2EL4A

Solution structure of the 15th zf-c2h2 domain from human zinc finger protein 268
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGVKPYGCSQCAKTFSLKSQLIVHQRSHTGVKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 268
publication title Solution structure of the 15th zf-C2H2 domain from human Zinc finger protein 268
rcsb
source organism Homo sapiens
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2el4A00
2YU8A 2YTIA 3M99B 2EM0A 2ENCA 2YTOA 4X9JA 3EPLA 2YRMA 2DLKA 4GZNC 1YUIA 2EN4A 3EPJA 2JPAA 1NCSA 2A25A 2EOJA 2YSOA 3EPHA 2EN6A 1UN6B 1TN9A 2EMCA 2YTDA 2EMXA 2EOMA 2LV2A 5KL3A 5KL4A 2PRTA 4F6MA 1RMDA 2YTNA 1B69A 4R2DA 2D9HA 5KL5A 2EMFA 1MEYC 2MKNA 4M9VC 5KL2A 2EN2A 1DGCA 2EM4A 2MKDA 1X6HA 2EM8A 2EL5A 1A1IA 1Z1BA 2EMIA 1YUJA 1ZU1A 2ADRA 2EN1A 2EN7A 3UK3C 1A1JA 2DRPA 5KL7A 1X5WA 4R2QA 2GLIA 2EOFA 2YTFA 2EOXA 2EQ0A 2EP3A 2LO3A 2YTEA 2DMIA 2ENAA 1JK2A 2YTJA 2MDGA 1LLMC 1BBOA 2CTDA 1YSAC 1UBDC 3VHTB 1WJPA 1ZAAC 2WCC3 2ELZA 2EQ1A 2GHFA 4R2CA 2EM2A 2EPZA 2EOHA 2R1FA 2LT7A 2EOIA 2RSIA 2EMHA 2DGCA 1TF3A 2EPAA 4FK5C 1F2IG 2EPRA 2EMWA 4IJDA 1A1FA 2YTGA 2JP9A 1BB8A 2EQ3A 3MHHC 2EMLA 2M9AA 2EMAA 2EM7A 1A1HA 2EN8A 2EPCA 2YU5A 4R2AA 1TF6A 2EORA 2EMYA 2EL6A 2CT1A 2EM5A 2RPCA 2EM9A 2ELYA 3MHSC 1G2DC 1X3CA 2YTPA 2EPPA 2EOEA 2EMZA 2WBTA 2NABA 1X6FA 2EOYA 4R2SA 4IS1C 3EPKA 2EOSA 2EOQA 2EL4A 1X6EA 2DLQA 2EE8A 2EPXA 2BB8A 2EM6A 2CSHA 2YSPA 1KJKA 4R2PA 4R2RA 2HGHA 2YRHA 2EMBA 2ENHA 4WSGA 2E72A 2YRKA 2EMGA 1A1KA 2I13A 1G2FC 2EN3A 2EOOA 2J7JA 1AAYA 5KL6A 4F6NA 4R2EA 2WBUA 1A1GA 2LVHA 1P47A 2EM3A 1A1LA 1ZR9A 2LCEA 2WBSA 4F2JC 1JK1A 2EJ4A 2EOZA 2VRDA 2EPUA 2EMKA 2YTQA
chains in the Genus database with same CATH superfamily
