2L33A

Solution nmr structure of drbm 2 domain of interleukin enhancer-binding factor 3 from homo sapiens, northeast structural genomics consortium target hr4527e
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
91
structure length
91
Chain Sequence
MGHHHHHHSHMLTKHGKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAYAALAALEKLFPDTPLALDANK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target HR4527E
rcsb
source organism Homo sapiens
molecule tags Transcription regulator
molecule keywords Interleukin enhancer-binding factor 3
total genus 15
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2010-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l33A00
3P1XA 1IBME 1ZBTA 4OOGC 3LLHA 3C4TA 4DV1E 4DR3E 1X48A 2VQEE 4K0KE 2CPNA 3ADLA 4LF6E 5LMUE 4KHPE 4X8WA 4JYAE 3VYXA 4B3TE 4LFBE 4DR7E 2RS7A 2LRSA 1N32E 4X66E 1IBKE 4X65E 3ADGA 2UXDE 3C4BA 2F4VE 4LF5E 2L2MA 2LUQA 3ADJA 4DV6E 1XNRE 4DUYE 2YT4A 2HHHE 4OX9E 4NXNE 1UHZA 4DV5E 2IHR1 2EZ6A 2UUAE 4YHHE 2L3JA 1YYKA 2N3GA 1HR0E 4M30A 1XMOE 4JI7E 4DR2E 2KHXA 4JI5E 4JI2E 4DV2E 4DR1E 2ZM6E 4DV0E 4JI8E 4GKKE 4WFTA 1RC7A 2LTSA 2JVAA 2VQFE 1HNWE 3HTXA 2B7TA 1EKZA 1STUA 2L2KB 4AQYE 1T4LB 4YY3E 1YZ9A 2LJHA 2LBSB 4NXME 4WYQB 4B3SE 2L33A 1RQ0A 4DR5E 2UUBE 1FJGE 1UILA 2UU9E 3ADIA 4DV7E 1GQEA 4DUZE 4LFCE 4B3ME 4LF8E 4DV3E 1XNQE 4JI3E 4B3RE 2UXCE 2DB2A 4DR4E 4GKJE 2E5LE 2B7VA 2DMYA 2L2NA 4X62E 5BR8E 2NA2A 2N3HA 1PKPA 4X64E 1X47A 4JI4E 1WHQA 5CFFE 1XMQE 1N36E 1J26A 4JI6E 1DI2A 1HNXE 3J7Yp 1HNZE 3T1YE 4DR6E 1T4OA 4LF9E 2NUFA 1I94E 2LTRA 2L3CA 4LF4E 3OTOE 4M2ZA 1YYOA 1QU6A 1J5EE 2UUCE 1X49A 4LFAE 2RTXA 2NUEA 4JI0E 1YYWA 2UXBE 2B3TB 2JY9A 1FKAE 5LMNE 2NUGA 1O0WA 2RSMA 1T4NA 1N33E 4LF7E 4DV4E 3T1HE 2LUPB 4JI1E 4JV5E 5IWAE 1IBLE 2RS6A 1N34E 2MDRA 3VYYA 2DIXA 4DKKA 1WHNA
chains in the Genus database with same CATH superfamily
