2L33A

Solution nmr structure of drbm 2 domain of interleukin enhancer-binding factor 3 from homo sapiens, northeast structural genomics consortium target hr4527e
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
91
structure length
91
Chain Sequence
MGHHHHHHSHMLTKHGKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAYAALAALEKLFPDTPLALDANK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin enhancer-binding factor 3
publication title Northeast Structural Genomics Consortium Target HR4527E
rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 15
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2010-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l33A00
3OTOE 4DV2E 1XMOE 1N33E 2EZ6A 4GKJE 1T4LB 2CPNA 1J5EE 4DR4E 3ADIA 1J26A 2NUGA 2UXBE 2RS6A 2NA2A 4LF7E 2ZM6E 4X64E 4NXNE 4DR2E 1IBKE 3ADLA 2DIXA 3T1HE 4X66E 1N36E 4WYQB 1FJGE 2E5LE 2KHXA 4DV6E 2VQFE 4JI2E 4GKKE 1XNRE 1YYKA 2L2MA 2HHHE 2UXCE 4LF5E 1O0WA 4JI6E 1YYWA 4DUZE 3HTXA 4JI1E 4LFCE 1HNXE 1YZ9A 2LUPB 4LF6E 4OX9E 2JY9A 3VYXA 1PKPA 2LTRA 3C4BA 3C4TA 1IBME 1DI2A 3VYYA 5IWAE 1T4NA 2UXDE 4OOGC 4DV4E 2LTSA 4JI7E 3T1YE 1N32E 2VQEE 2L2NA 4M30A 4M2ZA 1IBLE 4KHPE 2LUQA 4JI5E 2NUEA 1UHZA 4JV5E 2LBSB 2UU9E 4B3ME 4K0KE 5LMUE 1RQ0A 1YYOA 4DV0E 4B3SE 5BR8E 4DV1E 4DV7E 2UUAE 2B7VA 4YHHE 1XNQE 4DUYE 3ADJA 4B3RE 2DMYA 4JI8E 2L3CA 4X8WA 1T4OA 3J7Yp 2JVAA 1X47A 2RS7A 4WFTA 1HR0E 4X62E 4LFBE 1I94E 1EKZA 2IHR1 4LF9E 3ADGA 4JI0E 4DKKA 2MDRA 1QU6A 1UILA 2B3TB 4JI3E 1HNWE 1WHQA 4DR6E 2L2KB 2UUBE 2NUFA 1X48A 2UUCE 2N3HA 4LF8E 4JI4E 2N3GA 1HNZE 2L33A 4X65E 4DR5E 1X49A 4LFAE 4DR3E 1XMQE 1GQEA 1ZBTA 2RTXA 2B7TA 3LLHA 2YT4A 4AQYE 2DB2A 4DV5E 4DR1E 5LMNE 2LRSA 4DV3E 2LJHA 1RC7A 1FKAE 4NXME 1WHNA 4B3TE 2RSMA 1N34E 4JYAE 4YY3E 2F4VE 4LF4E 2L3JA 1STUA 4DR7E 3P1XA 5CFFE
chains in the Genus database with same CATH superfamily
