2L33A

Solution nmr structure of drbm 2 domain of interleukin enhancer-binding factor 3 from homo sapiens, northeast structural genomics consortium target hr4527e
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
91
structure length
91
Chain Sequence
MGHHHHHHSHMLTKHGKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAYAALAALEKLFPDTPLALDANK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin enhancer-binding factor 3
publication title Northeast Structural Genomics Consortium Target HR4527E
rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 15
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2010-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l33A00
4DR2E 4AQYE 4DR3E 2NUGA 4X64E 2DB2A 1STUA 1HNXE 2L3JA 3HTXA 1GQEA 2LTRA 3C4BA 4LFAE 4DV4E 4DKKA 1WHNA 4M2ZA 3VYXA 2VQFE 4X8WA 3ADGA 2LUPB 2DMYA 4DV1E 4DR1E 4JI0E 2LBSB 1RC7A 4LF7E 1HNWE 2L2MA 2UUCE 4DV2E 1XMOE 4LFCE 1T4NA 2B7TA 4LF4E 2NUEA 3ADIA 4DV5E 4K0KE 2LUQA 1X47A 3T1HE 2UU9E 2N3HA 4GKKE 4JV5E 2VQEE 2RS7A 2EZ6A 1ZBTA 3VYYA 1N34E 1XNRE 1IBME 4JI1E 2RS6A 5LMNE 1UHZA 4YHHE 2L2KB 4JI6E 1N32E 4DR7E 4DR6E 5IWAE 1PKPA 2ZM6E 4JI3E 4B3SE 1XNQE 4M30A 1N33E 1RQ0A 1WHQA 4OOGC 4LFBE 1IBLE 1J26A 4GKJE 4X65E 3P1XA 2LTSA 4B3RE 4JI8E 4WFTA 2L2NA 2RTXA 1DI2A 1T4LB 1IBKE 4DV7E 1EKZA 2NA2A 2B3TB 2UXBE 2UUBE 4B3TE 4DV6E 2YT4A 2RSMA 2NUFA 4JI7E 1X49A 4KHPE 3T1YE 4NXNE 4X66E 4OX9E 1YYKA 2CPNA 3C4TA 4JI4E 1I94E 1T4OA 4LF5E 4NXME 3ADJA 4DV3E 1YYWA 2DIXA 2JVAA 2UUAE 4DUZE 4DR4E 4X62E 1FJGE 3LLHA 4YY3E 2UXCE 1XMQE 4JYAE 1HR0E 5CFFE 4WYQB 1N36E 2B7VA 4DV0E 1YYOA 2LRSA 4DUYE 1UILA 2KHXA 3ADLA 2LJHA 4LF9E 2N3GA 2JY9A 2E5LE 2UXDE 2IHR1 5BR8E 4B3ME 4JI5E 4LF6E 3J7Yp 2L3CA 5LMUE 4DR5E 4JI2E 1YZ9A 3OTOE 2F4VE 2MDRA 1HNZE 1QU6A 2HHHE 4LF8E 1X48A 2L33A 1J5EE 1O0WA 1FKAE
chains in the Genus database with same CATH superfamily
