2EL4A

Solution structure of the 15th zf-c2h2 domain from human zinc finger protein 268
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGVKPYGCSQCAKTFSLKSQLIVHQRSHTGVKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the 15th zf-C2H2 domain from human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2el4A00
2EMLA 4R2PA 3EPHA 2EPZA 2LO3A 2MKNA 2YTJA 2EMIA 4WSGA 2YTGA 2EMCA 2YTQA 2EM4A 2D9HA 2LV2A 2YU8A 2EL4A 2EL6A 1UN6B 3M99B 2EOHA 2A25A 3UK3C 2RSIA 1X6HA 2EJ4A 2ELYA 2EN1A 2PRTA 2ENCA 2EQ0A 2ADRA 1B69A 2EMGA 2I13A 5KL6A 1DGCA 2DLKA 2J7JA 1A1KA 3EPKA 3MHSC 2WBSA 1YSAC 2YTDA 1A1LA 1BB8A 4X9JA 1UBDC 2YSPA 1F2IG 2EM6A 2LT7A 1X6FA 1NCSA 2ELZA 2YRMA 2ENHA 4R2SA 1MEYC 2EMAA 2GLIA 2EMZA 2YSOA 2WBTA 4R2DA 2EORA 2EOZA 2EMKA 1Z1BA 2EPAA 2CSHA 2EOFA 1WJPA 2EE8A 2EOQA 3EPLA 4R2QA 1KJKA 2EMFA 2EP3A 2YRHA 5KL2A 4IS1C 4M9VC 1X5WA 2EM8A 1TF6A 4R2CA 2EOIA 1X3CA 2YRKA 1A1IA 1ZU1A 5KL3A 2MKDA 2EL5A 2EPRA 2YTNA 2EM2A 3EPJA 2EN3A 1TN9A 2YTFA 2RPCA 2EPUA 2CT1A 2EOOA 4FK5C 5KL5A 1G2FC 1G2DC 2ENAA 2EPPA 1TF3A 1YUJA 2DMIA 2EQ3A 2YU5A 5KL4A 5KL7A 1A1HA 1RMDA 3VHTB 2YTOA 2EMBA 2NABA 4R2EA 2JPAA 2EM5A 2EM0A 2EMYA 2YTEA 1YUIA 1JK2A 4F2JC 2YTIA 2EM7A 4F6MA 1X6EA 2DRPA 2BB8A 2EM3A 2R1FA 1A1FA 2EOJA 2EN6A 1AAYA 2EN2A 1A1JA 2MDGA 1P47A 4R2AA 1BBOA 4F6NA 2EM9A 2EOEA 2CTDA 1LLMC 2E72A 2EMXA 1JK1A 2EN7A 2EMWA 3MHHC 2HGHA 2EPXA 2EPCA 2EN8A 2EOXA 4GZNC 2EQ1A 1ZR9A 2LCEA 4R2RA 1ZAAC 2EOSA 2GHFA 2EOYA 2LVHA 2VRDA 1A1GA 2EN4A 2M9AA 2DGCA 2EMHA 4IJDA 2WCC3 2YTPA 2DLQA 2WBUA 2EOMA 2JP9A
chains in the Genus database with same CATH superfamily
1GZ6A 2JOXA 2JOBA 4R2PA 4WX9A 2MC5A 3THOB 2UXCE 4DV4E 2YTJA 2YTGA 2YTQA 4HTGA 2EM4A 3ZOQB 2D9HA 2RS7A 2LTRA 1RC7A 1T4LB 4L8NA 2YU8A 4JI2E 2EL6A 1T39A 1O0WA 5T6JA 4B3SE 1WRJA 1UN6B 2L2KB 3UK3C 2UU9E 2RSIA 2EJ4A 4WXCA 2ADRA 1B69A 2V89A 5A6AA 2EMGA 2I13A 4DV7E 2J7JA 1A1KA 3L00A 1BB8A 1A1LA 4B3TE 4X9JA 4TUGA 4WXDA 2JR1A 2EM6A 1NEIA 2EPLX 5BR8E 2EMAA 4LU9A 