3OTOE 4DV2E 2EOYA 2JYAA 4WSPA 2EL5A 2VRDA 1AAYA 2V86A 4WX9A 3THOB 1X6FA 1X6EA 2G7HA 2VE7C 4ZYEA 2EMWA 4F2JC 3EPKA 1DQ3A 2ENHA 2YZTA 1N36E 1IQSA 3HXLA 2KHXA 3MSWA 4WXCA 2MDGA 1XNRE 1YYKA 2HHHE 4LF5E 2K7IA 2LV2A 2YSPA 3DJWA 2EMXA 4KZSA 1T39A 1PDAA 1QNTA 2YTDA 5TSEA 4LF6E 2EN4A 2ENAA 3IWDA 1PKPA 2HC5A 2NABA 4P7DA 2EMHA 3C4BA 5LL6R 1DI2A 3VYYA 4R2RA 4GEQB 2EMLA 5KL7A 1ZU1A 4OOGC 1BBOA 4KWYA 2EP3A 2MC6A 2EMKA 1YFHA 2RSIA 2GHFA 4JV5E 2HGHA 2EQ1A 4NZVA 1RQ0A 3EPJA 4IJDA 5BR8E 1GZ6A 2MKDA 3JAMC 1PJSA 4YHHE 2EN8A 4DUYE 3ADJA 3BF2A 3J81C 2L3CA 4O43A 2YTPA 2JVAA 2RS7A 5F3WA 2EMAA 2EM0A 2JP9A 2R76A 1I94E 2JOBA 3EQ1A 2EM3A 1ZR9A 1QU6A 1WHQA 4DR6E 5A69A 2V85A 2N3HA 2DMIA 2EPMX 2N3GA 2YRMA 4DR5E 3DF6A 4WSGA 1X49A 2EWLA 1HNZE 4F9CB 3M99B 2N8XA 1WXRA 5DNYA 1ZAAC 4LTYA 2DB2A 4DV3E 2R1FA 2PRTA 1DGCA 2EOZA 4B3TE 2CSHA 4JYAE 1L4SA 1SFEA 2F4VE 2VF1A 1STUA 1Z1BA 4TUGA 1TF3A 4F9AB 1XMOE 2EZ6A 4F54A 4Q35B 1T4LB 3UK3C 2EL4A 1J5EE 4DR4E 3ADIA 2V89A 5AE1A 4BMJA 2UXBE 4BS9A 2RS6A 2NA2A 2YWQA 2ZM6E 4X64E 3ADLA 4DR2E 5IT9C 3QG5C 2LE2A 5KL2A 3VHTB 2WCC3 5KL6A 2DSYA 2DRPA 1O0WA 2EPRA 4JI1E 2D9HA 3K6QA 2EM4A 2L92A 2B9DA 4ZYGA 2EOHA 2JY9A 2M7QA 3VYXA 2LTRA 1SR9A 4MLVA 2EL6A 4DMIA 4ZYDA 4DV4E 2LTSA 2EE8A 2ENCA 4JI7E 1A1KA 3HPSA 2VQEE 2L2NA 2LJUA 4M30A 2YTQA 2FGGA 2EOXA 2EM6A 4M9VC 2LBSB 2EPLX 2EM9A 5A6JA 5LMUE 2EPNA 4DV0E 4B3SE 1X6HA 2EPCA 2EN7A 4B3RE 4JI8E 1X3CA 2YTJA 2EPKX 1T4OA 3J7Yp 1X47A 2CTDA 1HR0E 4X62E 1ZBQA 3KZYA 1YUJA 3VK6A 1EH6A 3F6GA 1EKZA 4LF9E 1HNWE 4JI3E 2L2KB 2NUFA 3J7AG 4X9JA 2EOEA 2ELYA 1UN6B 4O24A 2JXPA 4DR3E 1JK1A 1GQEA 4Q28A 2YT4A 4R2AA 4RH8A 2WZOA 3RMPA 2EMZA 2EOSA 4R2CA 2JR1A 2EMYA 2YTOA 3BBGA 2ADRA 2RSMA 5FLXC 1N34E 2I13A 5KL3A 4M0VA 1G2DC 1AH5A 1N33E 2YTGA 4WPYA 2EPXA 4TUIA 2YPNA 5AC5A 2MKNA 2YU5A 3KZZA 5A6BD 2LMZA 2YTFA 4LF7E 1A1FA 2KOUA 4NXNE 4BCAA 1IBKE 1UBDC 4IS1C 3T1HE 4L5NC 3THNA 5A6AA 2L6MA 4O4KA 3JU0A 2E5LE 4BHCA 2VQFE 2F8BA 2WBUA 3F6HA 2UXCE 3BIDA 4R2PA 4JI6E 1YYWA 2A25A 4LFCE 3ECRA 2EOIA 1YZ9A 1PJQA 1YPNA 2LUPB 3AUZA 2LCEA 4I8OA 4OX9E 4R2QA 4MLQA 5IV8B 4F9BB 2YTIA 4HEIA 1NEIA 1T4NA 4P78A 4GZNC 4F6MA 1NCSA 3C6KA 2EQ0A 3T1YE 2DLQA 2LO3A 5AE3A 2EN1A 4L8NA 1IBLE 2LUQA 4KHPE 4JI5E 2NUEA 2YRKA 5IXMB 1T38A 2GPIA 2V8QB 2EMGA 1P47A 1A1LA 3HQ1A 1YYOA 2EQ3A 2EPOA 5A2QC 4DV1E 1F2IG 2FV4B 2DGCA 2UUAE 2YTEA 2EOOA 3EPHA 1XNQE 2ELZA 3H09A 4F6NA 2DMYA 4X8WA 2V87A 3BGHA 3L00A 2IHR1 2EN3A 4DKKA 2M1SA 3ZOQB 2MDRA 1UILA 2B3TB 1RMDA 1X48A 2UUCE 4LF8E 5KL5A 2EMIA 