2EL4A

Solution structure of the 15th zf-c2h2 domain from human zinc finger protein 268
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGTGVKPYGCSQCAKTFSLKSQLIVHQRSHTGVKPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the 15th zf-C2H2 domain from human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2el4A00
1P47A 2YSPA 1A1GA 2YTIA 5KL7A 2EP3A 1YSAC 2VRDA 2EM6A 2YTJA 1UN6B 2HGHA 4R2RA 2EM9A 2WBTA 2EMCA 2EM8A 2EPZA 2YTOA 1YUJA 2LO3A 4R2DA 1X5WA 2EN3A 2MKDA 1BB8A 2EOOA 3UK3C 2EL4A 4F2JC 2EQ0A 3EPJA 2EM3A 2EOYA 2CSHA 4R2SA 1LLMC 2EPPA 2EOSA 2EMXA 1JK2A 2I13A 2EORA 1BBOA 1A1HA 3EPLA 2EN4A 2EMYA 2WBSA 2YU5A 2EE8A 2EMIA 2EJ4A 5KL4A 2RPCA 2EPUA 3VHTB 1B69A 2JPAA 1TN9A 2M9AA 2EOJA 2MDGA 4IJDA 2EN1A 2DLQA 2EMZA 1AAYA 2EPCA 3M99B 2YTEA 5KL5A 4WSGA 2ENHA 1A1JA 4FK5C 2DMIA 2WCC3 1ZR9A 1MEYC 2EMAA 2EMKA 2YTNA 2EOQA 2GLIA 2ADRA 1X3CA 2YTPA 1X6FA 2EOMA 2ENCA 1A1IA 2ELZA 2LV2A 2EOHA 5KL3A 2JP9A 2E72A 3MHSC 4R2QA 2WBUA 2YTFA 1F2IG 4M9VC 2LVHA 1A1KA 1UBDC 2DRPA 2EMWA 2EN8A 2EOZA 1JK1A 2EQ1A 2DGCA 1NCSA 3EPKA 2EM4A 1Z1BA 3MHHC 2CT1A 1G2DC 1TF6A 2EPAA 1ZAAC 5KL6A 1RMDA 1G2FC 2EN2A 2EPRA 2EMGA 2ELYA 2YU8A 4R2PA 2EMFA 2EM2A 2ENAA 1TF3A 1WJPA 2YSOA 4F6MA 4F6NA 2EQ3A 2EOEA 2EOFA 2YTDA 1ZU1A 3EPHA 2EL5A 2PRTA 1YUIA 1X6HA 4R2EA 2J7JA 2RSIA 4R2CA 1A1FA 2YTQA 2YRKA 5KL2A 2EM0A 2LT7A 2BB8A 2EMBA 2EMLA 2LCEA 4X9JA 2A25A 2CTDA 2EMHA 2EM7A 2EM5A 2MKNA 2EOXA 2EL6A 4GZNC 2DLKA 1KJKA 2R1FA 1A1LA 4R2AA 2D9HA 4IS1C 1DGCA 2EOIA 2EPXA 2YTGA 2YRHA 2GHFA 2YRMA 1X6EA 2NABA 2EN7A 2EN6A
chains in the Genus database with same CATH superfamily
1P47A 3THNA 4DV5E 3TQMA 4LF4E 3MSWA 1XNRE 1STUA 3THOB 2UUAE 2EM8A 4JV5E 2YTOA 2YWQA 4DR6E 2L2MA 4R2DA 3UK3C 4WPYA 5CFFE 4F2JC 1T38A 2FV4B 5AE1A 2LTRA 4BC9A 5A6AA 2KONA 4R2SA 2CPNA 2EOSA 2EMXA 4MLQA 4NZVA 3J80C 2I13A 1BBOA 2ODRD 2WBSA 3BIDA 2NUFA 2EE8A 2LE2A 4BS9A 3F6HA 2B3TB 3VHTB 1N36E 3VYYA 4LF6E 4RHBB 1SR9A 2DB2A 2NUGA 2V83A 4R8OA 1N32E 1XMOE 2EPCA 