2EL4A

Solution structure of the 15th zf-c2h2 domain from human zinc finger protein 268
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGVKPYGCSQCAKTFSLKSQLIVHQRSHTGVKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the 15th zf-C2H2 domain from human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2el4A00
2EMIA 1X5WA 2DMIA 2EN1A 2YTJA 2YTFA 2EL4A 1TF3A 2YTNA 2EMCA 1G2FC 4R2AA 2EMWA 2EMZA 2CSHA 1X6EA 1YUIA 1P47A 2EM4A 2ENAA 3EPKA 2YRKA 3M99B 4F6NA 1TN9A 1A1JA 2EN4A 3EPHA 2RSIA 2NABA 1A1FA 2EORA 4R2EA 2GLIA 2CT1A 2ELZA 2YSOA 4F6MA 2YTPA 5KL7A 2LT7A 2HGHA 2EM9A 1Z1BA 2EM0A 2EOZA 2EM7A 1YUJA 2EJ4A 2EN3A 2EMFA 2YRMA 1BBOA 2YSPA 3EPJA 2YTIA 2EOOA 2YTDA 1G2DC 2EPCA 2EPRA 1MEYC 2EOXA 2YTQA 1X6HA 1RMDA 1KJKA 2JPAA 2EOSA 1BB8A 1F2IG 2EPPA 4X9JA 2R1FA 4WSGA 2EOHA 2EPXA 1JK2A 2GHFA 2YTOA 2WBUA 3MHHC 2DGCA 2EPAA 2EMGA 2ENCA 5KL5A 2EOYA 2EL5A 4M9VC 2ELYA 2EN6A 5KL3A 2EN7A 4R2RA 2WCC3 2LVHA 1NCSA 2EMHA 2M9AA 1DGCA 1YSAC 2PRTA 2EOIA 2EQ3A 2VRDA 2EOEA 4R2CA 2EL6A 1JK1A 2EMYA 2RPCA 2EM5A 2E72A 2WBTA 2YTEA 4R2SA 5KL6A 1A1LA 2A25A 2EMXA 3UK3C 1X3CA 3MHSC 2DLQA 2YTGA 2EM3A 2ENHA 2EM2A 2EQ0A 2EN2A 2EOMA 1ZU1A 1A1GA 4GZNC 1UN6B 2EM6A 3VHTB 1X6FA 1UBDC 2EM8A 1WJPA 2I13A 1A1KA 2EE8A 2YRHA 2EMAA 1TF6A 1ZAAC 5KL2A 2WBSA 5KL4A 2EPZA 2DLKA 3EPLA 2CTDA 2EP3A 2EQ1A 2EN8A 2EOFA 2MDGA 2ADRA 2YU8A 4FK5C 2DRPA 2EOQA 2YU5A 2LO3A 4R2DA 2JP9A 2LCEA 2LV2A 1ZR9A 2EMLA 1A1HA 1LLMC 2EOJA 4IS1C 2EPUA 4IJDA 2BB8A 2D9HA 1AAYA 4R2PA 2MKDA 1A1IA 2MKNA 2J7JA 1B69A 4F2JC 2EMBA 2EMKA 4R2QA
chains in the Genus database with same CATH superfamily
1X5WA 3H09A 2V86A 5LMNE 4LF7E 3JTZA 1YYKA 1GQEA 2KOUA 1G2FC 2RS7A 4NXME 2EMWA 4YHHE 2CPNA 1IQOA 2UUAE 1X6EA 3EPKA 2YRKA 5LLQA 1TN9A 2UXCE 1A1JA 2V88A 5T6JA 1HNZE 2HGHA 2CT1A 2ELZA 4F6MA 5KL7A 2R76A 1EH7A 2EM9A 1I94E 1KYQA 3J81C 2L92A 3BIDA 2E5LE 2YRMA 1BBOA 2RTXA 2VQFE 4DV4E 2EPRA 1AH5A 2YTQA 4DV7E 2ZM6E 4LF9E 2ODRC 5DNYA 1RC7A 1QU6A 1WHNA 2EPPA 2EWLA 