2YSOA 2WBTA 1YPNA 3VK6A 2LBSB 2EMKA 2KOUA 4MLQA 4DV3E 3DF6A 2EOQA 4F54A 3JU0A 1X5WA 2EPMX 4BMJA 2JVAA 1X49A 3VYXA 2V83A 1WHQA 4ZYEA 1PJSA 2YTNA 4J8ZA 4X65E 3EPJA 4WFTA 4L5NC 2V88A 4JI6E 2F8BA 1TN9A 4BHCA 2LE2A 2YTFA 2RPCA 2EPUA 4Q28A 2CT1A 4M2ZA 2K7IA 2EPPA 1HR0E 3JTZA 1N36E 5KL4A 1RMDA 4BHBA 3C4BA 2EMBA 2YZTA 2EM5A 1X47A 5IV8B 2V8QB 5AASA 1WHNA 3BF2A 5LL6R 1JK2A 1X6EA 3BIDA 4YHHE 2BB8A 2EM3A 5A6KA 1GQEA 2LUQA 3KZYA 4AQYE 2MDGA 2L92A 4R2AA 2ZM6E 2LJHA 2EM9A 3C4TA 3BBGA 4X62E 3F6GA 1QU6A 1JK1A 2EN7A 3MHHC 2MC6A 4JI3E 1IMUA 1T4OA 2LCEA 4R2RA 3OTOE 2EOSA 1PJQA 2VF1A 1T4NA 1BBGA 2EN4A 1XNQE 2M9AA 2DGCA 2H36X 4IJDA 2WZOA 2DLQA 1FJGE 2YT4A 2WBUA 2BBGA 3ADGA 2B7VA 3C6MA 4F9CB 1N33E 3EPHA 3F6HA 2LO3A 2MKNA 2EMIA 4WSGA 2LMZA 5LMNE 2NUFA 4DUZE 2ENCA 2EQ0A 1PDAA 4DR5E 5KL6A 2DLKA 3MHSC 1IQOA 2B7TA 1UBDC 4TUIA 1SFEA 2R76A 4LF7E 4LF5E 4MLVA 4KWYA 4NHRA 4Q35B 2LT7A 2L3CA 2UUCE 2HC5A 1IBLE 5F3WA 2E1MA 2ENHA 4R2SA 2VQEE 2GLIA 3JAMC 3IWBA 2EOZA 2EPNA 4JI0E 2VE7C 1X48A 2EE8A 4KHPE 4BCAA 2E5LE 1FKAE 2EP3A 5AE1A 4OOGC 2YRHA 4IS1C 2EM8A 1QNTA 2LUPB 4R2CA 2EOIA 1A1IA 1ZU1A 2MKDA 1J5EE 2EL5A 2EM2A 4F9AB 5FLXC 2G7HA 4BBYA 1EH8A 4KZSA 1J26A 4NZVA 1A1HA 1EH6A 4JYAE 2YTOA 5AE3A 5AC5A 1IBKE 1PJTA 2DMYA 3HQ1A 4BC9A 2ODRC 2YPNA 4JI7E 2YTIA 2NUEA 2I9IA 2R1FA 1GTKA 1SR9A 3KZZA 1AAYA 3DJWA 3MSWA 1BBOA 4F6NA 4X8WA 2JXPA 5LLQA 2IHR1 4DR3E 2E72A 2EMXA 3VYYA 2RTXA 2N8XA 2EN8A 4F9BB 4GZNC 4DV6E 2GHFA 4K0KE 2EOYA 5CFFE 2LTSA 4ZYGA 2GPIA 2VQFE 1PKPA 4DR6E 4YY3E 4ZYDA 1XMQE 4O4KA 3LMLA 4BS9A 3RMPA 3HPZA 2EPZA 4JI4E 2EMCA 4DUYE 5TSEA 1DQ3A 1N34E 2V85A 4DV2E 5ADZA 2EOHA 2A25A 2EN1A 2PRTA 2N3HA 3EPKA 4M0VA 1YYWA 2WBSA 1YSAC 2M7QA 4JI5E 2JY9A 2V87A 2RQLA 2L3JA 4LF8E 4DR7E 2ELZA 2YRMA 2K4VA 1MEYC 2EORA 2V86A 1Z1BA 4P7DA 4DV1E 2DSYA 2EOFA 3AV0A 2ODRD 4GEQB 3EPLA 4R2QA 2FV4B 1KJKA 4R03A 1YYOA 5KL2A 1IQSA 2JWOA 1T38A 4M9VC 3ECRA 4LFCE 5DNYA 1X3CA 2YRKA 4I8OA 5KL3A 3H09A 5AE2A 1WXRA 2EPRA 2M1SA 4B3RE 3ADJA 4O5GA 