2JVAA

Nmr solution structure of peptidyl-trna hydrolase domain protein from pseudomonas syringae pv. tomato. northeast structural genomics consortium target psr211
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
MLVISNNVHLPDAEIELTAIRAQGAGGQNVNKVSSAMHLRFDINASSLPPFYKERLLALNDSRITSDGVIVLKAQQYRTQEQNRADALLRLSELIVNAAKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase domain protein
publication title NMR structure of the peptidyl-tRNA hydrolase domain from Pseudomonas syringae expands the structural coverage of the hydrolysis domains of class 1 peptide chain release factors.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
total genus 23
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2007-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2jvaA00
2IHR1 2LJHA 4LF6E 2B7TA 2RTXA 1I94E 4DR7E 1X49A 4JI3E 2L3CA 1EKZA 4JI0E 2UUAE 2UUBE 4JI6E 4B3TE 2LTRA 1YYWA 4OOGC 4NXNE 4YY3E 4X62E 1FKAE 2L2NA 2RS7A 1T4NA 2LUQA 1PKPA 2JVAA 3VYYA 4DV1E 1XMQE 1WHQA 4B3RE 1J5EE 1YYKA 2NUGA 1WHNA 1O0WA 2VQFE 1XNQE 3T1HE 4GKKE 2L2KB 5LMUE 2RSMA 2DMYA 2JY9A 4LFAE 2UXBE 1N32E 4X65E 4AQYE 2DB2A 2B7VA 4B3SE 3LLHA 4M2ZA 2N3HA 2ZM6E 4WFTA 4DV2E 2RS6A 2UU9E 3OTOE 3P1XA 1XNRE 2UUCE 4LF5E 1IBME 2NUFA 4JI2E 2LTSA 1T4LB 1QU6A 4M30A 3C4BA 4DV4E 2VQEE 4DR6E 3J7Yp 2L3JA 2F4VE 1GQEA 5IWAE 2LUPB 4JI1E 4NXME 2LRSA 4DR3E 1IBKE 4X64E 4DV7E 3T1YE 4GKJE 3ADGA 4K0KE 4DV0E 4DV6E 2KHXA 1X47A 1YYOA 1J26A 4WYQB 4DUYE 4JI5E 4DR5E 4LF9E 1STUA 4YHHE 2B3TB 1HNXE 5LMNE 2L2MA 2NUEA 2EZ6A 4X66E 3ADIA 1HNWE 1UILA 1N33E 2UXCE 1T4OA 3C4TA 4DV5E 4DUZE 4LF8E 1HNZE 2DIXA 2CPNA 5BR8E 4JYAE 4KHPE 4LF4E 3ADLA 4JV5E 4LF7E 4DR4E 4OX9E 3VYXA 2L33A 1XMOE 4DV3E 1N36E 1RC7A 4JI8E 1IBLE 4X8WA 5CFFE 3HTXA 2UXDE 4JI4E 4DR1E 2MDRA 2LBSB 1N34E 1DI2A 1RQ0A 2NA2A 1ZBTA 1HR0E 3ADJA 1UHZA 4LFCE 2YT4A 2N3GA 4DR2E 1X48A 4JI7E 4LFBE 2HHHE 1YZ9A 4DKKA 1FJGE 4B3ME 2E5LE
chains in the Genus database with same CATH superfamily
