2EL4A

Solution structure of the 15th zf-c2h2 domain from human zinc finger protein 268
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGVKPYGCSQCAKTFSLKSQLIVHQRSHTGVKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the 15th zf-C2H2 domain from human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 268
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2el4A00
4R2EA 2GHFA 1BB8A 2EN6A 2M9AA 2EN8A 2EM4A 2EP3A 2EQ1A 5KL4A 2YTFA 2ENCA 2EM0A 2EN4A 4R2AA 1B69A 1YUJA 4WSGA 2EPUA 2EMHA 2EMIA 2YTPA 1A1KA 1G2DC 2EMYA 2EMFA 2YU5A 2GLIA 4R2PA 2EJ4A 2WBTA 2LCEA 1A1LA 4R2QA 3EPJA 2EL5A 2DLQA 2CSHA 3EPKA 1X6HA 2YTNA 2EPAA 2EMXA 1ZU1A 1BBOA 2EOQA 4GZNC 2I13A 2MKDA 2YTIA 1TF3A 2EMAA 5KL2A 4F2JC 2JPAA 2R1FA 4X9JA 2EN3A 2EOSA 2EM3A 2WCC3 2EE8A 1YUIA 2EMWA 2D9HA 2EMCA 2EPCA 2JP9A 1A1HA 1A1IA 3EPLA 1JK1A 4R2CA 3VHTB 2WBUA 2EPPA 3UK3C 1ZR9A 3MHHC 2YU8A 2MKNA 2RSIA 2EL6A 4F6MA 2ENHA 2CTDA 2EOYA 2EM8A 2EOFA 2PRTA 2LT7A 4F6NA 2ENAA 2E72A 2DRPA 2EOXA 4M9VC 2EM9A 2EOMA 2YTOA 2EMGA 5KL5A 2EPZA 2VRDA 1DGCA 1X5WA 2ADRA 5KL7A 2NABA 2YTQA 4IJDA 2YTDA 2EPXA 1RMDA 2CT1A 2EM2A 2YRKA 2A25A 2EMZA 1TN9A 1X6EA 2J7JA 2EOJA 1KJKA 1YSAC 1NCSA 5KL6A 2EMBA 2EOEA 2EM7A 2HGHA 1AAYA 2DMIA 2LV2A 2YRHA 2EQ3A 1JK2A 2EORA 1G2FC 4R2DA 1X3CA 2YSPA 2EOHA 2YTEA 1MEYC 2EMKA 2YSOA 2YRMA 2BB8A 2YTGA 1UBDC 2WBSA 2EOZA 1X6FA 1Z1BA 2EOOA 2MDGA 2YTJA 2EN1A 3MHSC 2EQ0A 2EPRA 2DGCA 2EL4A 2EOIA 1A1GA 2EN2A 4FK5C 2EM6A 3M99B 4IS1C 1LLMC 1A1JA 1A1FA 1ZAAC 4R2RA 1WJPA 2ELZA 2EN7A 3EPHA 1F2IG 4R2SA 1P47A 5KL3A 2EM5A 2EMLA 1TF6A 2RPCA 2LVHA 2LO3A 2DLKA 1UN6B 2ELYA
chains in the Genus database with same CATH superfamily
2GHFA 2EN6A 1RQ0A 2EN8A 2EM4A 1XNQE 5KL4A 3OMLA 3ADLA 4DV6E 4DMIA 3TQMA 1YUJA 2NUGA 4M0VA 2EMFA 2YU5A 2GLIA 4R2PA 2LJUA 5FLXC 2G7HA 2EL5A 4DR5E 1X6HA 2VF1A 3DF6A 1STUA 1GQEA 4R03A 1WHQA 3ADJA 3HPZA 2R76A 4F9BB 2I9IA 2D9HA 2EMCA 2JP9A 2E1MA 1IBME 3VHTB 1WRJA 3UK3C 2ODRC 1GZ6A 3MHHC 2KONA 2EL6A 4L8NA 5AE1A 