2L33A

Solution nmr structure of drbm 2 domain of interleukin enhancer-binding factor 3 from homo sapiens, northeast structural genomics consortium target hr4527e
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
91
structure length
91
Chain Sequence
MGHHHHHHSHMLTKHGKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAYAALAALEKLFPDTPLALDANK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target HR4527E
rcsb
source organism Homo sapiens
molecule tags Transcription regulator
molecule keywords Interleukin enhancer-binding factor 3
total genus 15
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2010-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l33A00
4LF9E 2L3JA 1I94E 1XNQE 3T1YE 4DR3E 1X48A 2LUQA 2NUGA 4DUZE 2RSMA 4B3RE 4LF6E 2UXDE 4DV1E 1XMOE 4OOGC 4JI0E 1QU6A 2LBSB 4DR4E 3LLHA 4KHPE 5LMUE 1HNWE 1WHNA 1UHZA 2RS6A 4DV0E 2NA2A 2RS7A 2JY9A 4LF5E 2UUBE 1T4OA 4X8WA 1X49A 2L2MA 1YZ9A 4K0KE 3C4BA 1YYOA 1STUA 2UUCE 2L3CA 2LTRA 1RC7A 3T1HE 3ADIA 4DV5E 4DV6E 2LTSA 2LUPB 4LFCE 1YYWA 4JI1E 2N3HA 2NUFA 4B3TE 2UXBE 4JI3E 2B3TB 2ZM6E 1N36E 4JI2E 3J7Yp 4M30A 1T4NA 2L2KB 1IBME 2JVAA 4X65E 2NUEA 4JI8E 4DV3E 2LJHA 4WYQB 4OX9E 1PKPA 3C4TA 4GKKE 1FKAE 4X66E 1N34E 4JI5E 2DIXA 3ADLA 4WFTA 3P1XA 3OTOE 1WHQA 2F4VE 1DI2A 4LFAE 5IWAE 4LFBE 4LF4E 1GQEA 1HNXE 2UUAE 1XNRE 5BR8E 5CFFE 4YHHE 2VQEE 2LRSA 4B3SE 2HHHE 4DV2E 3HTXA 2E5LE 1YYKA 1O0WA 1IBLE 4DR7E 4X64E 2KHXA 2UU9E 1J26A 4LF7E 2EZ6A 1T4LB 4X62E 4DR2E 2B7VA 2MDRA 4JI7E 2N3GA 4DUYE 1N33E 4YY3E 2L2NA 2CPNA 4M2ZA 4JYAE 4JI4E 2YT4A 1UILA 2B7TA 2IHR1 2VQFE 4DR1E 1HR0E 3ADGA 2L33A 1XMQE 3VYXA 4DV4E 4NXME 4B3ME 4DR5E 4JV5E 1HNZE 4LF8E 2RTXA 1FJGE 2UXCE 4DV7E 1N32E 3ADJA 5LMNE 1RQ0A 1J5EE 1EKZA 4NXNE 3VYYA 4AQYE 4JI6E 1IBKE 1ZBTA 1X47A 4DR6E 4DKKA 4GKJE 2DB2A 2DMYA
chains in the Genus database with same CATH superfamily
