4F6MA

Crystal structure of kaiso zinc finger dna binding domain in complex with kaiso binding site dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
116
Chain Sequence
DHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis for recognition of methylated and specific DNA sequences by the zinc finger protein Kaiso.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Transcriptional regulator Kaiso
total genus 28
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6mA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6mA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6mA02
1ZU1A 2EOQA 1DGCA 2LO3A 2DLKA 2YSPA 2YTEA 2EM7A 2EOIA 1A1FA 2EM8A 2EPZA 2YTGA 2EPRA 2DMIA 1X6FA 2BB8A 2EMCA 2EPUA 4R2QA 1A1HA 2EN3A 2MDGA 2EPCA 1ZR9A 2YSOA 2J7JA 2EE8A 2EM2A 2EMGA 2EOEA 4R2SA 2EOFA 2JP9A 1A1LA 2EMYA 2EOMA 2NABA 2DGCA 4F2JC 1NCSA 2EN4A 2A25A 4IS1C 2YTNA 2MKNA 2LV2A 1F2IG 4FK5C 4R2PA 2YTQA 4F6MA 4M9VC 1YUIA 2DLQA 2EL4A 4R2DA 1G2FC 2CT1A 2LVHA 2EM9A 2EPPA 2EJ4A 3VHTB 1X5WA 4R2AA 2LCEA 2WCC3 2LT7A 1ZAAC 2CTDA 2YTJA 1JK2A 1G2DC 1X6EA 2WBTA 1WJPA 1B69A 5KL6A 1YSAC 2M9AA 2GLIA 3EPLA 2R1FA 2PRTA 3UK3C 1BB8A 1LLMC 2EN1A 2YTPA 2YTIA 2RSIA 2VRDA 2WBUA 2E72A 1X3CA 2I13A 2YRHA 5KL3A 5KL2A 2ELYA 2YTOA 2EOJA 1A1IA 2EOHA 2GHFA 1TF3A 2ENHA 2EOYA 2RPCA 2EM4A 3EPJA 4F6NA 4GZNC 1X6HA 2ELZA 2EN2A 2EQ0A 4X9JA 3M99B 2EN7A 1TN9A 1AAYA 2EL6A 4WSGA 1YUJA 2MKDA 1UBDC 1KJKA 5KL5A 2EOOA 2EMWA 2WBSA 2YTDA 2EN6A 1P47A 2EMIA 2EMXA 2EOZA 2EMHA 2EOXA 2EPXA 2ENCA 2EMZA 3MHHC 2CSHA 2EM0A 1MEYC 2YRKA 2EOSA 2YU8A 2HGHA 2YTFA 2ENAA 4IJDA 2EMKA 2EMAA 1BBOA 2EN8A 1A1GA 2EPAA 1JK1A 2YU5A 5KL7A 2EQ1A 2YRMA 4R2EA 1RMDA 3EPKA 2EM5A 2EQ3A 2EMBA 2DRPA 1UN6B 2EP3A 2EM3A 5KL4A 2EORA 2JPAA 2D9HA 4R2RA 3MHSC 1Z1BA 1A1KA 2ADRA 2EL5A 4R2CA 3EPHA 1TF6A 1A1JA 2EMFA 2EM6A 2EMLA
chains in the Genus database with same CATH superfamily