1IQSA 2EM8A 4F6NA 2V87A 4F9CB 2B3TB 2RS7A 4GEQB 3THOB 4L5NC 2EOXA 2DRPA 1IQOA 4BCAA 2EPZA 4YY3E 2MC6A 1J5EE 3DJWA 1YZ9A 4LF4E 5AE3A 2L92A 2NABA 1ZBTA 1QU6A 2VQEE 3L00A 2EM2A 1TN9A 5LLQA 1X6EA 3FIGA 1KJKA 4O43A 4BHBA 4JI2E 4NXME 2EPNA 2RQLA 5T6JA 2JY9A 1G2FC 4OOGC 2EPKX 2DSYA 2LRSA 2M4IA 2BB8A 2YTGA 4LF7E 4DV4E 2EOZA 2LUPB 2UXDE 2YTJA 1EKZA 2LTRA 2L6MA 1IBLE 2DGCA 2L2NA 1LLMC 2UXCE 3J80C 1P47A 1F2IG 2NUFA 2LE2A 2UUBE 3K6QA 3J7Yp 4DV2E 2LMZA 1FJGE 2JVAA 4BMJA 5A6KA 2LTSA 4O24A 1O0WA 4R2EA 3THNA 4F9AB 2YWQA 3C4TA 2MC5A 2V86A 5IWAE 1IBKE 2YTFA 1N32E 4LTYA 2EM0A 4LF8E 4B3SE 4R2AA 3IWDA 1T38A 1B69A 1X49A 5IT9C 2EMIA 2LBSB 1A1KA 1G2DC 2EMYA 2EJ4A 2DIXA 2HJJA 3HQ1A 1A1LA 4DR7E 1EH6A 3EPKA 2EPAA 2V89A 4MLVA 2EOQA 1BBOA 1TF3A 4DKKA 5KL2A 4F2JC 4X64E 2R1FA 2L33A 2JPAA 4X9JA 2EOSA 3C6MA 2EMWA 3KWRA 3C6KA 3MSWA 3EPLA 1JK1A 4R2CA 2UUCE 4JI4E 2YU8A 2DB2A 2MKNA 4O5GA 4JYAE 4F6MA 1PJQA 2CTDA 2WZOA 4P78A 2E72A 4GKKE 1T39A 2JXPA 2YTOA 1HNZE 2EMGA 5KL5A 5CFFE 2YT4A 4DR4E 1J26A 4YHHE 1AH5A 4ZYGA 1DGCA 1X5WA 2UUAE 4JI7E 2EZ6A 2YTDA 4TUIA 2BBGA 2EPXA 1RMDA 4Q28A 2CT1A 4HTGA 2YRKA 4WXDA 1L4SA 2A25A 2EMZA 2V88A 2V85A 1NEIA 3H09A 5KL6A 4DR6E 2EMBA 4DV1E 4BS9A 1MGTA 1AAYA 4DR3E 4DR1E 2H36X 2B7TA 2M7QA 2F4VE 2EORA 3JU0A 4B3TE 4R2DA 5AE2A 5A6JA 1I94E 2YSPA 2YTEA 2N3HA 1MEYC 2EMKA 2Q8UA 2YSOA 2YRMA 2K7IA 4KHPE 1EH7A 2V83A 2M1SA 2N8XA 1BBGA 4JI8E 1Z1BA 4AQYE 1UHZA 1WXRA 5AC5A 4TUGA 1A1GA 3VYYA 2L2MA 4WYQB 5F3WA 2EN7A 4LFCE 2GPIA 5KL3A 2UU9E 3F6GA 4JI0E 4X8WA 2DMYA 4MLQA 4RH8A 2RPCA 1PJTA 1XNRE 3RMPA 3F6HA 1UN6B 4HEIA 4GKJE 1HNWE 1T4NA 2ELYA 3BF2A 1BB8A 3C4BA 3LLHA 5IV8B 3ECRA 1PKPA 2EQ1A 1YYKA 2VQFE 2EPUA 1KYQA 2WBTA 2LCEA 1YYWA 1PJSA 4WPYA 2CSHA 2DLQA 2YTNA 4DV5E 2EMXA 4RHBB 2B7VA 3OTOE 4GZNC 2YTIA 2EMAA 2NA2A 4DV3E 3AV0A 4JI1E 2EN3A 2EM3A 2WCC3 4M30A 2FTXB 2LUQA 3T1HE 2EPCA 1FKAE 1YYOA 1ZR9A 4DUZE 4LF9E 2L3CA 2EOFA 2LT7A 2KOUA 4K0KE 4M9VC 5A6BA 3HXLA 4JV5E 4N4RB 1T4OA 2EOMA 3KZZA 1DI2A 2JOBA 