1TN9A 3P1XA 2EWLA 1ZBTA 4R2DA 4Q35B 1X48A 3F6GA 4K0KE 3ADLA 2EOHA 2E72A 2EPCA 5KL4A 2EQ1A 5FLXC 4X8WA 1MGTA 4P78A 1L4SA 2RS7A 1N32E 3C4BA 3J7AG 2B9DA 2LUQA 4DV6E 2EOEA 5AE1A 3TQMA 2HHHE 2EMKA 2EE8A 4BC7A 1UHZA 2R76A 2JOXA 4BHBA 4IS1C 3EPLA 5A6AA 2L3JA 1YYKA 2N3GA 2LMZA 2GLIA 5AC4A 4JI7E 5AASA 4JI5E 2CTDA 4DV2E 2WZOA 2EOIA 2R1FA 2V86A 2EM3A 2L6MA 1RC7A 2B7TA 1STUA 4O5GA 4LTYA 1YZ9A 2LBSB 2J7JA 4FK5C 4NXME 1T39A 2EMIA 1RQ0A 2EOOA 4DV7E 1A1GA 4DUZE 2EMXA 4LF8E 2EM0A 4HTGA 2UXCE 2L2NA 2G7HA 3VK6A 2NA2A 5IT9C 2Q8UA 4TUIA 5AE3A 3ECRA 3KZZA 1G2FC 4F6MA 1XMQE 2D9HA 2EMBA 2BBGA 1UBDC 2EPZA 2WBSA 3J80C 1A1LA 2LE2A 4WSPA 5A6JA 2DMIA 4WPYA 2LVHA 2YTEA 2EMWA 2NUFA 2EOJA 3OMLA 2YSPA 4BS9A 3BF2A 3OTOE 4M2ZA 1YYOA 4GEQB 3M99B 2EMYA 2EORA 4LFAE 2YZTA 2NUEA 4JI0E 1YYWA 2UXBE 4F2JC 2NUGA 2L8TA 4ZYDA 2YWQA 4JI1E 2PRTA 4P7DA 2YTQA 4R2SA 4DKKA 2EM5A 5A6KA 5LLQA 1WHNA 2EPRA 1IBME 2ADRA 4RHBB 1B69A 2JXPA 2RSIA 2VQEE 2LO3A 1A1FA 2EL5A 2LT7A 5AC5A 3BBGA 5LMUE 4F6NA 3JAMC 2EM9A 5KL2A 3UK3C 4KHPE 1KYQA 4DR7E 2LRSA 1IBKE 1JK1A 2EN3A 1YFHA 3ZOQB 2YPNA 3THOB 4IJDA 4LF5E 2L2MA 4R03A 2EPUA 1XNRE 2YT4A 2V85A 3BIDA 4O43A 4TUGA 2YTDA 4DV5E 4YHHE 2LCEA 3EQ1A 1HR0E 4M30A 3J81C 2KHXA 4R2CA 4WX9A 3MSWA 1X6EA 2K7IA 4ZYGA 2YRHA 4DR1E 5A6BD 4R2EA 1DGCA 1EH7A 4GKKE 2JVAA 2VQFE 2EM8A 1EKZA 2DGCA 4YY3E 2EOXA 1EH8A 2MDGA 4WSGA 2NABA 2L33A 4L8NA 2UUBE 1GQEA 4LFCE 2JPAA 4B3ME 2YTGA 2DB2A 4GKJE 1PJQA 2B7VA 4X62E 2RPCA 2YRMA 1PKPA 4R2QA 3RMPA 1TF3A 5A2QC 2HJJA 1WHQA 1N36E 2YTPA 1BBOA 4JI6E 2EN6A 3C6MA 4R2PA 3HPZA 1WJPA 2WCC3 4J8ZA 1IQOA 2EP3A 2L3CA 3BGHA 4BC9A 1J5EE 2YTNA 1X49A 2JP9A 1T38A 2RTXA 3AUZA 2B3TB 2EMCA 2JY9A 3IWDA 4BCAA 2EPXA 5KL7A 5LMNE 1JK2A 1O0WA 1LLMC 2EM6A 4DV4E 3T1HE 2EOQA 2EPOA 2L92A 1IQSA 5IWAE 2DRPA 2ENCA 1IBLE 2FTXB 2EOYA 2EM4A 2EJ4A 4WXCA 5KL3A 2EMZA 1N3GA 3HPSA 2EPLX 4OOGC 3LLHA 2VRDA 2YU5A 4F9BB 1YSAC 2CPNA 4LF6E 1BBGA 3THNA 4JYAE 2EQ3A 3MHHC 4HEIA 4X66E 2WBTA 4X65E 3ADGA 1P47A 2EM7A 2UXDE 1ZAAC 3L00A 3ADJA 3VHTB 4BHCA 4OX9E 4NXNE 1X6FA 2JYAA 2RQLA 2YTFA 4MLVA 4DMIA 3JU0A 2EMLA 2EZ6A 1XMOE 4MLQA 2CT1A 4ZYHA 3EPKA 4JI2E 2V83A 2EMGA 1ZU1A 2CSHA 1NCSA 2ZM6E 2WBUA 4DV0E 4L5NC 1UN6B 4WFTA 1AAYA 2LTSA 1HNWE 4X9JA 2L2KB 4AQYE 1T4LB 2LJHA 1SR9A 4WYQB 1A1JA 2MC5A 3KWRA 3FIGA 1UILA 4Q28A 1FJGE 3ADIA 3MHSC 2DLKA 2EMFA 2EOZA 2VF1A 4DV3E 2N8XA 1XNQE 1AH5A 5A69A 4DR4E 5DNYA 2E5LE 2EOFA 4WXDA 2M1SA 1A1IA 4GZNC 2A25A 2N3HA 1NEIA 1PJTA 2E1MA 1ZR9A 2I9IA 5AE2A 1J26A 1DI2A 1WXRA 2V89A 2M7QA 