4F9CB 1X47A 2EPXA 1JK2A 2RS6A 4NXNE 4DUZE 3MHHC 2DGCA 3THNA 1HNXE 2EOYA 4J8ZA 3HPZA 5IV8B 4RH8A 2EMHA 2M9AA 1DGCA 4F54A 3ADIA 2EQ3A 4KWYA 2EOEA 2JWOA 2EL6A 3KZZA 2EMYA 2MC5A 4M2ZA 5KL6A 4OOGC 4GEQB 2L33A 3THOB 2EMXA 3MSWA 3AV0A 1EH6A 3MHSC 1STUA 2ENHA 1J5EE 1T4LB 4JV5E 4OX9E 4KHPE 4NHRA 1X6FA 2I13A 1TF6A 3IWBA 2UU9E 3ZOQB 5KL4A 1PJTA 3DJWA 2EPZA 3EPLA 4JI2E 2VQEE 3J80C 5IT9C 1PJSA 2E1MA 1X49A 2EN8A 2ADRA 1XMQE 2EOQA 4X64E 2JP9A 1ZR9A 5IWAE 2EOJA 4IS1C 2RQLA 2BB8A 2KONA 2D9HA 4NZVA 2M4IA 2DSYA 2MKDA 2LE2A 2V83A 1QNTA 4X66E 2V89A 2EMBA 4DV3E 2EMIA 3T1YE 2EN1A 1IBME 1FKAE 1L4SA 2EL4A 2EMCA 4DV1E 2CSHA 4BC7A 2L8TA 2ENAA 1N34E 2BBGA 5LL6R 2JXPA 2JOBA 2V85A 2EORA 4KZSA 1GTKA 2B3TB 3HQ1A 2YSOA 2LT7A 2IHR1 4JI7E 4BHCA 1EH8A 3IWCA 2EOZA 2EM7A 2WZOA 2EMFA 3RMPA 3LMLA 2YTIA 2YTDA 1G2DC 4DR1E 1N32E 4X62E 2EOXA 1X6HA 2FGGA 5A6AA 4JI1E 1BB8A 2UXBE 4BBYA 1HNWE 2EOHA 1N36E 3J7AG 2UXDE 1PJQA 2GHFA 2YTOA 4DMIA 2EPAA 4JI4E 2NA2A 2YT4A 2L2KB 2MC6A 3VYXA 3JAMC 2YPNA 2ELYA 1IQSA 2EN6A 4WFTA 2N3HA 2EPMX 2K4VA 4R2CA 5LMUE 1JK1A 2EM5A 2E72A 4B3ME 1A1LA 3L00A 1GZ6A 4WX9A 4RHBB 1A1GA 1YYOA 4GZNC 2RSMA 1UN6B 5F3WA 2EM8A 1A1KA 3IWDA 2EE8A 2YRHA 2EMAA 4DR5E 2NUGA 4Q28A 4YY3E 2UUCE 2EQ1A 2YWQA 2YU8A 4O5GA 4R03A 3T1HE 2YU5A 1XNQE 4R2DA 1T39A 2LV2A 4P78A 2EPNA 4X65E 1YPNA 2L6MA 2LJUA 1N33E 2M7QA 2J7JA 5CFFE 2L3JA 2VF1A 4JI5E 4ZYDA 2EMKA 4GKKE 3FIGA 4R2QA 2DMIA 1DQ3A 2JVAA 2LTSA 1TF3A 2YTNA 1DI2A 4AQYE 1FJGE 4B3SE 4WXCA 4DR3E 4BHBA 1P47A 2EM4A 2EN4A 1IMUA 1A1FA 4R2EA 2H36X 2YTPA 5FLXC 2EM0A 5TSEA 2VE7C 2B7VA 4DV0E 4JI6E 1X48A 3C4BA 2YSPA 3EPJA 3TQMA 5AE1A 4DUYE 1MEYC 2EPCA 4BCAA 2MDRA 1RMDA 2JY9A 3F6HA 2EOSA 4WXDA 2HHHE 1F2IG 1PDAA 4X9JA 5AE3A 3AUZA 4ZYEA 4K0KE 2R1FA 4O43A 4GKJE 2UUBE 4LF8E 3QG5C 3DF6A 1SR9A 3C6KA 4HEIA 4N4RB 5KL5A 2B7TA 2LBSB 4LF5E 4ZYGA 2EL5A 1WXRA 4M9VC 2WCC3 4DR4E 5KL3A 2EN7A 4R2RA 5A6KA 2DIXA 2LJHA 4X8WA 2EPLX 2LVHA 4L5NC 1NCSA 2I9IA 1YSAC 2PRTA 2EOIA 2JOXA 2VRDA 4P7DA 1EKZA 