4WSGA 4LF7E 2ENHA 4WFTA 1A1JA 2WCC3 2L2NA 4O43A 3HPSA 1J5EE 3ZOQB 5KL3A 4BHCA 2WBUA 1F2IG 3HXLA 1SFEA 4LFAE 1IMUA 2V86A 2HHHE 3EPKA 2EM4A 3MHHC 2V85A 4LFBE 1TF6A 2UUBE 2R76A 4NHRA 2EPAA 1RMDA 2JYAA 4F9AB 2JXPA 2EPRA 4JI5E 2EPNA 4R2PA 4B3RE 2V88A 2VE7C 4Q28A 4F6MA 2LTSA 4F6NA 2JR1A 4LF9E 4JYAE 2MDRA 1QU6A 3EPHA 4DR4E 5IWAE 3L00A 1YUIA 1T4NA 1X6HA 2FTXB 1WHQA 1XNQE 1I94E 2RSIA 3H09A 2YRKA 1PJSA 3QG5C 4WXCA 2BB8A 2EMBA 5A69A 2E1MA 2EM5A 3DJWA 3AV0A 1IQOA 5ADZA 4X64E 4IS1C 1DGCA 2EOIA 4AQYE 2YTGA 5AC4A 3HTXA 2YSPA 1A1GA 2N3GA 2YTIA 5KL7A 1NEIA 3JU0A 2ODRC 2EM6A 1PKPA 2MC6A 2EPLX 2YTJA 1X49A 2HGHA 4WSPA 3ADGA 1T39A 2ZM6E 4BBYA 2JOXA 3JAMC 1YUJA 4DV7E 1BB8A 2EOOA 1EH8A 4M30A 2EL4A 1N3GA 4I8OA 3EPJA 2K7IA 2EOYA 3EQ1A 4JI3E 1AH5A 1X47A 2EPPA 2JWOA 5AE3A 3HQ1A 3EPLA 1T4OA 4Q35B 2B7TA 4JI2E 4JI6E 2EJ4A 2RPCA 2EPUA 4X66E 4NXNE 3VYXA 1XMQE 1RQ0A 4DR5E 5A6BD 4FK5C 1ZR9A 2ADRA 2JY9A 1X3CA 2EPMX 2YTPA 4DMIA 2G7HA 5A6BA 3MHSC 4M2ZA 2GPIA 1FJGE 2N8XA 4ZYEA 1A1KA 4DR1E 3T1YE 4JI4E 2DRPA 2EN8A 1GQEA 2DGCA 1NCSA 4DV1E 1Z1BA 4LFCE 3KZZA 1N34E 5KL6A 4JI0E 2LJUA 1DQ3A 2EN2A 3DF6A 2ELYA 2RQLA 4OX9E 2EMFA 3JTZA 1HNXE 2LRSA 1WJPA 2YSOA 4RH8A 4DV0E 4O5GA 2V89A 2EQ3A 4LTYA 4B3SE 4B3ME 2PRTA 1PDAA 4ZYDA 2N3HA 5A6KA 2YTQA 2M7QA 2EM0A 5LL6R 2KHXA 2EMLA 5IT9C 4BHBA 3T1HE 2JVAA 3C6MA 2MKNA 1HNWE 1RC7A 1MGTA 2L8TA 2L3JA 4DUYE 2YRHA 3J81C 1FKAE 4B3TE 2EN7A 1J26A 2E5LE 1YSAC 4DR7E 1KYQA 2VRDA 1HNZE 4BC7A 1UN6B 4R2RA 2EM9A 2UUCE 2WBTA 4KWYA 4DV4E 4DR2E 5BR8E 2F8BA 2EM3A 1ZBTA 1GTKA 4HEIA 3ADJA 1LLMC 1JK2A 2DSYA 4TUGA 4TUIA 4LF5E 1EH6A 2EN4A 2H36X 2EMYA 3OTOE 4DV3E 5TSEA 4LU9A 3IWDA 5KL4A 4F54A 3KWRA 5IXMB 2JPAA 1TN9A 2M9AA 2LMZA 2EOJA 3IWCA 5A2QC 2MDGA 4KHPE 2UXBE 2DLQA 1AAYA 3M99B 2WZOA 2RTXA 5KL5A 3RMPA 1O0WA 2IHR1 2L33A 1EKZA 4GEQB 4BCAA 3ADLA 1X6FA 4P78A 2EOMA 2ENCA 1A1IA 2ELZA 1YYKA 2EOHA 4P7DA 2JP9A 2E72A 4R2QA 1IBKE 2YTFA 1WHNA 1UBDC 1JK1A 2EQ1A 4LF8E 1X48A 2CT1A 1YPNA 2JOBA 1L4SA 3C4TA 