2BB8A 2YTIA 1IMUA 1YSAC 5FLXC 2EN8A 1X48A 4BC9A 2NABA 2NUGA 2RSMA 2EN6A 2RQLA 2EN4A 4LF6E 2DSYA 5KL2A 1KJKA 1QU6A 2LBSB 5LMUE 1WHNA 2V87A 2YTDA 2V89A 4F9AB 1X6HA 5AASA 4O24A 3J80C 1YZ9A 1YYOA 2YSPA 2KOUA 5A6JA 2GLIA 1PJQA 2LTRA 2WZOA 2EMLA 4DV5E 2JP9A 2LUPB 4F6NA 4JI1E 2B3TB 2ZM6E 1A1FA 2L2KB 2EMHA 1IBME 4WSGA 5IV8B 1L4SA 2NUEA 2EPKX 2LJHA 1PKPA 2EPAA 3C4TA 4R2RA 1FKAE 2LT7A 2EORA 1A1LA 2WBSA 4WFTA 2YU8A 3P1XA 3KZYA 3OTOE 1ZAAC 5DNYA 2WBTA 2EM4A 1GQEA 2UUAE 2EM9A 1EH6A 5CFFE 2ELZA 5LLQA 2MKNA 3HPZA 2JOBA 2V83A 1P47A 2L8TA 2EOXA 2CTDA 2ELYA 2E5LE 2M9AA 2YPNA 2L6MA 2LE2A 2EMGA 4X64E 4I8OA 4LF7E 4DR2E 2F8BA 3RMPA 2JYAA 3JAMC 2MDRA 2EOZA 2EOOA 2N3GA 1N33E 1X6EA 4WXCA 2EPXA 1UBDC 5KL3A 4JYAE 2WBUA 2IHR1 4DR1E 1HR0E 1YFHA 1XMQE 2EOJA 4NXME 4B3ME 1YUIA 2EN2A 4O43A 2VRDA 2EM0A 3F6GA 1J5EE 1RQ0A 1UN6B 3F6HA 3VYYA 1PDAA 2ENHA 5AE2A 4R2CA 2RSIA 1X6FA 2DMYA 2YTJA 3C6KA 4MLQA 3C6MA 5F3WA 1XNQE 2RPCA 4DUZE 4BMJA 3VHTB 1LLMC 2UXDE 2YTOA 1XMOE 4JI0E 2EOSA 1TF3A 5AC4A 4DV0E 1T38A 1BBGA 4BBYA 2RS7A 4P78A 2DMIA 5A2QC 2ODRD 2UUBE 2EQ0A 4IS1C 4X8WA 1X49A 2L2MA 4R8OA 1JK1A 3ADIA 2E72A 4DV6E 2EMXA 2ENAA 2EM3A 2UXBE 2JWOA 4JI3E 4JI2E 2EQ1A 5AE1A 3J7Yp 2N8XA 1T4NA 2EP3A 5IXMB 4M0VA 2JVAA 4NHRA 1F2IG 2EPMX 2EPOA 4DV3E 2DRPA 2MKDA 4WYQB 1EH7A 4X66E 2Q8UA 2EMZA 1N34E 3K6QA 2DIXA 3ADLA 5TSEA 2VF1A 1N3GA 2F4VE 5IWAE 4LF4E 2K4VA 1G2DC 4WSPA 5BR8E 4YHHE 2R76A 3M99B 1BBOA 2DLQA 2YZTA 4R2PA 2EPRA 1MEYC 3AV0A 2E1MA 1BB8A 2LO3A 2WCC3 5T6JA 3EPKA 2I13A 2EZ6A 3L00A 4MLVA 3EQ1A 3IWCA 2B7VA 4JI7E 4TUGA 3DJWA 2CSHA 5AC5A 3TQMA 2KONA 2L2NA 2CPNA 2HC5A 4ZYHA 4JI4E 2VQFE 1UILA 2B7TA 1RMDA 3ADGA 2EN3A 4BHBA 2EMCA 4DR5E 1G2FC 2H36X 2RTXA 5AE3A 2M4IA 3ADJA 4R2DA 5LMNE 4NXNE 2EE8A 2HJJA 3J81C 1PJTA 1Z1BA 1ZBTA 4DR6E 3IWBA 2JPAA 3THOB 1A1HA 5LL6R 2EQ3A 3ZOQB 2L3JA 5KL5A 2EPPA 4DR3E 2LUQA 2J7JA 2EPCA 4LTYA 5A6KA 2MC6A 4DV1E 4OOGC 4Q35B 4DR4E 3LLHA 2PRTA 2EM5A 4GZNC 1UHZA 3BGHA 1KYQA 1YUJA 4R2EA 3AUZA 2NA2A 1QNTA 1A1KA 2LCEA 1ZU1A 4N4RB 1T4OA 2EMWA 1DGCA 3C4BA 2L3CA 2EOFA 2EM8A 2EMKA 3T1HE 1NCSA 2LTSA 4LFCE 2NUFA 2V88A 4B3TE 1SR9A 3MSWA 3EPHA 1PJSA 4R2QA 2YTPA 2EJ4A 4WXDA 4GKKE 3J7AG 1A1IA 4ZYGA 4BHCA 2EMAA 1WHQA 2EL5A 4IJDA 4LFAE 4LFBE 5KL6A 1A1GA 2YTGA 1AH5A 2L92A 2VQEE 2LRSA 2JOXA 2GHFA 5A69A 4B3SE 2HHHE 4RH8A 4DV2E 3HTXA 3QG5C 1YYKA 1O0WA 2EPZA 4LU9A 1IBLE 2EL4A 1B69A 1T4LB 4X62E 4BS9A 2DGCA 3ECRA 4O5GA 4BC7A 4RHBB 3HPSA 4X9JA 4R03A 2YTFA 1NEIA 2EOMA 1A1JA 2L33A 5A6AA 4GEQB 2V86A 3OMLA 2EWLA 