2EL4A

Solution structure of the 15th zf-c2h2 domain from human zinc finger protein 268
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGVKPYGCSQCAKTFSLKSQLIVHQRSHTGVKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the 15th zf-C2H2 domain from human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 268
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2el4A00
2YSPA 1KJKA 2EOXA 4F2JC 1Z1BA 2EMCA 2ENAA 2EMBA 2YTFA 1LLMC 4F6NA 1G2FC 2DGCA 2I13A 2HGHA 2YTEA 2YTJA 4F6MA 2LCEA 1BBOA 2EOZA 4R2SA 2YU5A 2RSIA 1A1JA 1MEYC 4IS1C 1YUJA 3VHTB 2DRPA 2R1FA 4GZNC 2WBSA 4R2AA 2DLQA 1B69A 2EOOA 2M9AA 3M99B 2EL6A 1BB8A 2EMWA 2EOHA 2J7JA 1DGCA 2EM8A 2RPCA 2EM0A 2EMLA 2EPUA 2BB8A 2CSHA 4IJDA 2YTNA 2EPAA 3EPKA 2EOMA 4R2EA 1F2IG 1TF6A 2EN3A 2VRDA 1A1FA 3EPJA 2EJ4A 4R2DA 2EORA 2YRKA 1UBDC 4R2PA 2EMFA 2MKNA 2EL4A 2EN6A 1YSAC 1ZU1A 2ELYA 3MHSC 2LVHA 2EMKA 2JPAA 2YTQA 1X6FA 2EM7A 2EOIA 2EOQA 3UK3C 2E72A 2EOFA 2LV2A 1P47A 1UN6B 4R2QA 3EPLA 4FK5C 2ELZA 2WBTA 2EM5A 2YTDA 2EQ3A 1YUIA 1X3CA 2MDGA 1A1GA 2YTPA 2YRHA 2EN4A 1JK1A 1TF3A 2YTGA 1A1KA 2EN7A 2EPCA 1X6HA 2EOYA 2EE8A 2GLIA 2YRMA 2EM9A 2EM6A 2PRTA 2GHFA 2ADRA 2EN2A 2EQ0A 2ENCA 2YTIA 2EOEA 1A1LA 1RMDA 1X5WA 4M9VC 1ZR9A 4R2CA 2EPPA 2EQ1A 1X6EA 5KL7A 2EMAA 2EM4A 2EMIA 2EPZA 2LT7A 2ENHA 2EM3A 2EOSA 2EMGA 2EP3A 2YTOA 1WJPA 1A1HA 2DLKA 5KL4A 2DMIA 2WCC3 5KL3A 1TN9A 4WSGA 4R2RA 2EL5A 2EN8A 5KL5A 2MKDA 2NABA 2LO3A 2D9HA 2EMHA 5KL6A 1A1IA 3EPHA 2EPXA 2CT1A 2EN1A 2WBUA 1ZAAC 2JP9A 2EMYA 2CTDA 2A25A 2EOJA 1NCSA 5KL2A 2EPRA 1AAYA 2YU8A 2YSOA 4X9JA 2EMZA 3MHHC 2EMXA 2EM2A 1G2DC 1JK2A
chains in the Genus database with same CATH superfamily
3FIGA 1KJKA 4F2JC 1Z1BA 2UUBE 4BC7A 2L33A 1PJSA 1XMOE 4R2SA 2EPMX 2F4VE 1RQ0A 5AE1A 4BS9A 4JI1E 2FTXB 2GPIA 1A1JA 1UHZA 1MEYC 4IS1C 1YUJA 3VHTB 2DRPA 2NUFA 4DUYE 4R2AA 4DR7E 1XNRE 3EQ1A 2E5LE 4B3RE 1J26A 2RS6A 2HJJA 5ADZA 2EOOA 2K4VA 1BB8A 4P7DA 2EOHA 2EM8A 2RPCA 4LF7E 2EM0A 4IJDA 2NUGA 3QG5C 5FLXC 1F2IG 