2VRDA 5A6AA 5KL7A 4B3ME 2YTQA 4IJDA 4LU9A 3J7AG 4I8OA 1GTKA 3EQ1A 1NCSA 3BBGA 2HHHE 4LFAE 2ODRD 5AC4A 3KZYA 2EOEA 4DV7E 1N34E 4BC9A 4F54A 5LMNE 2K4VA 2JOXA 1ZBQA 4WSPA 4BBYA 2EPOA 3JTZA 2FGGA 3HPSA 4NZVA 3VK6A 2IHR1 4O4KA 1UBDC 2WBSA 2CPNA 2EOOA 2EPLX 2RS6A 3BGHA 2YPNA 2EPRA 1N36E 2EL4A 2EOIA 4P7DA 4DV0E 2MDRA 1A1JA 3M99B 4ZYDA 1A1FA 4WX9A 4R2RA 1WJPA 2ELZA 3EPHA 4KWYA 2EM5A 4NXNE 4ZYHA 4ZYEA 2L2KB 3P1XA 1TF6A 3VYXA 5BR8E 2B9DA 4JI3E 2LJHA 2LO3A 2N3GA 5DNYA 1SFEA 4Q35B 2M9AA 4JI6E 4NHRA 2EP3A 5A6BD 2ENCA 4BHCA 5AASA 2JWOA 2VE7C 4WSGA 2YTPA 2EMHA 2RSMA 1HR0E 3ADIA 1N3GA 4R2QA 3EPJA 3IWCA 3ADGA 1ZU1A 2JYAA 2I13A 2MKDA 1X48A 2EE8A 5A2QC 1X47A 1YUIA 1A1HA 1A1IA 1EH8A 2WBUA 4DUYE 4DR2E 2EPPA 2EPMX 2RSIA 5TSEA 2ENHA 2EOYA 1HNXE 4BC7A 4JI5E 2PRTA 2ENAA 1RC7A 2EM9A 3AUZA 1UILA 4OX9E 2JR1A 3IWBA 2ADRA 5LMUE 1QNTA 3JAMC 1SR9A 1XMOE 1IMUA 2L8TA 3LMLA 2J7JA 4J8ZA 2EOJA 1YSAC 2EM7A 2HGHA 2DMIA 2LV2A 2YRHA 1YPNA 2EQ3A 2YZTA 5A69A 1YFHA 1JK2A 2L3JA 3ZOQB 2ZM6E 1X3CA 4WXCA 2KHXA 4X66E 3HTXA 4KZSA 2EOHA 3QG5C 5ADZA 1PDAA 3BIDA 2EWLA 2FV4B 1N33E 4X62E 1X6FA 2MDGA 2EN1A 3MHSC 4LF5E 2EQ0A 1DQ3A 4R8OA 4WFTA 4B3RE 2V8QB 2EN2A 4FK5C 2EM6A 4IS1C 1ZAAC 4M2ZA 4LFBE 2HC5A 2NUEA 5IXMB 4R2SA 4LF6E 2EMLA 5LL6R 2F8BA 4X65E 1T4LB 1WHNA 3T1YE 1XMQE 2LVHA 3J81C 2RTXA 2E5LE 2UXBE 2DLKA 2EN4A
chains in the Genus database with same CATH topology
4R2EA 2GHFA 1BB8A 2EN6A 2M9AA 2EN8A 2EM4A 2EP3A 2EQ1A 5KL4A 2YTFA 2ENCA 2EM0A 2EN4A 4R2AA 1B69A 1YUJA 4WSGA 2EPUA 2EMHA 2EMIA 2YTPA 1A1KA 1G2DC 2EMYA 2EMFA 2YU5A 2GLIA 4R2PA 2EJ4A 2WBTA 2LCEA 1A1LA 4R2QA 3EPJA 2EL5A 2DLQA 2CSHA 3EPKA 1X6HA 2YTNA 2EPAA 2EMXA 1ZU1A 1BBOA 2EOQA 4GZNC 2I13A 2MKDA 2YTIA 1TF3A 2EMAA 5KL2A 4F2JC 2JPAA 2R1FA 4X9JA 2EN3A 2EOSA 2EM3A 2WCC3 2EE8A 1YUIA 2EMWA 2D9HA 2EMCA 2EPCA 2JP9A 1A1HA 1A1IA 3EPLA 1JK1A 4R2CA 3VHTB 2WBUA 2EPPA 3UK3C 1ZR9A 3MHHC 2YU8A 2MKNA 2RSIA 2EL6A 4F6MA 2ENHA 2CTDA 2EOYA 2EM8A 2EOFA 2PRTA 2LT7A 4F6NA 2ENAA 2E72A 2DRPA 