3MSWA 1SR9A 1N3GA 2ENCA 4X9JA 5LMUE 2V85A 2MDRA 2EN4A 4DKKA 3EPHA 2EOJA 4TUIA 2DSYA 2EN6A 1IBKE 4MLQA 2YTDA 3ZOQB 1XNRE 2YTNA 1B69A 2EMFA 3T1YE 1MEYC 2JYAA 1GQEA 1PJSA 3IWCA 2EM8A 1A1IA 2N3GA 2EMIA 2F8BA 4YY3E 1QNTA 2ADRA 1EH6A 3KWRA 1STUA 5KL7A 1X5WA 2VF1A 2M4IA 2LJHA 4DV3E 3C4TA 5A6AA 2EP3A 3EQ1A 2B3TB 2ENAA 4Q35B 5IT9C 2K7IA 3BBGA 4M30A 4B3TE 4B3SE 4B3RE 1HNWE 3TQMA 3J81C 1UBDC 3VHTB 1WJPA 2L6MA 4DR1E 4WX9A 2I9IA 2WCC3 2EQ1A 2UUBE 2GHFA 4R2CA 2EPZA 2LT7A 2EOHA 3QG5C 3ADIA 2RSIA 2V86A 2EMHA 2EPOA 4NXNE 1TF3A 2EPAA 4DR7E 4KWYA 4OOGC 1KYQA 4LF7E 4IJDA 3J80C 4NZVA 4X65E 3DJWA 2JP9A 4RHBB 5AC5A 4NHRA 2M9AA 3KZYA 5LLQA 2EMAA 2EPLX 4ZYDA 4DV6E 2YU5A 2EORA 2EMYA 5AC4A 4DV1E 4JI2E 2L2NA 2UXDE 3BIDA 4AQYE 2EM5A 4ZYEA 2EM9A 2UU9E 5FLXC 3MHSC 1X3CA 2YTPA 2H36X 2EOEA 3RMPA 4JV5E 3LMLA 1X6FA 1YFHA 5A6BA 2EOSA 5T6JA 3AV0A 1RC7A 5IXMB 2EPXA 2YSPA 1N32E 4DUYE 4LF9E 2YRHA 5IV8B 5IWAE 2YZTA 2EWLA 4LFAE 3ECRA 2NA2A 4RH8A 5AASA 5ADZA 2NUGA 4R2EA 5AE1A 3HQ1A 1T4NA 2LVHA 3J7Yp 1PKPA 1ZR9A 2LCEA 3BF2A 2EPMX 3F6GA 4WPYA 2EMKA 2YU8A 2YTIA 3M99B 2EM0A 3EPLA 2DLKA 1YUIA 3EPJA 2JPAA 1J26A 1PJTA 4BMJA 1QU6A 2JOXA 2LV2A 4JI5E 5KL3A 2PRTA 2M7QA 1RMDA 5KL5A 2UXBE 1O0WA 4M9VC 3J7AG 4LF4E 4P78A 2EN2A 1DGCA 1X6HA 2EZ6A 3HPSA 1EKZA 2EN7A 2RTXA 4O43A 4JI0E 4JI1E 4F9CB 4X66E 2YTEA 2YTJA 2K4VA 1WHQA 2RS6A 1BBOA 2VQFE 2JR1A 4R03A 1EH7A 2EPNA 3VYYA 1UILA 4LFCE 3KZZA 1RQ0A 2EM2A 2FGGA 4GKJE 2B7TA 2EOIA 2JWOA 4HTGA 2DGCA 4K0KE 4JI6E 2KONA 2V88A 2L92A 3ADJA 4F9BB 4DV2E 2EMWA 4KZSA 1J5EE 1A1FA 2YTGA 1BB8A 2EQ3A 2LUPB 2DB2A 5A69A 2EMLA 2BBGA 4WXCA 4Q28A 3HTXA 1HNZE 2EN8A 4WFTA 2EL6A 1WRJA 2RPCA 3JU0A 2ELYA 2EPPA 1IBME 2EMZA 2NUFA 2EOYA 2VE7C 4IS1C 2V83A 3EPKA 4GKKE 2HJJA 1WXRA 1ZBQA 2JVAA 1X6EA 4F9AB 2UUCE 2BB8A 1BBGA 2EM6A 2CSHA 4N4RB 4DV5E 3JAMC 2E72A 2VQEE 3IWDA 4O24A 2I13A 1FKAE 1YZ9A 2EN3A 3BGHA 4DV0E 2WBUA 5LMNE 2LJUA 1A1GA 2B7VA 2EM3A 1A1LA 1JK1A 5AE3A 3ADGA 4WYQB 4M0VA 3FIGA 4MLVA 2YTOA 1WHNA 1XMOE 3OTOE 1IBLE 2A25A 2M1SA 1UN6B 5TSEA 2EMCA 4DR4E 1N36E 2MC5A 4DR3E 2EMXA 1YYKA 2EOMA 4BC9A 5DNYA 4DR2E 4JI7E 4JI4E 4R2DA 1T4LB 2MKNA 3OMLA 3VYXA 2L2KB 2YWQA 1YYOA 2EM4A 4JI3E 3IWBA 4OX9E 1ZU1A 2DMYA 3T1HE 3UK3C 1A1JA 2GLIA 2LMZA 4KHPE 4X64E 2EOXA 2DMIA 2MDGA 2YPNA 1LLMC 2L33A 