2BBGA 1ZBTA 4R2EA 2JY9A 1HR0E 2VRDA 2EJ4A 4WFTA 3MSWA 2LE2A 4K0KE 1DQ3A 2ELYA 3MHSC 3HQ1A 4GKJE 3JU0A 3KZYA 2EOIA 2Q8UA 3ZOQB 2EOFA 1P47A 4NHRA 2NUEA 2MC6A 1KYQA 3C4BA 5A69A 4P78A 2MDGA 4WXCA 4DUZE 1A1GA 1DI2A 1JK1A 1N33E 4LTYA 2YTGA 4BC9A 2EPCA 4L8NA 2EOYA 3DJWA 3J80C 4DR4E 4JI6E 4YY3E 1L4SA 2EM9A 2JOBA 2M7QA 4X62E 2IHR1 4OOGC 3H09A 1YYOA 2VF1A 5AE3A 5IXMB 3ADGA 1X48A 4R2CA 1WRJA 1IBME 2EMAA 3F6GA 3K6QA 2EPNA 4HEIA 4O5GA 3AUZA 2JWOA 2RSMA 4I8OA 1PJQA 4F9CB 3J7AG 2VQFE 2NABA 1BBGA 4J8ZA 2UUAE 3F6HA 2D9HA 5KL6A 1MGTA 4M30A 2EN1A 2WBUA 2JP9A 2LUQA 5DNYA 1IMUA 4LFAE 5CFFE 2EPOA 1NCSA 5KL2A 1AAYA 2ZM6E 2EMXA 4JI0E 1JK2A 2YSPA 3T1HE 3IWBA 2R76A 2V83A 5A2QC 2ENAA 2RTXA 2I13A 1YYKA 2LMZA 2UXDE 5LMNE 1EH6A 2EOZA 2N3HA 2LRSA 4NZVA 2FGGA 2JOXA 2DIXA 3VK6A 2YU5A 1NEIA 4WXDA 3OMLA 1FKAE 5IWAE 2WBSA 2NA2A 2YT4A 2LJHA 2EL6A 2YWQA 3ADLA 2LBSB 2J7JA 1XMQE 2N3GA 3ADJA 1YFHA 4Q35B 3EPKA 2CSHA 2ODRC 1IBKE 2K7IA 2DMYA 2EN3A 4NXNE 4DV7E 4BBYA 4WSPA 1EH8A 1YSAC 4KWYA 1QU6A 2LVHA 4YHHE 1HNXE 2EMKA 3AV0A 2E72A 2LV2A 4AQYE 4JI4E 1UN6B 4R2QA 4LF4E 3EPLA 2ELZA 2V86A 2V88A 1YUIA 5A6KA 4GEQB 2YTPA 1GTKA 4Q28A 4LF8E 4F9AB 4LU9A 1N32E 2EE8A 4JYAE 2GLIA 1YPNA 4GKKE 2PRTA 4BHBA 2GHFA 2EQ0A 2YTIA 4MLVA 4DR3E 1RMDA 2JR1A 2EM4A 2V8QB 4LF6E 3C6MA 1N34E 2EM3A 2EOSA 2EMGA 2YTOA 1WJPA 1A1HA 4ZYGA 5AE2A 1TN9A 4WSGA 2DSYA 2YPNA 5BR8E 4ZYDA 3EPHA 2EPXA 5IV8B 2WZOA 2EMYA 2JXPA 2CTDA 2A25A 2JYAA 2JVAA 1IBLE 1RC7A 4DR1E 2B9DA 2EPRA 2YU8A 2EMZA 3DF6A 3MHHC 1J5EE 2KOUA 1T4NA 1G2DC 4JI3E 2KONA 5LLQA 1STUA 2EOXA 2L3JA 3P1XA 2EMCA 4JV5E 1G2FC 2YTFA 4F6NA 3KWRA 5T6JA 2YTEA 4F6MA 2ODRD 2LCEA 1N3GA 3C4TA 2H36X 1SR9A 1WHQA 2VE7C 1T39A 4LF9E 2FV4B 4X66E 3HPZA 2HC5A 2R1FA 4GZNC 4O43A 2VQEE 3ADIA 4DR5E 2DLQA 1B69A 2M9AA 3JTZA 1O0WA 2EMWA 1DGCA 2RQLA 2MC5A 4LFBE 4TUGA 2EPAA 2EOMA 1TF6A 1A1FA 1QNTA 4R2DA 3IWCA 2EMFA 2MKNA 2EL4A 2EN6A 4KZSA 3KZZA 4WPYA 1EH7A 2B7VA 2EOQA 3UK3C 4M0VA 4WX9A 2EWLA 5A6BA 2L8TA 3BGHA 4FK5C 4R8OA 