4KWYA 5DNYA 2KOUA 4JI3E 2NABA 2WBSA 2UUAE 4B3TE 2LT7A 2M1SA 2YU8A 2YTGA 3M99B 1FKAE 1T4NA 2LE2A 2EOFA 2JVAA 1XMQE 2EOXA 1J5EE 2EN7A 3MSWA 3BBGA 3J7AG 2V89A 5A6AA 5AE1A 4R2PA 2EQ3A 2EN1A 4ZYDA 1X6FA 2WCC3 2RQLA 4BCAA 4AQYE 2JYAA 2RSIA 2EM2A 2HC5A 4M2ZA 4WFTA 2UU9E 2RS6A 2EMZA 4F2JC 2UUCE 2V8QB 4JI2E 2LTSA 3VK6A 3IWDA 1Z1BA 1T4LB 2EQ0A 2V88A 3TQMA 2JR1A 2EM7A 2EWLA 4BS9A 4WX9A 2CSHA 2F4VE 4BMJA 4TUIA 4RH8A 2M9AA 3L00A 5LL6R 4JI1E 1BBOA 1EH8A 4X64E 2GPIA 5A2QC 4DV0E 2PRTA 1X47A 1YYOA 2JOBA 4NZVA 2F8BA 3KWRA 3K6QA 2YU5A 1NCSA 1STUA 2DMIA 5LMNE 2B9DA 4RHBB 2M7QA 2EZ6A 5KL5A 2DGCA 1UBDC 2VF1A 2M4IA 4BC7A 1ZR9A 1PJSA 2FTXB 4LU9A 5IXMB 2ODRD 5KL6A 2EPCA 1WXRA 4JYAE 1A1IA 2YTFA 4JV5E 2JWOA 1GTKA 3VYXA 2V83A 3UK3C 2YSOA 4DV3E 2EMGA 1A1JA 1AAYA 3THNA 1IBLE 1X6EA 2MDRA 2FV4B 4L5NC 2LBSB 3MHSC 4TUGA 5F3WA 2LCEA 4ZYHA 1ZU1A 4M9VC 2V86A 1A1HA 3KZZA 3ECRA 2D9HA 2LJHA 5A69A 2EPKX 4P78A 1BB8A 2CTDA 2V85A 2RTXA 4DR7E 2EPOA 2EM5A 2EPUA 5AC5A 1EKZA 4IJDA 2L8TA 4O24A 4YY3E 1EH7A 4WSPA 2EOMA 1X5WA 2LUQA 1PKPA 1N3GA 2EOOA 3QG5C 3VYYA 1WHQA 4DV1E 4LTYA 1F2IG 1WHNA 5A6BA 2EJ4A 4HTGA 4MLVA 3AV0A 2VQFE 5LMUE 2DMYA 3C6MA 3HQ1A 3EPJA 4B3SE 3LLHA 3P1XA 1DQ3A 1PJTA 4LF5E 2FGGA 4DMIA 4R2SA 2EPNA 2L92A 2KONA 3C4BA 2YTNA 2ENCA 2VQEE 4DR6E 3DJWA 2YTOA 1GQEA 5KL4A 2LUPB 4DR3E 2R76A 1B69A 2DSYA 4DV7E 2JP9A 3ADGA 4GKJE 3LMLA 2EMAA 2EN8A 4WYQB 3OMLA 4DUYE 4Q28A 5KL7A 3EPKA 2EOZA 4YHHE 2B3TB 4F9CB 5KL2A 3HXLA 2NUEA 1TF3A 2YTQA 1A1LA 1SFEA 1YUJA 3ADIA 2EOIA 5IT9C 1ZBQA 1BBGA 2DIXA 4R03A 2J7JA 4LF4E 3ADLA 2EPXA 2YSPA 2WZOA 2YRKA 3RMPA 4X9JA 4IS1C 4HEIA 2EPRA 1YUIA 2EMCA 1MEYC 4DR1E 2EMLA 2VRDA 3EPHA 1DI2A 4R2AA 1ZBTA 5ADZA 1YPNA 2CT1A 2LJUA 2EM0A 1SR9A 2EN3A 2H36X 1FJGE 2EMHA 3ZOQB 4B3ME 4R2QA 1IQSA 2ELZA 5A6BD 1I94E 1X49A 4F9AB 2EQ1A 2L3CA 2BBGA 2UUBE 4JI6E 4FK5C 4R2DA 3IWCA 4NHRA 1KYQA 4BC9A 1YYWA 4OOGC 1RMDA 1G2FC 2EN2A 2EPMX 3F6GA 2L2NA 1WRJA 2RS7A 2EN4A 1WJPA 2ELYA 4B3RE 2HJJA 5AASA 2NUGA 2YWQA 2I9IA 1KJKA 3AUZA 4R8OA 3JAMC 1XNQE 4R2EA 1X6HA 2MC5A 4O43A 4GKKE 2L2KB 2RSMA 5AC4A 4LFAE 5FLXC 2EMYA 2UXBE 4J8ZA 4X65E 2DLKA 1N32E 2B7VA 4P7DA 2ZM6E 2EN6A 3OTOE 2EL5A 2EP3A 1XNRE 2RPCA 2EL4A 2YRMA 2JXPA 2EMXA 4M30A 4MLQA 5KL3A 2EL6A 1YSAC 3J7Yp 2L3JA 5AE3A 2DLQA 5IWAE 2YTDA 1JK1A 2A25A 2EPAA 2LRSA 1IBKE 3IWBA 1G2DC 3JTZA 2YRHA 4K0KE 2KHXA 1J26A 4DR5E 4LF9E 2EMKA 2LO3A 3F6HA 3VHTB 1HNXE 2L2MA 2EM9A 1A1KA 4F54A 1IMUA 4GEQB 