1IQOA 4JI4E 2L33A 4X65E 1LLMC 4LFAE 2EPUA 4R03A 2YU8A 1ZBTA 3J80C 1PJTA 5AE2A 2B7TA 3LLHA 4R2EA 4DR1E 1TF6A 5LMNE 1BBGA 2EM2A 1RC7A 3LMLA 2RQLA 1WRJA 2EOFA 1YSAC 2EORA 2LT7A 2V83A 4LF4E 2L3JA 2MC5A 2CT1A 1G2FC 3P1XA 4GKJE 3MHHC 2KONA 2CPNA 3EPLA 4HTGA 5AASA 1J26A 4FK5C 2NUGA 5AC4A 1BB8A 2EOJA 2J7JA 1GTKA 4R8OA 4NHRA 2DIXA 2EPAA 4X66E 2EPZA 1MEYC 4WYQB 1JK2A 1FJGE 2EM5A 1IMUA 4DV6E 2EN2A 2WBTA 4JI2E 4GKKE 2DLKA 2L2MA 1A1GA 1B69A 3KWRA 4DUZE 3HTXA 2YRHA 3MHSC 1HNXE 2L8TA 2K4VA 4J8ZA 1KJKA 3AV0A 3C4TA 4RHBB 1IBME 2JPAA 5IWAE 2UXDE 4ZYHA 2EM7A 4WXDA 1YUIA 2RPCA 3TQMA 1N32E 4M2ZA 1UHZA 2BB8A 2E1MA 4R2DA 4BC9A 2UU9E 4B3ME 4K0KE 2I9IA 4BHBA 1A1IA 2HJJA 4DV7E 3JTZA 4N4RB 1TN9A 1EH7A 2B7VA 2BBGA 1KYQA 2V88A 4WFTA 4LFBE 2FTXB 2ODRD 2WBSA 1MGTA 2EJ4A 2LVHA 3ADGA 4JI0E 4BC7A 3FIGA 1A1JA 2JWOA 2ODRC 5ADZA 2UUBE 1A1HA 2EPPA 3HPZA 5A6BA 5LLQA 2JOXA 4O5GA 2M9AA 5T6JA 1XMQE 2YSOA 5A6KA 3C6MA 1EH8A 2RTXA 3IWCA 4AQYE 4DV5E 3IWBA 2GLIA 2EMBA 2LRSA 2Q8UA 2LJHA 2EN6A 1FKAE 2E72A 4NXME 4R2SA 1WJPA 1WHNA 2EOQA 2H36X 4BBYA 2EM8A 3OMLA 2EOMA 2M4IA 4YY3E 4LU9A 1X5WA 1N3GA 2EMCA 2YTNA 4DR7E 2EMFA 5KL4A 5CFFE
chains in the Genus database with same CATH topology
3OTOE 4DV2E 1XMOE 1N33E 2EZ6A 4WPYA 4WSPA 4F54A 4TUIA 4GKJE 2KONA 1T4LB 2CPNA 1J5EE 5AASA 3ADIA 4DR4E 1J26A 2LMZA 2V86A 2V89A 5AE1A 4BMJA 2NUGA 4BS9A 2RS6A 2UXBE 2NA2A 4LF7E 2G7HA 2VE7C 4R8OA 2ZM6E 4X64E 2KOUA 4DR2E 4BCAA 5IT9C 1IBKE 4NXNE 3ADLA 1DQ3A 2DIXA 2YZTA 4X66E 4L5NC 3T1HE 1N36E 4WYQB 2L6MA 1FJGE 3JU0A 2LE2A 2E5LE 3HXLA 2KHXA 4DV6E 2VQFE 3MSWA 4JI2E 2F8BA 4GKKE 1XNRE 1YYKA 2L2MA 3F6HA 2HHHE 2UXCE 2DSYA 4LF5E 1O0WA 3DJWA 3KWRA 4DUZE 4JI6E 4JI1E 4KZSA 1YYWA 3HTXA 4LFCE 1HNXE 2L8TA 1YZ9A 3K6QA 2LUPB 4LF6E 2L92A 2B9DA 3AUZA 2K4VA 3IWDA 4I8OA 4J8ZA 2JY9A 2M7QA 1PKPA 4OX9E 3VYXA 4P7DA 2LTRA 3AV0A 1SR9A 3C4BA 3C4TA 5LL6R 1IBME 4F9BB 1DI2A 3VYYA 4GEQB 5IWAE 1T4NA 4DMIA 2UXDE 4P78A 4OOGC 4DV4E 2LTSA 4JI7E 3T1YE 1N32E 3HPSA 2VQEE 2L2NA 4M30A 4M2ZA 2MC6A 5AE3A 4L8NA 1IBLE 2FGGA 2LUQA 4JI5E 2NUEA 4KHPE 1UHZA 2E1MA 4JV5E 4BC9A 2LBSB 2UU9E 4B3ME 4K0KE 2V8QB 5LMUE 1RQ0A 3HQ1A 1YYOA 4DV0E 4B3SE 5BR8E 5A2QC 3JTZA 1GZ6A 4DV1E 4DV7E 2FV4B 