1T38A 4WPYA 1UILA 2RPCA 2WBTA 2YTEA 4F9AB 3UK3C 2K7IA 2DLQA 4I8OA 1XMOE 2EM2A 1WHQA 2EQ0A 4DR7E 2EOMA 2V87A 1ZU1A 4LFAE 4LTYA 2B9DA 2NUEA 2EM6A 2LUPB 1UBDC 1WJPA 2YZTA 4R8OA 2L2NA 1ZAAC 5KL2A 2WBSA 4ZYHA 2G7HA 4LF4E 2N8XA 5AC4A 3ADJA 2HC5A 4LF6E 4DKKA 2CTDA 2EP3A 2MDGA 3KWRA 4Q35B 3ECRA 4FK5C 2LO3A 2LRSA 2LCEA 2EMLA 4JI8E 1LLMC 1NEIA 1A1HA 3C6MA 2V8QB 5AE2A 3HTXA 3VK6A 1WRJA 5A6BA 1SFEA 2L2MA 1AAYA 5AASA 4LFBE 1T4OA 4DV2E 3ADGA 3VYYA 2DB2A 4DV6E 1T4NA 2YTJA 2YTFA 4M0VA 4M30A 2GPIA 4F9BB 2FTXB 4R2AA 2EMZA 4BC9A 2L3CA 5BR8E 5A69A 1YUIA 4O4KA 3J7Yp 3M99B 4F6NA 1IBLE 2EZ6A 3ADLA 4DV5E 3EPHA 2RSIA 2NABA 2M1SA 2GLIA 2DMYA 4BMJA 4LFCE 1Z1BA 5A6JA 4JI0E 5A2QC 2NUFA 1YUJA 3C4TA 2EJ4A 2EN3A 2ODRD 1YZ9A 4JYAE 4BS9A 2EOOA 3BF2A 2F8BA 1KJKA 4MLVA 2JPAA 2N3GA 2JYAA 2FV4B 4WSGA 4B3TE 4LU9A 1MGTA 3OTOE 2LUQA 2WBUA 2KHXA 4DR6E 2EMGA 2ENCA 3LLHA 3BGHA 4O24A 5ADZA 1YFHA 4WSPA 3JU0A 3KZYA 2Q8UA 3HPSA 1J26A 1RQ0A 3P1XA 4MLQA 1PKPA 4R2SA 2HJJA 2EPKX 2A25A 1IBKE 1O0WA 1X3CA 3EQ1A 1ZBQA 3HXLA 2YTGA 2EM3A 2EN2A 4DR2E 3K6QA 3VHTB 4WYQB 1UHZA 1ZBTA 4JI3E 2LTRA 4HTGA 2DLKA 4TUGA 2EOFA 1N3GA 3OMLA 4L8NA 5AC5A 2DRPA 3F6GA 2LMZA 4TUIA 2EPUA 4IJDA 5A6BD 5IXMB 4R2PA 1HR0E 4B3RE 2JR1A 2F4VE 1A1IA 1BBGA 2MKNA 2EPOA 1XNRE 3BBGA 1B69A 4F2JC 1YYWA
chains in the Genus database with same CATH topology
2EMIA 1X5WA 2DMIA 2EN1A 2YTJA 2YTFA 2EL4A 1TF3A 2YTNA 2EMCA 1G2FC 4R2AA 2EMWA 2EMZA 2CSHA 1X6EA 1YUIA 1P47A 2EM4A 2ENAA 3EPKA 2YRKA 3M99B 4F6NA 1TN9A 1A1JA 2EN4A 3EPHA 2RSIA 2NABA 1A1FA 2EORA 4R2EA 2GLIA 2CT1A 2ELZA 2YSOA 4F6MA 2YTPA 5KL7A 2LT7A 2HGHA 2EM9A 1Z1BA 2EM0A 2EOZA 2EM7A 1YUJA 2EJ4A 2EN3A 2EMFA 2YRMA 1BBOA 2YSPA 3EPJA 2YTIA 2EOOA 2YTDA 1G2DC 2EPCA 2EPRA 1MEYC 2EOXA 2YTQA 1X6HA 1RMDA 1KJKA 2JPAA 2EOSA 1BB8A 1F2IG 2EPPA 4X9JA 2R1FA 4WSGA 2EOHA 2EPXA 1JK2A 2GHFA 2YTOA 2WBUA 3MHHC 2DGCA 2EPAA 2EMGA 2ENCA 5KL5A 2EOYA 2EL5A 4M9VC 2ELYA 2EN6A 5KL3A 2EN7A 4R2RA 2WCC3 2LVHA 1NCSA 2EMHA 2M9AA 1DGCA 