4HTGA 3THNA 2WBTA 5AC4A 4LFCE 2YTDA 4DMIA 2EQ3A 4DV3E 5A6BD 5AC5A 4BMJA 3HPSA 1A1KA 2E1MA 2EN7A 2V85A 1X6HA 4JI7E 1PKPA 2LTSA 4F9BB 2HHHE 2UUCE 2YRMA 4F54A 3TQMA 4X8WA 2LUPB 2G7HA 2ADRA 1ZBQA 2ENCA 2EOEA 2L92A 4WYQB 4LF5E 3HTXA 1X5WA 1ZR9A 3ECRA 3THOB 2M4IA 1IQOA 1YZ9A 2EMIA 2EPZA 2ENHA 1YYWA 5LMUE 4DV4E 5LL6R 4DV0E 4B3SE 2LJUA 2DMIA 2WCC3 1HNWE 4MLQA 2CPNA 4L5NC 4JI8E 2L2MA 3J7Yp 2EL5A 1X49A 4JI5E 4BHCA 1SFEA 4DV1E 1WXRA 1IQSA 4X65E 2LO3A 1I94E 5AASA 1UILA 2MDRA 1T38A 1PJTA 5F3WA 2EM2A 2BB8A 5KL4A 4ZYHA 1LLMC 2DGCA 2EMBA 3LLHA 4KHPE 2LTRA 4RH8A 2HGHA 2EZ6A 4DR6E 2YTJA 3C6KA 3JAMC 1BBOA 4BCAA 4RHBB 2N8XA 2YZTA 2L6MA 4O24A 2L3CA 2RSIA 4R03A 2V87A 1T4OA 2RS7A 2B3TB 4M2ZA 5A6JA 4DKKA 3M99B 3OTOE 2EMLA 2EPUA 2YTNA 2DB2A 2L2KB 3EPJA 4DV5E 2EORA 2YRKA 2I9IA 1UBDC 4R2PA 3L00A 1ZU1A 4TUIA 2JPAA 5IT9C 3VYXA 2YTQA 1X6FA 2EM7A 5TSEA 1WHNA 3HXLA 1N36E 2EM5A 3LMLA 1EKZA 1HNZE 1X3CA 2UXBE 2YRHA 2EN4A 1X47A 3BIDA 1TF3A 2UXCE 3BF2A 2KHXA 4DR2E 2EM6A 3RMPA 2EN2A 4O4KA 4DV6E 4JI2E 2L2NA 1A1LA 4M9VC 2EPPA 2EQ1A 3IWDA 3VYYA 1X6EA 5KL7A 4B3TE 2LT7A 1T4LB 1GQEA 1FJGE 4ZYEA 2EP3A 4X64E 1GZ6A 2DLKA 3T1YE 2F8BA 2EPLX 5KL3A 2V89A 4R2RA 2EPKX 2EN8A 5KL5A 2MKDA 2B7TA 2M1SA 4N4RB 3BBGA 5A6AA 2EMHA 1A1IA 4NXME 1AH5A 2CT1A 1ZAAC 4B3ME 1PDAA 4DV2E 2EOJA 1XNQE 2UU9E 2YSOA 4X9JA 4OX9E 3J81C
chains in the Genus database with same CATH topology
2YSPA 1KJKA 2EOXA 4F2JC 1Z1BA 2EMCA 2ENAA 2EMBA 2YTFA 1LLMC 4F6NA 1G2FC 2DGCA 2I13A 2HGHA 2YTEA 2YTJA 4F6MA 2LCEA 1BBOA 2EOZA 4R2SA 2YU5A 2RSIA 1A1JA 1MEYC 4IS1C 1YUJA 3VHTB 2DRPA 2R1FA 4GZNC 2WBSA 4R2AA 2DLQA 1B69A 2EOOA 2M9AA 3M99B 2EL6A 1BB8A 2EMWA 2EOHA 2J7JA 1DGCA 2EM8A 2RPCA 2EM0A 2EMLA 2EPUA 2BB8A 2CSHA 4IJDA 2YTNA 2EPAA 3EPKA 2EOMA 4R2EA 1F2IG 1TF6A 2EN3A 2VRDA 1A1FA 3EPJA 2EJ4A 4R2DA 2EORA 2YRKA 1UBDC 4R2PA 2EMFA 2MKNA 2EL4A 2EN6A 1YSAC 1ZU1A 2ELYA 3MHSC 2LVHA 2EMKA 2JPAA 2YTQA 1X6FA 2EM7A 2EOIA 2EOQA 3UK3C 2E72A 2EOFA 2LV2A 1P47A 1UN6B 4R2QA 3EPLA 4FK5C 