1HNZE 1X5WA 2UXCE 2YRHA 4F54A 2ADRA 2CT1A 1EKZA 1AAYA 3MHSC 4JI6E 2EM2A 2EN1A 2VE7C 1IBKE 4F9BB 2EMBA 4F9CB 3LMLA 4F6MA 2DB2A 4GKJE 3FIGA 1TF6A 4LF9E 1I94E 3T1YE 4R2SA 2K7IA 2YSOA 2V85A 2A25A 4B3RE 4KWYA 2ODRC 1SFEA 4P7DA 2EN7A 1GTKA 2EM7A 2GPIA 4KHPE 1HNWE 4O4KA 1WJPA 2RS6A 3BIDA 2I9IA 4HEIA 2EPUA 2JXPA 2EOIA 2YRMA 1YPNA 4KZSA 2JY9A 3DF6A 3KWRA 4LF5E 3UK3C 3HQ1A 2YTNA 2YTEA 4K0KE 1STUA 2UUCE 5IT9C 2R1FA 4M9VC 1RC7A 4FK5C 3EPJA 2BBGA 2FV4B 2YRKA 3BBGA 1YYWA 2N3HA 5A6BD 2EOYA 1WXRA 1N36E 2EPLX 4M30A 2FGGA 3VK6A 4X65E 2EPNA 1X3CA 4JI8E 4WPYA 1JK2A 4OX9E 1WRJA 2M7QA 3EPLA 4F2JC 4JI5E 2EMIA 4DMIA 2EMYA 4ZYDA 1EH8A 2MC5A 4WX9A 2V8QB 1DI2A 1MGTA 1XNRE 1HNXE 1TN9A 2EM6A 1IQSA 2EMFA 1DQ3A 2DLKA 2B9DA 2YU5A 2YWQA 5KL7A 5ADZA 4J8ZA 4DR7E 2EL6A 2KHXA 2M1SA 2UU9E 1J26A 4R2AA 2YTQA 2FTXB 4L8NA 2MDGA 4BCAA 5KL4A 1ZBQA 3BF2A 3JU0A 4DUYE 4YY3E 4Q28A 3JTZA 3KZZA 1IQOA 2HGHA 4M2ZA 1ZR9A 2LVHA 1GZ6A 2YT4A 2G7HA 4HTGA 5A6BA 3THNA 4L5NC 3VYXA 4DV4E 4JV5E 4NZVA 2ENCA 4LF8E 1FJGE 4DV7E 3HXLA 4ZYEA 1N32E 2EOQA 4TUIA 2LV2A 1T39A 2EOHA 4AQYE 2EOEA 1X47A 2LMZA 3MHHC 4DKKA 3IWDA 2D9HA 3H09A 2JR1A 2LJUA
chains in the Genus database with same CATH topology
4LF9E 5F3WA 5LL6R 3ZOQB 5FLXC 2L3JA 1I94E 1XNQE 3T1YE 4DR3E 1X48A 4BC9A 2LUQA 2NUGA 4DUZE 2RSMA 2V85A 4BMJA 4B3RE 4LF6E 4LTYA 2DSYA 2UXDE 2MC6A 4DV1E 2ODRC 4P7DA 1XMOE 4OOGC 4JI0E 1QU6A 2LBSB 4DR4E 3LLHA 4KHPE 5LMUE 1HNWE 1WHNA 1UHZA 2RS6A 2V87A 2V89A 4DV0E 3AUZA 4F9AB 4BBYA 2NA2A 2RS7A 5AASA 4KZSA 2JY9A 4P78A 3DF6A 5A2QC 3J80C 3KWRA 4LF5E 2ODRD 2UUBE 3HQ1A 1T4OA 4X8WA 1X49A 2L2MA 1YZ9A 4K0KE 3C4BA 1YYOA 4R8OA 2KOUA 1STUA 2UUCE 2L3CA 5IT9C 2LTRA 2WZOA 3T1HE 1RC7A 3ADIA 4DV5E 2FV4B 4DV6E 2LTSA 2LUPB 4LFCE 1YYWA 4JI1E 2N3HA 2V88A 2NUFA 1SR9A 4B3TE 2JWOA 4JI3E 2B3TB 1WXRA 2ZM6E 1N36E 5AE1A 3J7Yp 4JI2E 4M30A 1T4NA 3MSWA 2L2KB 4M0VA 1IBME 2FGGA 3VK6A 2JVAA 2UXBE 4X65E 2NUEA 4JI8E 4DV3E 4WPYA 2LJHA 4WYQB 4OX9E 1PKPA 3C4TA 4GKKE 2M7QA 1FKAE 4X66E 1N34E 4JI5E 3K6QA 4DMIA 2DIXA 3J7AG 2MC5A 4WFTA 3ADLA 2VF1A 3P1XA 2V8QB 3OTOE 1WHQA 5DNYA 2F4VE 1DI2A 4LFAE 5IWAE 4LFBE 4LF4E 1GQEA 2K4VA 1HNXE 2UUAE 1XNRE 4WSPA 5BR8E 5CFFE 4YHHE 2L92A 2VQEE 