1YSAC 2PRTA 2EOIA 2EQ3A 2VRDA 2EOEA 4R2CA 2EL6A 1JK1A 2EMYA 2RPCA 2EM5A 2E72A 2WBTA 2YTEA 4R2SA 5KL6A 1A1LA 2A25A 2EMXA 3UK3C 1X3CA 3MHSC 2DLQA 2YTGA 2EM3A 2ENHA 2EM2A 2EQ0A 2EN2A 2EOMA 1ZU1A 1A1GA 4GZNC 1UN6B 2EM6A 3VHTB 1X6FA 1UBDC 2EM8A 1WJPA 2I13A 1A1KA 2EE8A 2YRHA 2EMAA 1TF6A 1ZAAC 5KL2A 2WBSA 5KL4A 2EPZA 2DLKA 3EPLA 2CTDA 2EP3A 2EQ1A 2EN8A 2EOFA 2MDGA 2ADRA 2YU8A 4FK5C 2DRPA 2EOQA 2YU5A 2LO3A 4R2DA 2JP9A 2LCEA 2LV2A 1ZR9A 2EMLA 1A1HA 1LLMC 2EOJA 4IS1C 2EPUA 4IJDA 2BB8A 2D9HA 1AAYA 4R2PA 2MKDA 1A1IA 2MKNA 2J7JA 1B69A 4F2JC 2EMBA 2EMKA 4R2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMI A;  1X5W A;  2DMI A;  2EN1 A;  2YTJ A;  2YTF A;  2EL4 A;  1TF3 A;  2YTN A;  2EMC A;  1G2F C;  4R2A A;  2EMW A;  2EMZ A;  2CSH A;  1X6E A;  1YUI A;  1P47 A;  2EM4 A;  2ENA A;  3EPK A;  2YRK A;  3M99 B;  4F6N A;  1TN9 A;  1A1J A;  2EN4 A;  3EPH A;  2RSI A;  2NAB A;  1A1F A;  2EOR A;  4R2E A;  2GLI A;  2CT1 A;  2ELZ A;  2YSO A;  4F6M A;  2YTP A;  5KL7 A;  2LT7 A;  2HGH A;  2EM9 A;  1Z1B A;  2EM0 A;  2EOZ A;  2EM7 A;  1YUJ A;  2EJ4 A;  2EN3 A;  2EMF A;  2YRM A;  1BBO A;  2YSP A;  3EPJ A;  2YTI A;  2EOO A;  2YTD A;  1G2D C;  2EPC A;  2EPR A;  1MEY C;  2EOX A;  2YTQ A;  1X6H A;  1RMD A;  1KJK A;  2JPA A;  2EOS A;  1BB8 A;  1F2I G;  2EPP A;  4X9J A;  2R1F A;  4WSG A;  2EOH A;  2EPX A;  1JK2 A;  2GHF A;  2YTO A;  2WBU A;  3MHH C;  2DGC A;  2EPA A;  2EMG A;  2ENC A;  5KL5 A;  2EOY A;  2EL5 A;  4M9V C;  2ELY A;  2EN6 A;  5KL3 A;  2EN7 A;  4R2R A;  2WCC 3;  2LVH A;  1NCS A;  2EMH A;  2M9A A;  1DGC A;  1YSA C;  2PRT A;  2EOI A;  2EQ3 A;  2VRD A;  2EOE A;  4R2C A;  2EL6 A;  1JK1 A;  2EMY A;  2RPC A;  2EM5 A;  2E72 A;  2WBT A;  2YTE A;  4R2S A;  5KL6 A;  1A1L A;  2A25 A;  2EMX A;  3UK3 C;  1X3C A;  3MHS C;  2DLQ A;  2YTG A;  2EM3 A;  2ENH A;  2EM2 A;  2EQ0 A;  2EN2 A;  2EOM A;  1ZU1 A;  1A1G A;  4GZN C;  1UN6 B;  2EM6 A;  3VHT B;  1X6F A;  1UBD C;  2EM8 A;  1WJP A;  2I13 A;  1A1K