2L33A

Solution nmr structure of drbm 2 domain of interleukin enhancer-binding factor 3 from homo sapiens, northeast structural genomics consortium target hr4527e
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
91
structure length
91
Chain Sequence
MGHHHHHHSHMLTKHGKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAYAALAALEKLFPDTPLALDANK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Interleukin enhancer-binding factor 3
publication title Northeast Structural Genomics Consortium Target HR4527E
rcsb
source organism Homo sapiens
total genus 15
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2010-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l33A00
4DV3E 5IWAE 2DB2A 1PKPA 1T4LB 2F4VE 2L2KB 4DV4E 1YYWA 4X62E 3J7Yp 3VYXA 2UXBE 4JI7E 1IBKE 4YHHE 4B3RE 5BR8E 4DR3E 1N34E 5CFFE 4X66E 4M30A 3OTOE 1I94E 2L2NA 2KHXA 4LF5E 4LF9E 1HNZE 3T1YE 4JI1E 1HR0E 1O0WA 3HTXA 4B3TE 2B7VA 4LFAE 4JI0E 1IBLE 4X8WA 1QU6A 4DV0E 4DUYE 2NUGA 3ADIA 4JI2E 4JV5E 2B7TA 2N3GA 2NUFA 2UUAE 2L3CA 2LUPB 2LUQA 3T1HE 4LFBE 4M2ZA 4OOGC 1XMQE 4AQYE 3VYYA 1X47A 1EKZA 1HNXE 3ADLA 1WHNA 1J26A 1UHZA 3P1XA 4GKKE 4DR2E 1N36E 3ADGA 4LF8E 2L33A 2LTSA 4LF6E 1ZBTA 4DUZE 1XMOE 1X48A 2IHR1 2B3TB 1XNQE 4X64E 1T4OA 5LMUE 4DV5E 1DI2A 3ADJA 2RTXA 2UXDE 4JI8E 1RC7A 2JVAA 2ZM6E 4DR5E 2VQFE 4JI3E 4DKKA 1XNRE 3C4BA 4NXME 2DMYA 2NA2A 2CPNA 2L3JA 2UUBE 4LF7E 1T4NA 2N3HA 4JYAE 4GKJE 4DR6E 4LF4E 3LLHA 1WHQA 4WYQB 1IBME 3C4TA 2EZ6A 2DIXA 4DV7E 2LTRA 2NUEA 4WFTA 1UILA 2UU9E 4YY3E 4DV6E 1GQEA 2L2MA 4DR1E 4K0KE 1FJGE 1STUA 1YZ9A 2LBSB 4JI5E 4KHPE 1J5EE 2UUCE 1YYKA 4DR4E 2VQEE 2YT4A 2MDRA 4JI6E 5LMNE 4X65E 2LRSA 4DR7E 1X49A 2E5LE 1RQ0A 4DV2E 1N33E 4OX9E 4B3ME 1YYOA 4DV1E 4B3SE 2RSMA 2RS6A 2HHHE 4LFCE 2LJHA 1HNWE 2RS7A 4NXNE 2JY9A 2UXCE 4JI4E 1FKAE 1N32E
chains in the Genus database with same CATH superfamily