4LF6E 1YSAC 2LBSB 4F54A 5F3WA 4DV4E 4M2ZA 2R76A 4X8WA 4BHCA 4DMIA 4J8ZA 4X62E 2R1FA 2KOUA 1HR0E 2EPRA 2LE2A 4JI8E 5BR8E 1MGTA 2F4VE 5AE2A 3MHHC 1N34E 3C6KA 2EPCA 4BS9A 4R2AA 1TF6A 4DUZE 2CT1A 4LTYA 2L8TA 2N3HA 1G2DC 2GPIA 4JYAE 1L4SA 3P1XA 4R2SA 2B9DA 1PDAA 2DIXA 1AH5A 2EOQA 2EL4A 2LTSA 4YHHE 2L2MA 2DLQA 2EE8A 4R2RA 1ZBTA 3HXLA 2RQLA 4WSGA 2YRKA 2E5LE 4DR5E 1A1KA 2YT4A 2EOOA 3THNA 2KHXA 2LRSA 2CPNA 1GTKA 1P47A 3C6MA 2FTXB 2EJ4A 2EOZA 5CFFE 1IQOA 2YRMA 2JXPA 4GZNC 2MC6A 1NCSA 2YSOA 4BCAA 1X47A 2NUEA 2V8QB 4LU9A 1TN9A 2HC5A 4NXME 2UXCE 4HEIA 5KL4A 4F6MA 1YPNA 3ADLA 2D9HA 4B3ME 5KL2A 4WXDA 2JOBA 2MKDA 2HHHE 1X49A 2EL5A 1Z1BA 4LFBE 1YUJA 2G7HA 2EN1A 5A6JA 2ODRD 2RSMA 2DRPA 4R2QA 4L8NA 2EOFA 2YTFA 2EQ0A 5A6BD 2LO3A 1JK2A 4P7DA 1T4OA 2UUAE 5LL6R 2IHR1 1NEIA 2LUQA 2CTDA 1IMUA 4TUGA 1IQSA 2LTRA 1ZAAC 1EH8A 3HPZA 2ELZA 2E1MA 3L00A 4BC7A 4ZYHA 1HNXE 2WZOA 5A2QC 1PJQA 4LF8E 4FK5C 1F2IG 4DV7E 1XNQE 1DQ3A 3F6HA 4BBYA 4L5NC 2FV4B 2L3JA 1N33E 2EM7A 1A1HA 2N8XA 3AUZA 4GEQB 2Q8UA 2ODRC 2JY9A 4I8OA 3LLHA 3JTZA 2WBTA 2NABA 4LF5E 1SFEA 3DF6A 2V87A 4R8OA 3THOB 4O4KA 3H09A 1XMQE 2RS7A 1T39A 1X48A 1KJKA 4O5GA 4R2PA 2HGHA 2V89A 3C4BA 4DR6E 2EMBA 5A6KA 2ENHA 1GZ6A 2EMGA 4BHBA 1T38A 3VK6A 2ZM6E 2EPKX 3K6QA 1G2FC 1YYWA 4ZYGA 2J7JA 1AAYA 1FJGE 5KL6A 1DI2A 4F6NA 2L3CA 2WBSA 4WSPA 4F2JC 1UHZA 1I94E 2VRDA 2EPUA 2YTQA
chains in the Genus database with same CATH topology
2YU8A 2YTIA 3M99B 2EM0A 2ENCA 2YTOA 4X9JA 3EPLA 2YRMA 2DLKA 4GZNC 1YUIA 2EN4A 3EPJA 2JPAA 1NCSA 2A25A 2EOJA 2YSOA 3EPHA 2EN6A 1UN6B 1TN9A 2EMCA 2YTDA 2EMXA 2EOMA 2LV2A 5KL3A 5KL4A 2PRTA 4F6MA 1RMDA 2YTNA 1B69A 4R2DA 2D9HA 5KL5A 2EMFA 1MEYC 2MKNA 4M9VC 5KL2A 2EN2A 1DGCA 2EM4A 2MKDA 1X6HA 2EM8A 2EL5A 1A1IA 1Z1BA 2EMIA 1YUJA 1ZU1A 2ADRA 2EN1A 2EN7A 3UK3C 1A1JA 2DRPA 5KL7A 1X5WA 4R2QA 2GLIA 2EOFA 2YTFA 2EOXA 2EQ0A 2EP3A 2LO3A 2YTEA 2DMIA 2ENAA 1JK2A 2YTJA 2MDGA 1LLMC 1BBOA 2CTDA 1YSAC 1UBDC 3VHTB 1WJPA 1ZAAC 2WCC3 2ELZA 2EQ1A 2GHFA 4R2CA 