4HTGA 4F9BB 5AE2A 2EMGA 2L6MA 2YU8A 2ENAA 2EM2A 1TF3A 1GZ6A 2M4IA 2UXCE 3LMLA 4N4RB 2EZ6A 2EOEA 2EOFA 4R03A 4JI1E 1YFHA 2L3CA 4WX9A 2L92A 4R2CA 1A1FA 5KL2A 4O4KA 2LT7A 5T6JA 1PJQA 3F6GA 2HJJA 2LUPB 4X9JA 2A25A 1QNTA 2EMHA 2YZTA 2EOXA 2EL6A 2DLKA 2VQFE 2RSMA 4X65E 1KJKA 2R1FA 2Q8UA 2D9HA 4R2AA 4BMJA 5DNYA 2YRMA 1X6EA 2NABA 2FGGA 4ZYGA 1BBGA 2RS6A 2EP3A 1DI2A 2EMCA 3KZYA 3C6KA 2EPZA 3AUZA 4YHHE 5LMNE 4DV6E 2EN6A 5A6JA 1X5WA 2BBGA 2EN3A 2MKDA 3BF2A 2EQ0A 4ZYHA 2B9DA 4KZSA 2VF1A 4L8NA 2CSHA 4GKJE 2YT4A 3IWBA 2LJHA 2NA2A 2EORA 1A1HA 3HPZA 2I9IA 2YU5A 3BBGA 5AC5A 2K4VA 3J7AG 2EMIA 1EH7A 4K0KE 1B69A 1YZ9A 1YYWA 4O24A 4IJDA 2EN1A 1IQSA 2EMZA 2L2KB 2LBSB 2V87A 2B7VA 2YTEA 4DV2E 1T4LB 4WYQB 1ZBQA 2DIXA 2DMIA 1MEYC 2VQEE 2EMAA 3FIGA 2EMKA 2YTNA 2EOQA 5AASA 1HR0E 2GLIA 2M1SA 5F3WA 4GKKE 4X8WA 3VK6A 2LV2A 3ECRA 1UILA 4M0VA 5LMUE 4M9VC 2LVHA 2F4VE 2EPOA 4JI8E 4J8ZA 2EMWA 2EOZA 4OOGC 1WXRA 4DUZE 1G2DC 1N33E 2HC5A 1ZAAC 1G2FC 1PJTA 1WRJA 3J7Yp 4X62E 3K6QA 4MLVA 4JI7E 3LLHA 5FLXC 4WXDA 3C4BA 3OMLA 1IBME 4NXME 1YYOA 2YPNA 2YTDA 1ZU1A 2EL5A 2MC5A 3BGHA 2DMYA 4R2EA 1IBLE 2EPKX 2J7JA 2KOUA 2RS7A 5LLQA 4DKKA 3P1XA 4F9CB 2NUEA 5IV8B 2LCEA 2UU9E 2CTDA 2UXDE 4L5NC 2EM7A 3ADIA 4GZNC 4DR3E 2LUQA 2V8QB 1A1LA 4YY3E 2EPXA 1UHZA 2EWLA 2GHFA 2LO3A
chains in the Genus database with same CATH topology
1P47A 2YSPA 1A1GA 2YTIA 5KL7A 2EP3A 1YSAC 2VRDA 2EM6A 2YTJA 1UN6B 2HGHA 4R2RA 2EM9A 2WBTA 2EMCA 2EM8A 2EPZA 2YTOA 1YUJA 2LO3A 4R2DA 1X5WA 2EN3A 2MKDA 1BB8A 2EOOA 3UK3C 2EL4A 4F2JC 2EQ0A 3EPJA 2EM3A 2EOYA 2CSHA 4R2SA 1LLMC 2EPPA 2EOSA 2EMXA 1JK2A 2I13A 2EORA 1BBOA 1A1HA 3EPLA 2EN4A 2EMYA 2WBSA 2YU5A 2EE8A 2EMIA 2EJ4A 5KL4A 2RPCA 2EPUA 3VHTB 1B69A 2JPAA 1TN9A 2M9AA 2EOJA 2MDGA 4IJDA 2EN1A 2DLQA 2EMZA 1AAYA 2EPCA 3M99B 2YTEA 5KL5A 4WSGA 2ENHA 1A1JA 4FK5C 2DMIA 2WCC3 1ZR9A 1MEYC 2EMAA 2EMKA 2YTNA 2EOQA 2GLIA 2ADRA 1X3CA 2YTPA 1X6FA 2EOMA 2ENCA 1A1IA 2ELZA 2LV2A 2EOHA 5KL3A 2JP9A 2E72A 3MHSC 4R2QA 2WBUA 