3JAMC 2UUAE 2B7VA 4YHHE 1XNQE 4DUYE 3H09A 3ADJA 3J81C 1HNWE 4B3RE 2DMYA 4JI8E 2L3CA 4X8WA 2V87A 2V88A 1T4OA 2JVAA 1X47A 2RS7A 4WFTA 3J7Yp 2FTXB 1ZBQA 4X62E 5F3WA 1HR0E 2ODRD 4LFBE 3VK6A 1I94E 1EKZA 2IHR1 2JOBA 3ADGA 3F6GA 4JI0E 4DKKA 2M1SA 4BC7A 3FIGA 4LF9E 3ZOQB 2MDRA 1QU6A 1UILA 2B3TB 2JWOA 2ODRC 1WHQA 5ADZA 2L2KB 2UUBE 4JI3E 4DR6E 2V85A 2NUFA 1X48A 2UUCE 2N3HA 4LF8E 3J7AG 3HPZA 2JOXA 4JI4E 2N3GA 1HNZE 2L33A 4X65E 3DF6A 4DR5E 1X49A 2EWLA 4LFAE 4R03A 4DR3E 1XMQE 5T6JA 4F9CB 1GQEA 1ZBTA 4Q28A 2RTXA 3J80C 5AE2A 1WXRA 2B7TA 3LLHA 2YT4A 5DNYA 3IWCA 4LTYA 4AQYE 2DB2A 3IWBA 4DV5E 4DR1E 2WZOA 5LMNE 2LRSA 4DV3E 3RMPA 2LJHA 1RC7A 1FKAE 2JR1A 4NXME 2H36X 1WHNA 3LMLA 4BBYA 4B3TE 3OMLA 2RSMA 5FLXC 1N34E 4JYAE 2M4IA 4YY3E 2F4VE 4LU9A 2V83A 4LF4E 2VF1A 4M0VA 2L3JA 2MC5A 1STUA 4DR7E 4TUGA 3P1XA 4F9AB 5CFFE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO E;  4DV2 E;  1XMO E;  1N33 E;  2EZ6 A;  4GKJ E;  1T4L B;  2CPN A;  1J5E E;  4DR4 E;  3ADI A;  1J26 A;  2NUG A;  2UXB E;  2RS6 A;  2NA2 A;  4LF7 E;  2ZM6 E;  4X64 E;  4NXN E;  4DR2 E;  1IBK E;  3ADL A;  2DIX A;  3T1H E;  4X66 E;  1N36 E;  4WYQ B;  1FJG E;  2E5L E;  2KHX A;  4DV6 E;  2VQF E;  4JI2 E;  4GKK E;  1XNR E;  1YYK A;  2L2M A;  2HHH E;  2UXC E;  4LF5 E;  1O0W A;  4JI6 E;  1YYW A;  4DUZ E;  3HTX A;  4JI1 E;  4LFC E;  1HNX E;  1YZ9 A;  2LUP B;  4LF6 E;  4OX9 E;  2JY9 A;  3VYX A;  1PKP A;  2LTR A;  3C4B A;  3C4T A;  1IBM E;  1DI2 A;  3VYY A;  5IWA E;  1T4N A;  2UXD E;  4OOG C;  4DV4 E;  2LTS A;  4JI7 E;  3T1Y E;  1N32 E;  2VQE E;  2L2N A;  4M30 A;  4M2Z A;  1IBL E;  4KHP E;  2LUQ A;  4JI5 E;  2NUE A;  1UHZ A;  4JV5 E;  2LBS B;  2UU9 E;  4B3M E;  4K0K E;  5LMU E;  1RQ0 A;  1YYO A;  4DV0 E;  4B3S E;  5BR8 E;  4DV1 E;  4DV7 E;  2UUA E;  2B7V A;  4YHH E;  1XNQ E;  4DUY E;  3ADJ A;  4B3R E;  2DMY A;  4JI8 E;  2L3C A;  4X8W A;  1T4O A;  3J7Y p;  2JVA A;  1X47 A;  2RS7 A;  4WFT A;  1HR0 E;  4X62 E;  4LFB E;  1I94 E;  1EKZ A;  2IHR 1;  4LF9 E;  3ADG A;  4JI0 E;  4DKK A;  2MDR A;  1QU6 A;  1UIL A;  2B3T B;  4JI3 E;  1HNW E;  1WHQ A;  4DR6 E;  2L2K B;  2UUB E;  2NUF A;  1X48 A;  2UUC E;  2N3H A;  4LF8 E;  4JI4 E;  