2EL4A

Solution structure of the 15th zf-c2h2 domain from human zinc finger protein 268
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGVKPYGCSQCAKTFSLKSQLIVHQRSHTGVKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the 15th zf-C2H2 domain from human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 268
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2el4A00
2EQ0A 2EMXA 1YSAC 2EOJA 2EOOA 1BB8A 4R2RA 1B69A 2DLQA 5KL4A 1X3CA 2YU8A 2EN6A 1X6HA 2EQ1A 2WBSA 2EPUA 1A1FA 2EM8A 4R2PA 2WBTA 1ZR9A 2EMHA 2EMKA 2YTPA 4GZNC 2BB8A 2VRDA 3M99B 2D9HA 2EM0A 2A25A 2ADRA 2EE8A 2EOEA 2EM4A 2EMFA 2WCC3 2LT7A 2EM7A 2EOXA 2GHFA 2I13A 1WJPA 2YTEA 1A1KA 5KL2A 2ENCA 2EOIA 3EPLA 2EM3A 4R2AA 1TF3A 2EOSA 2YTFA 2CT1A 2EORA 2EOHA 1A1IA 4R2DA 2RPCA 2DRPA 2ENHA 1A1JA 2LV2A 2EQ3A 1G2FC 2EPPA 2EN7A 2EL5A 2EOMA 2GLIA 2E72A 2ELYA 2EPXA 2EOQA 4R2EA 2EMIA 2DGCA 1X5WA 2YTNA 2EPAA 2EOZA 2ELZA 2DMIA 2YSOA 2JPAA 2EM9A 5KL5A 1BBOA 1F2IG 4F6NA 1TN9A 2EPRA 1Z1BA 5KL7A 2YRHA 3EPKA 2RSIA 2EM6A 2WBUA 1AAYA 1MEYC 1UBDC 2DLKA 2ENAA 2YTOA 4R2CA 2LVHA 1JK1A 1ZAAC 2YTJA 4F2JC 4F6MA 2LO3A 4WSGA 2EN1A 2PRTA 2EOYA 1YUIA 1X6EA 1A1HA 2YSPA 2CSHA 2CTDA 2EM2A 2R1FA 1LLMC 2YTGA 4X9JA 2EN2A 1ZU1A 1UN6B 1NCSA 2EMLA 2HGHA 4FK5C 2MKNA 3EPJA 2EMZA 2EP3A 4R2QA 2EMYA 2EN8A 2EMBA 3UK3C 4IJDA 3VHTB 2EOFA 2EN3A 1TF6A 2EJ4A 2YTQA 2JP9A 1JK2A 1KJKA 2M9AA 4IS1C 2EMWA 2EM5A 1P47A 1A1LA 2EPCA 2MDGA 1RMDA 5KL6A 2YTIA 2J7JA 2MKDA 2NABA 2YU5A 1A1GA 2EMCA 2EPZA 4M9VC 3EPHA 2LCEA 2EL6A 1G2DC 2EN4A 2YRKA 2EMAA 5KL3A 3MHHC 1X6FA 1YUJA 1DGCA 3MHSC 2YRMA 2EMGA 2YTDA 2EL4A 4R2SA
chains in the Genus database with same CATH superfamily
2EQ0A 3FIGA 2EMXA 2E5LE 1XMOE 1EH7A 1UHZA 4R2RA 2LUPB 3QG5C 4K0KE 3HPZA 1ZBQA 4BCAA 4JI5E 2EN6A 2JOXA 2L33A 1X6HA 2EPUA 1YFHA 2E1MA 4J8ZA 2JY9A 1HNWE 1PKPA 2DIXA 2YTPA 3KWRA 4BC9A 2B7TA 4X66E 2EM4A 2LT7A 4WFTA 2EOXA 2B9DA 1QNTA 1N32E 2YTEA 4NXME 3ADIA 5KL2A 2EOIA 4JI2E 3EPLA 1DQ3A 1XNQE 2IHR1 3ZOQB 2EORA 