3J7Yp 3HQ1A 2EN4A 3EPHA 4R8OA 1T4OA 4LF9E 5TSEA 1I94E 4F9CB 4BMJA 2LTRA 4LF4E 3IWBA 1GZ6A 4BBYA 1QU6A 1RMDA 2LJUA 2UUCE 4M0VA 2EPKX 2RSMA 1T4NA 1YPNA 1N33E 4LF7E 5A6BA 2ELYA 2EQ0A 1GTKA 2EM2A 2LV2A 2RS6A 2YRKA 2EOSA 1Z1BA 2DLQA 2DSYA 2F8BA 5KL6A 1F2IG 2YTJA 2KOUA 2EMHA 3C4TA 4DV1E 4DR3E 2JOBA 4LU9A 4I8OA 2V8QB 1MEYC 1KJKA 2YTOA 2M4IA 2FGGA 3KZYA 3VYXA 4B3TE 4LFBE 1WRJA 2ELZA 5F3WA 4KZSA 2F4VE 3DF6A 3F6HA 3EPJA 4DUYE 1A1HA 3DJWA 2EL6A 2EL4A 2V87A 1A1KA 3LMLA 4N4RB 1X3CA 2BB8A 2IHR1 3AV0A 2UUAE 2EPMX 4DR2E 5LL6R 4F9AB 2EOMA 1DQ3A 1BB8A 1PJSA 2ODRD 4JI8E 2YTIA 2K4VA 3HTXA 2EPPA 1QNTA 3C6KA 1YUIA 2YSOA 2MKNA 1IMUA 4B3SE 3H09A 4DR5E 2UU9E 4O24A 2GHFA 2EPAA 2EN2A 1ZBQA 4JI3E 4B3RE 2GPIA 4F54A 2EN1A 2DMYA 2FV4B 3QG5C 5BR8E 4NHRA 1PDAA 2YU8A 2KONA 5IV8B 4X64E 5KL5A 1X47A 4JI4E 2MKDA 2VE7C 5CFFE 2M9AA 1X5WA 2V88A 4M9VC 4ZYEA 1HNXE 2EMAA 1G2DC 2EN7A 1HNZE 3T1YE 5T6JA 4DR6E 3IWCA 2JR1A 2ENHA 2HC5A 2MC6A 3JTZA 1TF6A 1YUJA 5IXMB 4KWYA 4R2RA 3HXLA 2EN8A 1X6HA 4RH8A 2I13A 1FKAE 2H36X 1SFEA 4R2AA 2ENAA 2LUPB 5ADZA 4JV5E 4NZVA 1EH6A 2JWOA 1N34E 2MDRA 3VYYA 2DIXA 2HGHA 2EPNA 2ODRC 4O4KA 3K6QA
chains in the Genus database with same CATH topology
3HPSA 3P1XA 2EWLA 1IBME 1ZBTA 4OOGC 3LLHA 2KOUA 3C4TA 4DV1E 4DR3E 1X48A 2JOBA 3F6GA 2VQEE 4F9BB 4K0KE 2CPNA 3ADLA 4LF6E 4LU9A 4I8OA 5LMUE 2V8QB 3JAMC 2M4IA 2FGGA 5FLXC 4X8WA 4KHPE 4JYAE 3VYXA 4B3TE 4P78A 4DR7E 4LFBE 2RS7A 2LRSA 1N32E 4X66E 1IBKE 5F3WA 4KZSA 3ADGA 4X65E 2UXDE 3ZOQB 3C4BA 2F4VE 3DF6A 3J7AG 4LF5E 2B9DA 2L2MA 2LUQA 3ADJA 3F6HA 4R03A 4DV6E 4DUYE 1XNRE 2YT4A 5AE1A 2V85A 3DJWA 2HHHE 4OX9E 4BC7A 4NXNE 2V87A 3LMLA 4TUGA 1UHZA 4DMIA 4DV5E 3JU0A 2JOXA 2IHR1 3AV0A 2EZ6A 2UUAE 4YHHE 2L3JA 1YYKA 2N3GA 2LMZA 4M30A 1XMOE 3J81C 4JI7E 5LL6R 2KHXA 4DR2E 5AASA 1HR0E 4JI5E 4F9AB 3MSWA 4JI2E 1DQ3A 2V83A 4DV2E 2WZOA 4DR1E 2ZM6E 4DV0E 2ODRD 4JI8E 2V86A 4L5NC 2L6MA 4WFTA 4GKKE 2K4VA 1RC7A 2LTSA 2JVAA 2VQFE 1HNWE 3HTXA 2B7TA 1EKZA 1STUA 2L2KB 4LTYA 4AQYE 1T4LB 4YY3E 1YZ9A 2LJHA 1SR9A 2LBSB 4NXME 4WYQB 3H09A 4B3SE 2L33A 4L8NA 1RQ0A 4DR5E 2MC5A 3KWRA 3FIGA 1UILA 4Q28A 2UU9E 2UUBE 1FJGE 4DV7E 1GQEA 4DUZE 4LFCE 3ADIA 4B3ME 4LF8E 2VF1A 4DV3E 