2EOXA 4M9VC 2EM9A 2EOMA 2YTOA 2EMGA 5KL5A 2EPZA 2VRDA 1DGCA 1X5WA 2ADRA 5KL7A 2NABA 2YTQA 4IJDA 2YTDA 2EPXA 1RMDA 2CT1A 2EM2A 2YRKA 2A25A 2EMZA 1TN9A 1X6EA 2J7JA 2EOJA 1KJKA 1YSAC 1NCSA 5KL6A 2EMBA 2EOEA 2EM7A 2HGHA 1AAYA 2DMIA 2LV2A 2YRHA 2EQ3A 1JK2A 2EORA 1G2FC 4R2DA 1X3CA 2YSPA 2EOHA 2YTEA 1MEYC 2EMKA 2YSOA 2YRMA 2BB8A 2YTGA 1UBDC 2WBSA 2EOZA 1X6FA 1Z1BA 2EOOA 2MDGA 2YTJA 2EN1A 3MHSC 2EQ0A 2EPRA 2DGCA 2EL4A 2EOIA 1A1GA 2EN2A 4FK5C 2EM6A 3M99B 4IS1C 1LLMC 1A1JA 1A1FA 1ZAAC 4R2RA 1WJPA 2ELZA 2EN7A 3EPHA 1F2IG 4R2SA 1P47A 5KL3A 2EM5A 2EMLA 1TF6A 2RPCA 2LVHA 2LO3A 2DLKA 1UN6B 2ELYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2E A;  2GHF A;  1BB8 A;  2EN6 A;  2M9A A;  2EN8 A;  2EM4 A;  2EP3 A;  2EQ1 A;  5KL4 A;  2YTF A;  2ENC A;  2EM0 A;  2EN4 A;  4R2A A;  1B69 A;  1YUJ A;  4WSG A;  2EPU A;  2EMH A;  2EMI A;  2YTP A;  1A1K A;  1G2D C;  2EMY A;  2EMF A;  2YU5 A;  2GLI A;  4R2P A;  2EJ4 A;  2WBT A;  2LCE A;  1A1L A;  4R2Q A;  3EPJ A;  2EL5 A;  2DLQ A;  2CSH A;  3EPK A;  1X6H A;  2YTN A;  2EPA A;  2EMX A;  1ZU1 A;  1BBO A;  2EOQ A;  4GZN C;  2I13 A;  2MKD A;  2YTI A;  1TF3 A;  2EMA A;  5KL2 A;  4F2J C;  2JPA A;  2R1F A;  4X9J A;  2EN3 A;  2EOS A;  2EM3 A;  2WCC 3;  2EE8 A;  1YUI A;  2EMW A;  2D9H A;  2EMC A;  2EPC A;  2JP9 A;  1A1H A;  1A1I A;  3EPL A;  1JK1 A;  4R2C A;  3VHT B;  2WBU A;  2EPP A;  3UK3 C;  1ZR9 A;  3MHH C;  2YU8 A;  2MKN A;  2RSI A;  2EL6 A;  4F6M A;  2ENH A;  2CTD A;  2EOY A;  2EM8 A;  2EOF A;  2PRT A;  2LT7 A;  4F6N A;  2ENA A;  2E72 A;  2DRP A;  2EOX A;  4M9V C;  2EM9 A;  2EOM A;  2YTO A;  2EMG A;  5KL5 A;  2EPZ A;  2VRD A;  1DGC A;  1X5W A;  2ADR A;  5KL7 A;  2NAB A;  2YTQ A;  4IJD A;  2YTD A;  2EPX A;  1RMD A;  2CT1 A;  2EM2 A;  2YRK A;  2A25 A;  2EMZ A;  1TN9 A;  1X6E A;  2J7J A;  2EOJ A;  1KJK A;  1YSA C;  1NCS A;  5KL6 A;  2EMB A;  2EOE A;  2EM7 A;  2HGH A;  1AAY A;  2DMI A;  2LV2 A;  2YRH A;  2EQ3 A;  1JK2 A;  2EOR A;  1G2F C;  4R2D A;  