2N3G A;  1HNZ E;  2L33 A;  4X65 E;  4DR5 E;  1X49 A;  4LFA E;  4DR3 E;  1XMQ E;  1GQE A;  1ZBT A;  2RTX A;  2B7T A;  3LLH A;  2YT4 A;  4AQY E;  2DB2 A;  4DV5 E;  4DR1 E;  5LMN E;  2LRS A;  4DV3 E;  2LJH A;  1RC7 A;  1FKA E;  4NXM E;  1WHN A;  4B3T E;  2RSM A;  1N34 E;  4JYA E;  4YY3 E;  2F4V E;  4LF4 E;  2L3J A;  1STU A;  4DR7 E;  3P1X A;  5CFF E; 
#chains in the Genus database with same CATH topology
 3OTO E;  4DV2 E;  2EOY A;  2JYA A;  4WSP A;  2EL5 A;  2VRD A;  1AAY A;  2V86 A;  4WX9 A;  3THO B;  1X6F A;  1X6E A;  2G7H A;  2VE7 C;  4ZYE A;  2EMW A;  4F2J C;  3EPK A;  1DQ3 A;  2ENH A;  2YZT A;  1N36 E;  1IQS A;  3HXL A;  2KHX A;  3MSW A;  4WXC A;  2MDG A;  1XNR E;  1YYK A;  2HHH E;  4LF5 E;  2K7I A;  2LV2 A;  2YSP A;  3DJW A;  2EMX A;  4KZS A;  1T39 A;  1PDA A;  1QNT A;  2YTD A;  5TSE A;  4LF6 E;  2EN4 A;  2ENA A;  3IWD A;  1PKP A;  2HC5 A;  2NAB A;  4P7D A;  2EMH A;  3C4B A;  5LL6 R;  1DI2 A;  3VYY A;  4R2R A;  4GEQ B;  2EML A;  5KL7 A;  1ZU1 A;  4OOG C;  1BBO A;  4KWY A;  2EP3 A;  2MC6 A;  2EMK A;  1YFH A;  2RSI A;  2GHF A;  4JV5 E;  2HGH A;  2EQ1 A;  4NZV A;  1RQ0 A;  3EPJ A;  4IJD A;  5BR8 E;  1GZ6 A;  2MKD A;  3JAM C;  1PJS A;  4YHH E;  2EN8 A;  4DUY E;  3ADJ A;  3BF2 A;  3J81 C;  2L3C A;  4O43 A;  2YTP A;  2JVA A;  2RS7 A;  5F3W A;  2EMA A;  2EM0 A;  2JP9 A;  2R76 A;  1I94 E;  2JOB A;  3EQ1 A;  2EM3 A;  1ZR9 A;  1QU6 A;  1WHQ A;  4DR6 E;  5A69 A;  2V85 A;  2N3H A;  2DMI A;  2EPM X;  2N3G A;  2YRM A;  4DR5 E;  3DF6 A;  4WSG A;  1X49 A;  2EWL A;  1HNZ E;  4F9C B;  3M99 B;  2N8X A;  1WXR A;  5DNY A;  1ZAA C;  4LTY A;  2DB2 A;  4DV3 E;  2R1F A;  2PRT A;  1DGC A;  2EOZ A;  4B3T E;  2CSH A;  4JYA E;  1L4S A;  1SFE A;  2F4V E;  2VF1 A;  1STU A;  1Z1B A;  4TUG A;  1TF3 A;  4F9A B;  1XMO E;  2EZ6 A;  4F54 A;  4Q35 B;  1T4L B;  3UK3 C;  2EL4 A;  1J5E E;  4DR4 E;  3ADI A;  2V89 A;  5AE1 A;  4BMJ A;  2UXB E;  4BS9 A;  2RS6 A;  2NA2 A;  2YWQ A;  2ZM6 E;  4X64 E;  3ADL A;  4DR2 E;  5IT9 C;  3QG5 C;  2LE2 A;  5KL2 A;  3VHT B;  2WCC 3;  5KL6 A;  2DSY A;  2DRP A;  1O0W A;  2EPR A;  4JI1 E;  2D9H A;  3K6Q A;  2EM4 A;  2L92 A;  2B9D A;  4ZYG A;  2EOH A;  2JY9 A;  