5AC5A 2V83A 1IQOA 2YSOA 1PKPA 2WZOA 2F4VE 2YTIA 4F9AB 4WX9A 4X62E 3VYXA 4R2AA 5AE3A 4JI7E 4B3RE 2E72A 2LCEA 1IQSA 4M30A 3F6GA 1I94E 2HJJA 2L2NA 2EMWA 4LF5E 1NEIA 2YTPA 3T1YE 3EPLA 2EN7A 1F2IG 3JU0A 5F3WA 2EPKX 4B3TE 3J7AG 1EH6A 2B7VA 4Q35B 2EQ1A 1RMDA 4ZYEA 2EOHA 4R2EA 5KL6A 4JI0E 2L92A 2KOUA 4X8WA 5FLXC 1QU6A 5DNYA 3ADIA 2YU5A 3H09A 3LMLA 2N3GA 2NUFA 2UUAE 5IXMB 2LUQA 3T1HE 3AUZA 4AQYE 1X47A 5AE1A 1X3CA 1WHNA 2ENHA 2KONA 4F9CB 4LF8E 2YTNA 4DUZE 1X48A 1T4OA 3ECRA 2EPUA 2LMZA 1PJTA 3KZZA 2ZM6E 1GZ6A 4BBYA 2EMYA 4DKKA 4ZYGA 2DLKA 4NXME 1DGCA 2EPLX 2UUBE 2FTXB 2Q8UA 2EQ3A 2EOYA 3MHSC 2EMIA 2YU8A 4WSPA 2NABA 1IBME 4BMJA 3RMPA 3HPSA 4WSGA 3M99B 4O24A 1PJQA 1T38A 4YY3E 1JK2A 2YRKA 4R2RA 2R76A 1FJGE 2ENAA 2LBSB 4HEIA 4JI5E 1KYQA 2GLIA 2K4VA 5AASA 2EMBA 1BBOA 1ZBQA 2CT1A 2L8TA 3DJWA 5LMNE 2FV4B 1JK1A 4F54A 2E5LE 1N33E 2GPIA 2RS6A 4LFCE 2LJHA 1TF6A 2UXCE 2V89A 4I8OA 3JTZA 3F6HA 2DRPA 2EPZA 5IWAE 2DB2A 5ADZA 4KZSA 1GTKA 2L2KB 2J7JA 2I9IA 2EM4A 4M9VC 5IV8B 2L6MA 1X5WA 5BR8E 2LO3A 3J81C 4DR3E 4BC7A 2G7HA 3OTOE 3DF6A 4JI1E 2EOXA 1HR0E 2M7QA 1G2FC 2EOOA 2YRHA 3VK6A 5A6BD 4HTGA 4LFAE 3EQ1A 4NZVA 3HPZA 2A25A 2NUGA 2WCC3 1EH7A 5T6JA 2EM6A 1ZR9A 2ELZA 2EM7A 2N8XA 3K6QA 2LUPB 2LV2A 4LFBE 1A1LA 4BHCA 2JR1A 4TUGA 1EKZA 3VYYA 3ADLA 2CSHA 3KWRA 3P1XA 2H36X 2MKDA 4ZYDA 4GKKE 2DLQA 4DR2E 2LTSA 4LF6E 1ZBTA 2HGHA 5LMUE 2RTXA 1A1IA 3J80C 2R1FA 2B9DA 2JVAA 1WRJA 1PDAA 3JAMC 2EM0A 4J8ZA 2CPNA 2L3JA 2N3HA 4GKJE 2LT7A 2EN8A 2E1MA 1X6EA 1YUIA 4FK5C 4L8NA 1LLMC 2EZ6A 2DIXA 2JPAA 2ELYA 2UU9E 5A6JA 4WXDA 2VF1A 5A2QC 2RQLA 2RSIA 3VHTB 2EMCA 2M9AA 2UUCE 5LLQA 2EM2A 4P78A 2BB8A 2WBUA 1Z1BA 1SR9A 2EMLA 3KZYA 4B3ME 3FIGA 4DV1E 2RSMA 2VRDA 3HXLA 2D9HA 2RS7A 4NXNE 1SFEA 2JY9A 1B69A 1EH8A 1DI2A 3HQ1A 1N32E 4DV3E 1WXRA 4R2DA 2EOIA 1T4LB 3MHHC 3J7Yp 1A1HA 4YHHE 4BCAA 4L5NC 1QNTA 3UK3C 1YFHA 2EPXA 1KJKA 2YTOA 2MDGA 