1X3C A;  2YSP A;  2EOH A;  2YTE A;  1MEY C;  2EMK A;  2YSO A;  2YRM A;  2BB8 A;  2YTG A;  1UBD C;  2WBS A;  2EOZ A;  1X6F A;  1Z1B A;  2EOO A;  2MDG A;  2YTJ A;  2EN1 A;  3MHS C;  2EQ0 A;  2EPR A;  2DGC A;  2EL4 A;  2EOI A;  1A1G A;  2EN2 A;  4FK5 C;  2EM6 A;  3M99 B;  4IS1 C;  1LLM C;  1A1J A;  1A1F A;  1ZAA C;  4R2R A;  1WJP A;  2ELZ A;  2EN7 A;  3EPH A;  1F2I G;  4R2S A;  1P47 A;  5KL3 A;  2EM5 A;  2EML A;  1TF6 A;  2RPC A;  2LVH A;  2LO3 A;  2DLK A;  1UN6 B;  2ELY A; 
#chains in the Genus database with same CATH topology
 2GHF A;  2EN6 A;  1RQ0 A;  2EN8 A;  2EM4 A;  1XNQ E;  5KL4 A;  3OML A;  3ADL A;  4DV6 E;  4DMI A;  3TQM A;  1YUJ A;  2NUG A;  4M0V A;  2EMF A;  2YU5 A;  2GLI A;  4R2P A;  2LJU A;  5FLX C;  2G7H A;  2EL5 A;  4DR5 E;  1X6H A;  2VF1 A;  3DF6 A;  1STU A;  1GQE A;  4R03 A;  1WHQ A;  3ADJ A;  3HPZ A;  2R76 A;  4F9B B;  2I9I A;  2D9H A;  2EMC A;  2JP9 A;  2E1M A;  1IBM E;  3VHT B;  1WRJ A;  3UK3 C;  2ODR C;  1GZ6 A;  3MHH C;  2KON A;  2EL6 A;  4L8N A;  5AE1 A;  1IQS A;  2EM8 A;  4F6N A;  2V87 A;  4F9C B;  2B3T B;  2RS7 A;  4GEQ B;  3THO B;  4L5N C;  2EOX A;  2DRP A;  1IQO A;  4BCA A;  2EPZ A;  4YY3 E;  2MC6 A;  1J5E E;  3DJW A;  1YZ9 A;  4LF4 E;  5AE3 A;  2L92 A;  2NAB A;  1ZBT A;  1QU6 A;  2VQE E;  3L00 A;  2EM2 A;  1TN9 A;  5LLQ A;  1X6E A;  3FIG A;  1KJK A;  4O43 A;  4BHB A;  4JI2 E;  4NXM E;  2EPN A;  2RQL A;  5T6J A;  2JY9 A;  1G2F C;  4OOG C;  2EPK X;  2DSY A;  2LRS A;  2M4I A;  2BB8 A;  2YTG A;  4LF7 E;  4DV4 E;  2EOZ A;  2LUP B;  2UXD E;  2YTJ A;  1EKZ A;  2LTR A;  2L6M A;  1IBL E;  2DGC A;  2L2N A;  1LLM C;  2UXC E;  3J80 C;  1P47 A;  1F2I G;  2NUF A;  2LE2 A;  2UUB E;  3K6Q A;  3J7Y p;  4DV2 E;  2LMZ A;  1FJG E;  2JVA A;  4BMJ A;  5A6K A;  2LTS A;  4O24 A;  1O0W A;  4R2E A;  3THN A;  4F9A B;  2YWQ A;  3C4T A;  2MC5 A;  2V86 A;  5IWA E;  1IBK E;  2YTF A;  1N32 E;  4LTY A;  2EM0 A;  4LF8 E;  4B3S E;  4R2A A;  3IWD A;  1T38 A;  1B69 A;  1X49 A;  