5TSEA 2YSPA 1UILA 2L92A 2EOIA 2JYAA 4ZYDA 4DV5E 2EPNA 2GPIA 2BB8A 2LUPB 4LF5E 3C6MA 2RSMA 3KZYA 2MDGA 2EM2A 1O0WA 2EMGA 2EPOA 2JP9A 2WZOA 3J80C 4F54A 5ADZA 2LMZA 4L5NC 4F2JC 5T6JA 2EN4A 2L8TA 2MC5A 4ZYEA 2L2KB 4IS1C 1F2IG 3ECRA 4R2PA 5AASA 4DR6E 2K7IA 2YTQA 2JR1A 1HNWE 2M4IA 4BC7A 1SFEA 2UU9E 3VHTB 4B3ME 1STUA 5LLQA 4TUIA 1IQOA 3HPZA 1JK2A 2KOUA 3ADGA 4M30A 1HR0E 1X6EA 4JI2E 1N32E 3TQMA 2V85A 2L3CA 2M9AA 2JVAA 2PRTA 5LMUE 3UK3C 2MDRA 4NXME 1WRJA 2EWLA 4X64E 2LJUA 1AH5A 5KL2A 2ELYA 2GHFA 4DV4E 3IWBA 1DI2A 3P1XA 2JOXA 2L33A 3BGHA 1EH6A 4WXCA 2E5LE 4F6NA 4B3TE 2ELZA 4LTYA 3T1HE 4X9JA 3M99B 5CFFE 1TN9A 3L00A 1J26A 2MKDA 5KL5A 1DQ3A 5AE2A 4X62E 3ZOQB 1XNQE 3J7AG 4WSPA 3OMLA 4P78A 2ZM6E 2EPXA 2DIXA 2LUQA 2EMKA 2RS7A 4BHBA 2LJHA 1IMUA 2V87A 5AE3A 4NZVA 5KL7A 4NXNE 2EQ1A 2YPNA 1HNXE 3BF2A 2EM5A 4MLVA 1XMOE 5AC4A 2B3TB 2JPAA 3ADJA 5IT9C 2Q8UA 1QU6A 5AC5A 2M1SA 2UUAE 5A6BD 2NUGA 2EL5A 1KYQA 4R2CA 1X49A 4BMJA 4DV7E 2EM6A 2EOQA 1DGCA 2LO3A 2M7QA 2EM7A 4O43A 1A1FA 4DR1E 2EPZA 2JXPA 4R03A 2DMIA 4R2QA 4J8ZA 2LTRA 4KWYA 3F6GA 2LE2A 2EPCA 2VQEE 2J7JA 2EE8A 3EQ1A 5FLXC 4R2SA 1IBLE 4GEQB 2FV4B 2EMYA 4JV5E 2DGCA 1GTKA 4WXDA 2N3GA 3KZZA 3OTOE 3F6HA 4BHCA 2LTSA 4F6MA 2DLQA 4R2DA 4BBYA 4N4RB 4GKJE 2LVHA 4JI4E 2EPPA 4Q35B 1BBGA 1X5WA 4R2AA 4JYAE 3H09A 2WCC3 2B7VA 2JY9A 1PDAA 4GKKE 2CTDA 2YTJA 5A6AA 2VF1A 4DV0E 2CPNA 4DV2E 2YTPA 2RSIA 1YZ9A 1PKPA 2LBSB 2YTOA 2UXCE 2EPMX 4F9CB 5F3WA 5DNYA 4BS9A 4B3SE 2RPCA 1X6HA 1T4LB 2K4VA 1J5EE 2H36X 2N8XA 3JAMC 2VQFE 1N34E 2V86A 3C6KA 1WXRA 4DR3E 5A2QC 1T38A 1ZBTA 3HTXA 2EPLX 2EOOA 1YYWA 2EMWA 4DR7E 2EMIA 2N3HA 2EOZA 3IWCA 1MEYC 1YYOA 4L8NA 4DKKA 4OX9E 3HPSA 2ENAA 3C4TA 4X8WA 4X66E 4JI6E 2EPAA 4LU9A 2EPKX 2YU5A 3RMPA 3BIDA 4DR2E 2EQ3A 2DRPA 1EH8A 1UN6B 2ODRD 3LLHA 4LF9E 1T39A 3AV0A 1RC7A 2DB2A 4M0VA 3MHSC 1Z1BA 1NEIA 2ADRA 1XMQE 4JI1E 3EPHA 1A1JA 3QG5C 2EMFA 2EMLA 1ZU1A 1X48A 2DLKA 2MC6A 1EKZA 4X65E 4TUGA 5IXMB 2EM8A 4WFTA 5BR8E 1X6FA 4LF6E 4B3RE 2EPUA 2EMCA 3J81C 1A1HA 2R76A 5A6BA 1PJQA 3AUZA 4LFCE 1ZR9A 4DUZE 2EOEA 2L6MA 4JI7E 4LFAE 4DV6E 1A1LA 2NABA 4JI8E 2F8BA 1NCSA 2YTNA 2MKNA 4FK5C 3BBGA 4LF8E 