3HPZA 2LRSA 2JOXA 2JOBA 2V83A 4B3SE 2HHHE 2L8TA 4DV2E 1DQ3A 2B9DA 2YZTA 3HTXA 5ADZA 2E5LE 3AV0A 2E1MA 1YYKA 1O0WA 4J8ZA 2L6MA 4LU9A 2LE2A 1IBLE 4DR7E 2M1SA 2KHXA 4X64E 2UU9E 1J26A 4I8OA 5T6JA 4LF7E 2EZ6A 1T4LB 4X62E 4DR2E 4BS9A 3IWCA 2F8BA 3RMPA 3JAMC 2FTXB 2B7VA 2MDRA 4JI7E 3DJWA 4L8NA 4TUGA 4BCAA 2N3GA 1ZBQA 3JU0A 4DUYE 1N33E 2KONA 4BC7A 2L2NA 4Q28A 4YY3E 3JTZA 2CPNA 3HPSA 4R03A 4M2ZA 4JYAE 4JI4E 1GZ6A 2YT4A 1UILA 2B7TA 2G7HA 2IHR1 2VQFE 4DR1E 1HR0E 3ADGA 2L33A 1XMQE 4GEQB 4L5NC 3VYXA 4DV4E 4NXME 4B3ME 4DR5E 4JV5E 2V86A 2H36X 2EWLA 3OMLA 1HNZE 2RTXA 4LF8E 1FJGE 2UXCE 4DV7E 4F54A 3HXLA 1N32E 5AE3A 2M4IA 3ADJA 3F6GA 4TUIA 1RQ0A 5LMNE 1J5EE 1EKZA 3F6HA 4NXNE 3VYYA 3J81C 4AQYE 4JI6E 2VE7C 1IBKE 4F9BB 5AE2A 1ZBTA 1X47A 4F9CB 2LMZA 4DKKA 3LMLA 4DR6E 2DB2A 4GKJE 2DMYA 3IWDA 3H09A 2JR1A 3IWBA 3FIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 E;  2L3J A;  1I94 E;  1XNQ E;  3T1Y E;  4DR3 E;  1X48 A;  2LUQ A;  2NUG A;  4DUZ E;  2RSM A;  4B3R E;  4LF6 E;  2UXD E;  4DV1 E;  1XMO E;  4OOG C;  4JI0 E;  1QU6 A;  2LBS B;  4DR4 E;  3LLH A;  4KHP E;  5LMU E;  1HNW E;  1WHN A;  1UHZ A;  2RS6 A;  4DV0 E;  2NA2 A;  2RS7 A;  2JY9 A;  4LF5 E;  2UUB E;  1T4O A;  4X8W A;  1X49 A;  2L2M A;  1YZ9 A;  4K0K E;  3C4B A;  1YYO A;  1STU A;  2UUC E;  2L3C A;  2LTR A;  1RC7 A;  3T1H E;  3ADI A;  4DV5 E;  4DV6 E;  2LTS A;  2LUP B;  4LFC E;  1YYW A;  4JI1 E;  2N3H A;  2NUF A;  4B3T E;  2UXB E;  4JI3 E;  2B3T B;  2ZM6 E;  1N36 E;  4JI2 E;  3J7Y p;  4M30 A;  1T4N A;  2L2K B;  1IBM E;  2JVA A;  4X65 E;  2NUE A;  4JI8 E;  4DV3 E;  2LJH A;  4WYQ B;  4OX9 E;  1PKP A;  3C4T A;  4GKK E;  1FKA E;  4X66 E;  1N34 E;  4JI5 E;  2DIX A;  3ADL A;  4WFT A;  3P1X A;  3OTO E;  1WHQ A;  2F4V E;  1DI2 A;  4LFA E;  5IWA E;  4LFB E;  4LF4 E;  1GQE A;  1HNX E;  2UUA E;  1XNR E;  5BR8 E;  5CFF E;  4YHH E;  2VQE E;  2LRS A;  4B3S E;  2HHH E;  4DV2 E;  3HTX A;  2E5L E;  1YYK A;  1O0W A;  1IBL E;  4DR7 E;  4X64 E;  2KHX A;  2UU9 E;  1J26 A;  4LF7 E;  2EZ6 A;  1T4L B;  4X62 E;  4DR2 E;  2B7V A;  2MDR A;  4JI7 E;  2N3G A;  4DUY E;  1N33 E;  4YY3 E;  2L2N A;  2CPN A;  4M2Z A;  4JYA E;  4JI4 E;  2YT4 A;  