1X6EA 5A2QC 4KWYA 2DLKA 2L3JA 1A1JA 5AC4A 2HGHA 2YTPA 2V86A 4M2ZA 3VHTB 1SR9A 2JR1A 2LBSB 3M99B 2EN2A 2MC5A 1F2IG 2EMCA 4R2CA 2RQLA 3ADIA 2EM8A 4K0KE 2LUQA 2DRPA 2UU9E 1AH5A 4M9VC 4BBYA 5KL3A 2RS7A 2FV4B 2EZ6A 5LLQA 2RS6A 4YHHE 4O5GA 2KONA 4DR7E 2DMIA 1LLMC 4B3SE 2ENAA 4M30A 1N33E 4TUGA 1WHQA 4LFBE 1N3GA 1IBLE 2EOJA 2LV2A 4GKJE 1MGTA 2RTXA 5AC5A 2WCC3 3DF6A 4BC7A 2M1SA 2EPRA 3EPKA 3L00A 1EH8A 3ZOQB 2EPAA 1IMUA 2D9HA 3HPZA 5TSEA 1A1GA 4KHPE 4X66E 1G2FC 1I94E 1A1FA 4NXME 3ADJA 4I8OA 2DIXA 3ECRA 4R2QA 5T6JA 1MEYC 2YTQA 4N4RB 4DV0E 2M9AA 2ENCA 4DUYE 2DGCA 3ADLA 4ZYGA 1TF6A 2JY9A 2WZOA 4HEIA 2IHR1 1PJSA 4L8NA 4P78A 1PJQA 2EQ3A 4JI2E 2JPAA 3OTOE 4ZYEA 2A25A 2F4VE 4LU9A 2HHHE 1YUIA 1X48A 3LMLA 1J5EE 2LCEA 4R2SA 2L92A 2EJ4A 2BB8A 2JYAA 1IQOA 2B9DA 2EWLA 3OMLA 4X64E 2NUGA 2YTDA 5A6JA 1X5WA 1STUA 1KYQA 2ADRA 2R76A 3J80C 2YRKA 3K6QA 2NABA 4ZYHA 2LTRA 2LE2A 4RHBB 2DMYA 1EH6A 1AAYA 4DR1E 2EMFA 3EPHA 1RC7A 4LF7E 5A69A 3IWDA 2EOSA 2V89A 5KL6A 2WBTA 3BBGA 2I13A 4R2EA 1X47A 2RSIA 2V87A 2E1MA 2ELZA 2EMXA 1Z1BA 1YPNA 2EOYA 1N34E 2F8BA 4O43A 1G2DC 5LMNE 1ZAAC 4J8ZA 2WBUA 1N32E 2G7HA 4X9JA 2EPPA 4R8OA 4Q28A 1XNQE 4NHRA 1RQ0A 3KZYA 1ZR9A 4WSGA 3F6GA 1X3CA 4L5NC 4X65E 3P1XA 2EL6A 2EPNA 4WPYA 5AE3A 1T4LB 4IS1C 2MKNA 4DV7E 1EKZA 2EMKA 2B3TB 2HJJA 4IJDA 1WRJA 4DV6E 2EOXA 3TQMA 3C6MA 2YT4A 2EN4A 2MKDA 2EPKX 4JI7E 3T1YE 2EMGA 3BGHA 2LVHA 2CPNA 2RPCA 2EOMA 5AE1A 2JWOA 2EPCA 2L6MA 3IWCA 1YYWA 1X6FA 2JVAA 2UUAE 4DUZE 4X62E 2LJUA 1EH7A 2HC5A 3LLHA 2DSYA 4JYAE 3AV0A 4BCAA 5AE2A 2VF1A 4MLQA 5F3WA 2LRSA 2CT1A 2KHXA 1A1LA 5KL4A 2N3GA 2UXDE 1YSAC 1NEIA 5A6BA 3EQ1A 1UBDC 1L4SA 2KOUA 1QU6A 2V88A 1O0WA 2VE7C 2EMBA 2GLIA 4P7DA 2K7IA 1HNXE 3HTXA 1GQEA 2EM6A 1BB8A 4DV4E 5A6BD 1A1KA 1WHNA 2EN3A 3VYXA 2V8QB 2EMZA 2EN7A 5IV8B 4JI0E 2L2MA 3VK6A 2UUCE 4DV2E 3JTZA 3JAMC 2LMZA 2GHFA 4LFCE 2B7TA 3FIGA 1TN9A 2FTXB 3KWRA 2NUEA 2YWQA 2J7JA 3T1HE 2DLQA 4GKKE 4JV5E 2VQEE 3UK3C 2EPZA 1IBME 4R2AA 2YRHA 2EOHA 2N8XA 2EL5A 4F2JC 4R03A 4JI6E 4DR6E 1PKPA 3DJWA 4JI3E 2YSPA 4GEQB 4OOGC 3QG5C 2YTOA 4BHCA 2EOQA 2EPXA 5IXMB 4F6MA 2EN6A 4B3RE 4O24A 4WFTA 3EPJA 2EMWA 2YTJA 2L2NA 1PDAA 1DI2A 2EL4A 2GPIA 4WXDA 2UXBE 1JK2A 2EMAA 1ZBQA 1A1IA 2ODRD 2EM4A 2NUFA 3BF2A 2YTEA 4NXNE 3C4TA 2K4VA 2YTFA 1T4OA 4LF5E 2YTNA 1YFHA 1T38A 2EPOA 2EOEA 2YRMA 2CTDA 1FJGE 2LO3A 4YY3E 1XMQE 5KL7A 2YU5A 2ODRC 1YYOA 2VRDA 1P47A 1UILA 1KJKA 2JOXA 5A6AA 2E5LE 2YPNA 4B3ME 2YSOA 1BBGA 3J7Yp 2YZTA 4F9BB 3JU0A 1YUJA 2EPUA 2EQ0A 5KL2A 3J81C 