4X66E 1UILA 2GHFA 2EORA 1T4OA 2EE8A 3H09A 1JK2A 4LF8E 4BBYA 1HNZE 2K4VA 5BR8E 4LF7E 4DR4E 4OX9E 2L33A 3MHHC 2MDGA 4WSGA 2EMIA 4JI8E 2MKDA 4X8WA 2UXDE 3KZYA 3HTXA 3BGHA 4BHBA 2MKNA 3FIGA 4N4RB 1RQ0A 4WPYA 2EM3A 3J81C 3ADJA 1UHZA 4LFCE 2YT4A 4DR2E 1TN9A 2G7HA 2EPLX 2Q8UA 2HHHE 4KZSA 2YTJA 2JOXA 4WXDA 1PJQA 1L4SA 3HPZA 2IHR1 3JU0A 2B7TA 5TSEA 4LF6E 2E72A 2MC6A 1PDAA 2K7IA 1A1FA 4R2CA 3BF2A 2YTIA 2LV2A 4JI0E 2EMWA 4BHCA 2LTRA 3THOB 4ZYEA 2EM8A 4O4KA 4NXNE 2EOYA 2YTEA 1T38A 4X62E 2EOSA 2EOHA 3BIDA 2EM4A 2EOEA 1YYKA 1EH6A 1O0WA 3T1HE 2I13A 1X3CA 1ZAAC 5LLQA 2BB8A 2JY9A 3EPLA 2DB2A 1A1GA 2N3HA 3DF6A 4DV2E 4WXCA 1DGCA 4GZNC 1UN6B 2YZTA 1IBME 2NUFA 2ADRA 3J80C 2LVHA 2EMFA 1QU6A 4DV4E 4F9BB 1YFHA 2ODRC 4ZYGA 2GLIA 1IQOA 2LMZA 4NXME 1QNTA 2EPPA 2V87A 2EOQA 3T1YE 4DV6E 5A6JA 4L8NA 2DRPA 4JI5E 1TF6A 5T6JA 2VE7C 4F6MA 4F6NA 1NEIA 2EOJA 2HGHA 5AE2A 2JPAA 3C6KA 2WBUA 1HNWE 1N33E 2UXCE 2YPNA 3C4TA 4Q35B 2ENHA 5A6KA 4DUZE 4DV5E 1GZ6A 2EMBA 2CPNA 2R1FA 4KHPE 1AH5A 4O5GA 1XMOE 2E1MA 5IV8B 2EPZA 4R2RA 1LLMC 1N36E 2L6MA 2WBTA 2ENAA 1RC7A 1T39A 5CFFE 2YTPA 4JI4E 1N34E 2NA2A 1HR0E 1MGTA 2N3GA 3EQ1A 3HPSA 1X48A 4M0VA 2EM6A 4JI7E 4LFBE 1P47A 4I8OA 1YZ9A 4DKKA 2N8XA 2E5LE
chains in the Genus database with same CATH topology
2IHR1 2LJHA 3JU0A 2B7TA 4LF6E 4P78A 5DNYA 2V85A 2RTXA 2KOUA 1I94E 1X49A 4DR7E 4F9AB 4JI3E 2MC6A 2L3CA 1EKZA 4JI0E 2UUAE 2UUBE 4JI6E 4B3TE 2LTRA 3IWCA 2L8TA 4BC9A 2M1SA 1YYWA 4OOGC 4NXNE 4YY3E 4X62E 1FKAE 3F6GA 2L2NA 2RS7A 1T4NA 2LUQA 2LE2A 1PKPA 2JVAA 3VYYA 4DV1E 1XMQE 1WHQA 5AASA 4LTYA 1J5EE 1YYKA 2NUGA 1WHNA 1O0WA 3MSWA 1N34E 3J7AG 3AUZA 4R8OA 2V89A 3AV0A 3JAMC 5AE1A 2VQFE 1XNQE 3T1HE 4LF8E 2MC5A 4GKKE 2L2KB 5LMUE 2RSMA 2DMYA 2JY9A 4LFAE 5FLXC 3HQ1A 4BCAA 2UXBE 4J8ZA 4X65E 4AQYE 1N32E 2DB2A 2B7VA 4P7DA 4B3SE 3LLHA 4M2ZA 2N3HA 3DF6A 4WFTA 2ZM6E 2RS6A 4DV2E 3OTOE 2UU9E 3P1XA 1DQ3A 1XNRE 2UUCE 4LF5E 2FGGA 2YZTA 1IBME 2V8QB 3J80C 2NUFA 4JI2E 2LTSA 4DMIA 2L92A 2KONA 3VK6A 3IWDA 1T4LB 1QU6A 2V88A 4M30A 3C4BA 2JR1A 4DV4E 4F9BB 2ODRC 2VQEE 4DR6E 2EWLA 4BS9A 3J7Yp 2L3JA 5AE3A 2F4VE 3DJWA 4BMJA 1GQEA 5IWAE 2LMZA 4TUIA 5LL6R 2LUPB 4JI1E 4NXME 2LRSA 4DR3E 1IBKE 4X64E 3IWBA 3JTZA 