1UIL A;  2B7T A;  2IHR 1;  2VQF E;  4DR1 E;  1HR0 E;  3ADG A;  2L33 A;  1XMQ E;  3VYX A;  4DV4 E;  4NXM E;  4B3M E;  4DR5 E;  4JV5 E;  1HNZ E;  4LF8 E;  2RTX A;  1FJG E;  2UXC E;  4DV7 E;  1N32 E;  3ADJ A;  5LMN E;  1RQ0 A;  1J5E E;  1EKZ A;  4NXN E;  3VYY A;  4AQY E;  4JI6 E;  1IBK E;  1ZBT A;  1X47 A;  4DR6 E;  4DKK A;  4GKJ E;  2DB2 A;  2DMY A; 
#chains in the Genus database with same CATH topology
 2BB8 A;  2YTI A;  1IMU A;  1YSA C;  5FLX C;  2EN8 A;  1X48 A;  4BC9 A;  2NAB A;  2NUG A;  2RSM A;  2EN6 A;  2RQL A;  2EN4 A;  4LF6 E;  2DSY A;  5KL2 A;  1KJK A;  1QU6 A;  2LBS B;  5LMU E;  1WHN A;  2V87 A;  2YTD A;  2V89 A;  4F9A B;  1X6H A;  5AAS A;  4O24 A;  3J80 C;  1YZ9 A;  1YYO A;  2YSP A;  2KOU A;  5A6J A;  2GLI A;  1PJQ A;  2LTR A;  2WZO A;  2EML A;  4DV5 E;  2JP9 A;  2LUP B;  4F6N A;  4JI1 E;  2B3T B;  2ZM6 E;  1A1F A;  2L2K B;  2EMH A;  1IBM E;  4WSG A;  5IV8 B;  1L4S A;  2NUE A;  2EPK X;  2LJH A;  1PKP A;  2EPA A;  3C4T A;  4R2R A;  1FKA E;  2LT7 A;  2EOR A;  1A1L A;  2WBS A;  4WFT A;  2YU8 A;  3P1X A;  3KZY A;  3OTO E;  1ZAA C;  5DNY A;  2WBT A;  2EM4 A;  1GQE A;  2UUA E;  2EM9 A;  1EH6 A;  5CFF E;  2ELZ A;  5LLQ A;  2MKN A;  3HPZ A;  2JOB A;  2V83 A;  1P47 A;  2L8T A;  2EOX A;  2CTD A;  2ELY A;  2E5L E;  2M9A A;  2YPN A;  2L6M A;  2LE2 A;  2EMG A;  4X64 E;  4I8O A;  4LF7 E;  4DR2 E;  2F8B A;  3RMP A;  2JYA A;  3JAM C;  2MDR A;  2EOZ A;  2EOO A;  2N3G A;  1N33 E;  1X6E A;  4WXC A;  2EPX A;  1UBD C;  5KL3 A;  4JYA E;  2WBU A;  2IHR 1;  4DR1 E;  1HR0 E;  1YFH A;  1XMQ E;  2EOJ A;  4NXM E;  4B3M E;  1YUI A;  2EN2 A;  4O43 A;  2VRD A;  2EM0 A;  3F6G A;  1J5E E;  1RQ0 A;  1UN6 B;  3F6H A;  3VYY A;  1PDA A;  2ENH A;  5AE2 A;  4R2C A;  2RSI A;  1X6F A;  2DMY A;  2YTJ A;  3C6K A;  4MLQ A;  3C6M A;  5F3W A;  1XNQ E;  2RPC A;  4DUZ E;  4BMJ A;  3VHT B;  1LLM C;  2UXD E;  2YTO A;  1XMO E;  4JI0 E;  2EOS A;  1TF3 A;  5AC4 A;  4DV0 E;  1T38 A;  1BBG A;  4BBY A;  2RS7 A;  4P78 A;  2DMI A;  5A2Q C;  2ODR D;  2UUB E;  2EQ0 A;  4IS1 C;  4X8W A;  1X49 A;  2L2M A;  4R8O A;  1JK1 A;  3ADI A;  2E72 A;  4DV6 E;  2EMX A;  2ENA A;  2EM3 A;  2UXB E;  2JWO A;  4JI3 E;  