2EPMX 4Q35B 2EPPA 2EN7A 4BHCA 4KWYA 5LMNE 2ELYA 2EPXA 5A2QC 2EPKX 2DGCA 4DV2E 2YTNA 2EPAA 3H09A 4YHHE 2ELZA 1WXRA 2VF1A 4I8OA 2YRHA 2V85A 2L6MA 2EM6A 1MEYC 4MLQA 1L4SA 1UBDC 4L8NA 2DLKA 2ENAA 4DV4E 2ZM6E 4F2JC 2N3GA 4OX9E 1YZ9A 4DKKA 5F3WA 4WSGA 1YUIA 2VQEE 1N3GA 3THNA 1IQSA 1IBLE 2EN2A 1ZU1A 2UU9E 2M1SA 4MLVA 2L3JA 1SR9A 2RS7A 3T1YE 2MKNA 4R2QA 3BGHA 5IWAE 1J26A 4HTGA 2EOFA 4JV5E 2YTQA 2JP9A 1WHQA 1O0WA 2EMWA 2EM5A 1A1LA 1T39A 3OMLA 1RMDA 2F8BA 3KZYA 2EMCA 2EPZA 4M9VC 1BBGA 5A6JA 1NEIA 3MHHC 1YUJA 2WZOA 3AV0A 2YRMA 3F6GA 4F54A 4O4KA 4LTYA 1N33E 4R2SA 4JI8E 2EOJA 4X62E 1FJGE 3HQ1A 4TUGA 2UUCE 5AE1A 1FKAE 4DMIA 4B3RE 1I94E 4X64E 4DV3E 4LF5E 3VYXA 5A69A 2WBSA 1A1FA 1DI2A 2VE7C 2UUAE 2EMHA 3ADJA 4GZNC 1KYQA 2D9HA 2A25A 2EE8A 2Q8UA 3OTOE 2EMFA 3RMPA 2EM7A 3J7Yp 3J80C 2EWLA 4M30A 2RS6A 3T1HE 2FTXB 2MDRA 1A1KA 4O24A 4JI1E 4WXDA 4NXNE 2YZTA 3MSWA 2CT1A 1A1IA 2B7VA 4R2DA 2RPCA 2DRPA 2ENHA 1XNRE 2L2NA 2EL5A 2E72A 2L2KB 1QU6A 4DUZE 2EPOA 2LJUA 4R2EA 2EMIA 4LF8E 2YSOA 2JPAA 2EM9A 5KL5A 1PJSA 1N36E 4WSPA 1TN9A 2EPRA 2CPNA 3HTXA 2V86A 4RHBB 2LVHA 4LFAE 1YYKA 2NUGA 2YT4A 1HNXE 4WYQB 1PJTA 5AASA 1N34E 2EOYA 4JI7E 1GQEA 5A6AA 2CSHA 1LLMC 2EM2A 3IWCA 2YTGA 1IBME 2R76A 4ZYHA 4F9AB 4FK5C 4GKKE 1PDAA 5TSEA 4KZSA 3VHTB 2L3CA 2MC6A 4P7DA 4DR2E 1TF6A 4GKJE 4LFBE 2EPCA 2MDGA 2EL4A 1A1GA 5LMUE 4LF7E 3P1XA 5AC4A 4N4RB 2EN4A 2YRKA 4DV1E 4KHPE 2NUEA 4O43A 1YYWA 2LE2A 1RC7A 4DR4E 4R8OA 2EMGA 2H36X 5IV8B 1X47A 4JI6E 2EOOA 2N3HA 4BS9A 3JAMC 1B69A 5A6KA 5KL4A 2HJJA 1YYOA 3LMLA 2F4VE 2UXCE 3ADLA 2EM8A 4R2PA 2EMKA 4GEQB 2JR1A 2HC5A 4ZYDA 2EPNA 2V88A 2BB8A 3M99B 1GZ6A 2ADRA 2EOEA 2V87A 4BBYA 4B3ME 3IWDA 4DV0E 2I13A 1PJQA 5FLXC 2V83A 2EZ6A 4NZVA 2EM3A 2FGGA 1HNZE 4R2AA 1TF3A 2EOSA 2YTFA 2UXDE 3AUZA 5ADZA 5AE2A 1A1JA 2GLIA 1G2FC 2UUBE 3VK6A 4WX9A 4X65E 5IT9C 2EOQA 4WXCA 4JI4E 1X5WA 2V89A 2JYAA 2DMIA 4DR5E 1BBOA 1F2IG 4F6NA 5IXMB 4LF6E 4RH8A 1Z1BA 5KL7A 1IQOA 5A6BD 1YPNA 4YY3E 2JOBA 4LF9E 1WRJA 1JK1A 