1XNQE 4JI3E 1ZBQA 4B3RE 2UXCE 2DB2A 4F54A 4DR4E 4GKJE 5DNYA 2E5LE 2B7VA 2DMYA 2FV4B 2G7HA 2L2NA 2M1SA 4X62E 3VK6A 5BR8E 2NA2A 2N3HA 2KONA 5IT9C 1PKPA 4X64E 4TUIA 3RMPA 5AE3A 1X47A 4JI4E 5A2QC 1WHQA 2E1MA 2VE7C 5CFFE 1XMQE 5AE2A 2V88A 1N36E 1J26A 4JI6E 1DI2A 1WXRA 1HNXE 2V89A 2M7QA 3J80C 3J7Yp 2LE2A 3HQ1A 4WSPA 1HNZE 3HPZA 4WPYA 3T1YE 5T6JA 4R8OA 3IWCA 2JR1A 4DR6E 1T4OA 4LF9E 2NUFA 2MC6A 4J8ZA 1I94E 4F9CB 4BMJA 2LTRA 3JTZA 2L3CA 3OMLA 4LF4E 4BS9A 3OTOE 4BC9A 4M2ZA 1YYOA 3IWBA 1GZ6A 4GEQB 4BBYA 1QU6A 1J5EE 2UUCE 1X49A 3HXLA 4M0VA 2RTXA 2YZTA 3AUZA 4LFAE 2NUEA 4JI0E 1YYWA 2UXBE 2B3TB 2JY9A 3IWDA 4BCAA 1FKAE 2H36X 5LMNE 2NUGA 1O0WA 2RSMA 1T4NA 2L8TA 1N33E 4LF7E 4DV4E 3T1HE 2L92A 5ADZA 2LUPB 4JI1E 4JV5E 4P7DA 5IWAE 2JWOA 1IBLE 2RS6A 1N34E 2FTXB 2MDRA 3VYYA 2DIXA 4DKKA 2DSYA 2ODRC 2F8BA 1WHNA 3K6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P1X A;  1IBM E;  1ZBT A;  4OOG C;  3LLH A;  3C4T A;  4DV1 E;  4DR3 E;  1X48 A;  2VQE E;  4K0K E;  2CPN A;  3ADL A;  4LF6 E;  5LMU E;  4KHP E;  4X8W A;  4JYA E;  3VYX A;  4B3T E;  4LFB E;  4DR7 E;  2RS7 A;  2LRS A;  1N32 E;  4X66 E;  1IBK E;  4X65 E;  3ADG A;  2UXD E;  3C4B A;  2F4V E;  4LF5 E;  2L2M A;  2LUQ A;  3ADJ A;  4DV6 E;  1XNR E;  4DUY E;  2YT4 A;  2HHH E;  4OX9 E;  4NXN E;  1UHZ A;  4DV5 E;  2IHR 1;  2EZ6 A;  2UUA E;  4YHH E;  2L3J A;  1YYK A;  2N3G A;  1HR0 E;  4M30 A;  1XMO E;  4JI7 E;  4DR2 E;  2KHX A;  4JI5 E;  4JI2 E;  4DV2 E;  4DR1 E;  2ZM6 E;  4DV0 E;  4JI8 E;  4GKK E;  4WFT A;  1RC7 A;  2LTS A;  2JVA A;  2VQF E;  1HNW E;  3HTX A;  2B7T A;  1EKZ A;  1STU A;  2L2K B;  4AQY E;  1T4L B;  4YY3 E;  1YZ9 A;  2LJH A;  2LBS B;  4NXM E;  4WYQ B;  4B3S E;  2L33 A;  1RQ0 A;  4DR5 E;  2UUB E;  1FJG E;  1UIL A;  2UU9 E;  3ADI A;  4DV7 E;  1GQE A;  4DUZ E;  4LFC E;  4B3M E;  4LF8 E;  4DV3 E;  1XNQ E;  4JI3 E;  4B3R E;  2UXC E;  2DB2 A;  4DR4 E;  4GKJ E;  2E5L E;  2B7V A;  2DMY A;  2L2N A;  4X62 E;  5BR8 E;  2NA2 A;  2N3H A;  1PKP A;  4X64 E;  1X47 A;  4JI4 E;  1WHQ A;  5CFF E;  1XMQ E;  1N36 E;  1J26 A;  4JI6 E;  1DI2 A;  1HNX E;  3J7Y p;  1HNZ E;  3T1Y E;  4DR6 E;  1T4O A;  4LF9 E;  2NUF A;  1I94 E;  2LTR A;  