2YTFA 1F2IG 4M9VC 2LVHA 1A1KA 1UBDC 2DRPA 2EMWA 2EN8A 2EOZA 1JK1A 2EQ1A 2DGCA 1NCSA 3EPKA 2EM4A 1Z1BA 3MHHC 2CT1A 1G2DC 1TF6A 2EPAA 1ZAAC 5KL6A 1RMDA 1G2FC 2EN2A 2EPRA 2EMGA 2ELYA 2YU8A 4R2PA 2EMFA 2EM2A 2ENAA 1TF3A 1WJPA 2YSOA 4F6MA 4F6NA 2EQ3A 2EOEA 2EOFA 2YTDA 1ZU1A 3EPHA 2EL5A 2PRTA 1YUIA 1X6HA 4R2EA 2J7JA 2RSIA 4R2CA 1A1FA 2YTQA 2YRKA 5KL2A 2EM0A 2LT7A 2BB8A 2EMBA 2EMLA 2LCEA 4X9JA 2A25A 2CTDA 2EMHA 2EM7A 2EM5A 2MKNA 2EOXA 2EL6A 4GZNC 2DLKA 1KJKA 2R1FA 1A1LA 4R2AA 2D9HA 4IS1C 1DGCA 2EOIA 2EPXA 2YTGA 2YRHA 2GHFA 2YRMA 1X6EA 2NABA 2EN7A 2EN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P47 A;  2YSP A;  1A1G A;  2YTI A;  5KL7 A;  2EP3 A;  1YSA C;  2VRD A;  2EM6 A;  2YTJ A;  1UN6 B;  2HGH A;  4R2R A;  2EM9 A;  2WBT A;  2EMC A;  2EM8 A;  2EPZ A;  2YTO A;  1YUJ A;  2LO3 A;  4R2D A;  1X5W A;  2EN3 A;  2MKD A;  1BB8 A;  2EOO A;  3UK3 C;  2EL4 A;  4F2J C;  2EQ0 A;  3EPJ A;  2EM3 A;  2EOY A;  2CSH A;  4R2S A;  1LLM C;  2EPP A;  2EOS A;  2EMX A;  1JK2 A;  2I13 A;  2EOR A;  1BBO A;  1A1H A;  3EPL A;  2EN4 A;  2EMY A;  2WBS A;  2YU5 A;  2EE8 A;  2EMI A;  2EJ4 A;  5KL4 A;  2RPC A;  2EPU A;  3VHT B;  1B69 A;  2JPA A;  1TN9 A;  2M9A A;  2EOJ A;  2MDG A;  4IJD A;  2EN1 A;  2DLQ A;  2EMZ A;  1AAY A;  2EPC A;  3M99 B;  2YTE A;  5KL5 A;  4WSG A;  2ENH A;  1A1J A;  4FK5 C;  2DMI A;  2WCC 3;  1ZR9 A;  1MEY C;  2EMA A;  2EMK A;  2YTN A;  2EOQ A;  2GLI A;  2ADR A;  1X3C A;  2YTP A;  1X6F A;  2EOM A;  2ENC A;  1A1I A;  2ELZ A;  2LV2 A;  2EOH A;  5KL3 A;  2JP9 A;  2E72 A;  3MHS C;  4R2Q A;  2WBU A;  2YTF A;  1F2I G;  4M9V C;  2LVH A;  1A1K A;  1UBD C;  2DRP A;  2EMW A;  2EN8 A;  2EOZ A;  1JK1 A;  2EQ1 A;  2DGC A;  1NCS A;  3EPK A;  2EM4 A;  1Z1B A;  3MHH C;  2CT1 A;  1G2D C;  1TF6 A;  2EPA A;  1ZAA C;  5KL6 A;  1RMD A;  1G2F C;  2EN2 A;  2EPR A;  2EMG A;  2ELY A;  2YU8 A;  4R2P A;  2EMF A;  2EM2 A;  2ENA A;  1TF3 A;  1WJP A;  2YSO A;  4F6M A;  4F6N A;  2EQ3 A;  2EOE A;  