4WXCA 1PJSA 1X6HA 3BIDA 4LF9E 1HNZE 2EL4A 4NHRA 5A6BA 2ODRC 2EM3A 2EMFA 1WJPA 4R2CA 4BHBA 2PRTA 4F9BB 4MLQA 2V88A 4MLVA 1AH5A 2JOBA 2M4IA 2YPNA 4R2QA 2V85A 2YTJA 1A1GA 3TQMA 2ENCA 2EMZA 2JYAA 2DGCA 2DSYA 2L3CA 4O43A 2EOZA 2HC5A 3QG5C 5IT9C 2EPCA 2FGGA 5A69A 1XMQE 2VE7C 2EN2A 3OMLA 1UHZA 2L33A 4Q28A 1XMOE 2B3TB 1XNQE 4X64E 4DV5E 2F8BA 1AAYA 2EMXA 2UXDE 5AE2A 1UBDC 1RC7A 4DMIA 2VQFE 1ZU1A 2EMKA 4JI3E 3C4BA 4LF7E 4JYAE 4DR6E 1BB8A 4LF4E 3THOB 2YRMA 3LLHA 1YSAC 4IJDA 1WHQA 4WYQB 3AV0A 3C4TA 2WBTA 3EPHA 4DV7E 5KL5A 1YUJA 2EM5A 2LTRA 4BC9A 2NUEA 1DQ3A 1A1FA 2MKNA 3BF2A 2EMHA 4DV6E 1GQEA 4DR1E 4GEQB 2EN1A 4P7DA 5KL4A 1STUA 1YZ9A 1ZAAC 4KHPE 1J5EE 2YWQA 3THNA 2VQEE 2RPCA 4X65E 4F6NA 2LRSA 1X49A 1RQ0A 4OX9E 1YYOA 4B3SE 2EQ0A 1BBGA 2LVHA 4RH8A 2MC5A 5KL3A 4N4RB 1FKAE 3C6KA 1J26A 2EOQA 4F2JC 2EJ4A 4BS9A 2YTEA 4DV4E 1YYWA 1NCSA 1X6FA 2UXBE 1IBKE 2EP3A 2V86A 4X9JA 5CFFE 1N34E 4X66E 2EOJA 2EPRA 4KWYA 1MGTA 2EL6A 2KHXA 4R8OA 5TSEA 2EN3A 2ODRD 2YSPA 1O0WA 3HTXA 5A6AA 5LL6R 1YPNA 2JXPA 3L00A 4WPYA 2YZTA 1A1JA 2YTFA 1IBLE 1P47A 4O5GA 3IWBA 2K7IA 4DV0E 4DUYE 4F6MA 4JI2E 2YTGA 3BGHA 2EWLA 4JV5E 3IWDA 2B7TA 4R2PA 2EPOA 2YTDA 4M2ZA 2CTDA 4TUIA 4OOGC 4RHBB 2EE8A 3EPJA 2ADRA 2MC6A 2YTQA 1HNXE 4R2SA 1T39A 2EL5A 3BBGA 1N36E 3ADGA 2EOFA 2LE2A 2M1SA 2IHR1 3C6MA 4LU9A 3ADJA 3ZOQB 4M0VA 4JI8E 4GZNC 1L4SA 3MSWA 5KL2A 2LJUA 2EPPA 4DR5E 2V8QB 1XNRE 2EOEA 2DMYA 2NA2A 2JOXA 1T4NA 2DMIA 5KL7A 2EN6A 1A1KA 2EMGA 1TF3A 2EN4A 4LTYA 2EOSA 1N3GA 3EPKA 4WFTA 1UILA 1UN6B 2JWOA 2JP9A 2EM8A 4K0KE 2L2MA 4IS1C 4R03A 1IMUA 2EORA 4ZYHA 3IWCA 1MEYC 1YYKA 4DR4E 2YT4A 2EOMA 2MDRA 1G2DC 4JI6E 5AC4A 2V87A 4O4KA 4DR7E 2EMAA 4DV2E 2EM9A 1TN9A 2BBGA 2I13A 2EPMX 2WBSA 5A6KA 2GHFA 2HHHE 2EPAA 1HNWE 4JI4E 2EPNA
chains in the Genus database with same CATH topology
