4F6MA

Crystal structure of kaiso zinc finger dna binding domain in complex with kaiso binding site dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
116
Chain Sequence
DHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords Transcriptional regulator Kaiso
publication title Molecular basis for recognition of methylated and specific DNA sequences by the zinc finger protein Kaiso.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6mA03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6mA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4f6mA02
2YSOA 1YSAC 2YSPA 2EPZA 2EMKA 2ELZA 2RPCA 1MEYC 1BB8A 1NCSA 1A1FA 2EMXA 1JK1A 2MKDA 2EOQA 2DLQA 3M99B 3EPKA 5KL7A 1F2IG 2EOZA 1RMDA 2YU8A 2EOJA 1YUIA 2YTIA 2EOYA 2YTNA 2YRHA 1X6EA 2ENAA 2EL5A 1AAYA 2EPCA 1A1HA 1G2FC 2EORA 2EN1A 2EM7A 2VRDA 2DRPA 2EMZA 2MKNA 1ZAAC 2EMBA 2EQ3A 3EPLA 3UK3C 1P47A 2EQ1A 2EMGA 2EPAA 2LV2A 4IJDA 5KL6A 4X9JA 2EN3A 2ENHA 2EMYA 2D9HA 2CT1A 2YU5A 4R2QA 1DGCA 1G2DC 2YRKA 2WCC3 2BB8A 4GZNC 2EOEA 1JK2A 1LLMC 2EMIA 1UN6B 2EMAA 2E72A 2YTJA 2EE8A 1TN9A 2EM8A 2WBUA 3MHHC 2EM5A 4R2CA 3MHSC 5KL3A 2RSIA 2J7JA 1KJKA 4F2JC 2EOFA 2LVHA 1TF6A 2EN8A 2EM9A 2ELYA 2EOIA 2YTGA 2EOSA 2YRMA 5KL5A 1A1KA 1WJPA 2DMIA 1ZU1A 2EMHA 2CSHA 2EPRA 2HGHA 1UBDC 2JP9A 4R2PA 1A1JA 2YTOA 2R1FA 1TF3A 2EL4A 4R2DA 2EQ0A 2EM6A 2I13A 2LCEA 1YUJA 1ZR9A 2A25A 2JPAA 2EMLA 2EJ4A 2EMWA 2EMFA 2NABA 5KL4A 4R2RA 1Z1BA 2GHFA 1A1IA 3VHTB 1X6FA 2EM2A 2MDGA 2YTPA 4FK5C 2DGCA 2GLIA 2EOMA 2EMCA 4WSGA 2WBSA 1B69A 4M9VC 3EPJA 2EPUA 2YTFA 2EM0A 2LT7A 4F6NA 4IS1C 2EM4A 2YTQA 2EL6A 2EPXA 2YTEA 4R2AA 2M9AA 2DLKA 2EPPA 2ENCA 2EN6A 1X6HA 1X5WA 2EN2A 1A1GA 2PRTA 2EN4A 2EOXA 4R2SA 2EP3A 2EM3A 2LO3A 2CTDA 2EN7A 4R2EA 2YTDA 5KL2A 4F6MA 2WBTA 1BBOA 2EOHA 2EOOA 2ADRA 1X3CA 3EPHA 1A1LA
chains in the Genus database with same CATH superfamily