3J7AG 4WXCA 4R2DA 3THOB 1HNZE 2E72A 4ZYDA 3C6KA 2EMLA 2JOBA 5AASA 1FKAE 4DR2E 2EM9A 3HXLA 1TF3A 2EOOA 1UN6B 4AQYE 4DR3E 3HQ1A 1X6HA 2V83A 4BMJA 2DB2A 1GTKA 2M4IA 3MHHC 3C4BA 4LFAE 4DKKA 2Q8UA 4F9AB 2VQFE 1A1HA 4X8WA 2JP9A 3ADGA 2LUPB 3F6HA 4DV1E 4KZSA 1RMDA 4GZNC 1HNWE 5IT9C 4RH8A 1XMOE 2YTIA 1T4NA 2WBSA 2L8TA 2EN1A 2EORA 4LF4E 4DV5E 2BBGA 3IWBA 2EOIA 2N3HA 2EOFA 2EQ1A 2FGGA 4F6NA 4O4KA 1ZBTA 3VYYA 1XNRE 3HPSA 4Q35B 4JI1E 1BBOA 4FK5C 1PJTA 2R1FA 3BIDA 1UHZA 2L2KB 4DMIA 2YU8A 5IWAE 2ZM6E 3RMPA 2H36X 3MHSC 2EM2A 2CSHA 2EE8A 1JK1A 1DQ3A 1NCSA 2EM7A 4M0VA 3THNA 4BS9A 1J26A 2EOZA 4NZVA 1B69A 2LTSA 1SFEA 4JI8E 1QNTA 1IQSA 4R2RA 1IBKE 2YTGA 4WX9A 2NA2A 2UUBE 4B3TE 2EPMX 4F54A 2RSMA 2EMHA 1X49A 1T39A 3EPLA 3AUZA 4R2PA 4OX9E 3MSWA 4JI4E 1YYKA 1GZ6A 4DV3E 2EM3A 4DR4E 2MDGA 2I9IA 2UXCE 1HR0E 5A6KA 5CFFE 1DGCA 4WYQB 5KL5A 5FLXC 1N36E 2B7VA 3H09A 2PRTA 5ADZA 2EMIA 4LTYA 3KZZA 4BC9A 2EN8A 2EM0A 2LJHA 5LL6R 4LF9E 1WXRA 2M7QA 4BHBA 5BR8E 4F9CB 4JI5E 4LF6E 4HTGA 5DNYA 2MC6A 2L3CA 5LMUE 4DR5E 1YZ9A 2EM5A 4MLVA 1ZU1A 2JXPA 2MDRA 2ELYA 2EMYA 4WSPA 4TUIA 2LT7A 2V85A 4LF8E 2L33A 2ENHA 1WJPA 2EPLX 2EP3A
chains in the Genus database with same CATH topology
4P7DA 3HXLA 4DR2E 2B9DA 2EWLA 4AQYE 4DR3E 3HQ1A 5A2QC 2V83A 3OMLA 4BMJA 4X64E 2NUGA 2DB2A 1STUA 2M4IA 1HNXE 2L3JA 3J80C 3HTXA 1GQEA 3K6QA 2LTRA 3C4BA 4LFAE 4DV4E 4DKKA 1WHNA 2V86A 4M2ZA 4F9AB 2VQFE 2LE2A 1SR9A 2V8QB 4X8WA 3ADGA 2LUPB 3VYXA 2DMYA 3F6HA 2JR1A 4DV1E 4DR1E 4KZSA 4JI0E 2LBSB 1RC7A 4LF7E 1HNWE 2L2MA 3VK6A 5IT9C 2UUCE 4DV2E 3JTZA 3JAMC 2LMZA 2MC5A 3IWDA 1XMOE 4LFCE 2V89A 1T4NA 2B7TA 3FIGA 2L8TA 2FTXB 3KWRA 4LF4E 2NUEA 3ADIA 4DV5E 4K0KE 2LUQA 1X47A 2V87A 3T1HE 3IWBA 2UU9E 2E1MA 2N3HA 2FGGA 4BBYA 4GKKE 4JV5E 2VQEE 2RS7A 2FV4B 2EZ6A 1ZBTA 3VYYA 1N34E 1XNRE 1IBME 3HPSA 4JI1E 2F8BA 1FKAE 2RS6A 5LMNE 1UHZA 4J8ZA 4R03A 4YHHE 2L2KB 4DMIA 4JI6E 1N32E 1YYKA 2G7HA 2KONA 4DR7E 4DR6E 5IWAE 1PKPA 2ZM6E 3DJWA 4R8OA 3RMPA 4JI3E 2H36X 4Q28A 4B3SE 4GEQB 1XNQE 4M30A 1N33E 1DQ3A 4TUGA 1RQ0A 1WHQA 4M0VA 4OOGC 4LFBE 1IBLE 4BS9A 1J26A 3F6GA 4GKJE 4L5NC 4X65E 3P1XA 2LTSA 4B3RE 4JI8E 4WFTA 2L2NA 2RTXA 4WPYA 1DI2A 5AE3A 1T4LB 1IBKE 3DF6A 