A;  2EE8 A;  2YRH A;  2EMA A;  1TF6 A;  1ZAA C;  5KL2 A;  2WBS A;  5KL4 A;  2EPZ A;  2DLK A;  3EPL A;  2CTD A;  2EP3 A;  2EQ1 A;  2EN8 A;  2EOF A;  2MDG A;  2ADR A;  2YU8 A;  4FK5 C;  2DRP A;  2EOQ A;  2YU5 A;  2LO3 A;  4R2D A;  2JP9 A;  2LCE A;  2LV2 A;  1ZR9 A;  2EML A;  1A1H A;  1LLM C;  2EOJ A;  4IS1 C;  2EPU A;  4IJD A;  2BB8 A;  2D9H A;  1AAY A;  4R2P A;  2MKD A;  1A1I A;  2MKN A;  2J7J A;  1B69 A;  4F2J C;  2EMB A;  2EMK A;  4R2Q A; 
#chains in the Genus database with same CATH topology
 1X5W A;  3H09 A;  2V86 A;  5LMN E;  4LF7 E;  3JTZ A;  1YYK A;  1GQE A;  2KOU A;  1G2F C;  2RS7 A;  4NXM E;  2EMW A;  4YHH E;  2CPN A;  1IQO A;  2UUA E;  1X6E A;  3EPK A;  2YRK A;  5LLQ A;  1TN9 A;  2UXC E;  1A1J A;  2V88 A;  5T6J A;  1HNZ E;  2HGH A;  2CT1 A;  2ELZ A;  4F6M A;  5KL7 A;  2R76 A;  1EH7 A;  2EM9 A;  1I94 E;  1KYQ A;  3J81 C;  2L92 A;  3BID A;  2E5L E;  2YRM A;  1BBO A;  2RTX A;  2VQF E;  4DV4 E;  2EPR A;  1AH5 A;  2YTQ A;  4DV7 E;  2ZM6 E;  4LF9 E;  2ODR C;  5DNY A;  1RC7 A;  1QU6 A;  1WHN A;  2EPP A;  2EWL A;  4F9C B;  1X47 A;  2EPX A;  1JK2 A;  2RS6 A;  4NXN E;  4DUZ E;  3MHH C;  2DGC A;  3THN A;  1HNX E;  2EOY A;  4J8Z A;  3HPZ A;  5IV8 B;  4RH8 A;  2EMH A;  2M9A A;  1DGC A;  4F54 A;  3ADI A;  2EQ3 A;  4KWY A;  2EOE A;  2JWO A;  2EL6 A;  3KZZ A;  2EMY A;  2MC5 A;  4M2Z A;  5KL6 A;  4OOG C;  4GEQ B;  2L33 A;  3THO B;  2EMX A;  3MSW A;  3AV0 A;  1EH6 A;  3MHS C;  1STU A;  2ENH A;  1J5E E;  1T4L B;  4JV5 E;  4OX9 E;  4KHP E;  4NHR A;  1X6F A;  2I13 A;  1TF6 A;  3IWB A;  2UU9 E;  3ZOQ B;  5KL4 A;  1PJT A;  3DJW A;  2EPZ A;  3EPL A;  4JI2 E;  2VQE E;  3J80 C;  5IT9 C;  1PJS A;  2E1M A;  1X49 A;  2EN8 A;  2ADR A;  1XMQ E;  2EOQ A;  4X64 E;  2JP9 A;  1ZR9 A;  5IWA E;  2EOJ A;  4IS1 C;  2RQL A;  2BB8 A;  2KON A;  2D9H A;  4NZV A;  2M4I A;  2DSY A;  2MKD A;  2LE2 A;  2V83 A;  1QNT A;  4X66 E;  2V89 A;  2EMB A;  4DV3 E;  2EMI A;  3T1Y E;  2EN1 A;  1IBM E;  1FKA