2L3C A;  4LF4 E;  3OTO E;  4M2Z A;  1YYO A;  1QU6 A;  1J5E E;  2UUC E;  1X49 A;  4LFA E;  2RTX A;  2NUE A;  4JI0 E;  1YYW A;  2UXB E;  2B3T B;  2JY9 A;  1FKA E;  5LMN E;  2NUG A;  1O0W A;  2RSM A;  1T4N A;  1N33 E;  4LF7 E;  4DV4 E;  3T1H E;  2LUP B;  4JI1 E;  4JV5 E;  5IWA E;  1IBL E;  2RS6 A;  1N34 E;  2MDR A;  3VYY A;  2DIX A;  4DKK A;  1WHN A; 
#chains in the Genus database with same CATH topology
 1TN9 A;  3P1X A;  2EWL A;  1ZBT A;  4R2D A;  4Q35 B;  1X48 A;  3F6G A;  4K0K E;  3ADL A;  2EOH A;  2E72 A;  2EPC A;  5KL4 A;  2EQ1 A;  5FLX C;  4X8W A;  1MGT A;  4P78 A;  1L4S A;  2RS7 A;  1N32 E;  3C4B A;  3J7A G;  2B9D A;  2LUQ A;  4DV6 E;  2EOE A;  5AE1 A;  3TQM A;  2HHH E;  2EMK A;  2EE8 A;  4BC7 A;  1UHZ A;  2R76 A;  2JOX A;  4BHB A;  4IS1 C;  3EPL A;  5A6A A;  2L3J A;  1YYK A;  2N3G A;  2LMZ A;  2GLI A;  5AC4 A;  4JI7 E;  5AAS A;  4JI5 E;  2CTD A;  4DV2 E;  2WZO A;  2EOI A;  2R1F A;  2V86 A;  2EM3 A;  2L6M A;  1RC7 A;  2B7T A;  1STU A;  4O5G A;  4LTY A;  1YZ9 A;  2LBS B;  2J7J A;  4FK5 C;  4NXM E;  1T39 A;  2EMI A;  1RQ0 A;  2EOO A;  4DV7 E;  1A1G A;  4DUZ E;  2EMX A;  4LF8 E;  2EM0 A;  4HTG A;  2UXC E;  2L2N A;  2G7H A;  3VK6 A;  2NA2 A;  5IT9 C;  2Q8U A;  4TUI A;  5AE3 A;  3ECR A;  3KZZ A;  1G2F C;  4F6M A;  1XMQ E;  2D9H A;  2EMB A;  2BBG A;  1UBD C;  2EPZ A;  2WBS A;  3J80 C;  1A1L A;  2LE2 A;  4WSP A;  5A6J A;  2DMI A;  4WPY A;  2LVH A;  2YTE A;  2EMW A;  2NUF A;  2EOJ A;  3OML A;  2YSP A;  4BS9 A;  3BF2 A;  3OTO E;  4M2Z A;  1YYO A;  4GEQ B;  3M99 B;  2EMY A;  2EOR A;  4LFA E;  2YZT A;  2NUE A;  4JI0 E;  1YYW A;  2UXB E;  4F2J C;  2NUG A;  2L8T A;  4ZYD A;  2YWQ A;  4JI1 E;  2PRT A;  4P7D A;  2YTQ A;  4R2S A;  4DKK A;  2EM5 A;  5A6K A;  5LLQ A;  1WHN A;  2EPR A;  1IBM E;  2ADR A;  4RHB B;  1B69 A;  2JXP A;  2RSI A;  2VQE E;  2LO3 A;  1A1F A;  2EL5 A;  2LT7 A;  5AC5 A;  3BBG A;  5LMU E;  4F6N A;  3JAM C;  2EM9 A;  5KL2 A;  3UK3 C;  4KHP E;  1KYQ A;  4DR7 E;  2LRS A;  1IBK E;  1JK1 A;  2EN3 A;  1YFH A;  3ZOQ B;  2YPN A;  3THO B;  4IJD A;  4LF5 E;  2L2M A;  4R03 A;  2EPU A;  1XNR E;  2YT4 A;  2V85 A;  3BID A;  4O43 A;  4TUG A;  2YTD A;  4DV5 E;  