2V85A 3J80C 2V8QB 1J5EE 1YSAC 2HHHE 4KHPE 2EPZA 4JI0E 1MEYC 4B3SE 1BB8A 1XNQE 4WYQB 1A1FA 1QNTA 2DLQA 2EPNA 2WZOA 2LTRA 5KL7A 1RMDA 3F6HA 2JOBA 1DI2A 2EOYA 2RTXA 2ENAA 4NZVA 2EPCA 4Q35B 3BIDA 4ZYDA 2IHR1 2VRDA 2DRPA 4DKKA 1ZAAC 4WFTA 2RSMA 2JY9A 1BBGA 2EQ1A 2ODRC 4BBYA 2EPAA 5KL6A 2Q8UA 2I9IA 2RS7A 4LFAE 2CT1A 1DGCA 3JTZA 4DV2E 4HEIA 2WCC3 4LF9E 1PJTA 2EOEA 1LLMC 2EMIA 1L4SA 2EMAA 2E72A 1HNXE 5AE1A 4YHHE 4BCAA 2EM5A 5KL3A 2V88A 1KJKA 4M2ZA 4LF4E 2EN8A 2MC6A 4F54A 2LJHA 2YRMA 2YTGA 2RS6A 1A1KA 2EWLA 1WJPA 4DV6E 1ZU1A 1UHZA 2UXBE 1IQOA 5CFFE 2R1FA 2FV4B 3BF2A 4KZSA 2LUPB 2EL4A 2EQ0A 2EM6A 2I13A 3RMPA 4DR1E 2EMWA 1T4OA 1WHQA 4DV7E 3HTXA 4R2RA 2F8BA 4BC7A 2EOMA 2DIXA 4P78A 3LLHA 4M9VC 4WSPA 3ADGA 3MSWA 3DF6A 4F6NA 4L5NC 3HPSA 4JYAE 3TQMA 3T1YE 2DSYA 1N3GA 1X5WA 2EZ6A 3T1HE 2EOXA 2LTSA 3J7Yp 2EM3A 2F4VE 4JI7E 1T4LB 4R2EA 3KWRA 2EOHA 1X3CA 4RH8A 5IV8B 1A1LA 4LTYA 1I94E 1J26A 2EMKA 3H09A 4JI4E 1NCSA 4BS9A 4BHCA 2EMXA 2MKDA 2JYAA 4RHBB 3IWCA 2JVAA 1ZBQA 1F2IG 1O0WA 3LMLA 2VQFE 4MLVA 2YTIA 4X64E 5LMUE 2LUQA 2YTNA 2YRHA 1HNWE 1QU6A 1AH5A 1G2FC 1XNRE 2EORA 2M7QA 3THOB 2EM7A 2JWOA 2MKNA 2EQ3A 2RQLA 4DUYE 3P1XA 3VYYA 3HPZA 2V83A 2EPMX 5IT9C 4KWYA 4DMIA 2YWQA 4LFBE 2NUEA 2ENHA 2HC5A 5A6JA 1T38A 2EMYA 2UU9E 2YU5A 4R2QA 4JV5E 3ADIA 1G2DC 3ECRA 2NA2A 3EQ1A 2YRKA 2BB8A 1RC7A 4B3TE 1GZ6A 1YPNA 3JU0A 1TN9A 4X8WA 2FTXB 2BBGA 2J7JA 5T6JA 1YFHA 2JOXA 2LVHA 1TF6A 2LJUA 4ZYHA 2ELYA 2EOIA 4DV4E 2EOSA 3K6QA 2DMIA 3ADLA 1DQ3A 2JP9A 4R2PA 1A1JA 2UUBE 1TF3A 4OX9E 2G7HA 2N3GA 4R2DA 5FLXC 1YUJA 3C6MA 4NXME 2JPAA 2EMLA 2EJ4A 4J8ZA 1YZ9A 1Z1BA 2GHFA 3KZZA 1X6FA 3OMLA 5BR8E 2GLIA 1ZBTA 2JR1A 2WBSA 3EPJA 3JAMC 4LF8E 2EM0A 2LT7A 4JI3E 4YY3E 4IS1C 2EL6A 1SFEA 4O4KA 1SR9A 5LMNE 4K0KE 2N8XA 2EN6A 1X6HA 2EN2A 4N4RB 4R8OA 5A69A 1YYOA 1A1GA 4DV0E 4JI1E 4DR5E 3AV0A 2L6MA 4GEQB 4WXDA 2EP3A 5IXMB 2UXDE 1STUA 4MLQA 2YTDA 1BBOA 3EPHA 5TSEA 5AE3A 4HTGA 4LF7E 2YSOA 3OTOE 1N36E 2YSPA 5A6BD 2L3CA 3BBGA 2GPIA 1T4NA 4GKJE 2M4IA 2V89A 1X48A 1IBME 1JK1A 2EOQA 3M99B 2EOZA 1PDAA 1IQSA 2YPNA 2YU8A 1YUIA 1WXRA 3DJWA 4B3ME 5AC5A 1X6EA 1WRJA 2EL5A 4M0VA 4NXNE 4JI2E 2LRSA 2EN1A 2EMZA 1YYWA 