2DSYA 2V87A 4DV7E 3T1YE 4B3RE 4GKJE 3ADGA 4K0KE 5A2QC 4DV0E 4DV6E 2KHXA 3LMLA 1X47A 1YYOA 2JOBA 1J26A 4WYQB 3OMLA 4L8NA 2F8BA 4Q28A 4DUYE 4DR5E 4JI5E 3KWRA 4LF9E 5T6JA 2VE7C 3K6QA 3F6HA 1STUA 4YHHE 2B3TB 4F9CB 1HNXE 5LMNE 2L2MA 2B9DA 3HXLA 2NUEA 2M7QA 2EZ6A 4F54A 5AE2A 2VF1A 2M4IA 4GEQB 4X66E 4BC7A 3ADIA 2FTXB 4LU9A 1HNWE 1UILA 1N33E 2UXCE 2ODRD 1DI2A 1T4OA 3H09A 5IT9C 3C4TA 4DV5E 1ZBQA 4BBYA 4DUZE 1GZ6A 1WXRA 2DIXA 2CPNA 2K4VA 4R03A 5BR8E 1HNZE 4LF4E 3ADLA 4JYAE 2JWOA 4LF7E 4DR4E 4KHPE 4OX9E 4JV5E 3VYXA 2L33A 2WZOA 3RMPA 2V83A 1XMOE 2E1MA 4DV3E 1N36E 2L6MA 1RC7A 4JI8E 1IBLE 4X8WA 5CFFE 3HTXA 2UXDE 4JI4E 4DR1E 2MDRA 2FV4B 4L5NC 2LBSB 5F3WA 4TUGA 3FIGA 4WPYA 1RQ0A 2NA2A 1ZBTA 3J81C 3ADJA 1UHZA 5ADZA 1HR0E 2YT4A 4LFCE 2N3GA 4DR2E 1X48A 3HPSA 2G7HA 4M0VA 1SR9A 4JI7E 4LFBE 2V86A 2HHHE 4KZSA 4I8OA 2H36X 2JOXA 4DKKA 1YZ9A 1FJGE 3ZOQB 4WSPA 4B3ME 2E5LE 3HPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IHR 1;  2LJH A;  4LF6 E;  2B7T A;  2RTX A;  1I94 E;  4DR7 E;  1X49 A;  4JI3 E;  2L3C A;  1EKZ A;  4JI0 E;  2UUA E;  2UUB E;  4JI6 E;  4B3T E;  2LTR A;  1YYW A;  4OOG C;  4NXN E;  4YY3 E;  4X62 E;  1FKA E;  2L2N A;  2RS7 A;  1T4N A;  2LUQ A;  1PKP A;  2JVA A;  3VYY A;  4DV1 E;  1XMQ E;  1WHQ A;  4B3R E;  1J5E E;  1YYK A;  2NUG A;  1WHN A;  1O0W A;  2VQF E;  1XNQ E;  3T1H E;  4GKK E;  2L2K B;  5LMU E;  2RSM A;  2DMY A;  2JY9 A;  4LFA E;  2UXB E;  1N32 E;  4X65 E;  4AQY E;  2DB2 A;  2B7V A;  4B3S E;  3LLH A;  4M2Z A;  2N3H A;  2ZM6 E;  4WFT A;  4DV2 E;  2RS6 A;  2UU9 E;  3OTO E;  3P1X A;  1XNR E;  2UUC E;  4LF5 E;  1IBM E;  2NUF A;  4JI2 E;  2LTS A;  1T4L B;  1QU6 A;  4M30 A;  3C4B A;  4DV4 E;  2VQE E;  4DR6 E;  3J7Y p;  2L3J A;  2F4V E;  1GQE A;  5IWA E;  2LUP B;  4JI1 E;  4NXM E;  2LRS A;  4DR3 E;  1IBK E;  4X64 E;  4DV7 E;  3T1Y E;  4GKJ E;  3ADG A;  4K0K E;  4DV0 E;  4DV6 E;  2KHX A;  1X47 A;  1YYO A;  1J26 A;  4WYQ B;  4DUY E;  4JI5 E;  4DR5 E;  4LF9 E;  1STU A;  4YHH E;  2B3T B;  1HNX E;  5LMN E;  2L2M A;  2NUE A;  2EZ6 A;  4X66 E;  3ADI A;  1HNW E;  1UIL A;  1N33 E;  2UXC E;  1T4O A;  3C4T A;  4DV5 E;  4DUZ E;  4LF8 E;  1HNZ E;  2DIX A;  2CPN A;  5BR8 E;  4JYA