5IT9 C;  2EMI A;  2LBS B;  1A1K A;  1G2D C;  2EMY A;  2EJ4 A;  2DIX A;  2HJJ A;  3HQ1 A;  1A1L A;  4DR7 E;  1EH6 A;  3EPK A;  2EPA A;  2V89 A;  4MLV A;  2EOQ A;  1BBO A;  1TF3 A;  4DKK A;  5KL2 A;  4F2J C;  4X64 E;  2R1F A;  2L33 A;  2JPA A;  4X9J A;  2EOS A;  3C6M A;  2EMW A;  3KWR A;  3C6K A;  3MSW A;  3EPL A;  1JK1 A;  4R2C A;  2UUC E;  4JI4 E;  2YU8 A;  2DB2 A;  2MKN A;  4O5G A;  4JYA E;  4F6M A;  1PJQ A;  2CTD A;  2WZO A;  4P78 A;  2E72 A;  4GKK E;  1T39 A;  2JXP A;  2YTO A;  1HNZ E;  2EMG A;  5KL5 A;  5CFF E;  2YT4 A;  4DR4 E;  1J26 A;  4YHH E;  1AH5 A;  4ZYG A;  1DGC A;  1X5W A;  2UUA E;  4JI7 E;  2EZ6 A;  2YTD A;  4TUI A;  2BBG A;  2EPX A;  1RMD A;  4Q28 A;  2CT1 A;  4HTG A;  2YRK A;  4WXD A;  1L4S A;  2A25 A;  2EMZ A;  2V88 A;  2V85 A;  1NEI A;  3H09 A;  5KL6 A;  4DR6 E;  2EMB A;  4DV1 E;  4BS9 A;  1MGT A;  1AAY A;  4DR3 E;  4DR1 E;  2H36 X;  2B7T A;  2M7Q A;  2F4V E;  2EOR A;  3JU0 A;  4B3T E;  4R2D A;  5AE2 A;  5A6J A;  1I94 E;  2YSP A;  2YTE A;  2N3H A;  1MEY C;  2EMK A;  2Q8U A;  2YSO A;  2YRM A;  2K7I A;  4KHP E;  1EH7 A;  2V83 A;  2M1S A;  2N8X A;  1BBG A;  4JI8 E;  1Z1B A;  4AQY E;  1UHZ A;  1WXR A;  5AC5 A;  4TUG A;  1A1G A;  3VYY A;  2L2M A;  4WYQ B;  5F3W A;  2EN7 A;  4LFC E;  2GPI A;  5KL3 A;  2UU9 E;  3F6G A;  4JI0 E;  4X8W A;  2DMY A;  4MLQ A;  4RH8 A;  2RPC A;  1PJT A;  1XNR E;  3RMP A;  3F6H A;  1UN6 B;  4HEI A;  4GKJ E;  1HNW E;  1T4N A;  2ELY A;  3BF2 A;  1BB8 A;  3C4B A;  3LLH A;  5IV8 B;  3ECR A;  1PKP A;  2EQ1 A;  1YYK A;  2VQF E;  2EPU A;  1KYQ A;  2WBT A;  2LCE A;  1YYW A;  1PJS A;  4WPY A;  2CSH A;  2DLQ A;  2YTN A;  4DV5 E;  2EMX A;  4RHB B;  2B7V A;  3OTO E;  4GZN C;  2YTI A;  2EMA A;  2NA2 A;  4DV3 E;  3AV0 A;  4JI1 E;  2EN3 A;  2EM3 A;  2WCC 3;  4M30 A;  2FTX B;  2LUQ A;  3T1H E;  2EPC A;  1FKA E;  1YYO A;  1ZR9 A;  4DUZ E;  4LF9 E;  2L3C A;  2EOF A;  2LT7 A;  2KOU A;  4K0K E;  4M9V C;  5A6B A;  3HXL A;  4JV5 E;  4N4R B;  1T4O A;  