1YUIA 1IBKE 1G2FC 2CT1A 2EM9A 2EJ4A 1FKAE 4LF7E 3FIGA 1MGTA 2RS6A 2FTXB 1T4OA 1WHNA 1G2DC 1FJGE 4ZYGA 2GLIA 3K6QA 3ADIA 1N36E 3VK6A 4DR5E 1BB8A 2RQLA 5LMNE 5A69A 2V88A 2VRDA 2NUEA 2E72A 2G7HA 3THOB 1SR9A 2V8QB 1A1IA 1GQEA 2EOHA 3DF6A 2NUFA 2ENHA 5A6KA 3HQ1A 4WX9A 2EM4A 2L2NA 1XNRE 1PJTA 4MLQA 2EQ0A 4LF4E 4M2ZA 2L2MA 2E1MA 4KHPE 1IQSA 1YPNA 2RTXA 4HEIA 1AAYA 4F9AB 4WSGA 3T1YE 2LRSA 1YUJA 1WHQA 4O5GA 4DR4E 4P7DA 1P47A 2EMHA 1N3GA 2EOXA 3MHHC 1T4NA 2CSHA 2EM0A 2YRKA 3THNA 2L3JA 4JI5E 2YTFA 3KWRA 2EMAA 5LL6R 1HNZE 4ZYHA 4JI3E 4O4KA 1JK1A 4OOGC 2YRMA 2FGGA 3EPKA 4JI0E 2V83A 2EP3A 2EM3A 4RH8A 2EORA 1GZ6A 2D9HA 4R2RA 1A1KA 5IWAE 3EPLA 2JOBA 2YTEA 1X47A 2EZ6A 3VYYA 4R8OA 2YTGA 4BC9A 2EPRA 2UXBE 1IBME 2UUCE 2EN3A 3JU0A 2YSOA 3JTZA 2BBGA 2EOFA 2HC5A 4K0KE 3IWDA 2YT4A 2EOMA 2I9IA 2A25A 2LV2A 4KZSA 1YFHA 4NHRA 5AE1A 1ZBQA 4M9VC 1I94E 2EL4A 4I8OA 2HHHE 4YHHE 4DV3E 2LCEA 2LT7A 1ZAAC 5A6JA 4RHBB 2WBTA 1WJPA 1B69A 2DMYA 5KL6A 1YSAC 2R1FA 4O24A 3VYXA 4LFBE 1LLMC 2EN1A 1UHZA 2UUBE 2YTIA 4YY3E 2B7TA 2WBUA 1X3CA 2I13A 2YRHA 5KL3A 2B9DA 2EOJA 2IHR1 1RQ0A 3LMLA 1YYKA 4F9BB 1TF3A 2EOYA 4DV1E 3EPJA 4GZNC 3MSWA 2EN2A 2DSYA 1L4SA 4WYQB 2EN7A 3J7Yp 2EL6A 2YZTA 1UBDC 1KJKA 2KONA 2F4VE 1N33E 2YWQA 2WBSA 2YTDA 1EH7A 2UXDE 2EN6A 2V89A 2VE7C 2EMXA 2KHXA 2ENCA 2EMZA 2EOSA 2YU8A 4AQYE 2HGHA 5IV8B 4IJDA 1PJSA 1QNTA 1BBOA 2EN8A 1A1GA 4Q28A 4DUYE 4R2EA 1RMDA 2JWOA 2EMBA 3DJWA 4BCAA 3ADLA 5KL4A 2HJJA 2NA2A 4DMIA 3HXLA 3C4BA 4HTGA 2ODRC 1TF6A 4WPYA
chains in the Genus database with same CATH topology
1ZU1A 2EOQA 1DGCA 2LO3A 2DLKA 2YSPA 2YTEA 2EM7A 2EOIA 1A1FA 2EM8A 2EPZA 2YTGA 2EPRA 2DMIA 1X6FA 2BB8A 2EMCA 2EPUA 4R2QA 1A1HA 2EN3A 2MDGA 2EPCA 1ZR9A 2YSOA 2J7JA 2EE8A 2EM2A 2EMGA 2EOEA 4R2SA 2EOFA 2JP9A 1A1LA 2EMYA 2EOMA 2NABA 2DGCA 4F2JC 1NCSA 2EN4A 2A25A 4IS1C 2YTNA 2MKNA 2LV2A 1F2IG 4FK5C 4R2PA 2YTQA 4F6MA 4M9VC 1YUIA 2DLQA 2EL4A 4R2DA 1G2FC 2CT1A 2LVHA 2EM9A 2EPPA 2EJ4A 3VHTB 1X5WA 4R2AA 2LCEA 2WCC3 2LT7A 1ZAAC 2CTDA 2YTJA 1JK2A 