4JI2 E;  2EQ1 A;  5AE1 A;  3J7Y p;  2N8X A;  1T4N A;  2EP3 A;  5IXM B;  4M0V A;  2JVA A;  4NHR A;  1F2I G;  2EPM X;  2EPO A;  4DV3 E;  2DRP A;  2MKD A;  4WYQ B;  1EH7 A;  4X66 E;  2Q8U A;  2EMZ A;  1N34 E;  3K6Q A;  2DIX A;  3ADL A;  5TSE A;  2VF1 A;  1N3G A;  2F4V E;  5IWA E;  4LF4 E;  2K4V A;  1G2D C;  4WSP A;  5BR8 E;  4YHH E;  2R76 A;  3M99 B;  1BBO A;  2DLQ A;  2YZT A;  4R2P A;  2EPR A;  1MEY C;  3AV0 A;  2E1M A;  1BB8 A;  2LO3 A;  2WCC 3;  5T6J A;  3EPK A;  2I13 A;  2EZ6 A;  3L00 A;  4MLV A;  3EQ1 A;  3IWC A;  2B7V A;  4JI7 E;  4TUG A;  3DJW A;  2CSH A;  5AC5 A;  3TQM A;  2KON A;  2L2N A;  2CPN A;  2HC5 A;  4ZYH A;  4JI4 E;  2VQF E;  1UIL A;  2B7T A;  1RMD A;  3ADG A;  2EN3 A;  4BHB A;  2EMC A;  4DR5 E;  1G2F C;  2H36 X;  2RTX A;  5AE3 A;  2M4I A;  3ADJ A;  4R2D A;  5LMN E;  4NXN E;  2EE8 A;  2HJJ A;  3J81 C;  1PJT A;  1Z1B A;  1ZBT A;  4DR6 E;  3IWB A;  2JPA A;  3THO B;  1A1H A;  5LL6 R;  2EQ3 A;  3ZOQ B;  2L3J A;  5KL5 A;  2EPP A;  4DR3 E;  2LUQ A;  2J7J A;  2EPC A;  4LTY A;  5A6K A;  2MC6 A;  4DV1 E;  4OOG C;  4Q35 B;  4DR4 E;  3LLH A;  2PRT A;  2EM5 A;  4GZN C;  1UHZ A;  3BGH A;  1KYQ A;  1YUJ A;  4R2E A;  3AUZ A;  2NA2 A;  1QNT A;  1A1K A;  2LCE A;  1ZU1 A;  4N4R B;  1T4O A;  2EMW A;  1DGC A;  3C4B A;  2L3C A;  2EOF A;  2EM8 A;  2EMK A;  3T1H E;  1NCS A;  2LTS A;  4LFC E;  2NUF A;  2V88 A;  4B3T E;  1SR9 A;  3MSW A;  3EPH A;  1PJS A;  4R2Q A;  2YTP A;  2EJ4 A;  4WXD A;  4GKK E;  3J7A G;  1A1I A;  4ZYG A;  4BHC A;  2EMA A;  1WHQ A;  2EL5 A;  4IJD A;  4LFA E;  4LFB E;  5KL6 A;  1A1G A;  2YTG A;  1AH5 A;  2L92 A;  2VQE E;  2LRS A;  2JOX A;  2GHF A;  5A69 A;  4B3S E;  2HHH E;  4RH8 A;  4DV2 E;  3HTX A;  3QG5 C;  1YYK A;  1O0W A;  2EPZ A;  4LU9 A;  1IBL E;  2EL4 A;  1B69 A;  1T4L B;  4X62 E;  4BS9 A;  2DGC A;  3ECR A;  4O5G A;  4BC7 A;  4RHB B;  3HPS A;  4X9J A;  4R03 A;  2YTF A;  1NEI A;  2EOM A;  1A1J A;  2L33 A;  5A6A A;  4GEQ B;  2V86 A;  3OML A;  2EWL A;  1HNZ E;  1X5W A;  2UXC E;  2YRH A;  4F54 A;  2ADR A;  2CT1 A;  1EKZ A;  1AAY A;  3MHS C;  4JI6 E;  2EM2 A;  2EN1 A;  2VE7 C;  1IBK E;  4F9B B;  2EMB A;  4F9C B;  3LML A;  4F6M A;  2DB2 A;  