2ELZA 2WBTA 2EM5A 2YTDA 2EQ3A 1YUIA 1X3CA 2MDGA 1A1GA 2YTPA 2YRHA 2EN4A 1JK1A 1TF3A 2YTGA 1A1KA 2EN7A 2EPCA 1X6HA 2EOYA 2EE8A 2GLIA 2YRMA 2EM9A 2EM6A 2PRTA 2GHFA 2ADRA 2EN2A 2EQ0A 2ENCA 2YTIA 2EOEA 1A1LA 1RMDA 1X5WA 4M9VC 1ZR9A 4R2CA 2EPPA 2EQ1A 1X6EA 5KL7A 2EMAA 2EM4A 2EMIA 2EPZA 2LT7A 2ENHA 2EM3A 2EOSA 2EMGA 2EP3A 2YTOA 1WJPA 1A1HA 2DLKA 5KL4A 2DMIA 2WCC3 5KL3A 1TN9A 4WSGA 4R2RA 2EL5A 2EN8A 5KL5A 2MKDA 2NABA 2LO3A 2D9HA 2EMHA 5KL6A 1A1IA 3EPHA 2EPXA 2CT1A 2EN1A 2WBUA 1ZAAC 2JP9A 2EMYA 2CTDA 2A25A 2EOJA 1NCSA 5KL2A 2EPRA 1AAYA 2YU8A 2YSOA 4X9JA 2EMZA 3MHHC 2EMXA 2EM2A 1G2DC 1JK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YSP A;  1KJK A;  2EOX A;  4F2J C;  1Z1B A;  2EMC A;  2ENA A;  2EMB A;  2YTF A;  1LLM C;  4F6N A;  1G2F C;  2DGC A;  2I13 A;  2HGH A;  2YTE A;  2YTJ A;  4F6M A;  2LCE A;  1BBO A;  2EOZ A;  4R2S A;  2YU5 A;  2RSI A;  1A1J A;  1MEY C;  4IS1 C;  1YUJ A;  3VHT B;  2DRP A;  2R1F A;  4GZN C;  2WBS A;  4R2A A;  2DLQ A;  1B69 A;  2EOO A;  2M9A A;  3M99 B;  2EL6 A;  1BB8 A;  2EMW A;  2EOH A;  2J7J A;  1DGC A;  2EM8 A;  2RPC A;  2EM0 A;  2EML A;  2EPU A;  2BB8 A;  2CSH A;  4IJD A;  2YTN A;  2EPA A;  3EPK A;  2EOM A;  4R2E A;  1F2I G;  1TF6 A;  2EN3 A;  2VRD A;  1A1F A;  3EPJ A;  2EJ4 A;  4R2D A;  2EOR A;  2YRK A;  1UBD C;  4R2P A;  2EMF A;  2MKN A;  2EL4 A;  2EN6 A;  1YSA C;  1ZU1 A;  2ELY A;  3MHS C;  2LVH A;  2EMK A;  2JPA A;  2YTQ A;  1X6F A;  2EM7 A;  2EOI A;  2EOQ A;  3UK3 C;  2E72 A;  2EOF A;  2LV2 A;  1P47 A;  1UN6 B;  4R2Q A;  3EPL A;  4FK5 C;  2ELZ A;  2WBT A;  2EM5 A;  2YTD A;  2EQ3 A;  1YUI A;  1X3C A;  2MDG A;  1A1G A;  2YTP A;  2YRH A;  2EN4 A;  1JK1 A;  1TF3 A;  2YTG A;  1A1K A;  2EN7 A;  2EPC A;  1X6H A;  2EOY A;  2EE8 A;  2GLI A;  2YRM A;  2EM9 A;  2EM6 A;  2PRT A;  2GHF A;  2ADR A;  2EN2 A;  2EQ0 A;  2ENC A;  2YTI A;  2EOE A;  1A1L A;  1RMD A;  1X5W A;  4M9V C;  1ZR9 A;  4R2C A;  2EPP A;  2EQ1 A;  1X6E A;  5KL7 A;  2EMA A;  2EM4 A;  