E;  1L4S A;  2EL4 A;  2EMC A;  4DV1 E;  2CSH A;  4BC7 A;  2L8T A;  2ENA A;  1N34 E;  2BBG A;  5LL6 R;  2JXP A;  2JOB A;  2V85 A;  2EOR A;  4KZS A;  1GTK A;  2B3T B;  3HQ1 A;  2YSO A;  2LT7 A;  2IHR 1;  4JI7 E;  4BHC A;  1EH8 A;  3IWC A;  2EOZ A;  2EM7 A;  2WZO A;  2EMF A;  3RMP A;  3LML A;  2YTI A;  2YTD A;  1G2D C;  4DR1 E;  1N32 E;  4X62 E;  2EOX A;  1X6H A;  2FGG A;  5A6A A;  4JI1 E;  1BB8 A;  2UXB E;  4BBY A;  1HNW E;  2EOH A;  1N36 E;  3J7A G;  2UXD E;  1PJQ A;  2GHF A;  2YTO A;  4DMI A;  2EPA A;  4JI4 E;  2NA2 A;  2YT4 A;  2L2K B;  2MC6 A;  3VYX A;  3JAM C;  2YPN A;  2ELY A;  1IQS A;  2EN6 A;  4WFT A;  2N3H A;  2EPM X;  2K4V A;  4R2C A;  5LMU E;  1JK1 A;  2EM5 A;  2E72 A;  4B3M E;  1A1L A;  3L00 A;  1GZ6 A;  4WX9 A;  4RHB B;  1A1G A;  1YYO A;  4GZN C;  2RSM A;  1UN6 B;  5F3W A;  2EM8 A;  1A1K A;  3IWD A;  2EE8 A;  2YRH A;  2EMA A;  4DR5 E;  2NUG A;  4Q28 A;  4YY3 E;  2UUC E;  2EQ1 A;  2YWQ A;  2YU8 A;  4O5G A;  4R03 A;  3T1H E;  2YU5 A;  1XNQ E;  4R2D A;  1T39 A;  2LV2 A;  4P78 A;  2EPN A;  4X65 E;  1YPN A;  2L6M A;  2LJU A;  1N33 E;  2M7Q A;  2J7J A;  5CFF E;  2L3J A;  2VF1 A;  4JI5 E;  4ZYD A;  2EMK A;  4GKK E;  3FIG A;  4R2Q A;  2DMI A;  1DQ3 A;  2JVA A;  2LTS A;  1TF3 A;  2YTN A;  1DI2 A;  4AQY E;  1FJG E;  4B3S E;  4WXC A;  4DR3 E;  4BHB A;  1P47 A;  2EM4 A;  2EN4 A;  1IMU A;  1A1F A;  4R2E A;  2H36 X;  2YTP A;  5FLX C;  2EM0 A;  5TSE A;  2VE7 C;  2B7V A;  4DV0 E;  4JI6 E;  1X48 A;  3C4B A;  2YSP A;  3EPJ A;  3TQM A;  5AE1 A;  4DUY E;  1MEY C;  2EPC A;  4BCA A;  2MDR A;  1RMD A;  2JY9 A;  3F6H A;  2EOS A;  4WXD A;  2HHH E;  1F2I G;  1PDA A;  4X9J A;  5AE3 A;  3AUZ A;  4ZYE A;  4K0K E;  2R1F A;  4O43 A;  4GKJ E;  2UUB E;  4LF8 E;  3QG5 C;  3DF6 A;  1SR9 A;  3C6K A;  4HEI A;  4N4R B;  5KL5 A;  2B7T A;  2LBS B;  4LF5 E;  4ZYG A;  2EL5 A;  1WXR A;  4M9V C;  2WCC 3;  4DR4 E;  5KL3 A;  2EN7 A;  4R2R A;  5A6K A;  2DIX A;  2LJH A;  4X8W A;  2EPL X;  2LVH