1HR0E 2UUCE 2EMBA 2L2KB 1P47A 4AQYE 3F6GA 1EH7A 2EMGA 2R76A 1GQEA 2LV2A 4Q28A 2D9HA 3ADJA 4DV5E 4P7DA 2B3TB 4GZNC 1JK2A 1RQ0A 4O5GA 1UN6B 2E1MA 2EE8A 1FJGE 2WBUA 3MHHC 4WPYA 4R2CA 3MHSC 2RSIA 4O24A 4X65E 3FIGA 2L3JA 5DNYA 2ODRD 2B7TA 3C6KA 4DR6E 5LLQA 2K7IA 4JI5E 2HGHA 4BHBA 2EPKX 3J7AG 4TUIA 4BMJA 2KONA 2MC5A 2LCEA 4DR7E 2A25A 2EPOA 3QG5C 5KL4A 3L00A 2L92A 4DV3E 2EM2A 2MDGA 2L2NA 1NEIA 2YTPA 4FK5C 2DGCA 2B7VA 2E5LE 2LMZA 5ADZA 1IBKE 4WSGA 1IMUA 5AASA 2EPUA 2YTFA 4F9AB 4LF5E 3THNA 4GKKE 1N32E 2YTQA 5A6BA 3AUZA 4NHRA 4R2AA 2DLKA 2CPNA 2EPPA 4X62E 1EH6A 2EN4A 2JXPA 4R2SA 2LO3A 2EN7A 1PKPA 4F9BB 4B3RE 5KL2A 4LFCE 2EOOA 2N3HA 2NUFA 5IWAE 2LE2A 2L8TA 2EPLX 1IBLE 2DB2A 2ELZA 2RPCA 4LF6E 2ZM6E 4DV1E 4I8OA 1T39A 4TUGA 3EPKA 1X47A 2EOJA 4F9CB 4DR2E 4WX9A 5AC4A 1MGTA 1PJSA 3IWBA 2MDRA 3C4BA 1AAYA 2UUAE 1KYQA 4WXCA 1A1HA 4LU9A 1PJQA 3HQ1A 1XMOE 1GTKA 1FKAE 1HNZE 3VK6A 3EPLA 3UK3C 3IWDA 4IJDA 4X9JA 2K4VA 2VQEE 4M30A 2EN3A 2HJJA 4R03A 3J81C 5AE2A 4OOGC 1WHNA 2YZTA 3C4TA 2YTJA 1X49A 2EM8A 2YT4A 2KOUA 3HXLA 5A2QC 2V87A 4F2JC 2EOFA 2M1SA 2EM9A 3BGHA 5KL5A 3ZOQB 2EMHA 2CSHA 2EPRA 1UBDC 2YTOA 2V86A 2VE7C 2VF1A 2NUGA 4L8NA 2KHXA 2L33A 2H36X 1ZR9A 4DR4E 4JI6E 2DMYA 2EMFA 2NABA 5A6AA 1N34E 1A1IA 3VHTB 4ZYGA 1N33E 2L2MA 1UILA 4BC9A 2EMCA 4ZYEA 2LBSB 5LL6R 1B69A 4JI8E 1YYKA 4DUZE 2EM4A 3KZYA 2EPXA 1EH8A 2YTEA 2M9AA 2ENCA 2UXCE 5A6KA 2PRTA 2B9DA 2FGGA 1XMQE 3VYXA 4DR3E 2CTDA 1EKZA 4F6MA 4X66E 2WBTA 5F3WA 4O43A 2ADRA
chains in the Genus database with same CATH topology
2YSOA 1YSAC 2YSPA 2EPZA 2EMKA 2ELZA 2RPCA 1MEYC 1BB8A 1NCSA 1A1FA 2EMXA 1JK1A 2MKDA 2EOQA 2DLQA 3M99B 3EPKA 5KL7A 1F2IG 2EOZA 1RMDA 2YU8A 2EOJA 1YUIA 2YTIA 2EOYA 2YTNA 2YRHA 1X6EA 2ENAA 2EL5A 1AAYA 2EPCA 1A1HA 1G2FC 2EORA 2EN1A 2EM7A 2VRDA 2DRPA 2EMZA 2MKNA 1ZAAC 2EMBA 2EQ3A 3EPLA 3UK3C 1P47A 2EQ1A 2EMGA 2EPAA 2LV2A 4IJDA 5KL6A 4X9JA 2EN3A 2ENHA 2EMYA 2D9HA 2CT1A 2YU5A 4R2QA 1DGCA 1G2DC 2YRKA 2WCC3 2BB8A 4GZNC 2EOEA 1JK2A 1LLMC 2EMIA 1UN6B 2EMAA 