2YPNA 3ADGA 1T4LB 2YTJA 1GTKA 4Q28A 4BC7A 4F6MA 2PRTA 2FV4B 1X6EA 2KOUA 2N8XA 1A1HA 4TUIA 2YSPA 2R1FA 2RSMA 4X9JA 1UILA 1T4NA 1AH5A 1UN6B 1WHNA 1NCSA 2EMLA 3JU0A 1IMUA 2LJHA 3C6KA 4R03A 4WPYA 2EN8A 3THOB 2LMZA 3IWBA 1RQ0A 4BHBA 4L5NC 1HR0E 4LF4E 4JYAE 2EN3A 2JVAA 2HHHE 2I9IA 2M9AA 5LL6R 4NHRA 4IS1C 3K6QA 2YU5A 2RQLA 3JTZA 2LCEA 3KZZA 2VQFE 1J5EE 2MC5A 2EPLX 4LU9A 3MHSC 4DUYE 2YWQA 3C6MA 1EKZA 1SFEA 1YSAC 1BB8A 3BIDA 2DSYA 2DLQA 2LUQA 2LBSB 1X3CA 2YU8A 2JWOA 2LTSA 4DR6E 2UXBE 1STUA 2NUFA 4JI0E 1X48A 2EQ1A 4LFCE 3BBGA 2DMYA 3DF6A 2WBTA 3HPSA 1ZR9A 5AE3A 5T6JA 2VRDA 4BMJA 2EM0A 4DR1E 4JI3E 2WCC3 5CFFE 2GHFA 1ZBTA 1WJPA 2L92A 2ENCA 4DR7E 1EH6A 2BBGA 4DV7E 4F9CB 4DR3E 2EOHA 3F6HA 2LV2A 2EQ3A 3DJWA 4AQYE 2EOMA 2K4VA 2KONA 2DB2A 2GPIA 4M2ZA 1EH8A 2EOZA 4OOGC 5LLQA 2RTXA 4DV5E 4ZYGA 4P78A 2V8QB 2B3TB 3ECRA 4O5GA 3EPKA 2RSIA 2WBUA 1AAYA 2YTOA 4R2CA 1XMQE 3L00A 4HEIA 1ZAAC 2LO3A 2KHXA 2JXPA 2EN1A 4B3SE 2G7HA 3C4BA 2ODRD 3C4TA 2CTDA 3EQ1A 2L8TA 2K7IA 5A6BA 1IBKE 4ZYEA 2LTRA 2HGHA 5DNYA 3EPJA 2EMZA 2EP3A 2ODRC 4F9BB 2EMYA 2EMBA 3UK3C 4IJDA 2M4IA 2EJ4A 3HXLA 1T4OA 3LLHA 1JK2A 1KJKA 4B3TE 3VYYA 2M7QA 1P47A 5BR8E 5KL6A 2YTIA 3J81C 2J7JA 2MKDA 3BF2A 3TQMA 2NABA 3J7AG 1T38A 3EPHA 1G2DC 2EL6A 2EMAA 1MGTA 5KL3A 1X6FA 4X8WA 5AC5A 4M0VA 1DGCA 2LRSA 4DV6E 2NA2A 1X49A 2YTDA 2L2MA
chains in the Genus database with same CATH topology
2EQ0A 2EMXA 1YSAC 2EOJA 2EOOA 1BB8A 4R2RA 1B69A 2DLQA 5KL4A 1X3CA 2YU8A 2EN6A 1X6HA 2EQ1A 2WBSA 2EPUA 1A1FA 2EM8A 4R2PA 2WBTA 1ZR9A 2EMHA 2EMKA 2YTPA 4GZNC 2BB8A 2VRDA 3M99B 2D9HA 2EM0A 2A25A 2ADRA 2EE8A 2EOEA 2EM4A 2EMFA 2WCC3 2LT7A 2EM7A 2EOXA 2GHFA 2I13A 1WJPA 2YTEA 1A1KA 5KL2A 2ENCA 2EOIA 3EPLA 2EM3A 4R2AA 1TF3A 2EOSA 2YTFA 2CT1A 2EORA 2EOHA 1A1IA 4R2DA 2RPCA 2DRPA 2ENHA 1A1JA 2LV2A 2EQ3A 1G2FC 2EPPA 2EN7A 2EL5A 2EOMA 2GLIA 2E72A 2ELYA 2EPXA 2EOQA 4R2EA 2EMIA 2DGCA 1X5WA 2YTNA 2EPAA 2EOZA 2ELZA 2DMIA 2YSOA 2JPAA 2EM9A 5KL5A 1BBOA 1F2IG 4F6NA 1TN9A 2EPRA 1Z1BA 