2M7Q A;  3VYX A;  2LTR A;  1SR9 A;  4MLV A;  2EL6 A;  4DMI A;  4ZYD A;  4DV4 E;  2LTS A;  2EE8 A;  2ENC A;  4JI7 E;  1A1K A;  3HPS A;  2VQE E;  2L2N A;  2LJU A;  4M30 A;  2YTQ A;  2FGG A;  2EOX A;  2EM6 A;  4M9V C;  2LBS B;  2EPL X;  2EM9 A;  5A6J A;  5LMU E;  2EPN A;  4DV0 E;  4B3S E;  1X6H A;  2EPC A;  2EN7 A;  4B3R E;  4JI8 E;  1X3C A;  2YTJ A;  2EPK X;  1T4O A;  3J7Y p;  1X47 A;  2CTD A;  1HR0 E;  4X62 E;  1ZBQ A;  3KZY A;  1YUJ A;  3VK6 A;  1EH6 A;  3F6G A;  1EKZ A;  4LF9 E;  1HNW E;  4JI3 E;  2L2K B;  2NUF A;  3J7A G;  4X9J A;  2EOE A;  2ELY A;  1UN6 B;  4O24 A;  2JXP A;  4DR3 E;  1JK1 A;  1GQE A;  4Q28 A;  2YT4 A;  4R2A A;  4RH8 A;  2WZO A;  3RMP A;  2EMZ A;  2EOS A;  4R2C A;  2JR1 A;  2EMY A;  2YTO A;  3BBG A;  2ADR A;  2RSM A;  5FLX C;  1N34 E;  2I13 A;  5KL3 A;  4M0V A;  1G2D C;  1AH5 A;  1N33 E;  2YTG A;  4WPY A;  2EPX A;  4TUI A;  2YPN A;  5AC5 A;  2MKN A;  2YU5 A;  3KZZ A;  5A6B D;  2LMZ A;  2YTF A;  4LF7 E;  1A1F A;  2KOU A;  4NXN E;  4BCA A;  1IBK E;  1UBD C;  4IS1 C;  3T1H E;  4L5N C;  3THN A;  5A6A A;  2L6M A;  4O4K A;  3JU0 A;  2E5L E;  4BHC A;  2VQF E;  2F8B A;  2WBU A;  3F6H A;  2UXC E;  3BID A;  4R2P A;  4JI6 E;  1YYW A;  2A25 A;  4LFC E;  3ECR A;  2EOI A;  1YZ9 A;  1PJQ A;  1YPN A;  2LUP B;  3AUZ A;  2LCE A;  4I8O A;  4OX9 E;  4R2Q A;  4MLQ A;  5IV8 B;  4F9B B;  2YTI A;  4HEI A;  1NEI A;  1T4N A;  4P78 A;  4GZN C;  4F6M A;  1NCS A;  3C6K A;  2EQ0 A;  3T1Y E;  2DLQ A;  2LO3 A;  5AE3 A;  2EN1 A;  4L8N A;  1IBL E;  2LUQ A;  4KHP E;  4JI5 E;  2NUE A;  2YRK A;  5IXM B;  1T38 A;  2GPI A;  2V8Q B;  2EMG A;  1P47 A;  1A1L A;  3HQ1 A;  1YYO A;  2EQ3 A;  2EPO A;  5A2Q C;  4DV1 E;  1F2I G;  2FV4 B;  2DGC A;  2UUA E;  2YTE A;  2EOO A;  3EPH A;  1XNQ E;  2ELZ A;  3H09 A;  4F6N A;  2DMY A;  4X8W A;  2V87 A;  3BGH A;  3L00 A;  2IHR 1;  2EN3 A;  4DKK A;  2M1S A;  3ZOQ B;  2MDR A;  1UIL A;  2B3T B;  1RMD A;  1X48 A;  2UUC E;  4LF8 E;  5KL5 A;  2EMI A;  1IQO A;  4JI4 E;  2L33 A;  4X65 E;  1LLM C;  4LFA E;  2EPU A;  4R03 A;  2YU8 A;  1ZBT A;  3J80 C;  1PJT A;  5AE2 A;  2B7T A;  3LLH A;  4R2E A;  4DR1 E;  1TF6 A;  5LMN E;  1BBG A;  2EM2 A;  1RC7 A;  