2E72A 2YTJA 2EE8A 1TN9A 2EM8A 2WBUA 3MHHC 2EM5A 4R2CA 3MHSC 5KL3A 2RSIA 2J7JA 1KJKA 4F2JC 2EOFA 2LVHA 1TF6A 2EN8A 2EM9A 2ELYA 2EOIA 2YTGA 2EOSA 2YRMA 5KL5A 1A1KA 1WJPA 2DMIA 1ZU1A 2EMHA 2CSHA 2EPRA 2HGHA 1UBDC 2JP9A 4R2PA 1A1JA 2YTOA 2R1FA 1TF3A 2EL4A 4R2DA 2EQ0A 2EM6A 2I13A 2LCEA 1YUJA 1ZR9A 2A25A 2JPAA 2EMLA 2EJ4A 2EMWA 2EMFA 2NABA 5KL4A 4R2RA 1Z1BA 2GHFA 1A1IA 3VHTB 1X6FA 2EM2A 2MDGA 2YTPA 4FK5C 2DGCA 2GLIA 2EOMA 2EMCA 4WSGA 2WBSA 1B69A 4M9VC 3EPJA 2EPUA 2YTFA 2EM0A 2LT7A 4F6NA 4IS1C 2EM4A 2YTQA 2EL6A 2EPXA 2YTEA 4R2AA 2M9AA 2DLKA 2EPPA 2ENCA 2EN6A 1X6HA 1X5WA 2EN2A 1A1GA 2PRTA 2EN4A 2EOXA 4R2SA 2EP3A 2EM3A 2LO3A 2CTDA 2EN7A 4R2EA 2YTDA 5KL2A 4F6MA 2WBTA 1BBOA 2EOHA 2EOOA 2ADRA 1X3CA 3EPHA 1A1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YSO A;  1YSA C;  2YSP A;  2EPZ A;  2EMK A;  2ELZ A;  2RPC A;  1MEY C;  1BB8 A;  1NCS A;  1A1F A;  2EMX A;  1JK1 A;  2MKD A;  2EOQ A;  2DLQ A;  3M99 B;  3EPK A;  5KL7 A;  1F2I G;  2EOZ A;  1RMD A;  2YU8 A;  2EOJ A;  1YUI A;  2YTI A;  2EOY A;  2YTN A;  2YRH A;  1X6E A;  2ENA A;  2EL5 A;  1AAY A;  2EPC A;  1A1H A;  1G2F C;  2EOR A;  2EN1 A;  2EM7 A;  2VRD A;  2DRP A;  2EMZ A;  2MKN A;  1ZAA C;  2EMB A;  2EQ3 A;  3EPL A;  3UK3 C;  1P47 A;  2EQ1 A;  2EMG A;  2EPA A;  2LV2 A;  4IJD A;  5KL6 A;  4X9J A;  2EN3 A;  2ENH A;  2EMY A;  2D9H A;  2CT1 A;  2YU5 A;  4R2Q A;  1DGC A;  1G2D C;  2YRK A;  2WCC 3;  2BB8 A;  4GZN C;  2EOE A;  1JK2 A;  1LLM C;  2EMI A;  1UN6 B;  2EMA A;  2E72 A;  2YTJ A;  2EE8 A;  1TN9 A;  2EM8 A;  2WBU A;  3MHH C;  2EM5 A;  4R2C A;  3MHS C;  5KL3 A;  2RSI A;  2J7J A;  1KJK A;  4F2J C;  2EOF A;  2LVH A;  1TF6 A;  2EN8 A;  2EM9 A;  2ELY A;  2EOI A;  2YTG A;  2EOS A;  2YRM A;  5KL5 A;  1A1K A;  1WJP A;  2DMI A;  1ZU1 A;  2EMH A;  2CSH A;  2EPR A;  2HGH A;  1UBD C;  2JP9 A;  4R2P A;  1A1J A;  2YTO A;  2R1F A;  1TF3 A;  2EL4 A;  4R2D A;  2EQ0 A;  2EM6 A;  2I13 A;  2LCE A;  1YUJ A;  1ZR9 A;  2A25 A;  2JPA A;  2EML A;  2EJ4 A;  2EMW A;  2EMF