2EMI A;  2EPZ A;  2LT7 A;  2ENH A;  2EM3 A;  2EOS A;  2EMG A;  2EP3 A;  2YTO A;  1WJP A;  1A1H A;  2DLK A;  5KL4 A;  2DMI A;  2WCC 3;  5KL3 A;  1TN9 A;  4WSG A;  4R2R A;  2EL5 A;  2EN8 A;  5KL5 A;  2MKD A;  2NAB A;  2LO3 A;  2D9H A;  2EMH A;  5KL6 A;  1A1I A;  3EPH A;  2EPX A;  2CT1 A;  2EN1 A;  2WBU A;  1ZAA C;  2JP9 A;  2EMY A;  2CTD A;  2A25 A;  2EOJ A;  1NCS A;  5KL2 A;  2EPR A;  1AAY A;  2YU8 A;  2YSO A;  4X9J A;  2EMZ A;  3MHH C;  2EMX A;  2EM2 A;  1G2D C;  1JK2 A; 
#chains in the Genus database with same CATH topology
 3FIG A;  1KJK A;  4F2J C;  1Z1B A;  2UUB E;  4BC7 A;  2L33 A;  1PJS A;  1XMO E;  4R2S A;  2EPM X;  2F4V E;  1RQ0 A;  5AE1 A;  4BS9 A;  4JI1 E;  2FTX B;  2GPI A;  1A1J A;  1UHZ A;  1MEY C;  4IS1 C;  1YUJ A;  3VHT B;  2DRP A;  2NUF A;  4DUY E;  4R2A A;  4DR7 E;  1XNR E;  3EQ1 A;  2E5L E;  4B3R E;  1J26 A;  2RS6 A;  2HJJ A;  5ADZ A;  2EOO A;  2K4V A;  1BB8 A;  4P7D A;  2EOH A;  2EM8 A;  2RPC A;  4LF7 E;  2EM0 A;  4IJD A;  2NUG A;  3QG5 C;  5FLX C;  1F2I G;  2BBG A;  1ZBT A;  4R2E A;  2JY9 A;  1HR0 E;  2VRD A;  2EJ4 A;  4WFT A;  3MSW A;  2LE2 A;  4K0K E;  1DQ3 A;  2ELY A;  3MHS C;  3HQ1 A;  4GKJ E;  3JU0 A;  3KZY A;  2EOI A;  2Q8U A;  3ZOQ B;  2EOF A;  1P47 A;  4NHR A;  2NUE A;  2MC6 A;  1KYQ A;  3C4B A;  5A69 A;  4P78 A;  2MDG A;  4WXC A;  4DUZ E;  1A1G A;  1DI2 A;  1JK1 A;  1N33 E;  4LTY A;  2YTG A;  4BC9 A;  2EPC A;  4L8N A;  2EOY A;  3DJW A;  3J80 C;  4DR4 E;  4JI6 E;  4YY3 E;  1L4S A;  2EM9 A;  2JOB A;  2M7Q A;  4X62 E;  2IHR 1;  4OOG C;  3H09 A;  1YYO A;  2VF1 A;  5AE3 A;  5IXM B;  3ADG A;  1X48 A;  4R2C A;  1WRJ A;  1IBM E;  2EMA A;  3F6G A;  3K6Q A;  2EPN A;  4HEI A;  4O5G A;  3AUZ A;  2JWO A;  2RSM A;  4I8O A;  1PJQ A;  4F9C B;  3J7A G;  2VQF E;  2NAB A;  1BBG A;  4J8Z A;  2UUA E;  3F6H A;  2D9H A;  5KL6 A;  1MGT A;  4M30 A;  2EN1 A;  2WBU A;  2JP9 A;  2LUQ A;  5DNY A;  1IMU A;  4LFA E;  5CFF E;  2EPO A;  1NCS A;  5KL2 A;  1AAY A;  2ZM6 E;  