3LML A;  2RQL A;  1WRJ A;  2EOF A;  1YSA C;  2EOR A;  2LT7 A;  2V83 A;  4LF4 E;  2L3J A;  2MC5 A;  2CT1 A;  1G2F C;  3P1X A;  4GKJ E;  3MHH C;  2KON A;  2CPN A;  3EPL A;  4HTG A;  5AAS A;  1J26 A;  4FK5 C;  2NUG A;  5AC4 A;  1BB8 A;  2EOJ A;  2J7J A;  1GTK A;  4R8O A;  4NHR A;  2DIX A;  2EPA A;  4X66 E;  2EPZ A;  1MEY C;  4WYQ B;  1JK2 A;  1FJG E;  2EM5 A;  1IMU A;  4DV6 E;  2EN2 A;  2WBT A;  4JI2 E;  4GKK E;  2DLK A;  2L2M A;  1A1G A;  1B69 A;  3KWR A;  4DUZ E;  3HTX A;  2YRH A;  3MHS C;  1HNX E;  2L8T A;  2K4V A;  4J8Z A;  1KJK A;  3AV0 A;  3C4T A;  4RHB B;  1IBM E;  2JPA A;  5IWA E;  2UXD E;  4ZYH A;  2EM7 A;  4WXD A;  1YUI A;  2RPC A;  3TQM A;  1N32 E;  4M2Z A;  1UHZ A;  2BB8 A;  2E1M A;  4R2D A;  4BC9 A;  2UU9 E;  4B3M E;  4K0K E;  2I9I A;  4BHB A;  1A1I A;  2HJJ A;  4DV7 E;  3JTZ A;  4N4R B;  1TN9 A;  1EH7 A;  2B7V A;  2BBG A;  1KYQ A;  2V88 A;  4WFT A;  4LFB E;  2FTX B;  2ODR D;  2WBS A;  1MGT A;  2EJ4 A;  2LVH A;  3ADG A;  4JI0 E;  4BC7 A;  3FIG A;  1A1J A;  2JWO A;  2ODR C;  5ADZ A;  2UUB E;  1A1H A;  2EPP A;  3HPZ A;  5A6B A;  5LLQ A;  2JOX A;  4O5G A;  2M9A A;  5T6J A;  1XMQ E;  2YSO A;  5A6K A;  3C6M A;  1EH8 A;  2RTX A;  3IWC A;  4AQY E;  4DV5 E;  3IWB A;  2GLI A;  2EMB A;  2LRS A;  2Q8U A;  2LJH A;  2EN6 A;  1FKA E;  2E72 A;  4NXM E;  4R2S A;  1WJP A;  1WHN A;  2EOQ A;  2H36 X;  4BBY A;  2EM8 A;  3OML A;  2EOM A;  2M4I A;  4YY3 E;  4LU9 A;  1X5W A;  1N3G A;  2EMC A;  2YTN A;  4DR7 E;  2EMF A;  5KL4 A;  5CFF E; 
#chains in the Genus database with same CATH homology
 3OTO E;  4DV2 E;  1XMO E;  1N33 E;  2EZ6 A;  4WPY A;  4WSP A;  4F54 A;  4TUI A;  4GKJ E;  2KON A;  1T4L B;  2CPN A;  1J5E E;  5AAS A;  3ADI A;  4DR4 E;  1J26 A;  2LMZ A;  2V86 A;  2V89 A;  5AE1 A;  4BMJ A;  2NUG A;  4BS9 A;  2RS6 A;  2UXB E;  2NA2 A;  4LF7 E;  2G7H A;  2VE7 C;  4R8O A;  2ZM6 E;  4X64 E;  2KOU A;  4DR2 E;  4BCA A;  5IT9 C;  1IBK E;  4NXN E;  3ADL A;  1DQ3 A;  2DIX A;  2YZT A;  4X66 E;  4L5N C;  3T1H E;  1N36 E;  4WYQ B;  2L6M A;  1FJG E;  3JU0 A;  2LE2 A;  2E5L E;  3HXL A;  2KHX A;  4DV6 E;  2VQF E;  3MSW A;  4JI2 E;  2F8B A;  4GKK E;  1XNR E;  1YYK A;  2L2M A;  