A;  2NAB A;  5KL4 A;  4R2R A;  1Z1B A;  2GHF A;  1A1I A;  3VHT B;  1X6F A;  2EM2 A;  2MDG A;  2YTP A;  4FK5 C;  2DGC A;  2GLI A;  2EOM A;  2EMC A;  4WSG A;  2WBS A;  1B69 A;  4M9V C;  3EPJ A;  2EPU A;  2YTF A;  2EM0 A;  2LT7 A;  4F6N A;  4IS1 C;  2EM4 A;  2YTQ A;  2EL6 A;  2EPX A;  2YTE A;  4R2A A;  2M9A A;  2DLK A;  2EPP A;  2ENC A;  2EN6 A;  1X6H A;  1X5W A;  2EN2 A;  1A1G A;  2PRT A;  2EN4 A;  2EOX A;  4R2S A;  2EP3 A;  2EM3 A;  2LO3 A;  2CTD A;  2EN7 A;  4R2E A;  2YTD A;  5KL2 A;  4F6M A;  2WBT A;  1BBO A;  2EOH A;  2EOO A;  2ADR A;  1X3C A;  3EPH A;  1A1L A; 
#chains in the Genus database with same CATH topology
 2V85 A;  3J80 C;  2V8Q B;  1J5E E;  1YSA C;  2HHH E;  4KHP E;  2EPZ A;  4JI0 E;  1MEY C;  4B3S E;  1BB8 A;  1XNQ E;  4WYQ B;  1A1F A;  1QNT A;  2DLQ A;  2EPN A;  2WZO A;  2LTR A;  5KL7 A;  1RMD A;  3F6H A;  2JOB A;  1DI2 A;  2EOY A;  2RTX A;  2ENA A;  4NZV A;  2EPC A;  4Q35 B;  3BID A;  4ZYD A;  2IHR 1;  2VRD A;  2DRP A;  4DKK A;  1ZAA C;  4WFT A;  2RSM A;  2JY9 A;  1BBG A;  2EQ1 A;  2ODR C;  4BBY A;  2EPA A;  5KL6 A;  2Q8U A;  2I9I A;  2RS7 A;  4LFA E;  2CT1 A;  1DGC A;  3JTZ A;  4DV2 E;  4HEI A;  2WCC 3;  4LF9 E;  1PJT A;  2EOE A;  1LLM C;  2EMI A;  1L4S A;  2EMA A;  2E72 A;  1HNX E;  5AE1 A;  4YHH E;  4BCA A;  2EM5 A;  5KL3 A;  2V88 A;  1KJK A;  4M2Z A;  4LF4 E;  2EN8 A;  2MC6 A;  4F54 A;  2LJH A;  2YRM A;  2YTG A;  2RS6 A;  1A1K A;  2EWL A;  1WJP A;  4DV6 E;  1ZU1 A;  1UHZ A;  2UXB E;  1IQO A;  5CFF E;  2R1F A;  2FV4 B;  3BF2 A;  4KZS A;  2LUP B;  2EL4 A;  2EQ0 A;  2EM6 A;  2I13 A;  3RMP A;  4DR1 E;  2EMW A;  1T4O A;  1WHQ A;  4DV7 E;  3HTX A;  4R2R A;  2F8B A;  4BC7 A;  2EOM A;  2DIX A;  4P78 A;  3LLH A;  4M9V C;  4WSP A;  3ADG A;  3MSW A;  3DF6 A;  4F6N A;  4L5N C;  3HPS A;  4JYA E;  3TQM A;  3T1Y E;  2DSY A;  1N3G A;  1X5W A;  2EZ6 A;  3T1H E;  2EOX A;  2LTS A;  3J7Y p;  2EM3 A;  2F4V E;  4JI7 E;  1T4L B;  4R2E A;  3KWR A;  2EOH A;  1X3C A;  4RH8 A;  5IV8 B;  1A1L A;  