5KL7A 2YRHA 3EPKA 2RSIA 2EM6A 2WBUA 1AAYA 1MEYC 1UBDC 2DLKA 2ENAA 2YTOA 4R2CA 2LVHA 1JK1A 1ZAAC 2YTJA 4F2JC 4F6MA 2LO3A 4WSGA 2EN1A 2PRTA 2EOYA 1YUIA 1X6EA 1A1HA 2YSPA 2CSHA 2CTDA 2EM2A 2R1FA 1LLMC 2YTGA 4X9JA 2EN2A 1ZU1A 1UN6B 1NCSA 2EMLA 2HGHA 4FK5C 2MKNA 3EPJA 2EMZA 2EP3A 4R2QA 2EMYA 2EN8A 2EMBA 3UK3C 4IJDA 3VHTB 2EOFA 2EN3A 1TF6A 2EJ4A 2YTQA 2JP9A 1JK2A 1KJKA 2M9AA 4IS1C 2EMWA 2EM5A 1P47A 1A1LA 2EPCA 2MDGA 1RMDA 5KL6A 2YTIA 2J7JA 2MKDA 2NABA 2YU5A 1A1GA 2EMCA 2EPZA 4M9VC 3EPHA 2LCEA 2EL6A 1G2DC 2EN4A 2YRKA 2EMAA 5KL3A 3MHHC 1X6FA 1YUJA 1DGCA 3MHSC 2YRMA 2EMGA 2YTDA 2EL4A 4R2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQ0 A;  2EMX A;  1YSA C;  2EOJ A;  2EOO A;  1BB8 A;  4R2R A;  1B69 A;  2DLQ A;  5KL4 A;  1X3C A;  2YU8 A;  2EN6 A;  1X6H A;  2EQ1 A;  2WBS A;  2EPU A;  1A1F A;  2EM8 A;  4R2P A;  2WBT A;  1ZR9 A;  2EMH A;  2EMK A;  2YTP A;  4GZN C;  2BB8 A;  2VRD A;  3M99 B;  2D9H A;  2EM0 A;  2A25 A;  2ADR A;  2EE8 A;  2EOE A;  2EM4 A;  2EMF A;  2WCC 3;  2LT7 A;  2EM7 A;  2EOX A;  2GHF A;  2I13 A;  1WJP A;  2YTE A;  1A1K A;  5KL2 A;  2ENC A;  2EOI A;  3EPL A;  2EM3 A;  4R2A A;  1TF3 A;  2EOS A;  2YTF A;  2CT1 A;  2EOR A;  2EOH A;  1A1I A;  4R2D A;  2RPC A;  2DRP A;  2ENH A;  1A1J A;  2LV2 A;  2EQ3 A;  1G2F C;  2EPP A;  2EN7 A;  2EL5 A;  2EOM A;  2GLI A;  2E72 A;  2ELY A;  2EPX A;  2EOQ A;  4R2E A;  2EMI A;  2DGC A;  1X5W A;  2YTN A;  2EPA A;  2EOZ A;  2ELZ A;  2DMI A;  2YSO A;  2JPA A;  2EM9 A;  5KL5 A;  1BBO A;  1F2I G;  4F6N A;  1TN9 A;  2EPR A;  1Z1B A;  5KL7 A;  2YRH A;  3EPK A;  2RSI A;  2EM6 A;  2WBU A;  1AAY A;  1MEY C;  1UBD C;  2DLK A;  2ENA A;  2YTO A;  4R2C A;  2LVH A;  1JK1 A;  1ZAA C;  2YTJ A;  4F2J C;  4F6M A;  2LO3 A;  4WSG A;  2EN1 A;  2PRT A;  2EOY A;  1YUI A;  1X6E A;  1A1H A;  2YSP A;  2CSH A;  2CTD A;  2EM2 A;  2R1F A;  1LLM C;  2YTG A;  4X9J A;  2EN2 A;  1ZU1 A;  1UN6 B;  1NCS A;  2EML A;  2HGH A;  4FK5 C;  2MKN A;  3EPJ A;  2EMZ A;  