3F6H A;  2HHH E;  2UXC E;  2DSY A;  4LF5 E;  1O0W A;  3DJW A;  3KWR A;  4DUZ E;  4JI6 E;  4JI1 E;  4KZS A;  1YYW A;  3HTX A;  4LFC E;  1HNX E;  2L8T A;  1YZ9 A;  3K6Q A;  2LUP B;  4LF6 E;  2L92 A;  2B9D A;  3AUZ A;  2K4V A;  3IWD A;  4I8O A;  4J8Z A;  2JY9 A;  2M7Q A;  1PKP A;  4OX9 E;  3VYX A;  4P7D A;  2LTR A;  3AV0 A;  1SR9 A;  3C4B A;  3C4T A;  5LL6 R;  1IBM E;  4F9B B;  1DI2 A;  3VYY A;  4GEQ B;  5IWA E;  1T4N A;  4DMI A;  2UXD E;  4P78 A;  4OOG C;  4DV4 E;  2LTS A;  4JI7 E;  3T1Y E;  1N32 E;  3HPS A;  2VQE E;  2L2N A;  4M30 A;  4M2Z A;  2MC6 A;  5AE3 A;  4L8N A;  1IBL E;  2FGG A;  2LUQ A;  4JI5 E;  2NUE A;  4KHP E;  1UHZ A;  2E1M A;  4JV5 E;  4BC9 A;  2LBS B;  2UU9 E;  4B3M E;  4K0K E;  2V8Q B;  5LMU E;  1RQ0 A;  3HQ1 A;  1YYO A;  4DV0 E;  4B3S E;  5BR8 E;  5A2Q C;  3JTZ A;  1GZ6 A;  4DV1 E;  4DV7 E;  2FV4 B;  3JAM C;  2UUA E;  2B7V A;  4YHH E;  1XNQ E;  4DUY E;  3H09 A;  3ADJ A;  3J81 C;  1HNW E;  4B3R E;  2DMY A;  4JI8 E;  2L3C A;  4X8W A;  2V87 A;  2V88 A;  1T4O A;  2JVA A;  1X47 A;  2RS7 A;  4WFT A;  3J7Y p;  2FTX B;  1ZBQ A;  4X62 E;  5F3W A;  1HR0 E;  2ODR D;  4LFB E;  3VK6 A;  1I94 E;  1EKZ A;  2IHR 1;  2JOB A;  3ADG A;  3F6G A;  4JI0 E;  4DKK A;  2M1S A;  4BC7 A;  3FIG A;  4LF9 E;  3ZOQ B;  2MDR A;  1QU6 A;  1UIL A;  2B3T B;  2JWO A;  2ODR C;  1WHQ A;  5ADZ A;  2L2K B;  2UUB E;  4JI3 E;  4DR6 E;  2V85 A;  2NUF A;  1X48 A;  2UUC E;  2N3H A;  4LF8 E;  3J7A G;  3HPZ A;  2JOX A;  4JI4 E;  2N3G A;  1HNZ E;  2L33 A;  4X65 E;  3DF6 A;  4DR5 E;  1X49 A;  2EWL A;  4LFA E;  4R03 A;  4DR3 E;  1XMQ E;  5T6J A;  4F9C B;  1GQE A;  1ZBT A;  4Q28 A;  2RTX A;  3J80 C;  5AE2 A;  1WXR A;  2B7T A;  3LLH A;  2YT4 A;  5DNY A;  3IWC A;  4LTY A;  4AQY E;  2DB2 A;  3IWB A;  4DV5 E;  4DR1 E;  2WZO A;  5LMN E;  2LRS A;  4DV3 E;  3RMP A;  2LJH A;  1RC7 A;  1FKA E;  2JR1 A;  4NXM E;  2H36 X;  1WHN A;  3LML A;  4BBY A;  4B3T E;  3OML A;  2RSM A;  5FLX C;  1N34 E;  4JYA E;  2M4I A;  4YY3 E;  2F4V E;  4LU9 A;  2V83 A;  4LF4 E;  2VF1 A;  4M0V A;  2L3J A;  2MC5 A;  1STU A;  4DR7 E;  4TUG A;  3P1X A;  4F9A B;  5CFF E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...