2EMX A;  4JI0 E;  1JK2 A;  2YSP A;  3T1H E;  3IWB A;  2R76 A;  2V83 A;  5A2Q C;  2ENA A;  2RTX A;  2I13 A;  1YYK A;  2LMZ A;  2UXD E;  5LMN E;  1EH6 A;  2EOZ A;  2N3H A;  2LRS A;  4NZV A;  2FGG A;  2JOX A;  2DIX A;  3VK6 A;  2YU5 A;  1NEI A;  4WXD A;  3OML A;  1FKA E;  5IWA E;  2WBS A;  2NA2 A;  2YT4 A;  2LJH A;  2EL6 A;  2YWQ A;  3ADL A;  2LBS B;  2J7J A;  1XMQ E;  2N3G A;  3ADJ A;  1YFH A;  4Q35 B;  3EPK A;  2CSH A;  2ODR C;  1IBK E;  2K7I A;  2DMY A;  2EN3 A;  4NXN E;  4DV7 E;  4BBY A;  4WSP A;  1EH8 A;  1YSA C;  4KWY A;  1QU6 A;  2LVH A;  4YHH E;  1HNX E;  2EMK A;  3AV0 A;  2E72 A;  2LV2 A;  4AQY E;  4JI4 E;  1UN6 B;  4R2Q A;  4LF4 E;  3EPL A;  2ELZ A;  2V86 A;  2V88 A;  1YUI A;  5A6K A;  4GEQ B;  2YTP A;  1GTK A;  4Q28 A;  4LF8 E;  4F9A B;  4LU9 A;  1N32 E;  2EE8 A;  4JYA E;  2GLI A;  1YPN A;  4GKK E;  2PRT A;  4BHB A;  2GHF A;  2EQ0 A;  2YTI A;  4MLV A;  4DR3 E;  1RMD A;  2JR1 A;  2EM4 A;  2V8Q B;  4LF6 E;  3C6M A;  1N34 E;  2EM3 A;  2EOS A;  2EMG A;  2YTO A;  1WJP A;  1A1H A;  4ZYG A;  5AE2 A;  1TN9 A;  4WSG A;  2DSY A;  2YPN A;  5BR8 E;  4ZYD A;  3EPH A;  2EPX A;  5IV8 B;  2WZO A;  2EMY A;  2JXP A;  2CTD A;  2A25 A;  2JYA A;  2JVA A;  1IBL E;  1RC7 A;  4DR1 E;  2B9D A;  2EPR A;  2YU8 A;  2EMZ A;  3DF6 A;  3MHH C;  1J5E E;  2KOU A;  1T4N A;  1G2D C;  4JI3 E;  2KON A;  5LLQ A;  1STU A;  2EOX A;  2L3J A;  3P1X A;  2EMC A;  4JV5 E;  1G2F C;  2YTF A;  4F6N A;  3KWR A;  5T6J A;  2YTE A;  4F6M A;  2ODR D;  2LCE A;  1N3G A;  3C4T A;  2H36 X;  1SR9 A;  1WHQ A;  2VE7 C;  1T39 A;  4LF9 E;  2FV4 B;  4X66 E;  3HPZ A;  2HC5 A;  2R1F A;  4GZN C;  4O43 A;  2VQE E;  3ADI A;  4DR5 E;  2DLQ A;  1B69 A;  2M9A A;  3JTZ A;  1O0W A;  2EMW A;  1DGC A;  2RQL A;  2MC5 A;  4LFB E;  4TUG A;  2EPA A;  2EOM A;  1TF6 A;  1A1F A;  1QNT A;  4R2D A;  3IWC A;  2EMF A;  2MKN A;  2EL4 A;  2EN6 A;  4KZS A;  3KZZ A;  4WPY A;  1EH7 A;  2B7V A;  2EOQ A;  3UK3 C;  4M0V A;  4WX9 A;  2EWL A;  5A6B A;  