A;  4L5N C;  1NCS A;  2I9I A;  1YSA C;  2PRT A;  2EOI A;  2JOX A;  2VRD A;  4P7D A;  1EKZ A;  1T38 A;  4WPY A;  1UIL A;  2RPC A;  2WBT A;  2YTE A;  4F9A B;  3UK3 C;  2K7I A;  2DLQ A;  4I8O A;  1XMO E;  2EM2 A;  1WHQ A;  2EQ0 A;  4DR7 E;  2EOM A;  2V87 A;  1ZU1 A;  4LFA E;  4LTY A;  2B9D A;  2NUE A;  2EM6 A;  2LUP B;  1UBD C;  1WJP A;  2YZT A;  4R8O A;  2L2N A;  1ZAA C;  5KL2 A;  2WBS A;  4ZYH A;  2G7H A;  4LF4 E;  2N8X A;  5AC4 A;  3ADJ A;  2HC5 A;  4LF6 E;  4DKK A;  2CTD A;  2EP3 A;  2MDG A;  3KWR A;  4Q35 B;  3ECR A;  4FK5 C;  2LO3 A;  2LRS A;  2LCE A;  2EML A;  4JI8 E;  1LLM C;  1NEI A;  1A1H A;  3C6M A;  2V8Q B;  5AE2 A;  3HTX A;  3VK6 A;  1WRJ A;  5A6B A;  1SFE A;  2L2M A;  1AAY A;  5AAS A;  4LFB E;  1T4O A;  4DV2 E;  3ADG A;  3VYY A;  2DB2 A;  4DV6 E;  1T4N A;  2YTJ A;  2YTF A;  4M0V A;  4M30 A;  2GPI A;  4F9B B;  2FTX B;  4R2A A;  2EMZ A;  4BC9 A;  2L3C A;  5BR8 E;  5A69 A;  1YUI A;  4O4K A;  3J7Y p;  3M99 B;  4F6N A;  1IBL E;  2EZ6 A;  3ADL A;  4DV5 E;  3EPH A;  2RSI A;  2NAB A;  2M1S A;  2GLI A;  2DMY A;  4BMJ A;  4LFC E;  1Z1B A;  5A6J A;  4JI0 E;  5A2Q C;  2NUF A;  1YUJ A;  3C4T A;  2EJ4 A;  2EN3 A;  2ODR D;  1YZ9 A;  4JYA E;  4BS9 A;  2EOO A;  3BF2 A;  2F8B A;  1KJK A;  4MLV A;  2JPA A;  2N3G A;  2JYA A;  2FV4 B;  4WSG A;  4B3T E;  4LU9 A;  1MGT A;  3OTO E;  2LUQ A;  2WBU A;  2KHX A;  4DR6 E;  2EMG A;  2ENC A;  3LLH A;  3BGH A;  4O24 A;  5ADZ A;  1YFH A;  4WSP A;  3JU0 A;  3KZY A;  2Q8U A;  3HPS A;  1J26 A;  1RQ0 A;  3P1X A;  4MLQ A;  1PKP A;  4R2S A;  2HJJ A;  2EPK X;  2A25 A;  1IBK E;  1O0W A;  1X3C A;  3EQ1 A;  1ZBQ A;  3HXL A;  2YTG A;  2EM3 A;  2EN2 A;  4DR2 E;  3K6Q A;  3VHT B;  4WYQ B;  1UHZ A;  1ZBT A;  4JI3 E;  2LTR A;  4HTG A;  2DLK A;  4TUG A;  2EOF A;  1N3G A;  3OML A;  4L8N A;  5AC5 A;  2DRP A;  3F6G A;  2LMZ A;  4TUI A;  2EPU A;  4IJD A;  5A6B D;  5IXM B;  4R2P A;  1HR0 E;  4B3R E;  2JR1 A;  2F4V E;  1A1I A;  1BBG A;  2MKN A;  2EPO A;  1XNR E;  3BBG A;  1B69 A;  4F2J C;  1YYW A; 