2EM2A 2EPZA 2EOHA 2R1FA 2LT7A 2EOIA 2RSIA 2EMHA 2DGCA 1TF3A 2EPAA 4FK5C 1F2IG 2EPRA 2EMWA 4IJDA 1A1FA 2YTGA 2JP9A 1BB8A 2EQ3A 3MHHC 2EMLA 2M9AA 2EMAA 2EM7A 1A1HA 2EN8A 2EPCA 2YU5A 4R2AA 1TF6A 2EORA 2EMYA 2EL6A 2CT1A 2EM5A 2RPCA 2EM9A 2ELYA 3MHSC 1G2DC 1X3CA 2YTPA 2EPPA 2EOEA 2EMZA 2WBTA 2NABA 1X6FA 2EOYA 4R2SA 4IS1C 3EPKA 2EOSA 2EOQA 2EL4A 1X6EA 2DLQA 2EE8A 2EPXA 2BB8A 2EM6A 2CSHA 2YSPA 1KJKA 4R2PA 4R2RA 2HGHA 2YRHA 2EMBA 2ENHA 4WSGA 2E72A 2YRKA 2EMGA 1A1KA 2I13A 1G2FC 2EN3A 2EOOA 2J7JA 1AAYA 5KL6A 4F6NA 4R2EA 2WBUA 1A1GA 2LVHA 1P47A 2EM3A 1A1LA 1ZR9A 2LCEA 2WBSA 4F2JC 1JK1A 2EJ4A 2EOZA 2VRDA 2EPUA 2EMKA 2YTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YU8 A;  2YTI A;  3M99 B;  2EM0 A;  2ENC A;  2YTO A;  4X9J A;  3EPL A;  2YRM A;  2DLK A;  4GZN C;  1YUI A;  2EN4 A;  3EPJ A;  2JPA A;  1NCS A;  2A25 A;  2EOJ A;  2YSO A;  3EPH A;  2EN6 A;  1UN6 B;  1TN9 A;  2EMC A;  2YTD A;  2EMX A;  2EOM A;  2LV2 A;  5KL3 A;  5KL4 A;  2PRT A;  4F6M A;  1RMD A;  2YTN A;  1B69 A;  4R2D A;  2D9H A;  5KL5 A;  2EMF A;  1MEY C;  2MKN A;  4M9V C;  5KL2 A;  2EN2 A;  1DGC A;  2EM4 A;  2MKD A;  1X6H A;  2EM8 A;  2EL5 A;  1A1I A;  1Z1B A;  2EMI A;  1YUJ A;  1ZU1 A;  2ADR A;  2EN1 A;  2EN7 A;  3UK3 C;  1A1J A;  2DRP A;  5KL7 A;  1X5W A;  4R2Q A;  2GLI A;  2EOF A;  2YTF A;  2EOX A;  2EQ0 A;  2EP3 A;  2LO3 A;  2YTE A;  2DMI A;  2ENA A;  1JK2 A;  2YTJ A;  2MDG A;  1LLM C;  1BBO A;  2CTD A;  1YSA C;  1UBD C;  3VHT B;  1WJP A;  1ZAA C;  2WCC 3;  2ELZ A;  2EQ1 A;  2GHF A;  4R2C A;  2EM2 A;  2EPZ A;  2EOH A;  2R1F A;  2LT7 A;  2EOI A;  2RSI A;  2EMH A;  2DGC A;  1TF3 A;  2EPA A;  4FK5 C;  1F2I G;  2EPR A;  2EMW A;  4IJD A;  1A1F A;  2YTG A;  2JP9 A;  1BB8 A;  2EQ3 A;  3MHH C;  2EML A;  2M9A A;  2EMA A;  2EM7 A;  1A1H A;  2EN8 A;  2EPC A;  2YU5 A;  4R2A A;  1TF6 A;  2EOR A;  2EMY A;  2EL6 A;  2CT1 A;  2EM5 A;  2RPC A;  2EM9 A;  2ELY A;  3MHS C;  1G2D C;  1X3C A;  2YTP A;  2EPP A;  2EOE A;  2EMZ A;  2WBT