2EP3 A;  4R2Q A;  2EMY A;  2EN8 A;  2EMB A;  3UK3 C;  4IJD A;  3VHT B;  2EOF A;  2EN3 A;  1TF6 A;  2EJ4 A;  2YTQ A;  2JP9 A;  1JK2 A;  1KJK A;  2M9A A;  4IS1 C;  2EMW A;  2EM5 A;  1P47 A;  1A1L A;  2EPC A;  2MDG A;  1RMD A;  5KL6 A;  2YTI A;  2J7J A;  2MKD A;  2NAB A;  2YU5 A;  1A1G A;  2EMC A;  2EPZ A;  4M9V C;  3EPH A;  2LCE A;  2EL6 A;  1G2D C;  2EN4 A;  2YRK A;  2EMA A;  5KL3 A;  3MHH C;  1X6F A;  1YUJ A;  1DGC A;  3MHS C;  2YRM A;  2EMG A;  2YTD A;  2EL4 A;  4R2S A; 
#chains in the Genus database with same CATH topology
 2EQ0 A;  3FIG A;  2EMX A;  2E5L E;  1XMO E;  1EH7 A;  1UHZ A;  4R2R A;  2LUP B;  3QG5 C;  4K0K E;  3HPZ A;  1ZBQ A;  4BCA A;  4JI5 E;  2EN6 A;  2JOX A;  2L33 A;  1X6H A;  2EPU A;  1YFH A;  2E1M A;  4J8Z A;  2JY9 A;  1HNW E;  1PKP A;  2DIX A;  2YTP A;  3KWR A;  4BC9 A;  2B7T A;  4X66 E;  2EM4 A;  2LT7 A;  4WFT A;  2EOX A;  2B9D A;  1QNT A;  1N32 E;  2YTE A;  4NXM E;  3ADI A;  5KL2 A;  2EOI A;  4JI2 E;  3EPL A;  1DQ3 A;  1XNQ E;  2IHR 1;  3ZOQ B;  2EOR A;  2EPM X;  4Q35 B;  2EPP A;  2EN7 A;  4BHC A;  4KWY A;  5LMN E;  2ELY A;  2EPX A;  5A2Q C;  2EPK X;  2DGC A;  4DV2 E;  2YTN A;  2EPA A;  3H09 A;  4YHH E;  2ELZ A;  1WXR A;  2VF1 A;  4I8O A;  2YRH A;  2V85 A;  2L6M A;  2EM6 A;  1MEY C;  4MLQ A;  1L4S A;  1UBD C;  4L8N A;  2DLK A;  2ENA A;  4DV4 E;  2ZM6 E;  4F2J C;  2N3G A;  4OX9 E;  1YZ9 A;  4DKK A;  5F3W A;  4WSG A;  1YUI A;  2VQE E;  1N3G A;  3THN A;  1IQS A;  1IBL E;  2EN2 A;  1ZU1 A;  2UU9 E;  2M1S A;  4MLV A;  2L3J A;  1SR9 A;  2RS7 A;  3T1Y E;  2MKN A;  4R2Q A;  3BGH A;  5IWA E;  1J26 A;  4HTG A;  2EOF A;  4JV5 E;  2YTQ A;  2JP9 A;  1WHQ A;  1O0W A;  2EMW A;  2EM5 A;  1A1L A;  1T39 A;  3OML A;  1RMD A;  2F8B A;  3KZY A;  2EMC A;  2EPZ A;  4M9V C;  1BBG A;  5A6J A;  1NEI A;  3MHH C;  1YUJ A;  2WZO A;  3AV0 A;  2YRM A;  3F6G A;  4F54 A;  4O4K A;  4LTY A;  1N33 E;  4R2S A;  4JI8 E;  2EOJ A;  4X62 E;  1FJG E;  3HQ1 A;  4TUG A;  2UUC E;  5AE1 A;  