1G2DC 1X6EA 2WBTA 1WJPA 1B69A 5KL6A 1YSAC 2M9AA 2GLIA 3EPLA 2R1FA 2PRTA 3UK3C 1BB8A 1LLMC 2EN1A 2YTPA 2YTIA 2RSIA 2VRDA 2WBUA 2E72A 1X3CA 2I13A 2YRHA 5KL3A 5KL2A 2ELYA 2YTOA 2EOJA 1A1IA 2EOHA 2GHFA 1TF3A 2ENHA 2EOYA 2RPCA 2EM4A 3EPJA 4F6NA 4GZNC 1X6HA 2ELZA 2EN2A 2EQ0A 4X9JA 3M99B 2EN7A 1TN9A 1AAYA 2EL6A 4WSGA 1YUJA 2MKDA 1UBDC 1KJKA 5KL5A 2EOOA 2EMWA 2WBSA 2YTDA 2EN6A 1P47A 2EMIA 2EMXA 2EOZA 2EMHA 2EOXA 2EPXA 2ENCA 2EMZA 3MHHC 2CSHA 2EM0A 1MEYC 2YRKA 2EOSA 2YU8A 2HGHA 2YTFA 2ENAA 4IJDA 2EMKA 2EMAA 1BBOA 2EN8A 1A1GA 2EPAA 1JK1A 2YU5A 5KL7A 2EQ1A 2YRMA 4R2EA 1RMDA 3EPKA 2EM5A 2EQ3A 2EMBA 2DRPA 1UN6B 2EP3A 2EM3A 5KL4A 2EORA 2JPAA 2D9HA 4R2RA 3MHSC 1Z1BA 1A1KA 2ADRA 2EL5A 4R2CA 3EPHA 1TF6A 1A1JA 2EMFA 2EM6A 2EMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZU1 A;  2EOQ A;  1DGC A;  2LO3 A;  2DLK A;  2YSP A;  2YTE A;  2EM7 A;  2EOI A;  1A1F A;  2EM8 A;  2EPZ A;  2YTG A;  2EPR A;  2DMI A;  1X6F A;  2BB8 A;  2EMC A;  2EPU A;  4R2Q A;  1A1H A;  2EN3 A;  2MDG A;  2EPC A;  1ZR9 A;  2YSO A;  2J7J A;  2EE8 A;  2EM2 A;  2EMG A;  2EOE A;  4R2S A;  2EOF A;  2JP9 A;  1A1L A;  2EMY A;  2EOM A;  2NAB A;  2DGC A;  4F2J C;  1NCS A;  2EN4 A;  2A25 A;  4IS1 C;  2YTN A;  2MKN A;  2LV2 A;  1F2I G;  4FK5 C;  4R2P A;  2YTQ A;  4F6M A;  4M9V C;  1YUI A;  2DLQ A;  2EL4 A;  4R2D A;  1G2F C;  2CT1 A;  2LVH A;  2EM9 A;  2EPP A;  2EJ4 A;  3VHT B;  1X5W A;  4R2A A;  2LCE A;  2WCC 3;  2LT7 A;  1ZAA C;  2CTD A;  2YTJ A;  1JK2 A;  1G2D C;  1X6E A;  2WBT A;  1WJP A;  1B69 A;  5KL6 A;  1YSA C;  2M9A A;  2GLI A;  3EPL A;  2R1F A;  2PRT A;  3UK3 C;  1BB8 A;  1LLM C;  2EN1 A;  2YTP A;  2YTI A;  2RSI A;  2VRD A;  2WBU A;  2E72 A;  1X3C A;  2I13 A;  2YRH A;  5KL3 A;  5KL2 A;  2ELY A;  2YTO A;  2EOJ A;  1A1I A;  2EOH A;  2GHF A;  1TF3 A;  2ENH A;  2EOY A;  2RPC A;  2EM4 A;  3EPJ A;  4F6N A;  4GZN C;  1X6H A;  2ELZ A;  2EN2 A;  2EQ0 A;  4X9J A;  3M99 B;  2EN7 A;  1TN9 A;  1AAY A;  2EL6 A;  4WSG A;  1YUJ A;  2MKD A;  1UBD C;  