2L8T A;  3BGH A;  4FK5 C;  4R8O A;  4HTG A;  3THN A;  2WBT A;  5AC4 A;  4LFC E;  2YTD A;  4DMI A;  2EQ3 A;  4DV3 E;  5A6B D;  5AC5 A;  4BMJ A;  3HPS A;  1A1K A;  2E1M A;  2EN7 A;  2V85 A;  1X6H A;  4JI7 E;  1PKP A;  2LTS A;  4F9B B;  2HHH E;  2UUC E;  2YRM A;  4F54 A;  3TQM A;  4X8W A;  2LUP B;  2G7H A;  2ADR A;  1ZBQ A;  2ENC A;  2EOE A;  2L92 A;  4WYQ B;  4LF5 E;  3HTX A;  1X5W A;  1ZR9 A;  3ECR A;  3THO B;  2M4I A;  1IQO A;  1YZ9 A;  2EMI A;  2EPZ A;  2ENH A;  1YYW A;  5LMU E;  4DV4 E;  5LL6 R;  4DV0 E;  4B3S E;  2LJU A;  2DMI A;  2WCC 3;  1HNW E;  4MLQ A;  2CPN A;  4L5N C;  4JI8 E;  2L2M A;  3J7Y p;  2EL5 A;  1X49 A;  4JI5 E;  4BHC A;  1SFE A;  4DV1 E;  1WXR A;  1IQS A;  4X65 E;  2LO3 A;  1I94 E;  5AAS A;  1UIL A;  2MDR A;  1T38 A;  1PJT A;  5F3W A;  2EM2 A;  2BB8 A;  5KL4 A;  4ZYH A;  1LLM C;  2DGC A;  2EMB A;  3LLH A;  4KHP E;  2LTR A;  4RH8 A;  2HGH A;  2EZ6 A;  4DR6 E;  2YTJ A;  3C6K A;  3JAM C;  1BBO A;  4BCA A;  4RHB B;  2N8X A;  2YZT A;  2L6M A;  4O24 A;  2L3C A;  2RSI A;  4R03 A;  2V87 A;  1T4O A;  2RS7 A;  2B3T B;  4M2Z A;  5A6J A;  4DKK A;  3M99 B;  3OTO E;  2EML A;  2EPU A;  2YTN A;  2DB2 A;  2L2K B;  3EPJ A;  4DV5 E;  2EOR A;  2YRK A;  2I9I A;  1UBD C;  4R2P A;  3L00 A;  1ZU1 A;  4TUI A;  2JPA A;  5IT9 C;  3VYX A;  2YTQ A;  1X6F A;  2EM7 A;  5TSE A;  1WHN A;  3HXL A;  1N36 E;  2EM5 A;  3LML A;  1EKZ A;  1HNZ E;  1X3C A;  2UXB E;  2YRH A;  2EN4 A;  1X47 A;  3BID A;  1TF3 A;  2UXC E;  3BF2 A;  2KHX A;  4DR2 E;  2EM6 A;  3RMP A;  2EN2 A;  4O4K A;  4DV6 E;  4JI2 E;  2L2N A;  1A1L A;  4M9V C;  2EPP A;  2EQ1 A;  3IWD A;  3VYY A;  1X6E A;  5KL7 A;  4B3T E;  2LT7 A;  1T4L B;  1GQE A;  1FJG E;  4ZYE A;  2EP3 A;  4X64 E;  1GZ6 A;  2DLK A;  3T1Y E;  2F8B A;  2EPL X;  5KL3 A;  2V89 A;  4R2R A;  2EPK X;  2EN8 A;  5KL5 A;  2MKD A;  2B7T A;  2M1S A;  4N4R B;  3BBG A;  5A6A A;  2EMH A;  1A1I A;  4NXM E;  1AH5 A;  2CT1 A;  1ZAA C;  4B3M E;  1PDA A;  4DV2 E;  2EOJ A;  1XNQ E;  2UU9 E;  2YSO A;  4X9J A;  4OX9 E;  3J81 C; 