1FKA E;  4DMI A;  4B3R E;  1I94 E;  4X64 E;  4DV3 E;  4LF5 E;  3VYX A;  5A69 A;  2WBS A;  1A1F A;  1DI2 A;  2VE7 C;  2UUA E;  2EMH A;  3ADJ A;  4GZN C;  1KYQ A;  2D9H A;  2A25 A;  2EE8 A;  2Q8U A;  3OTO E;  2EMF A;  3RMP A;  2EM7 A;  3J7Y p;  3J80 C;  2EWL A;  4M30 A;  2RS6 A;  3T1H E;  2FTX B;  2MDR A;  1A1K A;  4O24 A;  4JI1 E;  4WXD A;  4NXN E;  2YZT A;  3MSW A;  2CT1 A;  1A1I A;  2B7V A;  4R2D A;  2RPC A;  2DRP A;  2ENH A;  1XNR E;  2L2N A;  2EL5 A;  2E72 A;  2L2K B;  1QU6 A;  4DUZ E;  2EPO A;  2LJU A;  4R2E A;  2EMI A;  4LF8 E;  2YSO A;  2JPA A;  2EM9 A;  5KL5 A;  1PJS A;  1N36 E;  4WSP A;  1TN9 A;  2EPR A;  2CPN A;  3HTX A;  2V86 A;  4RHB B;  2LVH A;  4LFA E;  1YYK A;  2NUG A;  2YT4 A;  1HNX E;  4WYQ B;  1PJT A;  5AAS A;  1N34 E;  2EOY A;  4JI7 E;  1GQE A;  5A6A A;  2CSH A;  1LLM C;  2EM2 A;  3IWC A;  2YTG A;  1IBM E;  2R76 A;  4ZYH A;  4F9A B;  4FK5 C;  4GKK E;  1PDA A;  5TSE A;  4KZS A;  3VHT B;  2L3C A;  2MC6 A;  4P7D A;  4DR2 E;  1TF6 A;  4GKJ E;  4LFB E;  2EPC A;  2MDG A;  2EL4 A;  1A1G A;  5LMU E;  4LF7 E;  3P1X A;  5AC4 A;  4N4R B;  2EN4 A;  2YRK A;  4DV1 E;  4KHP E;  2NUE A;  4O43 A;  1YYW A;  2LE2 A;  1RC7 A;  4DR4 E;  4R8O A;  2EMG A;  2H36 X;  5IV8 B;  1X47 A;  4JI6 E;  2EOO A;  2N3H A;  4BS9 A;  3JAM C;  1B69 A;  5A6K A;  5KL4 A;  2HJJ A;  1YYO A;  3LML A;  2F4V E;  2UXC E;  3ADL A;  2EM8 A;  4R2P A;  2EMK A;  4GEQ B;  2JR1 A;  2HC5 A;  4ZYD A;  2EPN A;  2V88 A;  2BB8 A;  3M99 B;  1GZ6 A;  2ADR A;  2EOE A;  2V87 A;  4BBY A;  4B3M E;  3IWD A;  4DV0 E;  2I13 A;  1PJQ A;  5FLX C;  2V83 A;  2EZ6 A;  4NZV A;  2EM3 A;  2FGG A;  1HNZ E;  4R2A A;  1TF3 A;  2EOS A;  2YTF A;  2UXD E;  3AUZ A;  5ADZ A;  5AE2 A;  1A1J A;  2GLI A;  1G2F C;  2UUB E;  3VK6 A;  4WX9 A;  4X65 E;  5IT9 C;  2EOQ A;  4WXC A;  4JI4 E;  1X5W A;  2V89 A;  2JYA A;  2DMI A;  4DR5 E;  1BBO A;  1F2I G;  4F6N A;  5IXM B;  4LF6 E;  4RH8 A;  1Z1B A;  5KL7 A;  1IQO A;  5A6B D;  1YPN A;  4YY3 E;  