4GKJ E;  3FIG A;  1TF6 A;  4LF9 E;  1I94 E;  3T1Y E;  4R2S A;  2K7I A;  2YSO A;  2V85 A;  2A25 A;  4B3R E;  4KWY A;  2ODR C;  1SFE A;  4P7D A;  2EN7 A;  1GTK A;  2EM7 A;  2GPI A;  4KHP E;  1HNW E;  4O4K A;  1WJP A;  2RS6 A;  3BID A;  2I9I A;  4HEI A;  2EPU A;  2JXP A;  2EOI A;  2YRM A;  1YPN A;  4KZS A;  2JY9 A;  3DF6 A;  3KWR A;  4LF5 E;  3UK3 C;  3HQ1 A;  2YTN A;  2YTE A;  4K0K E;  1STU A;  2UUC E;  5IT9 C;  2R1F A;  4M9V C;  1RC7 A;  4FK5 C;  3EPJ A;  2BBG A;  2FV4 B;  2YRK A;  3BBG A;  1YYW A;  2N3H A;  5A6B D;  2EOY A;  1WXR A;  1N36 E;  2EPL X;  4M30 A;  2FGG A;  3VK6 A;  4X65 E;  2EPN A;  1X3C A;  4JI8 E;  4WPY A;  1JK2 A;  4OX9 E;  1WRJ A;  2M7Q A;  3EPL A;  4F2J C;  4JI5 E;  2EMI A;  4DMI A;  2EMY A;  4ZYD A;  1EH8 A;  2MC5 A;  4WX9 A;  2V8Q B;  1DI2 A;  1MGT A;  1XNR E;  1HNX E;  1TN9 A;  2EM6 A;  1IQS A;  2EMF A;  1DQ3 A;  2DLK A;  2B9D A;  2YU5 A;  2YWQ A;  5KL7 A;  5ADZ A;  4J8Z A;  4DR7 E;  2EL6 A;  2KHX A;  2M1S A;  2UU9 E;  1J26 A;  4R2A A;  2YTQ A;  2FTX B;  4L8N A;  2MDG A;  4BCA A;  5KL4 A;  1ZBQ A;  3BF2 A;  3JU0 A;  4DUY E;  4YY3 E;  4Q28 A;  3JTZ A;  3KZZ A;  1IQO A;  2HGH A;  4M2Z A;  1ZR9 A;  2LVH A;  1GZ6 A;  2YT4 A;  2G7H A;  4HTG A;  5A6B A;  3THN A;  4L5N C;  3VYX A;  4DV4 E;  4JV5 E;  4NZV A;  2ENC A;  4LF8 E;  1FJG E;  4DV7 E;  3HXL A;  4ZYE A;  1N32 E;  2EOQ A;  4TUI A;  2LV2 A;  1T39 A;  2EOH A;  4AQY E;  2EOE A;  1X47 A;  2LMZ A;  3MHH C;  4DKK A;  3IWD A;  2D9H A;  3H09 A;  2JR1 A;  2LJU A; 
#chains in the Genus database with same CATH homology
 4LF9 E;  5F3W A;  5LL6 R;  3ZOQ B;  5FLX C;  2L3J A;  1I94 E;  1XNQ E;  3T1Y E;  4DR3 E;  1X48 A;  4BC9 A;  2LUQ A;  2NUG A;  4DUZ E;  2RSM A;  2V85 A;  4BMJ A;  4B3R E;  4LF6 E;  4LTY A;  2DSY A;  2UXD E;  2MC6 A;  4DV1 E;  2ODR C;  4P7D A;  1XMO E;  4OOG C;  4JI0 E;  1QU6 A;  2LBS B;  4DR4 E;  3LLH A;  4KHP E;  5LMU E;  1HNW E;  1WHN A;  1UHZ A;  2RS6 A;  2V87 A;  2V89 A;  4DV0 E;  3AUZ A;  4F9A B;  4BBY A;  2NA2 A;  2RS7 A;  5AAS A;  4KZS A;  2JY9 A;  4P78 A;  3DF6 A;  5A2Q C;  3J80 C;  3KWR A;  4LF5 E;  2ODR D;  2UUB E;  3HQ1 A;  1T4O A;  4X8W A;  1X49 A;  2L2M A;  1YZ9 