2K4V A;  2EE8 A;  4P7D A;  2EM8 A;  2EMZ A;  3M99 B;  4DR3 E;  1PJT A;  4JI1 E;  4BBY A;  1IQS A;  3EQ1 A;  5A6B D;  4JI2 E;  4RH8 A;  1EKZ A;  2B9D A;  2N3G A;  2F8B A;  1ZR9 A;  4O5G A;  5BR8 E;  5IT9 C;  2EOX A;  2CTD A;  4LF7 E;  2L3C A;  2ELY A;  4JI0 E;  3MHH C;  4M30 A;  3T1H E;  3VK6 A;  1XNQ E;  4LF6 E;  2RPC A;  1PJQ A;  3ADI A;  1NEI A;  4DR4 E;  1AH5 A;  1GQE A;  4I8O A;  4LU9 A;  1YUJ A;  2H36 X;  2L3J A;  3AV0 A;  1YFH A;  2ENA A;  4JI5 E;  4R2E A;  2EOJ A;  4KWY A;  5AE3 A;  2EN1 A;  5AE1 A;  4BHC A;  2CPN A;  2VQE E;  1RMD A;  4L8N A;  2GPI A;  1DI2 A;  2EPZ A;  2YTO A;  3ADG A;  2YTI A;  1DGC A;  2YTP A;  2LTS A;  4TUI A;  1WHQ A;  4JI8 E;  2YTG A;  2RSI A;  2YTE A;  3IWB A;  2EPL X;  2YU5 A;  4HEI A;  2LO3 A;  2EM4 A;  2LV2 A;  4BMJ A;  4HTG A;  1PJS A;  2EMH A;  2EN6 A;  3KZY A;  1UIL A;  2ENC A;  2L2N A;  3J7Y p;  4R8O A;  1EH6 A;  1MGT A;  2LJH A;  4DUY E;  2ELZ A;  1JK1 A;  1ZU1 A;  2EMG A;  1SFE A;  2EOI A;  4F6N A;  2N3H A;  2WZO A;  2YTF A;  1X47 A;  3BF2 A;  2EP3 A;  1FJG E;  2NUF A;  2I9I A;  2R76 A;  2V86 A;  2HGH A;  2V8Q B;  3H09 A;  2B7T A;  2EL5 A;  3OTO E;  3HQ1 A;  2B7V A;  1PDA A;  5F3W A;  2LE2 A;  1LLM C;  3THN A;  1A1K A;  1TN9 A;  3UK3 C;  2JP9 A;  2EPR A;  2BB8 A;  2JOX A;  1WXR A;  2EMW A;  2EQ3 A;  4Q35 B;  2CSH A;  2DIX A;  2NUG A;  4DMI A;  2FGG A;  4FK5 C;  4JI4 E;  1YPN A;  2R1F A;  2L92 A;  2LUQ A;  1XMQ E;  2EJ4 A;  4ZYD A;  2EOO A;  3J81 C;  1A1H A;  2F4V E;  2JOB A;  2YRK A;  2GLI A;  2A25 A;  2LUP B;  2JR1 A;  4F9A B;  2FTX B;  2N8X A;  2EOR A;  4F2J C;  3JTZ A;  2EOH A;  2NA2 A;  2EZ6 A;  2JXP A;  2DB2 A;  3F6H A;  2UXC E;  4R2P A;  2M4I A;  3T1Y E;  1ZBQ A;  2EM5 A;  4BC7 A;  1BBO A;  4LFA E;  4JI3 E;  2EOE A;  2EMX A;  2YSO A;  5KL4 A;  2L6M A;  3BBG A;  2EPO A;  4JV5 E;  5A69 A;  4X62 E;  4WFT A;  2YZT A;  2EPN A;  5A6K A;  2EWL A;  1RQ0 A;  1N3G A;  1DQ3 A;  2D9H A;  5A2Q C;  2CT1 A;  2YTN A;  5KL3 A;  4LFB E;  2GHF A;  4B3S E;  4F54 A;  4YY3 E;  4NXM E;  3HTX A;  4O43 A;  1BB8 A;  5AAS A;  5KL5 A;  2DMI A;  2EMA A;  2V89 A;  4DV6 E;  2LMZ A;  3VHT B;  3VYY A;  1YYK A;  2V85 A;  2DRP A;  2JYA A;  4F6M A;  1WRJ A;  2LTR A;  2EML A;  2EPP A;  1KJK A;  1ZBT A;  1N33 E;  2IHR 1;  5LL6 R;  4AQY E;  2ODR D;  4WSG A;  4IS1 C;  3JU0 A;  4DR5 E;  1YSA C;  1T4N A;  2EOQ A;  2ENH A;  1G2F C;  2HHH E;  2DLK A;  1RC7 A;  1GZ6 A;  4B3R E;  2BBG A;  3KWR A;  3ADL A;  2UUB E;  2YRM A;  2E72 A;  4X66 E;  4X8W A;  2RS7 A;  1KYQ A;  1HNW E;  2EM2 A;  1YZ9 A;  4LF8 E;  3J80 C;  2JY9 A;  2EMF A;  4OX9 E;  5A6J A;  2YWQ A;  4X65 E;  5TSE A;  2I13 A;  2EPC A;  4GEQ B;  1B69 A;  2B3T B;  1MEY C;  3IWD A;  4R2R A;  1N34 E;  2EN7 A;  4GZN C;  2YU8 A;  4DV2 E;  1L4S A;  4WYQ B;  1NCS A;  2YPN A;  3L00 A;  4R2C A;  2LRS A;  4R2Q A;  2EMI A;  2M1S A;  1IQO A;  4LF4 E;  1X3C A;  2MDR A;  3ADJ A;  4R2A A;  