4DV3E 5IWAE 2DB2A 2V83A 1WXRA 1PKPA 5ADZA 4KZSA 4BS9A 1T4LB 1N32E 2WZOA 2L2KB 2F4VE 4DV4E 4F9AB 1YYWA 4X62E 3J7Yp 3VYXA 2UXBE 5AE3A 4JI7E 1IBKE 2L6MA 4YHHE 5BR8E 4BCAA 3J81C 4DR3E 4B3RE 2V86A 4L5NC 1N34E 5CFFE 4X66E 4BC7A 2G7HA 4M30A 3F6GA 3OTOE 1DI2A 1I94E 2L2NA 3ADLA 2KHXA 3DF6A 4LF5E 4LF9E 4R8OA 3T1YE 1HNZE 4JI1E 2ODRD 3JU0A 1HR0E 5F3WA 2M7QA 1O0WA 2ODRC 4B3TE 3HTXA 3J7AG 2B7VA 5LL6R 3VK6A 4WPYA 2YZTA 4LFAE 4JI0E 1IBLE 4F9BB 2L92A 2KOUA 2V88A 2JOBA 4X8WA 2M4IA 5FLXC 3HPZA 1QU6A 3IWBA 2V85A 5DNYA 4DUYE 4DV0E 2NUGA 4JI2E 3ADIA 2EWLA 5T6JA 3LMLA 3H09A 4JV5E 3IWDA 2B7TA 2N3GA 2NUFA 2DSYA 2UUAE 2L3CA 2LUPB 2LUQA 3K6QA 3T1HE 4LFBE 4M2ZA 4TUIA 3AUZA 4OOGC 2JR1A 5IT9C 2FGGA 1XMQE 4TUGA 2MC6A 3VYYA 1X47A 2VE7C 5AE1A 4AQYE 1EKZA 1WHNA 3OMLA 3KWRA 1HNXE 2KONA 1J26A 1UHZA 2H36X 3P1XA 4GKKE 4F9CB 4DR2E 1N36E 3ADGA 4LF8E 2L33A 2LTSA 4LF6E 1ZBTA 2LE2A 4DUZE 4Q28A 2M1SA 1X48A 2IHR1 2B3TB 1XMOE 4X64E 1T4OA 2F8BA 4LU9A 5LMUE 4DV5E 1XNQE 3ADJA 2RTXA 2UXDE 3ZOQB 4M0VA 5AE2A 4JI8E 2LMZA 3J80C 3MSWA 1RC7A 2B9DA 2JVAA 4DMIA 3JAMC 2ZM6E 1GZ6A 4BBYA 2VQFE 2V8QB 4DKKA 4DR5E 4JI3E 1XNRE 3C4BA 4NXME 4J8ZA 2DMYA 2NA2A 2CPNA 2L3JA 2UUBE 2FTXB 1T4NA 2JOXA 2N3HA 4LF7E 4JYAE 4DR6E 4GKJE 4LF4E 2E1MA 3LLHA 4WSPA 1WHQA 4L8NA 4WYQB 1IBME 3AV0A 3C4TA 4BMJA 4LTYA 2EZ6A 2DIXA 4DV7E 1FKAE 4JI4E 2LTRA 4BC9A 3RMPA 2NUEA 4WFTA 1DQ3A 3HPSA 1UILA 2UU9E 2JWOA 4YY3E 4DV6E 1GQEA 2L2MA 4DR1E 4K0KE 4GEQB 2VF1A 4R03A 4P7DA 1FJGE 1STUA 5A2QC 1YZ9A 2LBSB 4JI5E 4KHPE 1J5EE 3IWCA 2UUCE 1YYKA 4DR4E 2K4VA 5AASA 2VQEE 2YT4A 2MDRA 1ZBQA 2L8TA 3DJWA 4JI6E 4P78A 5LMNE 2FV4B 2V87A 4X65E 2LRSA 4F54A 4DR7E 1X49A 2E5LE 1RQ0A 1SR9A 4DV2E 1N33E 4OX9E 4B3ME 3FIGA 1YYOA 4DV1E 4B3SE 2RSMA 3HXLA 2RS6A 2HHHE 4LFCE 2LJHA 1HNWE 2RS7A 4NXNE 2MC5A 2JY9A 2UXCE 2V89A 4I8OA 3JTZA 3HQ1A 3F6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV3 E;  5IWA E;  2DB2 A;  1PKP A;  1T4L B;  2F4V E;  2L2K B;  4DV4 