E;  4KHP E;  4LF4 E;  3ADL A;  4JV5 E;  4LF7 E;  4DR4 E;  4OX9 E;  3VYX A;  2L33 A;  1XMO E;  4DV3 E;  1N36 E;  1RC7 A;  4JI8 E;  1IBL E;  4X8W A;  5CFF E;  3HTX A;  2UXD E;  4JI4 E;  4DR1 E;  2MDR A;  2LBS B;  1N34 E;  1DI2 A;  1RQ0 A;  2NA2 A;  1ZBT A;  1HR0 E;  3ADJ A;  1UHZ A;  4LFC E;  2YT4 A;  2N3G A;  4DR2 E;  1X48 A;  4JI7 E;  4LFB E;  2HHH E;  1YZ9 A;  4DKK A;  1FJG E;  4B3M E;  2E5L E; 
#chains in the Genus database with same CATH topology
 4KWY A;  5DNY A;  2KOU A;  4JI3 E;  2NAB A;  2WBS A;  2UUA E;  4B3T E;  2LT7 A;  2M1S A;  2YU8 A;  2YTG A;  3M99 B;  1FKA E;  1T4N A;  2LE2 A;  2EOF A;  2JVA A;  1XMQ E;  2EOX A;  1J5E E;  2EN7 A;  3MSW A;  3BBG A;  3J7A G;  2V89 A;  5A6A A;  5AE1 A;  4R2P A;  2EQ3 A;  2EN1 A;  4ZYD A;  1X6F A;  2WCC 3;  2RQL A;  4BCA A;  4AQY E;  2JYA A;  2RSI A;  2EM2 A;  2HC5 A;  4M2Z A;  4WFT A;  2UU9 E;  2RS6 A;  2EMZ A;  4F2J C;  2UUC E;  2V8Q B;  4JI2 E;  2LTS A;  3VK6 A;  3IWD A;  1Z1B A;  1T4L B;  2EQ0 A;  2V88 A;  3TQM A;  2JR1 A;  2EM7 A;  2EWL A;  4BS9 A;  4WX9 A;  2CSH A;  2F4V E;  4BMJ A;  4TUI A;  4RH8 A;  2M9A A;  3L00 A;  5LL6 R;  4JI1 E;  1BBO A;  1EH8 A;  4X64 E;  2GPI A;  5A2Q C;  4DV0 E;  2PRT A;  1X47 A;  1YYO A;  2JOB A;  4NZV A;  2F8B A;  3KWR A;  3K6Q A;  2YU5 A;  1NCS A;  1STU A;  2DMI A;  5LMN E;  2B9D A;  4RHB B;  2M7Q A;  2EZ6 A;  5KL5 A;  2DGC A;  1UBD C;  2VF1 A;  2M4I A;  4BC7 A;  1ZR9 A;  1PJS A;  2FTX B;  4LU9 A;  5IXM B;  2ODR D;  5KL6 A;  2EPC A;  1WXR A;  4JYA E;  1A1I A;  2YTF A;  4JV5 E;  2JWO A;  1GTK A;  3VYX A;  2V83 A;  3UK3 C;  2YSO A;  4DV3 E;  2EMG A;  1A1J A;  1AAY A;  3THN A;  1IBL E;  1X6E A;  2MDR A;  2FV4 B;  4L5N C;  2LBS B;  3MHS C;  4TUG A;  5F3W A;  2LCE A;  4ZYH A;  1ZU1 A;  4M9V C;  2V86 A;  1A1H A;  3KZZ A;  3ECR A;  2D9H A;  2LJH A;  5A69 A;  2EPK X;  4P78 A;  1BB8 A;  2CTD A;  2V85 A;  2RTX A;  4DR7 E;  2EPO A;  2EM5 A;  2EPU A;  5AC5 A;  1EKZ A;  4IJD A;  2L8T A;  4O24 A;  4YY3 E;  1EH7 A;  4WSP A;  2EOM A;  1X5W A;  2LUQ A;  1PKP A;  1N3G A;  2EOO A;  3QG5 C;  3VYY A;  1WHQ A;  4DV1 E;  4LTY A;  1F2I G;  1WHN A;  5A6B A;  2EJ4 A;  4HTG A;  4MLV A;  3AV0 A;  2VQF E;  5LMU E;  