5KL5A 1G2FC 3THNA 2ENAA 1G2DC 5IXMB 1TF3A 5IT9C 2DMIA 2EZ6A 4LFAE 3J80C 4DKKA 1UILA 2L2MA 3T1YE 1STUA 3VHTB 2NABA 2JPAA 2EM0A 3J81C 1YUIA 4DV5E 2UXBE 1IBME 3AUZA 1ZBTA 4X66E 4F2JC 2EM7A 4WSPA 4F6MA 2DRPA 4O24A 1YYKA 4RH8A 2EN6A 4GKJE 1UHZA 1P47A 1A1JA 1AH5A 4RHBB 3P1XA 4O43A 2HHHE 4LF9E 2EMWA 3IWCA 1YFHA 3ADLA 2HGHA 5A69A 4DR2E 4DR4E 2EOXA 2LVHA 2VRDA 3EQ1A 1A1GA 1EH7A 4DV0E 2UXDE 3T1HE 2EMHA 2EOMA 2JP9A 2UUAE 1EKZA 2EMLA 3HXLA 2EPKX 2B3TB 5A6BA 4NXNE 2CPNA 2LV2A 4DR1E 2M4IA 2LRSA 1DI2A 2EL4A 1I94E 3M99B 1YZ9A 3KWRA 2DB2A 3J7AG 1X6HA 2N3GA 2ELYA 5A2QC 5A6JA 2EPOA 2Q8UA 3HPSA 4JI1E 1L4SA 4M30A 2KHXA 3IWDA 2DIXA 1DGCA 4P78A 3TQMA 2YTDA 1XNRE 1N32E 2YSPA 2L33A 1F2IG 3ADIA 5A6BD 2NUGA 3FIGA 1X6FA 2EWLA 1NCSA 4JI8E 1HNZE 2EMZA 4R2DA 1HNWE 4WPYA 2EPAA 2CSHA 1WJPA 2L8TA 3QG5C 2EMFA 4ZYHA 3BGHA 5AC4A 1HNXE 1TF6A 2KONA 1KYQA 2B9DA 2FTXB 3HTXA 4OX9E 2EN3A 2YWQA 3K6QA 2NA2A 4LF6E 4FK5C 2EOOA 4JV5E 2MDRA 2F4VE 4N4RB 1YUJA 2EQ3A 2RS6A 2YU5A 5KL7A 4B3ME 2L6MA 4R2EA 2YTEA 2EMYA 3OMLA 4BC7A 5IWAE 1N3GA 2HJJA 2L2NA 1RQ0A 1MGTA 3C6KA 1A1FA 2EOJA 2JYAA 4GKKE 5LMUE 2EN2A 1ZBQA 2LJUA 4DMIA 1XMOE 2EOEA 2CTDA 1LLMC 3LLHA 3J7Yp 4WYQB 4LFBE 2EPXA 2EPCA 4HEIA 2EQ1A 2FGGA 1ZR9A 4LF4E 1ZAAC 4X64E 2RSMA 4NXME 4R8OA 2UUBE 2WCC3 2YTPA 4LTYA
chains in the Genus database with same CATH topology
2EMLA 4R2PA 3EPHA 2EPZA 2LO3A 2MKNA 2YTJA 2EMIA 4WSGA 2YTGA 2EMCA 2YTQA 2EM4A 2D9HA 2LV2A 2YU8A 2EL4A 2EL6A 1UN6B 3M99B 2EOHA 2A25A 3UK3C 2RSIA 1X6HA 2EJ4A 2ELYA 2EN1A 2PRTA 2ENCA 2EQ0A 2ADRA 1B69A 2EMGA 2I13A 5KL6A 1DGCA 2DLKA 2J7JA 1A1KA 3EPKA 3MHSC 2WBSA 1YSAC 2YTDA 1A1LA 1BB8A 4X9JA 1UBDC 2YSPA 1F2IG 2EM6A 2LT7A 1X6FA 1NCSA 2ELZA 2YRMA 2ENHA 4R2SA 1MEYC 2EMAA 2GLIA 2EMZA 2YSOA 2WBTA 4R2DA 2EORA 2EOZA 2EMKA 1Z1BA 2EPAA 2CSHA 2EOFA 1WJPA 2EE8A 2EOQA 3EPLA 4R2QA 1KJKA 2EMFA 2EP3A 2YRHA 5KL2A 4IS1C 4M9VC 1X5WA 2EM8A 1TF6A 4R2CA 2EOIA 1X3CA 2YRKA 1A1IA 1ZU1A 5KL3A 2MKDA 2EL5A 2EPRA 2YTNA 2EM2A 3EPJA 