A;  2NAB A;  1X6F A;  2EOY A;  4R2S A;  4IS1 C;  3EPK A;  2EOS A;  2EOQ A;  2EL4 A;  1X6E A;  2DLQ A;  2EE8 A;  2EPX A;  2BB8 A;  2EM6 A;  2CSH A;  2YSP A;  1KJK A;  4R2P A;  4R2R A;  2HGH A;  2YRH A;  2EMB A;  2ENH A;  4WSG A;  2E72 A;  2YRK A;  2EMG A;  1A1K A;  2I13 A;  1G2F C;  2EN3 A;  2EOO A;  2J7J A;  1AAY A;  5KL6 A;  4F6N A;  4R2E A;  2WBU A;  1A1G A;  2LVH A;  1P47 A;  2EM3 A;  1A1L A;  1ZR9 A;  2LCE A;  2WBS A;  4F2J C;  1JK1 A;  2EJ4 A;  2EOZ A;  2VRD A;  2EPU A;  2EMK A;  2YTQ A; 
#chains in the Genus database with same CATH topology
 3MSW A;  1SR9 A;  1N3G A;  2ENC A;  4X9J A;  5LMU E;  2V85 A;  2MDR A;  2EN4 A;  4DKK A;  3EPH A;  2EOJ A;  4TUI A;  2DSY A;  2EN6 A;  1IBK E;  4MLQ A;  2YTD A;  3ZOQ B;  1XNR E;  2YTN A;  1B69 A;  2EMF A;  3T1Y E;  1MEY C;  2JYA A;  1GQE A;  1PJS A;  3IWC A;  2EM8 A;  1A1I A;  2N3G A;  2EMI A;  2F8B A;  4YY3 E;  1QNT A;  2ADR A;  1EH6 A;  3KWR A;  1STU A;  5KL7 A;  1X5W A;  2VF1 A;  2M4I A;  2LJH A;  4DV3 E;  3C4T A;  5A6A A;  2EP3 A;  3EQ1 A;  2B3T B;  2ENA A;  4Q35 B;  5IT9 C;  2K7I A;  3BBG A;  4M30 A;  4B3T E;  4B3S E;  4B3R E;  1HNW E;  3TQM A;  3J81 C;  1UBD C;  3VHT B;  1WJP A;  2L6M A;  4DR1 E;  4WX9 A;  2I9I A;  2WCC 3;  2EQ1 A;  2UUB E;  2GHF A;  4R2C A;  2EPZ A;  2LT7 A;  2EOH A;  3QG5 C;  3ADI A;  2RSI A;  2V86 A;  2EMH A;  2EPO A;  4NXN E;  1TF3 A;  2EPA A;  4DR7 E;  4KWY A;  4OOG C;  1KYQ A;  4LF7 E;  4IJD A;  3J80 C;  4NZV A;  4X65 E;  3DJW A;  2JP9 A;  4RHB B;  5AC5 A;  4NHR A;  2M9A A;  3KZY A;  5LLQ A;  2EMA A;  2EPL X;  4ZYD A;  4DV6 E;  2YU5 A;  2EOR A;  2EMY A;  5AC4 A;  4DV1 E;  4JI2 E;  2L2N A;  2UXD E;  3BID A;  4AQY E;  2EM5 A;  4ZYE A;  2EM9 A;  2UU9 E;  5FLX C;  3MHS C;  1X3C A;  2YTP A;  2H36 X;  2EOE A;  3RMP A;  4JV5 E;  3LML A;  1X6F A;  1YFH A;  5A6B A;  2EOS A;  5T6J A;  3AV0 A;  1RC7 A;  5IXM B;  2EPX A;  2YSP A;  1N32 E;  4DUY E;  4LF9 E;  2YRH A;  5IV8 B;  5IWA E;  2YZT A;  2EWL A;  4LFA E;  