2DMY A;  3C6M A;  3HQ1 A;  3EPJ A;  4B3S E;  3LLH A;  3P1X A;  1DQ3 A;  1PJT A;  4LF5 E;  2FGG A;  4DMI A;  4R2S A;  2EPN A;  2L92 A;  2KON A;  3C4B A;  2YTN A;  2ENC A;  2VQE E;  4DR6 E;  3DJW A;  2YTO A;  1GQE A;  5KL4 A;  2LUP B;  4DR3 E;  2R76 A;  1B69 A;  2DSY A;  4DV7 E;  2JP9 A;  3ADG A;  4GKJ E;  3LML A;  2EMA A;  2EN8 A;  4WYQ B;  3OML A;  4DUY E;  4Q28 A;  5KL7 A;  3EPK A;  2EOZ A;  4YHH E;  2B3T B;  4F9C B;  5KL2 A;  3HXL A;  2NUE A;  1TF3 A;  2YTQ A;  1A1L A;  1SFE A;  1YUJ A;  3ADI A;  2EOI A;  5IT9 C;  1ZBQ A;  1BBG A;  2DIX A;  4R03 A;  2J7J A;  4LF4 E;  3ADL A;  2EPX A;  2YSP A;  2WZO A;  2YRK A;  3RMP A;  4X9J A;  4IS1 C;  4HEI A;  2EPR A;  1YUI A;  2EMC A;  1MEY C;  4DR1 E;  2EML A;  2VRD A;  3EPH A;  1DI2 A;  4R2A A;  1ZBT A;  5ADZ A;  1YPN A;  2CT1 A;  2LJU A;  2EM0 A;  1SR9 A;  2EN3 A;  2H36 X;  1FJG E;  2EMH A;  3ZOQ B;  4B3M E;  4R2Q A;  1IQS A;  2ELZ A;  5A6B D;  1I94 E;  1X49 A;  4F9A B;  2EQ1 A;  2L3C A;  2BBG A;  2UUB E;  4JI6 E;  4FK5 C;  4R2D A;  3IWC A;  4NHR A;  1KYQ A;  4BC9 A;  1YYW A;  4OOG C;  1RMD A;  1G2F C;  2EN2 A;  2EPM X;  3F6G A;  2L2N A;  1WRJ A;  2RS7 A;  2EN4 A;  1WJP A;  2ELY A;  4B3R E;  2HJJ A;  5AAS A;  2NUG A;  2YWQ A;  2I9I A;  1KJK A;  3AUZ A;  4R8O A;  3JAM C;  1XNQ E;  4R2E A;  1X6H A;  2MC5 A;  4O43 A;  4GKK E;  2L2K B;  2RSM A;  5AC4 A;  4LFA E;  5FLX C;  2EMY A;  2UXB E;  4J8Z A;  4X65 E;  2DLK A;  1N32 E;  2B7V A;  4P7D A;  2ZM6 E;  2EN6 A;  3OTO E;  2EL5 A;  2EP3 A;  1XNR E;  2RPC A;  2EL4 A;  2YRM A;  2JXP A;  2EMX A;  4M30 A;  4MLQ A;  5KL3 A;  2EL6 A;  1YSA C;  3J7Y p;  2L3J A;  5AE3 A;  2DLQ A;  5IWA E;  2YTD A;  1JK1 A;  2A25 A;  2EPA A;  2LRS A;  1IBK E;  3IWB A;  1G2D C;  3JTZ A;  2YRH A;  4K0K E;  2KHX A;  1J26 A;  4DR5 E;  4LF9 E;  2EMK A;  2LO3 A;  3F6H A;  3VHT B;  1HNX E;  2L2M A;  2EM9 A;  1A1K A;  4F54 A;  1IMU A;  4GEQ B;  4X66 E;  1UIL A;  2GHF A;  2EOR A;  1T4O A;  2EE8 A;  3H09 A;  1JK2 A;  4LF8 E;  4BBY A;  1HNZ E;  2K4V A;  5BR8 E;  4LF7 E;  4DR4 E;  4OX9 E;  2L33 A;  3MHH C;  2MDG A;  4WSG A;  2EMI A;  4JI8 E;  2MKD A;  4X8W A;  2UXD E;  3KZY A;  3HTX A;  3BGH A;  4BHB A;  2MKN A;  