2JOB A;  4LF9 E;  1WRJ A;  1JK1 A;  2YPN A;  3ADG A;  1T4L B;  2YTJ A;  1GTK A;  4Q28 A;  4BC7 A;  4F6M A;  2PRT A;  2FV4 B;  1X6E A;  2KOU A;  2N8X A;  1A1H A;  4TUI A;  2YSP A;  2R1F A;  2RSM A;  4X9J A;  1UIL A;  1T4N A;  1AH5 A;  1UN6 B;  1WHN A;  1NCS A;  2EML A;  3JU0 A;  1IMU A;  2LJH A;  3C6K A;  4R03 A;  4WPY A;  2EN8 A;  3THO B;  2LMZ A;  3IWB A;  1RQ0 A;  4BHB A;  4L5N C;  1HR0 E;  4LF4 E;  4JYA E;  2EN3 A;  2JVA A;  2HHH E;  2I9I A;  2M9A A;  5LL6 R;  4NHR A;  4IS1 C;  3K6Q A;  2YU5 A;  2RQL A;  3JTZ A;  2LCE A;  3KZZ A;  2VQF E;  1J5E E;  2MC5 A;  2EPL X;  4LU9 A;  3MHS C;  4DUY E;  2YWQ A;  3C6M A;  1EKZ A;  1SFE A;  1YSA C;  1BB8 A;  3BID A;  2DSY A;  2DLQ A;  2LUQ A;  2LBS B;  1X3C A;  2YU8 A;  2JWO A;  2LTS A;  4DR6 E;  2UXB E;  1STU A;  2NUF A;  4JI0 E;  1X48 A;  2EQ1 A;  4LFC E;  3BBG A;  2DMY A;  3DF6 A;  2WBT A;  3HPS A;  1ZR9 A;  5AE3 A;  5T6J A;  2VRD A;  4BMJ A;  2EM0 A;  4DR1 E;  4JI3 E;  2WCC 3;  5CFF E;  2GHF A;  1ZBT A;  1WJP A;  2L92 A;  2ENC A;  4DR7 E;  1EH6 A;  2BBG A;  4DV7 E;  4F9C B;  4DR3 E;  2EOH A;  3F6H A;  2LV2 A;  2EQ3 A;  3DJW A;  4AQY E;  2EOM A;  2K4V A;  2KON A;  2DB2 A;  2GPI A;  4M2Z A;  1EH8 A;  2EOZ A;  4OOG C;  5LLQ A;  2RTX A;  4DV5 E;  4ZYG A;  4P78 A;  2V8Q B;  2B3T B;  3ECR A;  4O5G A;  3EPK A;  2RSI A;  2WBU A;  1AAY A;  2YTO A;  4R2C A;  1XMQ E;  3L00 A;  4HEI A;  1ZAA C;  2LO3 A;  2KHX A;  2JXP A;  2EN1 A;  4B3S E;  2G7H A;  3C4B A;  2ODR D;  3C4T A;  2CTD A;  3EQ1 A;  2L8T A;  2K7I A;  5A6B A;  1IBK E;  4ZYE A;  2LTR A;  2HGH A;  5DNY A;  3EPJ A;  2EMZ A;  2EP3 A;  2ODR C;  4F9B B;  2EMY A;  2EMB A;  3UK3 C;  4IJD A;  2M4I A;  2EJ4 A;  3HXL A;  1T4O A;  3LLH A;  1JK2 A;  1KJK A;  4B3T E;  3VYY A;  2M7Q A;  1P47 A;  5BR8 E;  5KL6 A;  2YTI A;  3J81 C;  2J7J A;  2MKD A;  3BF2 A;  3TQM A;  2NAB A;  3J7A G;  1T38 A;  3EPH A;  1G2D C;  2EL6 A;  2EMA A;  1MGT A;  5KL3 A;  1X6F A;  4X8W A;  5AC5 A;  4M0V A;  1DGC A;  2LRS A;  4DV6 E;  2NA2 A;  1X49 A;  2YTD A;  2L2M A; 