3ECR A;  2NA2 A;  4RH8 A;  5AAS A;  5ADZ A;  2NUG A;  4R2E A;  5AE1 A;  3HQ1 A;  1T4N A;  2LVH A;  3J7Y p;  1PKP A;  1ZR9 A;  2LCE A;  3BF2 A;  2EPM X;  3F6G A;  4WPY A;  2EMK A;  2YU8 A;  2YTI A;  3M99 B;  2EM0 A;  3EPL A;  2DLK A;  1YUI A;  3EPJ A;  2JPA A;  1J26 A;  1PJT A;  4BMJ A;  1QU6 A;  2JOX A;  2LV2 A;  4JI5 E;  5KL3 A;  2PRT A;  2M7Q A;  1RMD A;  5KL5 A;  2UXB E;  1O0W A;  4M9V C;  3J7A G;  4LF4 E;  4P78 A;  2EN2 A;  1DGC A;  1X6H A;  2EZ6 A;  3HPS A;  1EKZ A;  2EN7 A;  2RTX A;  4O43 A;  4JI0 E;  4JI1 E;  4F9C B;  4X66 E;  2YTE A;  2YTJ A;  2K4V A;  1WHQ A;  2RS6 A;  1BBO A;  2VQF E;  2JR1 A;  4R03 A;  1EH7 A;  2EPN A;  3VYY A;  1UIL A;  4LFC E;  3KZZ A;  1RQ0 A;  2EM2 A;  2FGG A;  4GKJ E;  2B7T A;  2EOI A;  2JWO A;  4HTG A;  2DGC A;  4K0K E;  4JI6 E;  2KON A;  2V88 A;  2L92 A;  3ADJ A;  4F9B B;  4DV2 E;  2EMW A;  4KZS A;  1J5E E;  1A1F A;  2YTG A;  1BB8 A;  2EQ3 A;  2LUP B;  2DB2 A;  5A69 A;  2EML A;  2BBG A;  4WXC A;  4Q28 A;  3HTX A;  1HNZ E;  2EN8 A;  4WFT A;  2EL6 A;  1WRJ A;  2RPC A;  3JU0 A;  2ELY A;  2EPP A;  1IBM E;  2EMZ A;  2NUF A;  2EOY A;  2VE7 C;  4IS1 C;  2V83 A;  3EPK A;  4GKK E;  2HJJ A;  1WXR A;  1ZBQ A;  2JVA A;  1X6E A;  4F9A B;  2UUC E;  2BB8 A;  1BBG A;  2EM6 A;  2CSH A;  4N4R B;  4DV5 E;  3JAM C;  2E72 A;  2VQE E;  3IWD A;  4O24 A;  2I13 A;  1FKA E;  1YZ9 A;  2EN3 A;  3BGH A;  4DV0 E;  2WBU A;  5LMN E;  2LJU A;  1A1G A;  2B7V A;  2EM3 A;  1A1L A;  1JK1 A;  5AE3 A;  3ADG A;  4WYQ B;  4M0V A;  3FIG A;  4MLV A;  2YTO A;  1WHN A;  1XMO E;  3OTO E;  1IBL E;  2A25 A;  2M1S A;  1UN6 B;  5TSE A;  2EMC A;  4DR4 E;  1N36 E;  2MC5 A;  4DR3 E;  2EMX A;  1YYK A;  2EOM A;  4BC9 A;  5DNY A;  4DR2 E;  4JI7 E;  4JI4 E;  4R2D A;  1T4L B;  2MKN A;  3OML A;  3VYX A;  2L2K B;  2YWQ A;  1YYO A;  2EM4 A;  4JI3 E;  3IWB A;  4OX9 E;  1ZU1 A;  2DMY A;  3T1H E;  3UK3 C;  1A1J A;  2GLI A;  2LMZ A;  4KHP E;  4X64 E;  2EOX A;  2DMI A;  2MDG A;  2YPN A;  1LLM C;  2L33 