1KJK A;  5KL5 A;  2EOO A;  2EMW A;  2WBS A;  2YTD A;  2EN6 A;  1P47 A;  2EMI A;  2EMX A;  2EOZ A;  2EMH A;  2EOX A;  2EPX A;  2ENC A;  2EMZ A;  3MHH C;  2CSH A;  2EM0 A;  1MEY C;  2YRK A;  2EOS A;  2YU8 A;  2HGH A;  2YTF A;  2ENA A;  4IJD A;  2EMK A;  2EMA A;  1BBO A;  2EN8 A;  1A1G A;  2EPA A;  1JK1 A;  2YU5 A;  5KL7 A;  2EQ1 A;  2YRM A;  4R2E A;  1RMD A;  3EPK A;  2EM5 A;  2EQ3 A;  2EMB A;  2DRP A;  1UN6 B;  2EP3 A;  2EM3 A;  5KL4 A;  2EOR A;  2JPA A;  2D9H A;  4R2R A;  3MHS C;  1Z1B A;  1A1K A;  2ADR A;  2EL5 A;  4R2C A;  3EPH A;  1TF6 A;  1A1J A;  2EMF A;  2EM6 A;  2EML A; 
#chains in the Genus database with same CATH topology
 5TSE A;  2YSP A;  1UIL A;  2L92 A;  2EOI A;  2JYA A;  4ZYD A;  4DV5 E;  2EPN A;  2GPI A;  2BB8 A;  2LUP B;  4LF5 E;  3C6M A;  2RSM A;  3KZY A;  2MDG A;  2EM2 A;  1O0W A;  2EMG A;  2EPO A;  2JP9 A;  2WZO A;  3J80 C;  4F54 A;  5ADZ A;  2LMZ A;  4L5N C;  4F2J C;  5T6J A;  2EN4 A;  2L8T A;  2MC5 A;  4ZYE A;  2L2K B;  4IS1 C;  1F2I G;  3ECR A;  4R2P A;  5AAS A;  4DR6 E;  2K7I A;  2YTQ A;  2JR1 A;  1HNW E;  2M4I A;  4BC7 A;  1SFE A;  2UU9 E;  3VHT B;  4B3M E;  1STU A;  5LLQ A;  4TUI A;  1IQO A;  3HPZ A;  1JK2 A;  2KOU A;  3ADG A;  4M30 A;  1HR0 E;  1X6E A;  4JI2 E;  1N32 E;  3TQM A;  2V85 A;  2L3C A;  2M9A A;  2JVA A;  2PRT A;  5LMU E;  3UK3 C;  2MDR A;  4NXM E;  1WRJ A;  2EWL A;  4X64 E;  2LJU A;  1AH5 A;  5KL2 A;  2ELY A;  2GHF A;  4DV4 E;  3IWB A;  1DI2 A;  3P1X A;  2JOX A;  2L33 A;  3BGH A;  1EH6 A;  4WXC A;  2E5L E;  4F6N A;  4B3T E;  2ELZ A;  4LTY A;  3T1H E;  4X9J A;  3M99 B;  5CFF E;  1TN9 A;  3L00 A;  1J26 A;  2MKD A;  5KL5 A;  1DQ3 A;  5AE2 A;  4X62 E;  3ZOQ B;  1XNQ E;  3J7A G;  4WSP A;  3OML A;  4P78 A;  2ZM6 E;  2EPX A;  2DIX A;  2LUQ A;  2EMK A;  2RS7 A;  4BHB A;  2LJH A;  1IMU A;  2V87 A;  5AE3 A;  4NZV A;  5KL7 A;  4NXN E;  2EQ1 A;  2YPN A;  1HNX E;  3BF2 A;  2EM5 A;  4MLV A;  1XMO E;  5AC4 A;  2B3T B;  2JPA A;  3ADJ A;  5IT9 C;  2Q8U A;  1QU6 A;  5AC5 A;  