2EN3A 1TN9A 2YTFA 2RPCA 2EPUA 2CT1A 2EOOA 4FK5C 5KL5A 1G2FC 1G2DC 2ENAA 2EPPA 1TF3A 1YUJA 2DMIA 2EQ3A 2YU5A 5KL4A 5KL7A 1A1HA 1RMDA 3VHTB 2YTOA 2EMBA 2NABA 4R2EA 2JPAA 2EM5A 2EM0A 2EMYA 2YTEA 1YUIA 1JK2A 4F2JC 2YTIA 2EM7A 4F6MA 1X6EA 2DRPA 2BB8A 2EM3A 2R1FA 1A1FA 2EOJA 2EN6A 1AAYA 2EN2A 1A1JA 2MDGA 1P47A 4R2AA 1BBOA 4F6NA 2EM9A 2EOEA 2CTDA 1LLMC 2E72A 2EMXA 1JK1A 2EN7A 2EMWA 3MHHC 2HGHA 2EPXA 2EPCA 2EN8A 2EOXA 4GZNC 2EQ1A 1ZR9A 2LCEA 4R2RA 1ZAAC 2EOSA 2GHFA 2EOYA 2LVHA 2VRDA 1A1GA 2EN4A 2M9AA 2DGCA 2EMHA 4IJDA 2WCC3 2YTPA 2DLQA 2WBUA 2EOMA 2JP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EML A;  4R2P A;  3EPH A;  2EPZ A;  2LO3 A;  2MKN A;  2YTJ A;  2EMI A;  4WSG A;  2YTG A;  2EMC A;  2YTQ A;  2EM4 A;  2D9H A;  2LV2 A;  2YU8 A;  2EL4 A;  2EL6 A;  1UN6 B;  3M99 B;  2EOH A;  2A25 A;  3UK3 C;  2RSI A;  1X6H A;  2EJ4 A;  2ELY A;  2EN1 A;  2PRT A;  2ENC A;  2EQ0 A;  2ADR A;  1B69 A;  2EMG A;  2I13 A;  5KL6 A;  1DGC A;  2DLK A;  2J7J A;  1A1K A;  3EPK A;  3MHS C;  2WBS A;  1YSA C;  2YTD A;  1A1L A;  1BB8 A;  4X9J A;  1UBD C;  2YSP A;  1F2I G;  2EM6 A;  2LT7 A;  1X6F A;  1NCS A;  2ELZ A;  2YRM A;  2ENH A;  4R2S A;  1MEY C;  2EMA A;  2GLI A;  2EMZ A;  2YSO A;  2WBT A;  4R2D A;  2EOR A;  2EOZ A;  2EMK A;  1Z1B A;  2EPA A;  2CSH A;  2EOF A;  1WJP A;  2EE8 A;  2EOQ A;  3EPL A;  4R2Q A;  1KJK A;  2EMF A;  2EP3 A;  2YRH A;  5KL2 A;  4IS1 C;  4M9V C;  1X5W A;  2EM8 A;  1TF6 A;  4R2C A;  2EOI A;  1X3C A;  2YRK A;  1A1I A;  1ZU1 A;  5KL3 A;  2MKD A;  2EL5 A;  2EPR A;  2YTN A;  2EM2 A;  3EPJ A;  2EN3 A;  1TN9 A;  2YTF A;  2RPC A;  2EPU A;  2CT1 A;  2EOO A;  4FK5 C;  5KL5 A;  1G2F C;  1G2D C;  2ENA A;  2EPP A;  1TF3 A;  1YUJ A;  2DMI A;  2EQ3 A;  2YU5 A;  5KL4 A;  5KL7 A;  1A1H A;  1RMD A;  3VHT B;  2YTO A;  2EMB A;  2NAB A;  4R2E A;  2JPA A;  2EM5 A;  2EM0 A;  2EMY A;  2YTE A;  1YUI A;  1JK2 A;  4F2J C;  2YTI A;  2EM7 A;  4F6M A;  1X6E A;  2DRP A;  2BB8 A;  2EM3 A;  2R1F