4LTY A;  1I94 E;  1J26 A;  2EMK A;  3H09 A;  4JI4 E;  1NCS A;  4BS9 A;  4BHC A;  2EMX A;  2MKD A;  2JYA A;  4RHB B;  3IWC A;  2JVA A;  1ZBQ A;  1F2I G;  1O0W A;  3LML A;  2VQF E;  4MLV A;  2YTI A;  4X64 E;  5LMU E;  2LUQ A;  2YTN A;  2YRH A;  1HNW E;  1QU6 A;  1AH5 A;  1G2F C;  1XNR E;  2EOR A;  2M7Q A;  3THO B;  2EM7 A;  2JWO A;  2MKN A;  2EQ3 A;  2RQL A;  4DUY E;  3P1X A;  3VYY A;  3HPZ A;  2V83 A;  2EPM X;  5IT9 C;  4KWY A;  4DMI A;  2YWQ A;  4LFB E;  2NUE A;  2ENH A;  2HC5 A;  5A6J A;  1T38 A;  2EMY A;  2UU9 E;  2YU5 A;  4R2Q A;  4JV5 E;  3ADI A;  1G2D C;  3ECR A;  2NA2 A;  3EQ1 A;  2YRK A;  2BB8 A;  1RC7 A;  4B3T E;  1GZ6 A;  1YPN A;  3JU0 A;  1TN9 A;  4X8W A;  2FTX B;  2BBG A;  2J7J A;  5T6J A;  1YFH A;  2JOX A;  2LVH A;  1TF6 A;  2LJU A;  4ZYH A;  2ELY A;  2EOI A;  4DV4 E;  2EOS A;  3K6Q A;  2DMI A;  3ADL A;  1DQ3 A;  2JP9 A;  4R2P A;  1A1J A;  2UUB E;  1TF3 A;  4OX9 E;  2G7H A;  2N3G A;  4R2D A;  5FLX C;  1YUJ A;  3C6M A;  4NXM E;  2JPA A;  2EML A;  2EJ4 A;  4J8Z A;  1YZ9 A;  1Z1B A;  2GHF A;  3KZZ A;  1X6F A;  3OML A;  5BR8 E;  2GLI A;  1ZBT A;  2JR1 A;  2WBS A;  3EPJ A;  3JAM C;  4LF8 E;  2EM0 A;  2LT7 A;  4JI3 E;  4YY3 E;  4IS1 C;  2EL6 A;  1SFE A;  4O4K A;  1SR9 A;  5LMN E;  4K0K E;  2N8X A;  2EN6 A;  1X6H A;  2EN2 A;  4N4R B;  4R8O A;  5A69 A;  1YYO A;  1A1G A;  4DV0 E;  4JI1 E;  4DR5 E;  3AV0 A;  2L6M A;  4GEQ B;  4WXD A;  2EP3 A;  5IXM B;  2UXD E;  1STU A;  4MLQ A;  2YTD A;  1BBO A;  3EPH A;  5TSE A;  5AE3 A;  4HTG A;  4LF7 E;  2YSO A;  3OTO E;  1N36 E;  2YSP A;  5A6B D;  2L3C A;  3BBG A;  2GPI A;  1T4N A;  4GKJ E;  2M4I A;  2V89 A;  1X48 A;  1IBM E;  1JK1 A;  2EOQ A;  3M99 B;  2EOZ A;  1PDA A;  1IQS A;  2YPN A;  2YU8 A;  1YUI A;  1WXR A;  3DJW A;  4B3M E;  5AC5 A;  1X6E A;  1WRJ A;  2EL5 A;  4M0V A;  4NXN E;  4JI2 E;  2LRS A;  2EN1 A;  2EMZ A;  1YYW A;  1HR0 E;  2UUC E;  2EMB A;  2L2K B;  1P47 A;  4AQY E;  3F6G A;  1EH7 A;  2EMG A;  2R76 A;  1GQE A;  2LV2 A;  4Q28 A;  2D9H