3FIG A;  4N4R B;  1RQ0 A;  4WPY A;  2EM3 A;  3J81 C;  3ADJ A;  1UHZ A;  4LFC E;  2YT4 A;  4DR2 E;  1TN9 A;  2G7H A;  2EPL X;  2Q8U A;  2HHH E;  4KZS A;  2YTJ A;  2JOX A;  4WXD A;  1PJQ A;  1L4S A;  3HPZ A;  2IHR 1;  3JU0 A;  2B7T A;  5TSE A;  4LF6 E;  2E72 A;  2MC6 A;  1PDA A;  2K7I A;  1A1F A;  4R2C A;  3BF2 A;  2YTI A;  2LV2 A;  4JI0 E;  2EMW A;  4BHC A;  2LTR A;  3THO B;  4ZYE A;  2EM8 A;  4O4K A;  4NXN E;  2EOY A;  2YTE A;  1T38 A;  4X62 E;  2EOS A;  2EOH A;  3BID A;  2EM4 A;  2EOE A;  1YYK A;  1EH6 A;  1O0W A;  3T1H E;  2I13 A;  1X3C A;  1ZAA C;  5LLQ A;  2BB8 A;  2JY9 A;  3EPL A;  2DB2 A;  1A1G A;  2N3H A;  3DF6 A;  4DV2 E;  4WXC A;  1DGC A;  4GZN C;  1UN6 B;  2YZT A;  1IBM E;  2NUF A;  2ADR A;  3J80 C;  2LVH A;  2EMF A;  1QU6 A;  4DV4 E;  4F9B B;  1YFH A;  2ODR C;  4ZYG A;  2GLI A;  1IQO A;  2LMZ A;  4NXM E;  1QNT A;  2EPP A;  2V87 A;  2EOQ A;  3T1Y E;  4DV6 E;  5A6J A;  4L8N A;  2DRP A;  4JI5 E;  1TF6 A;  5T6J A;  2VE7 C;  4F6M A;  4F6N A;  1NEI A;  2EOJ A;  2HGH A;  5AE2 A;  2JPA A;  3C6K A;  2WBU A;  1HNW E;  1N33 E;  2UXC E;  2YPN A;  3C4T A;  4Q35 B;  2ENH A;  5A6K A;  4DUZ E;  4DV5 E;  1GZ6 A;  2EMB A;  2CPN A;  2R1F A;  4KHP E;  1AH5 A;  4O5G A;  1XMO E;  2E1M A;  5IV8 B;  2EPZ A;  4R2R A;  1LLM C;  1N36 E;  2L6M A;  2WBT A;  2ENA A;  1RC7 A;  1T39 A;  5CFF E;  2YTP A;  4JI4 E;  1N34 E;  2NA2 A;  1HR0 E;  1MGT A;  2N3G A;  3EQ1 A;  3HPS A;  1X48 A;  4M0V A;  2EM6 A;  4JI7 E;  4LFB E;  1P47 A;  4I8O A;  1YZ9 A;  4DKK A;  2N8X A;  2E5L E; 
#chains in the Genus database with same CATH homology
 2IHR 1;  2LJH A;  3JU0 A;  2B7T A;  4LF6 E;  4P78 A;  5DNY A;  2V85 A;  2RTX A;  2KOU A;  1I94 E;  1X49 A;  4DR7 E;  4F9A B;  4JI3 E;  2MC6 A;  2L3C A;  1EKZ A;  4JI0 E;  2UUA E;  2UUB E;  4JI6 E;  4B3T E;  2LTR A;  3IWC A;  2L8T A;  4BC9 A;  2M1S A;  1YYW A;  4OOG C;  4NXN E;  4YY3 E;  4X62 E;  1FKA E;  3F6G A;  2L2N A;  2RS7 A;  1T4N A;  2LUQ A;  2LE2 A;  1PKP A;  2JVA A;  3VYY A;  4DV1 E;  1XMQ E;  1WHQ A;  5AAS A;  4LTY A;  1J5E E;  1YYK A;  2NUG A;  1WHN A;  1O0W A;  3MSW A;  1N34 E;  3J7A G;  3AUZ A;  4R8O A;  2V89 A;  3AV0 A;  3JAM C;  5AE1 A;  2VQF E;  