A;  1A1F A;  2EOJ A;  2EN6 A;  1AAY A;  2EN2 A;  1A1J A;  2MDG A;  1P47 A;  4R2A A;  1BBO A;  4F6N A;  2EM9 A;  2EOE A;  2CTD A;  1LLM C;  2E72 A;  2EMX A;  1JK1 A;  2EN7 A;  2EMW A;  3MHH C;  2HGH A;  2EPX A;  2EPC A;  2EN8 A;  2EOX A;  4GZN C;  2EQ1 A;  1ZR9 A;  2LCE A;  4R2R A;  1ZAA C;  2EOS A;  2GHF A;  2EOY A;  2LVH A;  2VRD A;  1A1G A;  2EN4 A;  2M9A A;  2DGC A;  2EMH A;  4IJD A;  2WCC 3;  2YTP A;  2DLQ A;  2WBU A;  2EOM A;  2JP9 A; 
#chains in the Genus database with same CATH topology
 1GZ6 A;  2JOX A;  2JOB A;  4R2P A;  4WX9 A;  2MC5 A;  3THO B;  2UXC E;  4DV4 E;  2YTJ A;  2YTG A;  2YTQ A;  4HTG A;  2EM4 A;  3ZOQ B;  2D9H A;  2RS7 A;  2LTR A;  1RC7 A;  1T4L B;  4L8N A;  2YU8 A;  4JI2 E;  2EL6 A;  1T39 A;  1O0W A;  5T6J A;  4B3S E;  1WRJ A;  1UN6 B;  2L2K B;  3UK3 C;  2UU9 E;  2RSI A;  2EJ4 A;  4WXC A;  2ADR A;  1B69 A;  2V89 A;  5A6A A;  2EMG A;  2I13 A;  4DV7 E;  2J7J A;  1A1K A;  3L00 A;  1BB8 A;  1A1L A;  4B3T E;  4X9J A;  4TUG A;  4WXD A;  2JR1 A;  2EM6 A;  1NEI A;  2EPL X;  5BR8 E;  2EMA A;  4LU9 A;  2YSO A;  2WBT A;  1YPN A;  3VK6 A;  2LBS B;  2EMK A;  2KOU A;  4MLQ A;  4DV3 E;  3DF6 A;  2EOQ A;  4F54 A;  3JU0 A;  1X5W A;  2EPM X;  4BMJ A;  2JVA A;  1X49 A;  3VYX A;  2V83 A;  1WHQ A;  4ZYE A;  1PJS A;  2YTN A;  4J8Z A;  4X65 E;  3EPJ A;  4WFT A;  4L5N C;  2V88 A;  4JI6 E;  2F8B A;  1TN9 A;  4BHC A;  2LE2 A;  2YTF A;  2RPC A;  2EPU A;  4Q28 A;  2CT1 A;  4M2Z A;  2K7I A;  2EPP A;  1HR0 E;  3JTZ A;  1N36 E;  5KL4 A;  1RMD A;  4BHB A;  3C4B A;  2EMB A;  2YZT A;  2EM5 A;  1X47 A;  5IV8 B;  2V8Q B;  5AAS A;  1WHN A;  3BF2 A;  5LL6 R;  1JK2 A;  1X6E A;  3BID A;  4YHH E;  2BB8 A;  2EM3 A;  5A6K A;  1GQE A;  2LUQ A;  3KZY A;  4AQY E;  2MDG A;  2L92 A;  4R2A A;  2ZM6 E;  2LJH A;  2EM9 A;  3C4T A;  3BBG A;  4X62 E;  3F6G A;  1QU6 A;  1JK1 A;  2EN7 A;  3MHH C;  2MC6 A;  4JI3 E;  1IMU A;  1T4O A;  2LCE A;  4R2R A;  3OTO E;  2EOS A;  1PJQ A;  2VF1 A;  1T4N