2M1S A;  2UUA E;  5A6B D;  2NUG A;  2EL5 A;  1KYQ A;  4R2C A;  1X49 A;  4BMJ A;  4DV7 E;  2EM6 A;  2EOQ A;  1DGC A;  2LO3 A;  2M7Q A;  2EM7 A;  4O43 A;  1A1F A;  4DR1 E;  2EPZ A;  2JXP A;  4R03 A;  2DMI A;  4R2Q A;  4J8Z A;  2LTR A;  4KWY A;  3F6G A;  2LE2 A;  2EPC A;  2VQE E;  2J7J A;  2EE8 A;  3EQ1 A;  5FLX C;  4R2S A;  1IBL E;  4GEQ B;  2FV4 B;  2EMY A;  4JV5 E;  2DGC A;  1GTK A;  4WXD A;  2N3G A;  3KZZ A;  3OTO E;  3F6H A;  4BHC A;  2LTS A;  4F6M A;  2DLQ A;  4R2D A;  4BBY A;  4N4R B;  4GKJ E;  2LVH A;  4JI4 E;  2EPP A;  4Q35 B;  1BBG A;  1X5W A;  4R2A A;  4JYA E;  3H09 A;  2WCC 3;  2B7V A;  2JY9 A;  1PDA A;  4GKK E;  2CTD A;  2YTJ A;  5A6A A;  2VF1 A;  4DV0 E;  2CPN A;  4DV2 E;  2YTP A;  2RSI A;  1YZ9 A;  1PKP A;  2LBS B;  2YTO A;  2UXC E;  2EPM X;  4F9C B;  5F3W A;  5DNY A;  4BS9 A;  4B3S E;  2RPC A;  1X6H A;  1T4L B;  2K4V A;  1J5E E;  2H36 X;  2N8X A;  3JAM C;  2VQF E;  1N34 E;  2V86 A;  3C6K A;  1WXR A;  4DR3 E;  5A2Q C;  1T38 A;  1ZBT A;  3HTX A;  2EPL X;  2EOO A;  1YYW A;  2EMW A;  4DR7 E;  2EMI A;  2N3H A;  2EOZ A;  3IWC A;  1MEY C;  1YYO A;  4L8N A;  4DKK A;  4OX9 E;  3HPS A;  2ENA A;  3C4T A;  4X8W A;  4X66 E;  4JI6 E;  2EPA A;  4LU9 A;  2EPK X;  2YU5 A;  3RMP A;  3BID A;  4DR2 E;  2EQ3 A;  2DRP A;  1EH8 A;  1UN6 B;  2ODR D;  3LLH A;  4LF9 E;  1T39 A;  3AV0 A;  1RC7 A;  2DB2 A;  4M0V A;  3MHS C;  1Z1B A;  1NEI A;  2ADR A;  1XMQ E;  4JI1 E;  3EPH A;  1A1J A;  3QG5 C;  2EMF A;  2EML A;  1ZU1 A;  1X48 A;  2DLK A;  2MC6 A;  1EKZ A;  4X65 E;  4TUG A;  5IXM B;  2EM8 A;  4WFT A;  5BR8 E;  1X6F A;  4LF6 E;  4B3R E;  2EPU A;  2EMC A;  3J81 C;  1A1H A;  2R76 A;  5A6B A;  1PJQ A;  3AUZ A;  4LFC E;  1ZR9 A;  4DUZ E;  2EOE A;  2L6M A;  4JI7 E;  4LFA E;  4DV6 E;  1A1L A;  2NAB A;  4JI8 E;  2F8B A;  1NCS A;  2YTN A;  2MKN A;  4FK5 C;  3BBG A;  4LF8 E;  1YUI A;  1IBK E;  1G2F C;  2CT1 A;  2EM9 A;  2EJ4 A;  1FKA E;  4LF7 E;  3FIG A;  1MGT A;  2RS6 A;  2FTX B;  1T4O A;  1WHN A;  1G2D C;  1FJG E;  