4YHH E;  2LCE A;  3EQ1 A;  1HR0 E;  4M30 A;  3J81 C;  2KHX A;  4R2C A;  4WX9 A;  3MSW A;  1X6E A;  2K7I A;  4ZYG A;  2YRH A;  4DR1 E;  5A6B D;  4R2E A;  1DGC A;  1EH7 A;  4GKK E;  2JVA A;  2VQF E;  2EM8 A;  1EKZ A;  2DGC A;  4YY3 E;  2EOX A;  1EH8 A;  2MDG A;  4WSG A;  2NAB A;  2L33 A;  4L8N A;  2UUB E;  1GQE A;  4LFC E;  2JPA A;  4B3M E;  2YTG A;  2DB2 A;  4GKJ E;  1PJQ A;  2B7V A;  4X62 E;  2RPC A;  2YRM A;  1PKP A;  4R2Q A;  3RMP A;  1TF3 A;  5A2Q C;  2HJJ A;  1WHQ A;  1N36 E;  2YTP A;  1BBO A;  4JI6 E;  2EN6 A;  3C6M A;  4R2P A;  3HPZ A;  1WJP A;  2WCC 3;  4J8Z A;  1IQO A;  2EP3 A;  2L3C A;  3BGH A;  4BC9 A;  1J5E E;  2YTN A;  1X49 A;  2JP9 A;  1T38 A;  2RTX A;  3AUZ A;  2B3T B;  2EMC A;  2JY9 A;  3IWD A;  4BCA A;  2EPX A;  5KL7 A;  5LMN E;  1JK2 A;  1O0W A;  1LLM C;  2EM6 A;  4DV4 E;  3T1H E;  2EOQ A;  2EPO A;  2L92 A;  1IQS A;  5IWA E;  2DRP A;  2ENC A;  1IBL E;  2FTX B;  2EOY A;  2EM4 A;  2EJ4 A;  4WXC A;  5KL3 A;  2EMZ A;  1N3G A;  3HPS A;  2EPL X;  4OOG C;  3LLH A;  2VRD A;  2YU5 A;  4F9B B;  1YSA C;  2CPN A;  4LF6 E;  1BBG A;  3THN A;  4JYA E;  2EQ3 A;  3MHH C;  4HEI A;  4X66 E;  2WBT A;  4X65 E;  3ADG A;  1P47 A;  2EM7 A;  2UXD E;  1ZAA C;  3L00 A;  3ADJ A;  3VHT B;  4BHC A;  4OX9 E;  4NXN E;  1X6F A;  2JYA A;  2RQL A;  2YTF A;  4MLV A;  4DMI A;  3JU0 A;  2EML A;  2EZ6 A;  1XMO E;  4MLQ A;  2CT1 A;  4ZYH A;  3EPK A;  4JI2 E;  2V83 A;  2EMG A;  1ZU1 A;  2CSH A;  1NCS A;  2ZM6 E;  2WBU A;  4DV0 E;  4L5N C;  1UN6 B;  4WFT A;  1AAY A;  2LTS A;  1HNW E;  4X9J A;  2L2K B;  4AQY E;  1T4L B;  2LJH A;  1SR9 A;  4WYQ B;  1A1J A;  2MC5 A;  3KWR A;  3FIG A;  1UIL A;  4Q28 A;  1FJG E;  3ADI A;  3MHS C;  2DLK A;  2EMF A;  2EOZ A;  2VF1 A;  4DV3 E;  2N8X A;  1XNQ E;  1AH5 A;  5A69 A;  4DR4 E;  5DNY A;  2E5L E;  2EOF A;  4WXD A;  2M1S A;  1A1I A;  4GZN C;  2A25 A;  2N3H A;  1NEI A;  1PJT A;  2E1M A;  1ZR9 A;  2I9I A;  5AE2 A;  1J26 A;  1DI2 A;  1WXR A;  2V89 A;  2M7Q A;  3J7Y p;  3HQ1 A;  2EN4 A;  3EPH A;  4R8O A;  1T4O A;  4LF9 E;  5TSE A;  1I94 E;  4F9C B;  4BMJ A;  2LTR A;  4LF4 E;  3IWB A;  1GZ6 A;  4BBY A;  1QU6 A;  1RMD A;  2LJU A;  2UUC E;  4M0V