2EOF A;  2YTD A;  1ZU1 A;  3EPH A;  2EL5 A;  2PRT A;  1YUI A;  1X6H A;  4R2E A;  2J7J A;  2RSI A;  4R2C A;  1A1F A;  2YTQ A;  2YRK A;  5KL2 A;  2EM0 A;  2LT7 A;  2BB8 A;  2EMB A;  2EML A;  2LCE A;  4X9J A;  2A25 A;  2CTD A;  2EMH A;  2EM7 A;  2EM5 A;  2MKN A;  2EOX A;  2EL6 A;  4GZN C;  2DLK A;  1KJK A;  2R1F A;  1A1L A;  4R2A A;  2D9H A;  4IS1 C;  1DGC A;  2EOI A;  2EPX A;  2YTG A;  2YRH A;  2GHF A;  2YRM A;  1X6E A;  2NAB A;  2EN7 A;  2EN6 A; 
#chains in the Genus database with same CATH topology
 1P47 A;  3THN A;  4DV5 E;  3TQM A;  4LF4 E;  3MSW A;  1XNR E;  1STU A;  3THO B;  2UUA E;  2EM8 A;  4JV5 E;  2YTO A;  2YWQ A;  4DR6 E;  2L2M A;  4R2D A;  3UK3 C;  4WPY A;  5CFF E;  4F2J C;  1T38 A;  2FV4 B;  5AE1 A;  2LTR A;  4BC9 A;  5A6A A;  2KON A;  4R2S A;  2CPN A;  2EOS A;  2EMX A;  4MLQ A;  4NZV A;  3J80 C;  2I13 A;  1BBO A;  2ODR D;  2WBS A;  3BID A;  2NUF A;  2EE8 A;  2LE2 A;  4BS9 A;  3F6H A;  2B3T B;  3VHT B;  1N36 E;  3VYY A;  4LF6 E;  4RHB B;  1SR9 A;  2DB2 A;  2NUG A;  2V83 A;  4R8O A;  1N32 E;  1XMO E;  2EPC A;  4WSG A;  4LF7 E;  2ENH A;  4WFT A;  1A1J A;  2WCC 3;  2L2N A;  4O43 A;  3HPS A;  1J5E E;  3ZOQ B;  5KL3 A;  4BHC A;  2WBU A;  1F2I G;  3HXL A;  1SFE A;  4LFA E;  1IMU A;  2V86 A;  2HHH E;  3EPK A;  2EM4 A;  3MHH C;  2V85 A;  4LFB E;  1TF6 A;  2UUB E;  2R76 A;  4NHR A;  2EPA A;  1RMD A;  2JYA A;  4F9A B;  2JXP A;  2EPR A;  4JI5 E;  2EPN A;  4R2P A;  4B3R E;  2V88 A;  2VE7 C;  4Q28 A;  4F6M A;  2LTS A;  4F6N A;  2JR1 A;  4LF9 E;  4JYA E;  2MDR A;  1QU6 A;  3EPH A;  4DR4 E;  5IWA E;  3L00 A;  1YUI A;  1T4N A;  1X6H A;  2FTX B;  1WHQ A;  1XNQ E;  1I94 E;  2RSI A;  3H09 A;  2YRK A;  1PJS A;  3QG5 C;  4WXC A;  2BB8 A;  2EMB A;  5A69 A;  2E1M A;  2EM5 A;  3DJW A;  3AV0 A;  1IQO A;  5ADZ A;  4X64 E;  4IS1 C;  1DGC A;  2EOI A;  4AQY E;  2YTG A;  5AC4 A;  3HTX A;  2YSP A;  1A1G A;  2N3G A;  2YTI A;  5KL7 A;  1NEI A;  3JU0 A;  2ODR C;  2EM6 A;  1PKP A;  