A;  4K0K E;  3C4B A;  1YYO A;  4R8O A;  2KOU A;  1STU A;  2UUC E;  2L3C A;  5IT9 C;  2LTR A;  2WZO A;  3T1H E;  1RC7 A;  3ADI A;  4DV5 E;  2FV4 B;  4DV6 E;  2LTS A;  2LUP B;  4LFC E;  1YYW A;  4JI1 E;  2N3H A;  2V88 A;  2NUF A;  1SR9 A;  4B3T E;  2JWO A;  4JI3 E;  2B3T B;  1WXR A;  2ZM6 E;  1N36 E;  5AE1 A;  3J7Y p;  4JI2 E;  4M30 A;  1T4N A;  3MSW A;  2L2K B;  4M0V A;  1IBM E;  2FGG A;  3VK6 A;  2JVA A;  2UXB E;  4X65 E;  2NUE A;  4JI8 E;  4DV3 E;  4WPY A;  2LJH A;  4WYQ B;  4OX9 E;  1PKP A;  3C4T A;  4GKK E;  2M7Q A;  1FKA E;  4X66 E;  1N34 E;  4JI5 E;  3K6Q A;  4DMI A;  2DIX A;  3J7A G;  2MC5 A;  4WFT A;  3ADL A;  2VF1 A;  3P1X A;  2V8Q B;  3OTO E;  1WHQ A;  5DNY A;  2F4V E;  1DI2 A;  4LFA E;  5IWA E;  4LFB E;  4LF4 E;  1GQE A;  2K4V A;  1HNX E;  2UUA E;  1XNR E;  4WSP A;  5BR8 E;  5CFF E;  4YHH E;  2L92 A;  2VQE E;  3HPZ A;  2LRS A;  2JOX A;  2JOB A;  2V83 A;  4B3S E;  2HHH E;  2L8T A;  4DV2 E;  1DQ3 A;  2B9D A;  2YZT A;  3HTX A;  5ADZ A;  2E5L E;  3AV0 A;  2E1M A;  1YYK A;  1O0W A;  4J8Z A;  2L6M A;  4LU9 A;  2LE2 A;  1IBL E;  4DR7 E;  2M1S A;  2KHX A;  4X64 E;  2UU9 E;  1J26 A;  4I8O A;  5T6J A;  4LF7 E;  2EZ6 A;  1T4L B;  4X62 E;  4DR2 E;  4BS9 A;  3IWC A;  2F8B A;  3RMP A;  3JAM C;  2FTX B;  2B7V A;  2MDR A;  4JI7 E;  3DJW A;  4L8N A;  4TUG A;  4BCA A;  2N3G A;  1ZBQ A;  3JU0 A;  4DUY E;  1N33 E;  2KON A;  4BC7 A;  2L2N A;  4Q28 A;  4YY3 E;  3JTZ A;  2CPN A;  3HPS A;  4R03 A;  4M2Z A;  4JYA E;  4JI4 E;  1GZ6 A;  2YT4 A;  1UIL A;  2B7T A;  2G7H A;  2IHR 1;  2VQF E;  4DR1 E;  1HR0 E;  3ADG A;  2L33 A;  1XMQ E;  4GEQ B;  4L5N C;  3VYX A;  4DV4 E;  4NXM E;  4B3M E;  4DR5 E;  4JV5 E;  2V86 A;  2H36 X;  2EWL A;  3OML A;  1HNZ E;  2RTX A;  4LF8 E;  1FJG E;  2UXC E;  4DV7 E;  4F54 A;  3HXL A;  1N32 E;  5AE3 A;  2M4I A;  3ADJ A;  3F6G A;  4TUI A;  1RQ0 A;  5LMN E;  1J5E E;  1EKZ A;  3F6H A;  4NXN E;  3VYY A;  3J81 C;  4AQY E;  4JI6 E;  2VE7 C;  1IBK E;  4F9B B;  5AE2 A;  1ZBT A;  1X47 A;  4F9C B;  2LMZ A;  4DKK A;  3LML A;  4DR6 E;  2DB2 A;  4GKJ E;  2DMY A;  3IWD A;  3H09 A;  2JR1 A;  3IWB A;  3FIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...