4DV7E 4BC7A 2M1SA 1EKZA 2NA2A 2B3TB 2UXBE 1ZBQA 2UUBE 4B3TE 4F54A 4DV6E 3ZOQB 2YT4A 2RSMA 2ODRD 3HPZA 2NUFA 4JI7E 1X49A 4KHPE 3T1YE 4NXNE 4X66E 3AUZA 4OX9E 2CPNA 3C4TA 2K4VA 3MSWA 5AE1A 4JI4E 1I94E 1T4OA 2JWOA 2L6MA 3ADJA 4I8OA 4LF5E 1GZ6A 4NXME 3IWCA 4DV3E 1YYWA 2DIXA 2JVAA 2UUAE 4DUZE 4DR4E 4X62E 1FJGE 3LLHA 5T6JA 4YY3E 2DSYA 1XMQE 4JYAE 1HR0E 2UXCE 5CFFE 3AV0A 2UXDE 4WYQB 4BCAA 5AE2A 5FLXC 2B7VA 2ODRC 2VF1A 4DV0E 1YYOA 3H09A 1N36E 5ADZA 5F3WA 4LTYA 2LRSA 4DUYE 1UILA 2KHXA 4BC9A 3ADLA 2LJHA 5LL6R 4LF9E 2JOXA 2JY9A 2N3GA 2WZOA 2M7QA 2IHR1 5BR8E 4F9CB 1WXRA 2E5LE 4B3ME 4JI5E 3J7Yp 4LF6E 4L8NA 2YZTA 5DNYA 2MC6A 4F9BB 4P78A 2L3CA 3JU0A 5LMUE 4DR5E 4JI2E 1YZ9A 3J7AG 3J81C 3OTOE 2F4VE 2MDRA 4WSPA 1HNZE 2KOUA 1QU6A 4LU9A 4TUIA 2V88A 2HHHE 2V85A 4LF8E 1X48A 2L33A 3LMLA 1J5EE 1O0WA 2VE7C 2L92A 2JOBA 5AASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR2 E;  4AQY E;  4DR3 E;  2NUG A;  4X64 E;  2DB2 A;  1STU A;  1HNX E;  2L3J A;  3HTX A;  1GQE A;  2LTR A;  3C4B A;  4LFA E;  4DV4 E;  4DKK A;  1WHN A;  4M2Z A;  3VYX A;  2VQF E;  4X8W A;  3ADG A;  2LUP B;  2DMY A;  4DV1 E;  4DR1 E;  4JI0 E;  2LBS B;  1RC7 A;  4LF7 E;  1HNW E;  2L2M A;  2UUC E;  4DV2 E;  1XMO E;  4LFC E;  1T4N A;  2B7T A;  4LF4 E;  2NUE A;  3ADI A;  4DV5 E;  4K0K E;  2LUQ A;  1X47 A;  3T1H E;  2UU9 E;  2N3H A;  4GKK E;  4JV5 E;  2VQE E;  2RS7 A;  2EZ6 A;  1ZBT A;  3VYY A;  1N34 E;  1XNR E;  1IBM E;  4JI1 E;  2RS6 A;  5LMN E;  1UHZ A;  4YHH E;  2L2K B;  4JI6 E;  1N32 E;  4DR7 E;  4DR6 E;  5IWA E;  1PKP A;  2ZM6 E;  4JI3 E;  4B3S E;  1XNQ E;  4M30 A;  1N33 E;  1RQ0 A;  1WHQ A;  4OOG C;  4LFB E;  1IBL E;  1J26 A;  4GKJ E;  4X65 E;  3P1X A;  2LTS A;  4B3R E;  4JI8 E;  4WFT A;  2L2N A;  2RTX A;  1DI2 A;  1T4L B;  1IBK E;  4DV7 E;  1EKZ A;  2NA2 A;  2B3T B;  2UXB E;  2UUB E;  4B3T E;  4DV6 E;  2YT4 A;  2RSM A;  2NUF A;  4JI7 E;  1X49 A;  4KHP E;  3T1Y E;  4NXN E;  4X66 E;  4OX9 E;  1YYK A;  2CPN A;  3C4T A;  4JI4 E;  1I94 E;  1T4O A;  4LF5 E;  4NXM E;  3ADJ A;  4DV3 E;  1YYW A;  2DIX A;  2JVA A;  2UUA E;  4DUZ E;  4DR4 E;  4X62 E;  1FJG E;  3LLH A;  4YY3 E;  2UXC E;  1XMQ E;  4JYA E;  1HR0 E;  5CFF E;  