#chains in the Genus database with same CATH homology
 2EQ0 A;  2EMX A;  1YSA C;  2EOJ A;  2EOO A;  1BB8 A;  4R2R A;  1B69 A;  2DLQ A;  5KL4 A;  1X3C A;  2YU8 A;  2EN6 A;  1X6H A;  2EQ1 A;  2WBS A;  2EPU A;  1A1F A;  2EM8 A;  4R2P A;  2WBT A;  1ZR9 A;  2EMH A;  2EMK A;  2YTP A;  4GZN C;  2BB8 A;  2VRD A;  3M99 B;  2D9H A;  2EM0 A;  2A25 A;  2ADR A;  2EE8 A;  2EOE A;  2EM4 A;  2EMF A;  2WCC 3;  2LT7 A;  2EM7 A;  2EOX A;  2GHF A;  2I13 A;  1WJP A;  2YTE A;  1A1K A;  5KL2 A;  2ENC A;  2EOI A;  3EPL A;  2EM3 A;  4R2A A;  1TF3 A;  2EOS A;  2YTF A;  2CT1 A;  2EOR A;  2EOH A;  1A1I A;  4R2D A;  2RPC A;  2DRP A;  2ENH A;  1A1J A;  2LV2 A;  2EQ3 A;  1G2F C;  2EPP A;  2EN7 A;  2EL5 A;  2EOM A;  2GLI A;  2E72 A;  2ELY A;  2EPX A;  2EOQ A;  4R2E A;  2EMI A;  2DGC A;  1X5W A;  2YTN A;  2EPA A;  2EOZ A;  2ELZ A;  2DMI A;  2YSO A;  2JPA A;  2EM9 A;  5KL5 A;  1BBO A;  1F2I G;  4F6N A;  1TN9 A;  2EPR A;  1Z1B A;  5KL7 A;  2YRH A;  3EPK A;  2RSI A;  2EM6 A;  2WBU A;  1AAY A;  1MEY C;  1UBD C;  2DLK A;  2ENA A;  2YTO A;  4R2C A;  2LVH A;  1JK1 A;  1ZAA C;  2YTJ A;  4F2J C;  4F6M A;  2LO3 A;  4WSG A;  2EN1 A;  2PRT A;  2EOY A;  1YUI A;  1X6E A;  1A1H A;  2YSP A;  2CSH A;  2CTD A;  2EM2 A;  2R1F A;  1LLM C;  2YTG A;  4X9J A;  2EN2 A;  1ZU1 A;  1UN6 B;  1NCS A;  2EML A;  2HGH A;  4FK5 C;  2MKN A;  3EPJ A;  2EMZ A;  2EP3 A;  4R2Q A;  2EMY A;  2EN8 A;  2EMB A;  3UK3 C;  4IJD A;  3VHT B;  2EOF A;  2EN3 A;  1TF6 A;  2EJ4 A;  2YTQ A;  2JP9 A;  1JK2 A;  1KJK A;  2M9A A;  4IS1 C;  2EMW A;  2EM5 A;  1P47 A;  1A1L A;  2EPC A;  2MDG A;  1RMD A;  5KL6 A;  2YTI A;  2J7J A;  2MKD A;  2NAB A;  2YU5 A;  1A1G A;  2EMC A;  2EPZ A;  4M9V C;  3EPH A;  2LCE A;  2EL6 A;  1G2D C;  2EN4 A;  2YRK A;  2EMA A;  5KL3 A;  3MHH C;  1X6F A;  1YUJ A;  1DGC A;  3MHS C;  2YRM A;  2EMG A;  2YTD A;  2EL4 A;  4R2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...