2MC6 A;  2EPL X;  2YTJ A;  1X49 A;  2HGH A;  4WSP A;  3ADG A;  1T39 A;  2ZM6 E;  4BBY A;  2JOX A;  3JAM C;  1YUJ A;  4DV7 E;  1BB8 A;  2EOO A;  1EH8 A;  4M30 A;  2EL4 A;  1N3G A;  4I8O A;  3EPJ A;  2K7I A;  2EOY A;  3EQ1 A;  4JI3 E;  1AH5 A;  1X47 A;  2EPP A;  2JWO A;  5AE3 A;  3HQ1 A;  3EPL A;  1T4O A;  4Q35 B;  2B7T A;  4JI2 E;  4JI6 E;  2EJ4 A;  2RPC A;  2EPU A;  4X66 E;  4NXN E;  3VYX A;  1XMQ E;  1RQ0 A;  4DR5 E;  5A6B D;  4FK5 C;  1ZR9 A;  2ADR A;  2JY9 A;  1X3C A;  2EPM X;  2YTP A;  4DMI A;  2G7H A;  5A6B A;  3MHS C;  4M2Z A;  2GPI A;  1FJG E;  2N8X A;  4ZYE A;  1A1K A;  4DR1 E;  3T1Y E;  4JI4 E;  2DRP A;  2EN8 A;  1GQE A;  2DGC A;  1NCS A;  4DV1 E;  1Z1B A;  4LFC E;  3KZZ A;  1N34 E;  5KL6 A;  4JI0 E;  2LJU A;  1DQ3 A;  2EN2 A;  3DF6 A;  2ELY A;  2RQL A;  4OX9 E;  2EMF A;  3JTZ A;  1HNX E;  2LRS A;  1WJP A;  2YSO A;  4RH8 A;  4DV0 E;  4O5G A;  2V89 A;  2EQ3 A;  4LTY A;  4B3S E;  4B3M E;  2PRT A;  1PDA A;  4ZYD A;  2N3H A;  5A6K A;  2YTQ A;  2M7Q A;  2EM0 A;  5LL6 R;  2KHX A;  2EML A;  5IT9 C;  4BHB A;  3T1H E;  2JVA A;  3C6M A;  2MKN A;  1HNW E;  1RC7 A;  1MGT A;  2L8T A;  2L3J A;  4DUY E;  2YRH A;  3J81 C;  1FKA E;  4B3T E;  2EN7 A;  1J26 A;  2E5L E;  1YSA C;  4DR7 E;  1KYQ A;  2VRD A;  1HNZ E;  4BC7 A;  1UN6 B;  4R2R A;  2EM9 A;  2UUC E;  2WBT A;  4KWY A;  4DV4 E;  4DR2 E;  5BR8 E;  2F8B A;  2EM3 A;  1ZBT A;  1GTK A;  4HEI A;  3ADJ A;  1LLM C;  1JK2 A;  2DSY A;  4TUG A;  4TUI A;  4LF5 E;  1EH6 A;  2EN4 A;  2H36 X;  2EMY A;  3OTO E;  4DV3 E;  5TSE A;  4LU9 A;  3IWD A;  5KL4 A;  4F54 A;  3KWR A;  5IXM B;  2JPA A;  1TN9 A;  2M9A A;  2LMZ A;  2EOJ A;  3IWC A;  5A2Q C;  2MDG A;  4KHP E;  2UXB E;  2DLQ A;  1AAY A;  3M99 B;  2WZO A;  2RTX A;  5KL5 A;  3RMP A;  1O0W A;  2IHR 1;  2L33 A;  1EKZ A;  4GEQ B;  4BCA A;  3ADL A;  1X6F A;  4P78 A;  2EOM A;  2ENC A;  1A1I A;  2ELZ A;  1YYK A;  2EOH A;  4P7D A;  2JP9 A;  2E72 A;  4R2Q A;  1IBK E;  2YTF A;  1WHN A;  1UBD