E;  1YYW A;  4X62 E;  3J7Y p;  3VYX A;  2UXB E;  4JI7 E;  1IBK E;  4YHH E;  4B3R E;  5BR8 E;  4DR3 E;  1N34 E;  5CFF E;  4X66 E;  4M30 A;  3OTO E;  1I94 E;  2L2N A;  2KHX A;  4LF5 E;  4LF9 E;  1HNZ E;  3T1Y E;  4JI1 E;  1HR0 E;  1O0W A;  3HTX A;  4B3T E;  2B7V A;  4LFA E;  4JI0 E;  1IBL E;  4X8W A;  1QU6 A;  4DV0 E;  4DUY E;  2NUG A;  3ADI A;  4JI2 E;  4JV5 E;  2B7T A;  2N3G A;  2NUF A;  2UUA E;  2L3C A;  2LUP B;  2LUQ A;  3T1H E;  4LFB E;  4M2Z A;  4OOG C;  1XMQ E;  4AQY E;  3VYY A;  1X47 A;  1EKZ A;  1HNX E;  3ADL A;  1WHN A;  1J26 A;  1UHZ A;  3P1X A;  4GKK E;  4DR2 E;  1N36 E;  3ADG A;  4LF8 E;  2L33 A;  2LTS A;  4LF6 E;  1ZBT A;  4DUZ E;  1XMO E;  1X48 A;  2IHR 1;  2B3T B;  1XNQ E;  4X64 E;  1T4O A;  5LMU E;  4DV5 E;  1DI2 A;  3ADJ A;  2RTX A;  2UXD E;  4JI8 E;  1RC7 A;  2JVA A;  2ZM6 E;  4DR5 E;  2VQF E;  4JI3 E;  4DKK A;  1XNR E;  3C4B A;  4NXM E;  2DMY A;  2NA2 A;  2CPN A;  2L3J A;  2UUB E;  4LF7 E;  1T4N A;  2N3H A;  4JYA E;  4GKJ E;  4DR6 E;  4LF4 E;  3LLH A;  1WHQ A;  4WYQ B;  1IBM E;  3C4T A;  2EZ6 A;  2DIX A;  4DV7 E;  2LTR A;  2NUE A;  4WFT A;  1UIL A;  2UU9 E;  4YY3 E;  4DV6 E;  1GQE A;  2L2M A;  4DR1 E;  4K0K E;  1FJG E;  1STU A;  1YZ9 A;  2LBS B;  4JI5 E;  4KHP E;  1J5E E;  2UUC E;  1YYK A;  4DR4 E;  2VQE E;  2YT4 A;  2MDR A;  4JI6 E;  5LMN E;  4X65 E;  2LRS A;  4DR7 E;  1X49 A;  2E5L E;  1RQ0 A;  4DV2 E;  1N33 E;  4OX9 E;  4B3M E;  1YYO A;  4DV1 E;  4B3S E;  2RSM A;  2RS6 A;  2HHH E;  4LFC E;  2LJH A;  1HNW E;  2RS7 A;  4NXN E;  2JY9 A;  2UXC E;  4JI4 E;  1FKA E;  1N32 E; 
#chains in the Genus database with same CATH topology