A;  2EPK X;  2RSM A;  1T4N A;  1YPN A;  1N33 E;  4LF7 E;  5A6B A;  2ELY A;  2EQ0 A;  1GTK A;  2EM2 A;  2LV2 A;  2RS6 A;  2YRK A;  2EOS A;  1Z1B A;  2DLQ A;  2DSY A;  2F8B A;  5KL6 A;  1F2I G;  2YTJ A;  2KOU A;  2EMH A;  3C4T A;  4DV1 E;  4DR3 E;  2JOB A;  4LU9 A;  4I8O A;  2V8Q B;  1MEY C;  1KJK A;  2YTO A;  2M4I A;  2FGG A;  3KZY A;  3VYX A;  4B3T E;  4LFB E;  1WRJ A;  2ELZ A;  5F3W A;  4KZS A;  2F4V E;  3DF6 A;  3F6H A;  3EPJ A;  4DUY E;  1A1H A;  3DJW A;  2EL6 A;  2EL4 A;  2V87 A;  1A1K A;  3LML A;  4N4R B;  1X3C A;  2BB8 A;  2IHR 1;  3AV0 A;  2UUA E;  2EPM X;  4DR2 E;  5LL6 R;  4F9A B;  2EOM A;  1DQ3 A;  1BB8 A;  1PJS A;  2ODR D;  4JI8 E;  2YTI A;  2K4V A;  3HTX A;  2EPP A;  1QNT A;  3C6K A;  1YUI A;  2YSO A;  2MKN A;  1IMU A;  4B3S E;  3H09 A;  4DR5 E;  2UU9 E;  4O24 A;  2GHF A;  2EPA A;  2EN2 A;  1ZBQ A;  4JI3 E;  4B3R E;  2GPI A;  4F54 A;  2EN1 A;  2DMY A;  2FV4 B;  3QG5 C;  5BR8 E;  4NHR A;  1PDA A;  2YU8 A;  2KON A;  5IV8 B;  4X64 E;  5KL5 A;  1X47 A;  4JI4 E;  2MKD A;  2VE7 C;  5CFF E;  2M9A A;  1X5W A;  2V88 A;  4M9V C;  4ZYE A;  1HNX E;  2EMA A;  1G2D C;  2EN7 A;  1HNZ E;  3T1Y E;  5T6J A;  4DR6 E;  3IWC A;  2JR1 A;  2ENH A;  2HC5 A;  2MC6 A;  3JTZ A;  1TF6 A;  1YUJ A;  5IXM B;  4KWY A;  4R2R A;  3HXL A;  2EN8 A;  1X6H A;  4RH8 A;  2I13 A;  1FKA E;  2H36 X;  1SFE A;  4R2A A;  2ENA A;  2LUP B;  5ADZ A;  4JV5 E;  4NZV A;  1EH6 A;  2JWO A;  1N34 E;  2MDR A;  3VYY A;  2DIX A;  2HGH A;  2EPN A;  2ODR C;  4O4K A;  3K6Q A; 
#chains in the Genus database with same CATH homology
 3HPS A;  3P1X A;  2EWL A;  1IBM E;  1ZBT A;  4OOG C;  3LLH A;  2KOU A;  3C4T A;  4DV1 E;  4DR3 E;  1X48 A;  2JOB A;  3F6G A;  2VQE E;  4F9B B;  4K0K E;  2CPN A;  3ADL A;  4LF6 E;  4LU9 A;  4I8O A;  5LMU E;  2V8Q B;  3JAM C;  2M4I A;  2FGG A;  5FLX C;  4X8W A;  4KHP E;  4JYA E;  3VYX A;  4B3T E;  4P78 A;  4DR7 E;  4LFB E;  2RS7 A;  2LRS A;  1N32 E;  4X66 E;  1IBK E;  5F3W A;  4KZS A;  3ADG A;  4X65 E;  2UXD E;  3ZOQ B;  3C4B A;  2F4V E;  3DF6 A;  3J7A G;  4LF5 E;  2B9D A;  2L2M A;  2LUQ A;  3ADJ A;  3F6H A;  4R03 A;  4DV6 E;  4DUY E;  1XNR E;  2YT4 A;  5AE1 A;  2V85 A;  3DJW