A;  1BBG A;  2EN4 A;  1XNQ E;  2M9A A;  2DGC A;  2H36 X;  4IJD A;  2WZO A;  2DLQ A;  1FJG E;  2YT4 A;  2WBU A;  2BBG A;  3ADG A;  2B7V A;  3C6M A;  4F9C B;  1N33 E;  3EPH A;  3F6H A;  2LO3 A;  2MKN A;  2EMI A;  4WSG A;  2LMZ A;  5LMN E;  2NUF A;  4DUZ E;  2ENC A;  2EQ0 A;  1PDA A;  4DR5 E;  5KL6 A;  2DLK A;  3MHS C;  1IQO A;  2B7T A;  1UBD C;  4TUI A;  1SFE A;  2R76 A;  4LF7 E;  4LF5 E;  4MLV A;  4KWY A;  4NHR A;  4Q35 B;  2LT7 A;  2L3C A;  2UUC E;  2HC5 A;  1IBL E;  5F3W A;  2E1M A;  2ENH A;  4R2S A;  2VQE E;  2GLI A;  3JAM C;  3IWB A;  2EOZ A;  2EPN A;  4JI0 E;  2VE7 C;  1X48 A;  2EE8 A;  4KHP E;  4BCA A;  2E5L E;  1FKA E;  2EP3 A;  5AE1 A;  4OOG C;  2YRH A;  4IS1 C;  2EM8 A;  1QNT A;  2LUP B;  4R2C A;  2EOI A;  1A1I A;  1ZU1 A;  2MKD A;  1J5E E;  2EL5 A;  2EM2 A;  4F9A B;  5FLX C;  2G7H A;  4BBY A;  1EH8 A;  4KZS A;  1J26 A;  4NZV A;  1A1H A;  1EH6 A;  4JYA E;  2YTO A;  5AE3 A;  5AC5 A;  1IBK E;  1PJT A;  2DMY A;  3HQ1 A;  4BC9 A;  2ODR C;  2YPN A;  4JI7 E;  2YTI A;  2NUE A;  2I9I A;  2R1F A;  1GTK A;  1SR9 A;  3KZZ A;  1AAY A;  3DJW A;  3MSW A;  1BBO A;  4F6N A;  4X8W A;  2JXP A;  5LLQ A;  2IHR 1;  4DR3 E;  2E72 A;  2EMX A;  3VYY A;  2RTX A;  2N8X A;  2EN8 A;  4F9B B;  4GZN C;  4DV6 E;  2GHF A;  4K0K E;  2EOY A;  5CFF E;  2LTS A;  4ZYG A;  2GPI A;  2VQF E;  1PKP A;  4DR6 E;  4YY3 E;  4ZYD A;  1XMQ E;  4O4K A;  3LML A;  4BS9 A;  3RMP A;  3HPZ A;  2EPZ A;  4JI4 E;  2EMC A;  4DUY E;  5TSE A;  1DQ3 A;  1N34 E;  2V85 A;  4DV2 E;  5ADZ A;  2EOH A;  2A25 A;  2EN1 A;  2PRT A;  2N3H A;  3EPK A;  4M0V A;  1YYW A;  2WBS A;  1YSA C;  2M7Q A;  4JI5 E;  2JY9 A;  2V87 A;  2RQL A;  2L3J A;  4LF8 E;  4DR7 E;  2ELZ A;  2YRM A;  2K4V A;  1MEY C;  2EOR A;  2V86 A;  1Z1B A;  4P7D A;  4DV1 E;  2DSY A;  2EOF A;  3AV0 A;  2ODR D;  4GEQ B;  3EPL A;  4R2Q A;  2FV4 B;  1KJK A;  4R03 A;  1YYO A;  5KL2 A;  1IQS A;  2JWO A;  1T38 A;  4M9V C;  3ECR A;  4LFC E;  5DNY A;  1X3C A;  2YRK