4WYQ B;  1N36 E;  2B7V A;  4DV0 E;  1YYO A;  2LRS A;  4DUY E;  1UIL A;  2KHX A;  3ADL A;  2LJH A;  4LF9 E;  2N3G A;  2JY9 A;  2E5L E;  2UXD E;  2IHR 1;  5BR8 E;  4B3M E;  4JI5 E;  4LF6 E;  3J7Y p;  2L3C A;  5LMU E;  4DR5 E;  4JI2 E;  1YZ9 A;  3OTO E;  2F4V E;  2MDR A;  1HNZ E;  1QU6 A;  2HHH E;  4LF8 E;  1X48 A;  2L33 A;  1J5E E;  1O0W A;  1FKA E; 
#chains in the Genus database with same CATH topology
 1X6E A;  5A2Q C;  4KWY A;  2DLK A;  2L3J A;  1A1J A;  5AC4 A;  2HGH A;  2YTP A;  2V86 A;  4M2Z A;  3VHT B;  1SR9 A;  2JR1 A;  2LBS B;  3M99 B;  2EN2 A;  2MC5 A;  1F2I G;  2EMC A;  4R2C A;  2RQL A;  3ADI A;  2EM8 A;  4K0K E;  2LUQ A;  2DRP A;  2UU9 E;  1AH5 A;  4M9V C;  4BBY A;  5KL3 A;  2RS7 A;  2FV4 B;  2EZ6 A;  5LLQ A;  2RS6 A;  4YHH E;  4O5G A;  2KON A;  4DR7 E;  2DMI A;  1LLM C;  4B3S E;  2ENA A;  4M30 A;  1N33 E;  4TUG A;  1WHQ A;  4LFB E;  1N3G A;  1IBL E;  2EOJ A;  2LV2 A;  4GKJ E;  1MGT A;  2RTX A;  5AC5 A;  2WCC 3;  3DF6 A;  4BC7 A;  2M1S A;  2EPR A;  3EPK A;  3L00 A;  1EH8 A;  3ZOQ B;  2EPA A;  1IMU A;  2D9H A;  3HPZ A;  5TSE A;  1A1G A;  4KHP E;  4X66 E;  1G2F C;  1I94 E;  1A1F A;  4NXM E;  3ADJ A;  4I8O A;  2DIX A;  3ECR A;  4R2Q A;  5T6J A;  1MEY C;  2YTQ A;  4N4R B;  4DV0 E;  2M9A A;  2ENC A;  4DUY E;  2DGC A;  3ADL A;  4ZYG A;  1TF6 A;  2JY9 A;  2WZO A;  4HEI A;  2IHR 1;  1PJS A;  4L8N A;  4P78 A;  1PJQ A;  2EQ3 A;  4JI2 E;  2JPA A;  3OTO E;  4ZYE A;  2A25 A;  2F4V E;  4LU9 A;  2HHH E;  1YUI A;  1X48 A;  3LML A;  1J5E E;  2LCE A;  4R2S A;  2L92 A;  2EJ4 A;  2BB8 A;  2JYA A;  1IQO A;  2B9D A;  2EWL A;  3OML A;  4X64 E;  2NUG A;  2YTD A;  5A6J A;  1X5W A;  1STU A;  1KYQ A;  2ADR A;  2R76 A;  3J80 C;  2YRK A;  3K6Q A;  2NAB A;  4ZYH A;  2LTR A;  2LE2 A;  4RHB B;  2DMY A;  1EH6 A;  1AAY A;  4DR1 E;  2EMF A;  3EPH A;  1RC7 A;  4LF7 E;  5A69 A;  3IWD A;  2EOS A;  2V89 A;  5KL6 A;  2WBT A;  3BBG A;  2I13 A;  4R2E A;  1X47 A;  2RSI A;  2V87 A;  2E1M A;  2ELZ A;  2EMX A;  1Z1B A;  1YPN A;  2EOY A;  1N34 E;  2F8B A;  4O43 A;  1G2D C;  5LMN E;  1ZAA C;  4J8Z A;  2WBU A;  1N32 E;  2G7H A;  4X9J A;  2EPP A;  4R8O A;  4Q28 A;  1XNQ E;  4NHR A;  1RQ0 