1J26 A;  2KHX A;  4B3T E;  2WBT A;  2Q8U A;  1N32 E;  2NAB A;  1ZAA C;  1TF6 A;  3C4B A;  2EPU A;  2RTX A;  2J7J A;  2YTD A;  2WBU A;  1X6H A;  1G2D C;  2KOU A;  1JK2 A;  2LVH A;  3HPZ A;  3RMP A;  2L2K B;  2VE7 C;  2M7Q A;  2UXB E;  5FLX C;  1WHN A;  4TUG A;  3P1X A;  4DR2 E;  2LT7 A;  1X48 A;  4K0K E;  4M9V C;  2YT4 A;  2EOS A;  4WSP A;  3J7A G;  4DV0 E;  4N4R B;  1UBD C;  4WX9 A;  4M2Z A;  2EN4 A;  1T4L B;  2L2M A;  2EN3 A;  1I94 E;  4KZS A;  1IMU A;  1A1L A;  4ZYG A;  5AE2 A;  4Q28 A;  5IV8 B;  4MLV A;  2EN8 A;  1A1F A;  2ZM6 E;  2JPA A;  5IWA E;  1XMO E;  2JWO A;  2EQ1 A;  4NZV A;  4JI7 E;  2LBS B;  2LCE A;  1IBL E;  1EH8 A;  1UHZ A;  3DJW A;  3C6K A;  2G7H A;  3IWC A;  4F9C B;  2DGC A;  5KL2 A;  5LMU E;  4LF9 E;  3TQM A;  2UUC E;  3EPH A;  4R2D A;  3MSW A;  1IBK E;  2EMK A;  2KON A;  2MKN A;  3JAM C;  2YTQ A;  2EM0 A;  2MC6 A;  4DUZ E;  1TF3 A;  2EL4 A;  5LLQ A;  4YHH E;  2K7I A;  1HNZ E;  4BCA A;  4JYA E;  1N36 E; 
#chains in the Genus database with same CATH homology
 4R2S A;  2EM2 A;  1X6E A;  1F2I G;  1LLM C;  2EM7 A;  2EMF A;  2EOY A;  3MHS C;  1A1G A;  1A1K A;  1TN9 A;  2EM6 A;  2I13 A;  2EPC A;  3UK3 C;  1B69 A;  2EPR A;  1MEY C;  2BB8 A;  2JP9 A;  2EMW A;  2M9A A;  4R2R A;  2EN7 A;  1A1I A;  4GZN C;  2YU8 A;  2EQ3 A;  2CSH A;  2YSP A;  1NCS A;  2EE8 A;  4R2C A;  2EM8 A;  4FK5 C;  1P47 A;  2EMZ A;  3M99 B;  2R1F A;  4R2Q A;  2EMI A;  2EL6 A;  1X3C A;  4R2A A;  2EJ4 A;  2WBS A;  2EMC A;  2EOO A;  1A1H A;  2WBT A;  2NAB A;  1UN6 B;  2YRK A;  4X9J A;  2GLI A;  1AAY A;  2A25 A;  1TF6 A;  1ZAA C;  1ZR9 A;  2EOX A;  2EPU A;  2EN2 A;  2CTD A;  3EPL A;  2ELY A;  2J7J A;  2EOR A;  4F2J C;  2YTD A;  2WBU A;  2EOH A;  3MHH C;  3EPK A;  1X6H A;  2EMB A;  1G2D C;  1JK2 A;  2LVH A;  2DLQ A;  2RPC A;  2EPA A;  5KL7 A;  2MDG A;  4R2P A;  1BBO A;  2EM5 A;  2EOM A;  1YUJ A;  2EOE A;  2LT7 A;  2EMX A;  2YSO A;  5KL4 A;  4M9V C;  2ENA A;  2EOS A;  4R2E A;  2EOJ A;  2EOF A;  1UBD C;  2EN1 A;  2EN4 A;  2EN3 A;  1RMD A;  1A1L A;  2EPX A;  2D9H A;  1A1F A;  2EN8 A;  2CT1 A;  2EPZ A;  2YTN A;  2EOZ A;  2GHF A;  2YTI A;  2YTO A;  5KL3 A;  2JPA A;  1DGC A;  2MKD A;  3EPJ A;  2YTP A;  1BB8 A;  2EM9 A;  2PRT A;  2EQ1 A;  5KL5 A;  2DMI A;  2EMA A;  1X5W A;  2YTG A;  2RSI A;  2YTE A;  2EM3 A;  3VHT B;  2YU5 A;  2LO3 A;  2LCE A;  2EM4 A;  2DRP A;  2LV2 A;  4F6M A;  5KL6 A;  2EQ0 A;  2EMH A;  1WJP A;  2ADR A;  2EN6 A;  2EML A;  2ENC A;  2EPP A;  1KJK A;  4IJD A;  2DGC A;  5KL2 A;  4WSG A;  4IS1 C;  1YSA C;  2ELZ A;  2EMY A;  2EOQ A;  2ENH A;  3EPH A;  1JK1 A;  1G2F C;  1ZU1 A;  1X6F A;  2EMG A;  2DLK A;  4R2D A;  1A1J A;  2EOI A;  2EMK A;  2YRH A;  4F6N A;  2WCC 3;  2YTF A;  2MKN A;  2YTJ A;  2EP3 A;  2YTQ A;  2YRM A;  2E72 A;  2EM0 A;  1TF3 A;  2EL4 A;  2HGH A;  1YUI A;  2VRD A;  1Z1B A;  2EL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...