2EOM A;  3KZZ A;  1DI2 A;  2JOB A;  2VRD A;  5A6A A;  5KL7 A;  4B3M E;  2YTQ A;  4IJD A;  4LU9 A;  3J7A G;  4I8O A;  1GTK A;  3EQ1 A;  1NCS A;  3BBG A;  2HHH E;  4LFA E;  2ODR D;  5AC4 A;  3KZY A;  2EOE A;  4DV7 E;  1N34 E;  4BC9 A;  4F54 A;  5LMN E;  2K4V A;  2JOX A;  1ZBQ A;  4WSP A;  4BBY A;  2EPO A;  3JTZ A;  2FGG A;  3HPS A;  4NZV A;  3VK6 A;  2IHR 1;  4O4K A;  1UBD C;  2WBS A;  2CPN A;  2EOO A;  2EPL X;  2RS6 A;  3BGH A;  2YPN A;  2EPR A;  1N36 E;  2EL4 A;  2EOI A;  4P7D A;  4DV0 E;  2MDR A;  1A1J A;  3M99 B;  4ZYD A;  1A1F A;  4WX9 A;  4R2R A;  1WJP A;  2ELZ A;  3EPH A;  4KWY A;  2EM5 A;  4NXN E;  4ZYH A;  4ZYE A;  2L2K B;  3P1X A;  1TF6 A;  3VYX A;  5BR8 E;  2B9D A;  4JI3 E;  2LJH A;  2LO3 A;  2N3G A;  5DNY A;  1SFE A;  4Q35 B;  2M9A A;  4JI6 E;  4NHR A;  2EP3 A;  5A6B D;  2ENC A;  4BHC A;  5AAS A;  2JWO A;  2VE7 C;  4WSG A;  2YTP A;  2EMH A;  2RSM A;  1HR0 E;  3ADI A;  1N3G A;  4R2Q A;  3EPJ A;  3IWC A;  3ADG A;  1ZU1 A;  2JYA A;  2I13 A;  2MKD A;  1X48 A;  2EE8 A;  5A2Q C;  1X47 A;  1YUI A;  1A1H A;  1A1I A;  1EH8 A;  2WBU A;  4DUY E;  4DR2 E;  2EPP A;  2EPM X;  2RSI A;  5TSE A;  2ENH A;  2EOY A;  1HNX E;  4BC7 A;  4JI5 E;  2PRT A;  2ENA A;  1RC7 A;  2EM9 A;  3AUZ A;  1UIL A;  4OX9 E;  2JR1 A;  3IWB A;  2ADR A;  5LMU E;  1QNT A;  3JAM C;  1SR9 A;  1XMO E;  1IMU A;  2L8T A;  3LML A;  2J7J A;  4J8Z A;  2EOJ A;  1YSA C;  2EM7 A;  2HGH A;  2DMI A;  2LV2 A;  2YRH A;  1YPN A;  2EQ3 A;  2YZT A;  5A69 A;  1YFH A;  1JK2 A;  2L3J A;  3ZOQ B;  2ZM6 E;  1X3C A;  4WXC A;  2KHX A;  4X66 E;  3HTX A;  4KZS A;  2EOH A;  3QG5 C;  5ADZ A;  1PDA A;  3BID A;  2EWL A;  2FV4 B;  1N33 E;  4X62 E;  1X6F A;  2MDG A;  2EN1 A;  3MHS C;  4LF5 E;  2EQ0 A;  1DQ3 A;  4R8O A;  4WFT A;  4B3R E;  2V8Q B;  2EN2 A;  4FK5 C;  2EM6 A;  4IS1 C;  1ZAA C;  4M2Z A;  4LFB E;  2HC5 A;  2NUE A;  5IXM B;  4R2S A;  4LF6 E;  2EML A;  5LL6 R;  2F8B A;  4X65 E;  1T4L B;  1WHN A;  3T1Y E;  1XMQ E;  2LVH A;  3J81 C;  2RTX A;  2E5L E;  2UXB E;  2DLK A;  2EN4 A; 