A;  4LF6 E;  1YSA C;  2LBS B;  4F54 A;  5F3W A;  4DV4 E;  4M2Z A;  2R76 A;  4X8W A;  4BHC A;  4DMI A;  4J8Z A;  4X62 E;  2R1F A;  2KOU A;  1HR0 E;  2EPR A;  2LE2 A;  4JI8 E;  5BR8 E;  1MGT A;  2F4V E;  5AE2 A;  3MHH C;  1N34 E;  3C6K A;  2EPC A;  4BS9 A;  4R2A A;  1TF6 A;  4DUZ E;  2CT1 A;  4LTY A;  2L8T A;  2N3H A;  1G2D C;  2GPI A;  4JYA E;  1L4S A;  3P1X A;  4R2S A;  2B9D A;  1PDA A;  2DIX A;  1AH5 A;  2EOQ A;  2EL4 A;  2LTS A;  4YHH E;  2L2M A;  2DLQ A;  2EE8 A;  4R2R A;  1ZBT A;  3HXL A;  2RQL A;  4WSG A;  2YRK A;  2E5L E;  4DR5 E;  1A1K A;  2YT4 A;  2EOO A;  3THN A;  2KHX A;  2LRS A;  2CPN A;  1GTK A;  1P47 A;  3C6M A;  2FTX B;  2EJ4 A;  2EOZ A;  5CFF E;  1IQO A;  2YRM A;  2JXP A;  4GZN C;  2MC6 A;  1NCS A;  2YSO A;  4BCA A;  1X47 A;  2NUE A;  2V8Q B;  4LU9 A;  1TN9 A;  2HC5 A;  4NXM E;  2UXC E;  4HEI A;  5KL4 A;  4F6M A;  1YPN A;  3ADL A;  2D9H A;  4B3M E;  5KL2 A;  4WXD A;  2JOB A;  2MKD A;  2HHH E;  1X49 A;  2EL5 A;  1Z1B A;  4LFB E;  1YUJ A;  2G7H A;  2EN1 A;  5A6J A;  2ODR D;  2RSM A;  2DRP A;  4R2Q A;  4L8N A;  2EOF A;  2YTF A;  2EQ0 A;  5A6B D;  2LO3 A;  1JK2 A;  4P7D A;  1T4O A;  2UUA E;  5LL6 R;  2IHR 1;  1NEI A;  2LUQ A;  2CTD A;  1IMU A;  4TUG A;  1IQS A;  2LTR A;  1ZAA C;  1EH8 A;  3HPZ A;  2ELZ A;  2E1M A;  3L00 A;  4BC7 A;  4ZYH A;  1HNX E;  2WZO A;  5A2Q C;  1PJQ A;  4LF8 E;  4FK5 C;  1F2I G;  4DV7 E;  1XNQ E;  1DQ3 A;  3F6H A;  4BBY A;  4L5N C;  2FV4 B;  2L3J A;  1N33 E;  2EM7 A;  1A1H A;  2N8X A;  3AUZ A;  4GEQ B;  2Q8U A;  2ODR C;  2JY9 A;  4I8O A;  3LLH A;  3JTZ A;  2WBT A;  2NAB A;  4LF5 E;  1SFE A;  3DF6 A;  2V87 A;  4R8O A;  3THO B;  4O4K A;  3H09 A;  1XMQ E;  2RS7 A;  1T39 A;  1X48 A;  1KJK A;  4O5G A;  4R2P A;  2HGH A;  2V89 A;  3C4B A;  4DR6 E;  2EMB A;  5A6K A;  2ENH A;  1GZ6 A;  2EMG A;  4BHB A;  1T38 A;  3VK6 A;  2ZM6 E;  2EPK X;  3K6Q A;  1G2F C;  1YYW A;  4ZYG A;  2J7J A;  1AAY A;  1FJG E;  5KL6 A;  1DI2 A;  4F6N A;  2L3C A;  2WBS A;  4WSP A;  4F2J C;  1UHZ A;  1I94 E;  2VRD A;  2EPU A;  2YTQ A; 