C;  1JK1 A;  2EQ1 A;  4LF8 E;  1X48 A;  2CT1 A;  1YPN A;  2JOB A;  1L4S A;  3C4T A;  4HTG A;  4F9B B;  5AE2 A;  2EMG A;  2L6M A;  2YU8 A;  2ENA A;  2EM2 A;  1TF3 A;  1GZ6 A;  2M4I A;  2UXC E;  3LML A;  4N4R B;  2EZ6 A;  2EOE A;  2EOF A;  4R03 A;  4JI1 E;  1YFH A;  2L3C A;  4WX9 A;  2L92 A;  4R2C A;  1A1F A;  5KL2 A;  4O4K A;  2LT7 A;  5T6J A;  1PJQ A;  3F6G A;  2HJJ A;  2LUP B;  4X9J A;  2A25 A;  1QNT A;  2EMH A;  2YZT A;  2EOX A;  2EL6 A;  2DLK A;  2VQF E;  2RSM A;  4X65 E;  1KJK A;  2R1F A;  2Q8U A;  2D9H A;  4R2A A;  4BMJ A;  5DNY A;  2YRM A;  1X6E A;  2NAB A;  2FGG A;  4ZYG A;  1BBG A;  2RS6 A;  2EP3 A;  1DI2 A;  2EMC A;  3KZY A;  3C6K A;  2EPZ A;  3AUZ A;  4YHH E;  5LMN E;  4DV6 E;  2EN6 A;  5A6J A;  1X5W A;  2BBG A;  2EN3 A;  2MKD A;  3BF2 A;  2EQ0 A;  4ZYH A;  2B9D A;  4KZS A;  2VF1 A;  4L8N A;  2CSH A;  4GKJ E;  2YT4 A;  3IWB A;  2LJH A;  2NA2 A;  2EOR A;  1A1H A;  3HPZ A;  2I9I A;  2YU5 A;  3BBG A;  5AC5 A;  2K4V A;  3J7A G;  2EMI A;  1EH7 A;  4K0K E;  1B69 A;  1YZ9 A;  1YYW A;  4O24 A;  4IJD A;  2EN1 A;  1IQS A;  2EMZ A;  2L2K B;  2LBS B;  2V87 A;  2B7V A;  2YTE A;  4DV2 E;  1T4L B;  4WYQ B;  1ZBQ A;  2DIX A;  2DMI A;  1MEY C;  2VQE E;  2EMA A;  3FIG A;  2EMK A;  2YTN A;  2EOQ A;  5AAS A;  1HR0 E;  2GLI A;  2M1S A;  5F3W A;  4GKK E;  4X8W A;  3VK6 A;  2LV2 A;  3ECR A;  1UIL A;  4M0V A;  5LMU E;  4M9V C;  2LVH A;  2F4V E;  2EPO A;  4JI8 E;  4J8Z A;  2EMW A;  2EOZ A;  4OOG C;  1WXR A;  4DUZ E;  1G2D C;  1N33 E;  2HC5 A;  1ZAA C;  1G2F C;  1PJT A;  1WRJ A;  3J7Y p;  4X62 E;  3K6Q A;  4MLV A;  4JI7 E;  3LLH A;  5FLX C;  4WXD A;  3C4B A;  3OML A;  1IBM E;  4NXM E;  1YYO A;  2YPN A;  2YTD A;  1ZU1 A;  2EL5 A;  2MC5 A;  3BGH A;  2DMY A;  4R2E A;  1IBL E;  2EPK X;  2J7J A;  2KOU A;  2RS7 A;  5LLQ A;  4DKK A;  3P1X A;  4F9C B;  2NUE A;  5IV8 B;  2LCE A;  2UU9 E;  2CTD A;  2UXD E;  4L5N C;  2EM7 A;  3ADI A;  4GZN C;  4DR3 E;  2LUQ A;  2V8Q B;  1A1L A;  4YY3 E;  2EPX A;  1UHZ A;  2EWL A;  2GHF A;  2LO3 A; 