A;  2HHH E;  4OX9 E;  4BC7 A;  4NXN E;  2V87 A;  3LML A;  4TUG A;  1UHZ A;  4DMI A;  4DV5 E;  3JU0 A;  2JOX A;  2IHR 1;  3AV0 A;  2EZ6 A;  2UUA E;  4YHH E;  2L3J A;  1YYK A;  2N3G A;  2LMZ A;  4M30 A;  1XMO E;  3J81 C;  4JI7 E;  5LL6 R;  2KHX A;  4DR2 E;  5AAS A;  1HR0 E;  4JI5 E;  4F9A B;  3MSW A;  4JI2 E;  1DQ3 A;  2V83 A;  4DV2 E;  2WZO A;  4DR1 E;  2ZM6 E;  4DV0 E;  2ODR D;  4JI8 E;  2V86 A;  4L5N C;  2L6M A;  4WFT A;  4GKK E;  2K4V A;  1RC7 A;  2LTS A;  2JVA A;  2VQF E;  1HNW E;  3HTX A;  2B7T A;  1EKZ A;  1STU A;  2L2K B;  4LTY A;  4AQY E;  1T4L B;  4YY3 E;  1YZ9 A;  2LJH A;  1SR9 A;  2LBS B;  4NXM E;  4WYQ B;  3H09 A;  4B3S E;  2L33 A;  4L8N A;  1RQ0 A;  4DR5 E;  2MC5 A;  3KWR A;  3FIG A;  1UIL A;  4Q28 A;  2UU9 E;  2UUB E;  1FJG E;  4DV7 E;  1GQE A;  4DUZ E;  4LFC E;  3ADI A;  4B3M E;  4LF8 E;  2VF1 A;  4DV3 E;  1XNQ E;  4JI3 E;  1ZBQ A;  4B3R E;  2UXC E;  2DB2 A;  4F54 A;  4DR4 E;  4GKJ E;  5DNY A;  2E5L E;  2B7V A;  2DMY A;  2FV4 B;  2G7H A;  2L2N A;  2M1S A;  4X62 E;  3VK6 A;  5BR8 E;  2NA2 A;  2N3H A;  2KON A;  5IT9 C;  1PKP A;  4X64 E;  4TUI A;  3RMP A;  5AE3 A;  1X47 A;  4JI4 E;  5A2Q C;  1WHQ A;  2E1M A;  2VE7 C;  5CFF E;  1XMQ E;  5AE2 A;  2V88 A;  1N36 E;  1J26 A;  4JI6 E;  1DI2 A;  1WXR A;  1HNX E;  2V89 A;  2M7Q A;  3J80 C;  3J7Y p;  2LE2 A;  3HQ1 A;  4WSP A;  1HNZ E;  3HPZ A;  4WPY A;  3T1Y E;  5T6J A;  4R8O A;  3IWC A;  2JR1 A;  4DR6 E;  1T4O A;  4LF9 E;  2NUF A;  2MC6 A;  4J8Z A;  1I94 E;  4F9C B;  4BMJ A;  2LTR A;  3JTZ A;  2L3C A;  3OML A;  4LF4 E;  4BS9 A;  3OTO E;  4BC9 A;  4M2Z A;  1YYO A;  3IWB A;  1GZ6 A;  4GEQ B;  4BBY A;  1QU6 A;  1J5E E;  2UUC E;  1X49 A;  3HXL A;  4M0V A;  2RTX A;  2YZT A;  3AUZ A;  4LFA E;  2NUE A;  4JI0 E;  1YYW A;  2UXB E;  2B3T B;  2JY9 A;  3IWD A;  4BCA A;  1FKA E;  2H36 X;  5LMN E;  2NUG A;  1O0W A;  2RSM A;  1T4N A;  2L8T A;  1N33 E;  4LF7 E;  4DV4 E;  3T1H E;  2L92 A;  5ADZ A;  2LUP B;  4JI1 E;  4JV5 E;  4P7D A;  5IWA E;  2JWO A;  1IBL E;  2RS6 A;  1N34 E;  2FTX B;  2MDR A;  3VYY A;  2DIX A;  4DKK A;  2DSY A;  2ODR C;  2F8B A;  1WHN A;  3K6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...