1XNQ E;  3T1H E;  4LF8 E;  2MC5 A;  4GKK E;  2L2K B;  5LMU E;  2RSM A;  2DMY A;  2JY9 A;  4LFA E;  5FLX C;  3HQ1 A;  4BCA A;  2UXB E;  4J8Z A;  4X65 E;  4AQY E;  1N32 E;  2DB2 A;  2B7V A;  4P7D A;  4B3S E;  3LLH A;  4M2Z A;  2N3H A;  3DF6 A;  4WFT A;  2ZM6 E;  2RS6 A;  4DV2 E;  3OTO E;  2UU9 E;  3P1X A;  1DQ3 A;  1XNR E;  2UUC E;  4LF5 E;  2FGG A;  2YZT A;  1IBM E;  2V8Q B;  3J80 C;  2NUF A;  4JI2 E;  2LTS A;  4DMI A;  2L92 A;  2KON A;  3VK6 A;  3IWD A;  1T4L B;  1QU6 A;  2V88 A;  4M30 A;  3C4B A;  2JR1 A;  4DV4 E;  4F9B B;  2ODR C;  2VQE E;  4DR6 E;  2EWL A;  4BS9 A;  3J7Y p;  2L3J A;  5AE3 A;  2F4V E;  3DJW A;  4BMJ A;  1GQE A;  5IWA E;  2LMZ A;  4TUI A;  5LL6 R;  2LUP B;  4JI1 E;  4NXM E;  2LRS A;  4DR3 E;  1IBK E;  4X64 E;  3IWB A;  3JTZ A;  2DSY A;  2V87 A;  4DV7 E;  3T1Y E;  4B3R E;  4GKJ E;  3ADG A;  4K0K E;  5A2Q C;  4DV0 E;  4DV6 E;  2KHX A;  3LML A;  1X47 A;  1YYO A;  2JOB A;  1J26 A;  4WYQ B;  3OML A;  4L8N A;  2F8B A;  4Q28 A;  4DUY E;  4DR5 E;  4JI5 E;  3KWR A;  4LF9 E;  5T6J A;  2VE7 C;  3K6Q A;  3F6H A;  1STU A;  4YHH E;  2B3T B;  4F9C B;  1HNX E;  5LMN E;  2L2M A;  2B9D A;  3HXL A;  2NUE A;  2M7Q A;  2EZ6 A;  4F54 A;  5AE2 A;  2VF1 A;  2M4I A;  4GEQ B;  4X66 E;  4BC7 A;  3ADI A;  2FTX B;  4LU9 A;  1HNW E;  1UIL A;  1N33 E;  2UXC E;  2ODR D;  1DI2 A;  1T4O A;  3H09 A;  5IT9 C;  3C4T A;  4DV5 E;  1ZBQ A;  4BBY A;  4DUZ E;  1GZ6 A;  1WXR A;  2DIX A;  2CPN A;  2K4V A;  4R03 A;  5BR8 E;  1HNZ E;  4LF4 E;  3ADL A;  4JYA E;  2JWO A;  4LF7 E;  4DR4 E;  4KHP E;  4OX9 E;  4JV5 E;  3VYX A;  2L33 A;  2WZO A;  3RMP A;  2V83 A;  1XMO E;  2E1M A;  4DV3 E;  1N36 E;  2L6M A;  1RC7 A;  4JI8 E;  1IBL E;  4X8W A;  5CFF E;  3HTX A;  2UXD E;  4JI4 E;  4DR1 E;  2MDR A;  2FV4 B;  4L5N C;  2LBS B;  5F3W A;  4TUG A;  3FIG A;  4WPY A;  1RQ0 A;  2NA2 A;  1ZBT A;  3J81 C;  3ADJ A;  1UHZ A;  5ADZ A;  1HR0 E;  2YT4 A;  4LFC E;  2N3G A;  4DR2 E;  1X48 A;  3HPS A;  2G7H A;  4M0V A;  1SR9 A;  4JI7 E;  4LFB E;  2V86 A;  2HHH E;  4KZS A;  4I8O A;  2H36 X;  2JOX A;  4DKK A;  1YZ9 A;  1FJG E;  3ZOQ B;  4WSP A;  4B3M E;  2E5L E;  3HPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...