#chains in the Genus database with same CATH homology
 1P47 A;  2YSP A;  1A1G A;  2YTI A;  5KL7 A;  2EP3 A;  1YSA C;  2VRD A;  2EM6 A;  2YTJ A;  1UN6 B;  2HGH A;  4R2R A;  2EM9 A;  2WBT A;  2EMC A;  2EM8 A;  2EPZ A;  2YTO A;  1YUJ A;  2LO3 A;  4R2D A;  1X5W A;  2EN3 A;  2MKD A;  1BB8 A;  2EOO A;  3UK3 C;  2EL4 A;  4F2J C;  2EQ0 A;  3EPJ A;  2EM3 A;  2EOY A;  2CSH A;  4R2S A;  1LLM C;  2EPP A;  2EOS A;  2EMX A;  1JK2 A;  2I13 A;  2EOR A;  1BBO A;  1A1H A;  3EPL A;  2EN4 A;  2EMY A;  2WBS A;  2YU5 A;  2EE8 A;  2EMI A;  2EJ4 A;  5KL4 A;  2RPC A;  2EPU A;  3VHT B;  1B69 A;  2JPA A;  1TN9 A;  2M9A A;  2EOJ A;  2MDG A;  4IJD A;  2EN1 A;  2DLQ A;  2EMZ A;  1AAY A;  2EPC A;  3M99 B;  2YTE A;  5KL5 A;  4WSG A;  2ENH A;  1A1J A;  4FK5 C;  2DMI A;  2WCC 3;  1ZR9 A;  1MEY C;  2EMA A;  2EMK A;  2YTN A;  2EOQ A;  2GLI A;  2ADR A;  1X3C A;  2YTP A;  1X6F A;  2EOM A;  2ENC A;  1A1I A;  2ELZ A;  2LV2 A;  2EOH A;  5KL3 A;  2JP9 A;  2E72 A;  3MHS C;  4R2Q A;  2WBU A;  2YTF A;  1F2I G;  4M9V C;  2LVH A;  1A1K A;  1UBD C;  2DRP A;  2EMW A;  2EN8 A;  2EOZ A;  1JK1 A;  2EQ1 A;  2DGC A;  1NCS A;  3EPK A;  2EM4 A;  1Z1B A;  3MHH C;  2CT1 A;  1G2D C;  1TF6 A;  2EPA A;  1ZAA C;  5KL6 A;  1RMD A;  1G2F C;  2EN2 A;  2EPR A;  2EMG A;  2ELY A;  2YU8 A;  4R2P A;  2EMF A;  2EM2 A;  2ENA A;  1TF3 A;  1WJP A;  2YSO A;  4F6M A;  4F6N A;  2EQ3 A;  2EOE A;  2EOF A;  2YTD A;  1ZU1 A;  3EPH A;  2EL5 A;  2PRT A;  1YUI A;  1X6H A;  4R2E A;  2J7J A;  2RSI A;  4R2C A;  1A1F A;  2YTQ A;  2YRK A;  5KL2 A;  2EM0 A;  2LT7 A;  2BB8 A;  2EMB A;  2EML A;  2LCE A;  4X9J A;  2A25 A;  2CTD A;  2EMH A;  2EM7 A;  2EM5 A;  2MKN A;  2EOX A;  2EL6 A;  4GZN C;  2DLK A;  1KJK A;  2R1F A;  1A1L A;  4R2A A;  2D9H A;  4IS1 C;  1DGC A;  2EOI A;  2EPX A;  2YTG A;  2YRH A;  2GHF A;  2YRM A;  1X6E A;  2NAB A;  2EN7 A;  2EN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...