A;  3KZY A;  1ZR9 A;  4WSG A;  3F6G A;  1X3C A;  4L5N C;  4X65 E;  3P1X A;  2EL6 A;  2EPN A;  4WPY A;  5AE3 A;  1T4L B;  4IS1 C;  2MKN A;  4DV7 E;  1EKZ A;  2EMK A;  2B3T B;  2HJJ A;  4IJD A;  1WRJ A;  4DV6 E;  2EOX A;  3TQM A;  3C6M A;  2YT4 A;  2EN4 A;  2MKD A;  2EPK X;  4JI7 E;  3T1Y E;  2EMG A;  3BGH A;  2LVH A;  2CPN A;  2RPC A;  2EOM A;  5AE1 A;  2JWO A;  2EPC A;  2L6M A;  3IWC A;  1YYW A;  1X6F A;  2JVA A;  2UUA E;  4DUZ E;  4X62 E;  2LJU A;  1EH7 A;  2HC5 A;  3LLH A;  2DSY A;  4JYA E;  3AV0 A;  4BCA A;  5AE2 A;  2VF1 A;  4MLQ A;  5F3W A;  2LRS A;  2CT1 A;  2KHX A;  1A1L A;  5KL4 A;  2N3G A;  2UXD E;  1YSA C;  1NEI A;  5A6B A;  3EQ1 A;  1UBD C;  1L4S A;  2KOU A;  1QU6 A;  2V88 A;  1O0W A;  2VE7 C;  2EMB A;  2GLI A;  4P7D A;  2K7I A;  1HNX E;  3HTX A;  1GQE A;  2EM6 A;  1BB8 A;  4DV4 E;  5A6B D;  1A1K A;  1WHN A;  2EN3 A;  3VYX A;  2V8Q B;  2EMZ A;  2EN7 A;  5IV8 B;  4JI0 E;  2L2M A;  3VK6 A;  2UUC E;  4DV2 E;  3JTZ A;  3JAM C;  2LMZ A;  2GHF A;  4LFC E;  2B7T A;  3FIG A;  1TN9 A;  2FTX B;  3KWR A;  2NUE A;  2YWQ A;  2J7J A;  3T1H E;  2DLQ A;  4GKK E;  4JV5 E;  2VQE E;  3UK3 C;  2EPZ A;  1IBM E;  4R2A A;  2YRH A;  2EOH A;  2N8X A;  2EL5 A;  4F2J C;  4R03 A;  4JI6 E;  4DR6 E;  1PKP A;  3DJW A;  4JI3 E;  2YSP A;  4GEQ B;  4OOG C;  3QG5 C;  2YTO A;  4BHC A;  2EOQ A;  2EPX A;  5IXM B;  4F6M A;  2EN6 A;  4B3R E;  4O24 A;  4WFT A;  3EPJ A;  2EMW A;  2YTJ A;  2L2N A;  1PDA A;  1DI2 A;  2EL4 A;  2GPI A;  4WXD A;  2UXB E;  1JK2 A;  2EMA A;  1ZBQ A;  1A1I A;  2ODR D;  2EM4 A;  2NUF A;  3BF2 A;  2YTE A;  4NXN E;  3C4T A;  2K4V A;  2YTF A;  1T4O A;  4LF5 E;  2YTN A;  1YFH A;  1T38 A;  2EPO A;  2EOE A;  2YRM A;  2CTD A;  1FJG E;  2LO3 A;  4YY3 E;  1XMQ E;  5KL7 A;  2YU5 A;  2ODR C;  1YYO A;  2VRD A;  1P47 A;  1UIL A;  1KJK A;  2JOX A;  5A6A A;  2E5L E;  2YPN A;  4B3M E;  2YSO A;  1BBG A;  3J7Y p;  2YZT A;  4F9B B;  3JU0 A;  1YUJ A;  2EPU A;  2EQ0 A;  5KL2 A;  3J81 C;  3J7A G;  4WXC A;  4R2D A;  3THO B;  1HNZ E;  2E72 A;  4ZYD A;  3C6K A;  2EML A;  2JOB A;  5AAS A;  1FKA E;  4DR2 E;  2EM9 A;  3HXL A;  1TF3 A;  2EOO A;  1UN6 B;  4AQY E;  4DR3 E;  3HQ1 A;  1X6H