#chains in the Genus database with same CATH homology
 2EMI A;  1X5W A;  2DMI A;  2EN1 A;  2YTJ A;  2YTF A;  2EL4 A;  1TF3 A;  2YTN A;  2EMC A;  1G2F C;  4R2A A;  2EMW A;  2EMZ A;  2CSH A;  1X6E A;  1YUI A;  1P47 A;  2EM4 A;  2ENA A;  3EPK A;  2YRK A;  3M99 B;  4F6N A;  1TN9 A;  1A1J A;  2EN4 A;  3EPH A;  2RSI A;  2NAB A;  1A1F A;  2EOR A;  4R2E A;  2GLI A;  2CT1 A;  2ELZ A;  2YSO A;  4F6M A;  2YTP A;  5KL7 A;  2LT7 A;  2HGH A;  2EM9 A;  1Z1B A;  2EM0 A;  2EOZ A;  2EM7 A;  1YUJ A;  2EJ4 A;  2EN3 A;  2EMF A;  2YRM A;  1BBO A;  2YSP A;  3EPJ A;  2YTI A;  2EOO A;  2YTD A;  1G2D C;  2EPC A;  2EPR A;  1MEY C;  2EOX A;  2YTQ A;  1X6H A;  1RMD A;  1KJK A;  2JPA A;  2EOS A;  1BB8 A;  1F2I G;  2EPP A;  4X9J A;  2R1F A;  4WSG A;  2EOH A;  2EPX A;  1JK2 A;  2GHF A;  2YTO A;  2WBU A;  3MHH C;  2DGC A;  2EPA A;  2EMG A;  2ENC A;  5KL5 A;  2EOY A;  2EL5 A;  4M9V C;  2ELY A;  2EN6 A;  5KL3 A;  2EN7 A;  4R2R A;  2WCC 3;  2LVH A;  1NCS A;  2EMH A;  2M9A A;  1DGC A;  1YSA C;  2PRT A;  2EOI A;  2EQ3 A;  2VRD A;  2EOE A;  4R2C A;  2EL6 A;  1JK1 A;  2EMY A;  2RPC A;  2EM5 A;  2E72 A;  2WBT A;  2YTE A;  4R2S A;  5KL6 A;  1A1L A;  2A25 A;  2EMX A;  3UK3 C;  1X3C A;  3MHS C;  2DLQ A;  2YTG A;  2EM3 A;  2ENH A;  2EM2 A;  2EQ0 A;  2EN2 A;  2EOM A;  1ZU1 A;  1A1G A;  4GZN C;  1UN6 B;  2EM6 A;  3VHT B;  1X6F A;  1UBD C;  2EM8 A;  1WJP A;  2I13 A;  1A1K A;  2EE8 A;  2YRH A;  2EMA A;  1TF6 A;  1ZAA C;  5KL2 A;  2WBS A;  5KL4 A;  2EPZ A;  2DLK A;  3EPL A;  2CTD A;  2EP3 A;  2EQ1 A;  2EN8 A;  2EOF A;  2MDG A;  2ADR A;  2YU8 A;  4FK5 C;  2DRP A;  2EOQ A;  2YU5 A;  2LO3 A;  4R2D A;  2JP9 A;  2LCE A;  2LV2 A;  1ZR9 A;  2EML A;  1A1H A;  1LLM C;  2EOJ A;  4IS1 C;  2EPU A;  4IJD A;  2BB8 A;  2D9H A;  1AAY A;  4R2P A;  2MKD A;  1A1I A;  2MKN A;  2J7J A;  1B69 A;  4F2J C;  2EMB A;  2EMK A;  4R2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...