A;  4I8O A;  5KL3 A;  3H09 A;  5AE2 A;  1WXR A;  2EPR A;  2M1S A;  4B3R E;  3ADJ A;  4O5G A;  5KL5 A;  1G2F C;  3THN A;  2ENA A;  1G2D C;  5IXM B;  1TF3 A;  5IT9 C;  2DMI A;  2EZ6 A;  4LFA E;  3J80 C;  4DKK A;  1UIL A;  2L2M A;  3T1Y E;  1STU A;  3VHT B;  2NAB A;  2JPA A;  2EM0 A;  3J81 C;  1YUI A;  4DV5 E;  2UXB E;  1IBM E;  3AUZ A;  1ZBT A;  4X66 E;  4F2J C;  2EM7 A;  4WSP A;  4F6M A;  2DRP A;  4O24 A;  1YYK A;  4RH8 A;  2EN6 A;  4GKJ E;  1UHZ A;  1P47 A;  1A1J A;  1AH5 A;  4RHB B;  3P1X A;  4O43 A;  2HHH E;  4LF9 E;  2EMW A;  3IWC A;  1YFH A;  3ADL A;  2HGH A;  5A69 A;  4DR2 E;  4DR4 E;  2EOX A;  2LVH A;  2VRD A;  3EQ1 A;  1A1G A;  1EH7 A;  4DV0 E;  2UXD E;  3T1H E;  2EMH A;  2EOM A;  2JP9 A;  2UUA E;  1EKZ A;  2EML A;  3HXL A;  2EPK X;  2B3T B;  5A6B A;  4NXN E;  2CPN A;  2LV2 A;  4DR1 E;  2M4I A;  2LRS A;  1DI2 A;  2EL4 A;  1I94 E;  3M99 B;  1YZ9 A;  3KWR A;  2DB2 A;  3J7A G;  1X6H A;  2N3G A;  2ELY A;  5A2Q C;  5A6J A;  2EPO A;  2Q8U A;  3HPS A;  4JI1 E;  1L4S A;  4M30 A;  2KHX A;  3IWD A;  2DIX A;  1DGC A;  4P78 A;  3TQM A;  2YTD A;  1XNR E;  1N32 E;  2YSP A;  2L33 A;  1F2I G;  3ADI A;  5A6B D;  2NUG A;  3FIG A;  1X6F A;  2EWL A;  1NCS A;  4JI8 E;  1HNZ E;  2EMZ A;  4R2D A;  1HNW E;  4WPY A;  2EPA A;  2CSH A;  1WJP A;  2L8T A;  3QG5 C;  2EMF A;  4ZYH A;  3BGH A;  5AC4 A;  1HNX E;  1TF6 A;  2KON A;  1KYQ A;  2B9D A;  2FTX B;  3HTX A;  4OX9 E;  2EN3 A;  2YWQ A;  3K6Q A;  2NA2 A;  4LF6 E;  4FK5 C;  2EOO A;  4JV5 E;  2MDR A;  2F4V E;  4N4R B;  1YUJ A;  2EQ3 A;  2RS6 A;  2YU5 A;  5KL7 A;  4B3M E;  2L6M A;  4R2E A;  2YTE A;  2EMY A;  3OML A;  4BC7 A;  5IWA E;  1N3G A;  2HJJ A;  2L2N A;  1RQ0 A;  1MGT A;  3C6K A;  1A1F A;  2EOJ A;  2JYA A;  4GKK E;  5LMU E;  2EN2 A;  1ZBQ A;  2LJU A;  4DMI A;  1XMO E;  2EOE A;  2CTD A;  1LLM C;  3LLH A;  3J7Y p;  4WYQ B;  4LFB E;  2EPX A;  2EPC A;  4HEI A;  2EQ1 A;  2FGG A;  1ZR9 A;  4LF4 E;  1ZAA C;  4X64 E;  2RSM A;  4NXM E;  4R8O A;  2UUB E;  2WCC 3;  2YTP A;  4LTY A; 