A;  2V83 A;  4BMJ A;  2DB2 A;  1GTK A;  2M4I A;  3MHH C;  3C4B A;  4LFA E;  4DKK A;  2Q8U A;  4F9A B;  2VQF E;  1A1H A;  4X8W A;  2JP9 A;  3ADG A;  2LUP B;  3F6H A;  4DV1 E;  4KZS A;  1RMD A;  4GZN C;  1HNW E;  5IT9 C;  4RH8 A;  1XMO E;  2YTI A;  1T4N A;  2WBS A;  2L8T A;  2EN1 A;  2EOR A;  4LF4 E;  4DV5 E;  2BBG A;  3IWB A;  2EOI A;  2N3H A;  2EOF A;  2EQ1 A;  2FGG A;  4F6N A;  4O4K A;  1ZBT A;  3VYY A;  1XNR E;  3HPS A;  4Q35 B;  4JI1 E;  1BBO A;  4FK5 C;  1PJT A;  2R1F A;  3BID A;  1UHZ A;  2L2K B;  4DMI A;  2YU8 A;  5IWA E;  2ZM6 E;  3RMP A;  2H36 X;  3MHS C;  2EM2 A;  2CSH A;  2EE8 A;  1JK1 A;  1DQ3 A;  1NCS A;  2EM7 A;  4M0V A;  3THN A;  4BS9 A;  1J26 A;  2EOZ A;  4NZV A;  1B69 A;  2LTS A;  1SFE A;  4JI8 E;  1QNT A;  1IQS A;  4R2R A;  1IBK E;  2YTG A;  4WX9 A;  2NA2 A;  2UUB E;  4B3T E;  2EPM X;  4F54 A;  2RSM A;  2EMH A;  1X49 A;  1T39 A;  3EPL A;  3AUZ A;  4R2P A;  4OX9 E;  3MSW A;  4JI4 E;  1YYK A;  1GZ6 A;  4DV3 E;  2EM3 A;  4DR4 E;  2MDG A;  2I9I A;  2UXC E;  1HR0 E;  5A6K A;  5CFF E;  1DGC A;  4WYQ B;  5KL5 A;  5FLX C;  1N36 E;  2B7V A;  3H09 A;  2PRT A;  5ADZ A;  2EMI A;  4LTY A;  3KZZ A;  4BC9 A;  2EN8 A;  2EM0 A;  2LJH A;  5LL6 R;  4LF9 E;  1WXR A;  2M7Q A;  4BHB A;  5BR8 E;  4F9C B;  4JI5 E;  4LF6 E;  4HTG A;  5DNY A;  2MC6 A;  2L3C A;  5LMU E;  4DR5 E;  1YZ9 A;  2EM5 A;  4MLV A;  1ZU1 A;  2JXP A;  2MDR A;  2ELY A;  2EMY A;  4WSP A;  4TUI A;  2LT7 A;  2V85 A;  4LF8 E;  2L33 A;  2ENH A;  1WJP A;  2EPL X;  2EP3 A; 
#chains in the Genus database with same CATH homology
 4P7D A;  3HXL A;  4DR2 E;  2B9D A;  2EWL A;  4AQY E;  4DR3 E;  3HQ1 A;  5A2Q C;  2V83 A;  3OML A;  4BMJ A;  4X64 E;  2NUG A;  2DB2 A;  1STU A;  2M4I A;  1HNX E;  2L3J A;  3J80 C;  3HTX A;  1GQE A;  3K6Q A;  2LTR A;  3C4B A;  4LFA E;  4DV4 E;  4DKK A;  1WHN A;  2V86 A;  4M2Z A;  4F9A B;  2VQF E;  2LE2 A;  1SR9 A;  2V8Q B;  4X8W A;  3ADG A;  2LUP B;  3VYX A;  2DMY A;  3F6H A;  2JR1 A;  4DV1 E;  4DR1 E;  4KZS A;  4JI0 E;  2LBS B;  1RC7 A;  4LF7 E;  1HNW E;  2L2M A;  3VK6 A;  5IT9 C;  2UUC E;  4DV2 E;  3JTZ A;  3JAM C;  2LMZ A;  2MC5 A;  3IWD A;  1XMO E;  4LFC E;  2V89 A;  1T4N