#chains in the Genus database with same CATH homology
 4R2E A;  2GHF A;  1BB8 A;  2EN6 A;  2M9A A;  2EN8 A;  2EM4 A;  2EP3 A;  2EQ1 A;  5KL4 A;  2YTF A;  2ENC A;  2EM0 A;  2EN4 A;  4R2A A;  1B69 A;  1YUJ A;  4WSG A;  2EPU A;  2EMH A;  2EMI A;  2YTP A;  1A1K A;  1G2D C;  2EMY A;  2EMF A;  2YU5 A;  2GLI A;  4R2P A;  2EJ4 A;  2WBT A;  2LCE A;  1A1L A;  4R2Q A;  3EPJ A;  2EL5 A;  2DLQ A;  2CSH A;  3EPK A;  1X6H A;  2YTN A;  2EPA A;  2EMX A;  1ZU1 A;  1BBO A;  2EOQ A;  4GZN C;  2I13 A;  2MKD A;  2YTI A;  1TF3 A;  2EMA A;  5KL2 A;  4F2J C;  2JPA A;  2R1F A;  4X9J A;  2EN3 A;  2EOS A;  2EM3 A;  2WCC 3;  2EE8 A;  1YUI A;  2EMW A;  2D9H A;  2EMC A;  2EPC A;  2JP9 A;  1A1H A;  1A1I A;  3EPL A;  1JK1 A;  4R2C A;  3VHT B;  2WBU A;  2EPP A;  3UK3 C;  1ZR9 A;  3MHH C;  2YU8 A;  2MKN A;  2RSI A;  2EL6 A;  4F6M A;  2ENH A;  2CTD A;  2EOY A;  2EM8 A;  2EOF A;  2PRT A;  2LT7 A;  4F6N A;  2ENA A;  2E72 A;  2DRP A;  2EOX A;  4M9V C;  2EM9 A;  2EOM A;  2YTO A;  2EMG A;  5KL5 A;  2EPZ A;  2VRD A;  1DGC A;  1X5W A;  2ADR A;  5KL7 A;  2NAB A;  2YTQ A;  4IJD A;  2YTD A;  2EPX A;  1RMD A;  2CT1 A;  2EM2 A;  2YRK A;  2A25 A;  2EMZ A;  1TN9 A;  1X6E A;  2J7J A;  2EOJ A;  1KJK A;  1YSA C;  1NCS A;  5KL6 A;  2EMB A;  2EOE A;  2EM7 A;  2HGH A;  1AAY A;  2DMI A;  2LV2 A;  2YRH A;  2EQ3 A;  1JK2 A;  2EOR A;  1G2F C;  4R2D A;  1X3C A;  2YSP A;  2EOH A;  2YTE A;  1MEY C;  2EMK A;  2YSO A;  2YRM A;  2BB8 A;  2YTG A;  1UBD C;  2WBS A;  2EOZ A;  1X6F A;  1Z1B A;  2EOO A;  2MDG A;  2YTJ A;  2EN1 A;  3MHS C;  2EQ0 A;  2EPR A;  2DGC A;  2EL4 A;  2EOI A;  1A1G A;  2EN2 A;  4FK5 C;  2EM6 A;  3M99 B;  4IS1 C;  1LLM C;  1A1J A;  1A1F A;  1ZAA C;  4R2R A;  1WJP A;  2ELZ A;  2EN7 A;  3EPH A;  1F2I G;  4R2S A;  1P47 A;  5KL3 A;  2EM5 A;  2EML A;  1TF6 A;  2RPC A;  2LVH A;  2LO3 A;  2DLK A;  1UN6 B;  2ELY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...