#chains in the Genus database with same CATH homology
 2EML A;  4R2P A;  3EPH A;  2EPZ A;  2LO3 A;  2MKN A;  2YTJ A;  2EMI A;  4WSG A;  2YTG A;  2EMC A;  2YTQ A;  2EM4 A;  2D9H A;  2LV2 A;  2YU8 A;  2EL4 A;  2EL6 A;  1UN6 B;  3M99 B;  2EOH A;  2A25 A;  3UK3 C;  2RSI A;  1X6H A;  2EJ4 A;  2ELY A;  2EN1 A;  2PRT A;  2ENC A;  2EQ0 A;  2ADR A;  1B69 A;  2EMG A;  2I13 A;  5KL6 A;  1DGC A;  2DLK A;  2J7J A;  1A1K A;  3EPK A;  3MHS C;  2WBS A;  1YSA C;  2YTD A;  1A1L A;  1BB8 A;  4X9J A;  1UBD C;  2YSP A;  1F2I G;  2EM6 A;  2LT7 A;  1X6F A;  1NCS A;  2ELZ A;  2YRM A;  2ENH A;  4R2S A;  1MEY C;  2EMA A;  2GLI A;  2EMZ A;  2YSO A;  2WBT A;  4R2D A;  2EOR A;  2EOZ A;  2EMK A;  1Z1B A;  2EPA A;  2CSH A;  2EOF A;  1WJP A;  2EE8 A;  2EOQ A;  3EPL A;  4R2Q A;  1KJK A;  2EMF A;  2EP3 A;  2YRH A;  5KL2 A;  4IS1 C;  4M9V C;  1X5W A;  2EM8 A;  1TF6 A;  4R2C A;  2EOI A;  1X3C A;  2YRK A;  1A1I A;  1ZU1 A;  5KL3 A;  2MKD A;  2EL5 A;  2EPR A;  2YTN A;  2EM2 A;  3EPJ A;  2EN3 A;  1TN9 A;  2YTF A;  2RPC A;  2EPU A;  2CT1 A;  2EOO A;  4FK5 C;  5KL5 A;  1G2F C;  1G2D C;  2ENA A;  2EPP A;  1TF3 A;  1YUJ A;  2DMI A;  2EQ3 A;  2YU5 A;  5KL4 A;  5KL7 A;  1A1H A;  1RMD A;  3VHT B;  2YTO A;  2EMB A;  2NAB A;  4R2E A;  2JPA A;  2EM5 A;  2EM0 A;  2EMY A;  2YTE A;  1YUI A;  1JK2 A;  4F2J C;  2YTI A;  2EM7 A;  4F6M A;  1X6E A;  2DRP A;  2BB8 A;  2EM3 A;  2R1F A;  1A1F A;  2EOJ A;  2EN6 A;  1AAY A;  2EN2 A;  1A1J A;  2MDG A;  1P47 A;  4R2A A;  1BBO A;  4F6N A;  2EM9 A;  2EOE A;  2CTD A;  1LLM C;  2E72 A;  2EMX A;  1JK1 A;  2EN7 A;  2EMW A;  3MHH C;  2HGH A;  2EPX A;  2EPC A;  2EN8 A;  2EOX A;  4GZN C;  2EQ1 A;  1ZR9 A;  2LCE A;  4R2R A;  1ZAA C;  2EOS A;  2GHF A;  2EOY A;  2LVH A;  2VRD A;  1A1G A;  2EN4 A;  2M9A A;  2DGC A;  2EMH A;  4IJD A;  2WCC 3;  2YTP A;  2DLQ A;  2WBU A;  2EOM A;  2JP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...