4ZYG A;  2GLI A;  3K6Q A;  3ADI A;  1N36 E;  3VK6 A;  4DR5 E;  1BB8 A;  2RQL A;  5LMN E;  5A69 A;  2V88 A;  2VRD A;  2NUE A;  2E72 A;  2G7H A;  3THO B;  1SR9 A;  2V8Q B;  1A1I A;  1GQE A;  2EOH A;  3DF6 A;  2NUF A;  2ENH A;  5A6K A;  3HQ1 A;  4WX9 A;  2EM4 A;  2L2N A;  1XNR E;  1PJT A;  4MLQ A;  2EQ0 A;  4LF4 E;  4M2Z A;  2L2M A;  2E1M A;  4KHP E;  1IQS A;  1YPN A;  2RTX A;  4HEI A;  1AAY A;  4F9A B;  4WSG A;  3T1Y E;  2LRS A;  1YUJ A;  1WHQ A;  4O5G A;  4DR4 E;  4P7D A;  1P47 A;  2EMH A;  1N3G A;  2EOX A;  3MHH C;  1T4N A;  2CSH A;  2EM0 A;  2YRK A;  3THN A;  2L3J A;  4JI5 E;  2YTF A;  3KWR A;  2EMA A;  5LL6 R;  1HNZ E;  4ZYH A;  4JI3 E;  4O4K A;  1JK1 A;  4OOG C;  2YRM A;  2FGG A;  3EPK A;  4JI0 E;  2V83 A;  2EP3 A;  2EM3 A;  4RH8 A;  2EOR A;  1GZ6 A;  2D9H A;  4R2R A;  1A1K A;  5IWA E;  3EPL A;  2JOB A;  2YTE A;  1X47 A;  2EZ6 A;  3VYY A;  4R8O A;  2YTG A;  4BC9 A;  2EPR A;  2UXB E;  1IBM E;  2UUC E;  2EN3 A;  3JU0 A;  2YSO A;  3JTZ A;  2BBG A;  2EOF A;  2HC5 A;  4K0K E;  3IWD A;  2YT4 A;  2EOM A;  2I9I A;  2A25 A;  2LV2 A;  4KZS A;  1YFH A;  4NHR A;  5AE1 A;  1ZBQ A;  4M9V C;  1I94 E;  2EL4 A;  4I8O A;  2HHH E;  4YHH E;  4DV3 E;  2LCE A;  2LT7 A;  1ZAA C;  5A6J A;  4RHB B;  2WBT A;  1WJP A;  1B69 A;  2DMY A;  5KL6 A;  1YSA C;  2R1F A;  4O24 A;  3VYX A;  4LFB E;  1LLM C;  2EN1 A;  1UHZ A;  2UUB E;  2YTI A;  4YY3 E;  2B7T A;  2WBU A;  1X3C A;  2I13 A;  2YRH A;  5KL3 A;  2B9D A;  2EOJ A;  2IHR 1;  1RQ0 A;  3LML A;  1YYK A;  4F9B B;  1TF3 A;  2EOY A;  4DV1 E;  3EPJ A;  4GZN C;  3MSW A;  2EN2 A;  2DSY A;  1L4S A;  4WYQ B;  2EN7 A;  3J7Y p;  2EL6 A;  2YZT A;  1UBD C;  1KJK A;  2KON A;  2F4V E;  1N33 E;  2YWQ A;  2WBS A;  2YTD A;  1EH7 A;  2UXD E;  2EN6 A;  2V89 A;  2VE7 C;  2EMX A;  2KHX A;  2ENC A;  2EMZ A;  2EOS A;  2YU8 A;  4AQY E;  2HGH A;  5IV8 B;  4IJD A;  1PJS A;  1QNT A;  1BBO A;  2EN8 A;  1A1G A;  4Q28 A;  4DUY E;  4R2E A;  1RMD A;  2JWO A;  2EMB A;  3DJW A;  4BCA A;  3ADL A;  5KL4 A;  2HJJ A;  2NA2 A;  4DMI A;  3HXL A;  3C4B A;  4HTG A;  2ODR C;  1TF6 A;  4WPY A; 