#chains in the Genus database with same CATH homology
 2YU8 A;  2YTI A;  3M99 B;  2EM0 A;  2ENC A;  2YTO A;  4X9J A;  3EPL A;  2YRM A;  2DLK A;  4GZN C;  1YUI A;  2EN4 A;  3EPJ A;  2JPA A;  1NCS A;  2A25 A;  2EOJ A;  2YSO A;  3EPH A;  2EN6 A;  1UN6 B;  1TN9 A;  2EMC A;  2YTD A;  2EMX A;  2EOM A;  2LV2 A;  5KL3 A;  5KL4 A;  2PRT A;  4F6M A;  1RMD A;  2YTN A;  1B69 A;  4R2D A;  2D9H A;  5KL5 A;  2EMF A;  1MEY C;  2MKN A;  4M9V C;  5KL2 A;  2EN2 A;  1DGC A;  2EM4 A;  2MKD A;  1X6H A;  2EM8 A;  2EL5 A;  1A1I A;  1Z1B A;  2EMI A;  1YUJ A;  1ZU1 A;  2ADR A;  2EN1 A;  2EN7 A;  3UK3 C;  1A1J A;  2DRP A;  5KL7 A;  1X5W A;  4R2Q A;  2GLI A;  2EOF A;  2YTF A;  2EOX A;  2EQ0 A;  2EP3 A;  2LO3 A;  2YTE A;  2DMI A;  2ENA A;  1JK2 A;  2YTJ A;  2MDG A;  1LLM C;  1BBO A;  2CTD A;  1YSA C;  1UBD C;  3VHT B;  1WJP A;  1ZAA C;  2WCC 3;  2ELZ A;  2EQ1 A;  2GHF A;  4R2C A;  2EM2 A;  2EPZ A;  2EOH A;  2R1F A;  2LT7 A;  2EOI A;  2RSI A;  2EMH A;  2DGC A;  1TF3 A;  2EPA A;  4FK5 C;  1F2I G;  2EPR A;  2EMW A;  4IJD A;  1A1F A;  2YTG A;  2JP9 A;  1BB8 A;  2EQ3 A;  3MHH C;  2EML A;  2M9A A;  2EMA A;  2EM7 A;  1A1H A;  2EN8 A;  2EPC A;  2YU5 A;  4R2A A;  1TF6 A;  2EOR A;  2EMY A;  2EL6 A;  2CT1 A;  2EM5 A;  2RPC A;  2EM9 A;  2ELY A;  3MHS C;  1G2D C;  1X3C A;  2YTP A;  2EPP A;  2EOE A;  2EMZ A;  2WBT A;  2NAB A;  1X6F A;  2EOY A;  4R2S A;  4IS1 C;  3EPK A;  2EOS A;  2EOQ A;  2EL4 A;  1X6E A;  2DLQ A;  2EE8 A;  2EPX A;  2BB8 A;  2EM6 A;  2CSH A;  2YSP A;  1KJK A;  4R2P A;  4R2R A;  2HGH A;  2YRH A;  2EMB A;  2ENH A;  4WSG A;  2E72 A;  2YRK A;  2EMG A;  1A1K A;  2I13 A;  1G2F C;  2EN3 A;  2EOO A;  2J7J A;  1AAY A;  5KL6 A;  4F6N A;  4R2E A;  2WBU A;  1A1G A;  2LVH A;  1P47 A;  2EM3 A;  1A1L A;  1ZR9 A;  2LCE A;  2WBS A;  4F2J C;  1JK1 A;  2EJ4 A;  2EOZ A;  2VRD A;  2EPU A;  2EMK A;  2YTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...