A;  2B7T A;  3FIG A;  2L8T A;  2FTX B;  3KWR A;  4LF4 E;  2NUE A;  3ADI A;  4DV5 E;  4K0K E;  2LUQ A;  1X47 A;  2V87 A;  3T1H E;  3IWB A;  2UU9 E;  2E1M A;  2N3H A;  2FGG A;  4BBY A;  4GKK E;  4JV5 E;  2VQE E;  2RS7 A;  2FV4 B;  2EZ6 A;  1ZBT A;  3VYY A;  1N34 E;  1XNR E;  1IBM E;  3HPS A;  4JI1 E;  2F8B A;  1FKA E;  2RS6 A;  5LMN E;  1UHZ A;  4J8Z A;  4R03 A;  4YHH E;  2L2K B;  4DMI A;  4JI6 E;  1N32 E;  1YYK A;  2G7H A;  2KON A;  4DR7 E;  4DR6 E;  5IWA E;  1PKP A;  2ZM6 E;  3DJW A;  4R8O A;  3RMP A;  4JI3 E;  2H36 X;  4Q28 A;  4B3S E;  4GEQ B;  1XNQ E;  4M30 A;  1N33 E;  1DQ3 A;  4TUG A;  1RQ0 A;  1WHQ A;  4M0V A;  4OOG C;  4LFB E;  1IBL E;  4BS9 A;  1J26 A;  3F6G A;  4GKJ E;  4L5N C;  4X65 E;  3P1X A;  2LTS A;  4B3R E;  4JI8 E;  4WFT A;  2L2N A;  2RTX A;  4WPY A;  1DI2 A;  5AE3 A;  1T4L B;  1IBK E;  3DF6 A;  4DV7 E;  4BC7 A;  2M1S A;  1EKZ A;  2NA2 A;  2B3T B;  2UXB E;  1ZBQ A;  2UUB E;  4B3T E;  4F54 A;  4DV6 E;  3ZOQ B;  2YT4 A;  2RSM A;  2ODR D;  3HPZ A;  2NUF A;  4JI7 E;  1X49 A;  4KHP E;  3T1Y E;  4NXN E;  4X66 E;  3AUZ A;  4OX9 E;  2CPN A;  3C4T A;  2K4V A;  3MSW A;  5AE1 A;  4JI4 E;  1I94 E;  1T4O A;  2JWO A;  2L6M A;  3ADJ A;  4I8O A;  4LF5 E;  1GZ6 A;  4NXM E;  3IWC A;  4DV3 E;  1YYW A;  2DIX A;  2JVA A;  2UUA E;  4DUZ E;  4DR4 E;  4X62 E;  1FJG E;  3LLH A;  5T6J A;  4YY3 E;  2DSY A;  1XMQ E;  4JYA E;  1HR0 E;  2UXC E;  5CFF E;  3AV0 A;  2UXD E;  4WYQ B;  4BCA A;  5AE2 A;  5FLX C;  2B7V A;  2ODR C;  2VF1 A;  4DV0 E;  1YYO A;  3H09 A;  1N36 E;  5ADZ A;  5F3W A;  4LTY A;  2LRS A;  4DUY E;  1UIL A;  2KHX A;  4BC9 A;  3ADL A;  2LJH A;  5LL6 R;  4LF9 E;  2JOX A;  2JY9 A;  2N3G A;  2WZO A;  2M7Q A;  2IHR 1;  5BR8 E;  4F9C B;  1WXR A;  2E5L E;  4B3M E;  4JI5 E;  3J7Y p;  4LF6 E;  4L8N A;  2YZT A;  5DNY A;  2MC6 A;  4F9B B;  4P78 A;  2L3C A;  3JU0 A;  5LMU E;  4DR5 E;  4JI2 E;  1YZ9 A;  3J7A G;  3J81 C;  3OTO E;  2F4V E;  2MDR A;  4WSP A;  1HNZ E;  2KOU A;  1QU6 A;  4LU9 A;  4TUI A;  2V88 A;  2HHH E;  2V85 A;  4LF8 E;  1X48 A;  2L33 A;  3LML A;  1J5E E;  1O0W A;  2VE7 C;  2L92 A;  2JOB A;  5AAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...