#chains in the Genus database with same CATH homology
 1ZU1 A;  2EOQ A;  1DGC A;  2LO3 A;  2DLK A;  2YSP A;  2YTE A;  2EM7 A;  2EOI A;  1A1F A;  2EM8 A;  2EPZ A;  2YTG A;  2EPR A;  2DMI A;  1X6F A;  2BB8 A;  2EMC A;  2EPU A;  4R2Q A;  1A1H A;  2EN3 A;  2MDG A;  2EPC A;  1ZR9 A;  2YSO A;  2J7J A;  2EE8 A;  2EM2 A;  2EMG A;  2EOE A;  4R2S A;  2EOF A;  2JP9 A;  1A1L A;  2EMY A;  2EOM A;  2NAB A;  2DGC A;  4F2J C;  1NCS A;  2EN4 A;  2A25 A;  4IS1 C;  2YTN A;  2MKN A;  2LV2 A;  1F2I G;  4FK5 C;  4R2P A;  2YTQ A;  4F6M A;  4M9V C;  1YUI A;  2DLQ A;  2EL4 A;  4R2D A;  1G2F C;  2CT1 A;  2LVH A;  2EM9 A;  2EPP A;  2EJ4 A;  3VHT B;  1X5W A;  4R2A A;  2LCE A;  2WCC 3;  2LT7 A;  1ZAA C;  2CTD A;  2YTJ A;  1JK2 A;  1G2D C;  1X6E A;  2WBT A;  1WJP A;  1B69 A;  5KL6 A;  1YSA C;  2M9A A;  2GLI A;  3EPL A;  2R1F A;  2PRT A;  3UK3 C;  1BB8 A;  1LLM C;  2EN1 A;  2YTP A;  2YTI A;  2RSI A;  2VRD A;  2WBU A;  2E72 A;  1X3C A;  2I13 A;  2YRH A;  5KL3 A;  5KL2 A;  2ELY A;  2YTO A;  2EOJ A;  1A1I A;  2EOH A;  2GHF A;  1TF3 A;  2ENH A;  2EOY A;  2RPC A;  2EM4 A;  3EPJ A;  4F6N A;  4GZN C;  1X6H A;  2ELZ A;  2EN2 A;  2EQ0 A;  4X9J A;  3M99 B;  2EN7 A;  1TN9 A;  1AAY A;  2EL6 A;  4WSG A;  1YUJ A;  2MKD A;  1UBD C;  1KJK A;  5KL5 A;  2EOO A;  2EMW A;  2WBS A;  2YTD A;  2EN6 A;  1P47 A;  2EMI A;  2EMX A;  2EOZ A;  2EMH A;  2EOX A;  2EPX A;  2ENC A;  2EMZ A;  3MHH C;  2CSH A;  2EM0 A;  1MEY C;  2YRK A;  2EOS A;  2YU8 A;  2HGH A;  2YTF A;  2ENA A;  4IJD A;  2EMK A;  2EMA A;  1BBO A;  2EN8 A;  1A1G A;  2EPA A;  1JK1 A;  2YU5 A;  5KL7 A;  2EQ1 A;  2YRM A;  4R2E A;  1RMD A;  3EPK A;  2EM5 A;  2EQ3 A;  2EMB A;  2DRP A;  1UN6 B;  2EP3 A;  2EM3 A;  5KL4 A;  2EOR A;  2JPA A;  2D9H A;  4R2R A;  3MHS C;  1Z1B A;  1A1K A;  2ADR A;  2EL5 A;  4R2C A;  3EPH A;  1TF6 A;  1A1J A;  2EMF A;  2EM6 A;  2EML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...