#chains in the Genus database with same CATH homology
 2YSP A;  1KJK A;  2EOX A;  4F2J C;  1Z1B A;  2EMC A;  2ENA A;  2EMB A;  2YTF A;  1LLM C;  4F6N A;  1G2F C;  2DGC A;  2I13 A;  2HGH A;  2YTE A;  2YTJ A;  4F6M A;  2LCE A;  1BBO A;  2EOZ A;  4R2S A;  2YU5 A;  2RSI A;  1A1J A;  1MEY C;  4IS1 C;  1YUJ A;  3VHT B;  2DRP A;  2R1F A;  4GZN C;  2WBS A;  4R2A A;  2DLQ A;  1B69 A;  2EOO A;  2M9A A;  3M99 B;  2EL6 A;  1BB8 A;  2EMW A;  2EOH A;  2J7J A;  1DGC A;  2EM8 A;  2RPC A;  2EM0 A;  2EML A;  2EPU A;  2BB8 A;  2CSH A;  4IJD A;  2YTN A;  2EPA A;  3EPK A;  2EOM A;  4R2E A;  1F2I G;  1TF6 A;  2EN3 A;  2VRD A;  1A1F A;  3EPJ A;  2EJ4 A;  4R2D A;  2EOR A;  2YRK A;  1UBD C;  4R2P A;  2EMF A;  2MKN A;  2EL4 A;  2EN6 A;  1YSA C;  1ZU1 A;  2ELY A;  3MHS C;  2LVH A;  2EMK A;  2JPA A;  2YTQ A;  1X6F A;  2EM7 A;  2EOI A;  2EOQ A;  3UK3 C;  2E72 A;  2EOF A;  2LV2 A;  1P47 A;  1UN6 B;  4R2Q A;  3EPL A;  4FK5 C;  2ELZ A;  2WBT A;  2EM5 A;  2YTD A;  2EQ3 A;  1YUI A;  1X3C A;  2MDG A;  1A1G A;  2YTP A;  2YRH A;  2EN4 A;  1JK1 A;  1TF3 A;  2YTG A;  1A1K A;  2EN7 A;  2EPC A;  1X6H A;  2EOY A;  2EE8 A;  2GLI A;  2YRM A;  2EM9 A;  2EM6 A;  2PRT A;  2GHF A;  2ADR A;  2EN2 A;  2EQ0 A;  2ENC A;  2YTI A;  2EOE A;  1A1L A;  1RMD A;  1X5W A;  4M9V C;  1ZR9 A;  4R2C A;  2EPP A;  2EQ1 A;  1X6E A;  5KL7 A;  2EMA A;  2EM4 A;  2EMI A;  2EPZ A;  2LT7 A;  2ENH A;  2EM3 A;  2EOS A;  2EMG A;  2EP3 A;  2YTO A;  1WJP A;  1A1H A;  2DLK A;  5KL4 A;  2DMI A;  2WCC 3;  5KL3 A;  1TN9 A;  4WSG A;  4R2R A;  2EL5 A;  2EN8 A;  5KL5 A;  2MKD A;  2NAB A;  2LO3 A;  2D9H A;  2EMH A;  5KL6 A;  1A1I A;  3EPH A;  2EPX A;  2CT1 A;  2EN1 A;  2WBU A;  1ZAA C;  2JP9 A;  2EMY A;  2CTD A;  2A25 A;  2EOJ A;  1NCS A;  5KL2 A;  2EPR A;  1AAY A;  2YU8 A;  2YSO A;  4X9J A;  2EMZ A;  3MHH C;  2EMX A;  2EM2 A;  1G2D C;  1JK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...