A;  3ADJ A;  4DV5 E;  4P7D A;  2B3T B;  4GZN C;  1JK2 A;  1RQ0 A;  4O5G A;  1UN6 B;  2E1M A;  2EE8 A;  1FJG E;  2WBU A;  3MHH C;  4WPY A;  4R2C A;  3MHS C;  2RSI A;  4O24 A;  4X65 E;  3FIG A;  2L3J A;  5DNY A;  2ODR D;  2B7T A;  3C6K A;  4DR6 E;  5LLQ A;  2K7I A;  4JI5 E;  2HGH A;  4BHB A;  2EPK X;  3J7A G;  4TUI A;  4BMJ A;  2KON A;  2MC5 A;  2LCE A;  4DR7 E;  2A25 A;  2EPO A;  3QG5 C;  5KL4 A;  3L00 A;  2L92 A;  4DV3 E;  2EM2 A;  2MDG A;  2L2N A;  1NEI A;  2YTP A;  4FK5 C;  2DGC A;  2B7V A;  2E5L E;  2LMZ A;  5ADZ A;  1IBK E;  4WSG A;  1IMU A;  5AAS A;  2EPU A;  2YTF A;  4F9A B;  4LF5 E;  3THN A;  4GKK E;  1N32 E;  2YTQ A;  5A6B A;  3AUZ A;  4NHR A;  4R2A A;  2DLK A;  2CPN A;  2EPP A;  4X62 E;  1EH6 A;  2EN4 A;  2JXP A;  4R2S A;  2LO3 A;  2EN7 A;  1PKP A;  4F9B B;  4B3R E;  5KL2 A;  4LFC E;  2EOO A;  2N3H A;  2NUF A;  5IWA E;  2LE2 A;  2L8T A;  2EPL X;  1IBL E;  2DB2 A;  2ELZ A;  2RPC A;  4LF6 E;  2ZM6 E;  4DV1 E;  4I8O A;  1T39 A;  4TUG A;  3EPK A;  1X47 A;  2EOJ A;  4F9C B;  4DR2 E;  4WX9 A;  5AC4 A;  1MGT A;  1PJS A;  3IWB A;  2MDR A;  3C4B A;  1AAY A;  2UUA E;  1KYQ A;  4WXC A;  1A1H A;  4LU9 A;  1PJQ A;  3HQ1 A;  1XMO E;  1GTK A;  1FKA E;  1HNZ E;  3VK6 A;  3EPL A;  3UK3 C;  3IWD A;  4IJD A;  4X9J A;  2K4V A;  2VQE E;  4M30 A;  2EN3 A;  2HJJ A;  4R03 A;  3J81 C;  5AE2 A;  4OOG C;  1WHN A;  2YZT A;  3C4T A;  2YTJ A;  1X49 A;  2EM8 A;  2YT4 A;  2KOU A;  3HXL A;  5A2Q C;  2V87 A;  4F2J C;  2EOF A;  2M1S A;  2EM9 A;  3BGH A;  5KL5 A;  3ZOQ B;  2EMH A;  2CSH A;  2EPR A;  1UBD C;  2YTO A;  2V86 A;  2VE7 C;  2VF1 A;  2NUG A;  4L8N A;  2KHX A;  2L33 A;  2H36 X;  1ZR9 A;  4DR4 E;  4JI6 E;  2DMY A;  2EMF A;  2NAB A;  5A6A A;  1N34 E;  1A1I A;  3VHT B;  4ZYG A;  1N33 E;  2L2M A;  1UIL A;  4BC9 A;  2EMC A;  4ZYE A;  2LBS B;  5LL6 R;  1B69 A;  4JI8 E;  1YYK A;  4DUZ E;  2EM4 A;  3KZY A;  2EPX A;  1EH8 A;  2YTE A;  2M9A A;  2ENC A;  2UXC E;  5A6K A;  2PRT A;  2B9D A;  2FGG A;  1XMQ E;  3VYX A;  4DR3 E;  2CTD A;  1EKZ A;  4F6M A;  4X66 E;  2WBT A;  5F3W A;  4O43 A;  2ADR A; 
#chains in the Genus database with same CATH homology
 2YSO A;  1YSA C;  2YSP A;  2EPZ A;  2EMK A;  2ELZ A;  2RPC A;  1MEY C;  1BB8 A;  1NCS A;  1A1F A;  2EMX A;  1JK1 A;  2MKD A;  2EOQ A;  2DLQ A;  3M99 B;  3EPK A;  5KL7 A;  1F2I G;  2EOZ A;  1RMD A;  2YU8 A;  2EOJ A;  1YUI A;  2YTI A;  2EOY A;  2YTN A;  2YRH A;  1X6E A;  2ENA A;  2EL5 A;  1AAY A;  2EPC A;  1A1H A;  1G2F C;  2EOR A;  2EN1 A;  2EM7 A;  2VRD A;  2DRP A;  2EMZ A;  2MKN A;  1ZAA C;  2EMB A;  2EQ3 A;  3EPL A;  3UK3 C;  1P47 A;  2EQ1 A;  2EMG A;  2EPA A;  2LV2 A;  4IJD A;  5KL6 A;  4X9J A;  2EN3 A;  2ENH A;  2EMY A;  2D9H A;  2CT1 A;  2YU5 A;  4R2Q A;  1DGC A;  1G2D C;  2YRK A;  2WCC 3;  2BB8 A;  4GZN C;  2EOE A;  1JK2 A;  1LLM C;  2EMI A;  1UN6 B;  2EMA A;  2E72 A;  2YTJ A;  2EE8 A;  1TN9 A;  2EM8 A;  2WBU A;  3MHH C;  2EM5 A;  4R2C A;  3MHS C;  5KL3 A;  2RSI A;  2J7J A;  1KJK A;  4F2J C;  2EOF A;  2LVH A;  1TF6 A;  2EN8 A;  2EM9 A;  2ELY A;  2EOI A;  2YTG A;  2EOS A;  2YRM A;  5KL5 A;  1A1K A;  1WJP A;  2DMI A;  1ZU1 A;  2EMH A;  2CSH A;  2EPR A;  2HGH A;  1UBD C;  2JP9 A;  4R2P A;  1A1J A;  2YTO A;  2R1F A;  1TF3 A;  2EL4 A;  4R2D A;  2EQ0 A;  2EM6 A;  2I13 A;  2LCE A;  1YUJ A;  1ZR9 A;  2A25 A;  2JPA A;  2EML A;  2EJ4 A;  2EMW A;  2EMF A;  2NAB A;  5KL4 A;  4R2R A;  1Z1B A;  2GHF A;  1A1I A;  3VHT B;  1X6F A;  2EM2 A;  2MDG A;  2YTP A;  4FK5 C;  2DGC A;  2GLI A;  2EOM A;  2EMC A;  4WSG A;  2WBS A;  1B69 A;  4M9V C;  3EPJ A;  2EPU A;  2YTF A;  2EM0 A;  2LT7 A;  4F6N A;  4IS1 C;  2EM4 A;  2YTQ A;  2EL6 A;  2EPX A;  2YTE A;  4R2A A;  2M9A A;  2DLK A;  2EPP A;  2ENC A;  2EN6 A;  1X6H A;  1X5W A;  2EN2 A;  1A1G A;  2PRT A;  2EN4 A;  2EOX A;  4R2S A;  2EP3 A;  2EM3 A;  2LO3 A;  2CTD A;  2EN7 A;  4R2E A;  2YTD A;  5KL2 A;  4F6M A;  2WBT A;  1BBO A;  2EOH A;  2EOO A;  2ADR A;  1X3C A;  3EPH A;  1A1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...