 5AC5 A;  2V83 A;  1IQO A;  2YSO A;  1PKP A;  2WZO A;  2F4V E;  2YTI A;  4F9A B;  4WX9 A;  4X62 E;  3VYX A;  4R2A A;  5AE3 A;  4JI7 E;  4B3R E;  2E72 A;  2LCE A;  1IQS A;  4M30 A;  3F6G A;  1I94 E;  2HJJ A;  2L2N A;  2EMW A;  4LF5 E;  1NEI A;  2YTP A;  3T1Y E;  3EPL A;  2EN7 A;  1F2I G;  3JU0 A;  5F3W A;  2EPK X;  4B3T E;  3J7A G;  1EH6 A;  2B7V A;  4Q35 B;  2EQ1 A;  1RMD A;  4ZYE A;  2EOH A;  4R2E A;  5KL6 A;  4JI0 E;  2L92 A;  2KOU A;  4X8W A;  5FLX C;  1QU6 A;  5DNY A;  3ADI A;  2YU5 A;  3H09 A;  3LML A;  2N3G A;  2NUF A;  2UUA E;  5IXM B;  2LUQ A;  3T1H E;  3AUZ A;  4AQY E;  1X47 A;  5AE1 A;  1X3C A;  1WHN A;  2ENH A;  2KON A;  4F9C B;  4LF8 E;  2YTN A;  4DUZ E;  1X48 A;  1T4O A;  3ECR A;  2EPU A;  2LMZ A;  1PJT A;  3KZZ A;  2ZM6 E;  1GZ6 A;  4BBY A;  2EMY A;  4DKK A;  4ZYG A;  2DLK A;  4NXM E;  1DGC A;  2EPL X;  2UUB E;  2FTX B;  2Q8U A;  2EQ3 A;  2EOY A;  3MHS C;  2EMI A;  2YU8 A;  4WSP A;  2NAB A;  1IBM E;  4BMJ A;  3RMP A;  3HPS A;  4WSG A;  3M99 B;  4O24 A;  1PJQ A;  1T38 A;  4YY3 E;  1JK2 A;  2YRK A;  4R2R A;  2R76 A;  1FJG E;  2ENA A;  2LBS B;  4HEI A;  4JI5 E;  1KYQ A;  2GLI A;  2K4V A;  5AAS A;  2EMB A;  1BBO A;  1ZBQ A;  2CT1 A;  2L8T A;  3DJW A;  5LMN E;  2FV4 B;  1JK1 A;  4F54 A;  2E5L E;  1N33 E;  2GPI A;  2RS6 A;  4LFC E;  2LJH A;  1TF6 A;  2UXC E;  2V89 A;  4I8O A;  3JTZ A;  3F6H A;  2DRP A;  2EPZ A;  5IWA E;  2DB2 A;  5ADZ A;  4KZS A;  1GTK A;  2L2K B;  2J7J A;  2I9I A;  2EM4 A;  4M9V C;  5IV8 B;  2L6M A;  1X5W A;  5BR8 E;  2LO3 A;  3J81 C;  4DR3 E;  4BC7 A;  2G7H A;  3OTO E;  3DF6 A;  4JI1 E;  2EOX A;  1HR0 E;  2M7Q A;  1G2F C;  2EOO A;  2YRH A;  3VK6 A;  5A6B D;  4HTG A;  4LFA E;  3EQ1 A;  4NZV A;  3HPZ A;  2A25 A;  2NUG A;  2WCC 3;  1EH7 A;  5T6J A;  2EM6 A;  1ZR9 A;  2ELZ A;  2EM7 A;  2N8X A;  3K6Q A;  2LUP B;  2LV2 A;  4LFB E;  1A1L A;  4BHC A;  2JR1 A;  4TUG A;  1EKZ A;  3VYY A;  3ADL A;  2CSH A;  3KWR A;  3P1X A;  2H36 X;  2MKD A;  4ZYD A;  4GKK E;  2DLQ A;  4DR2 E;  2LTS A;  4LF6 E;  1ZBT A;  2HGH A;  5LMU E;  2RTX A;  1A1I A;  3J80 C;  2R1F A;  2B9D A;  2JVA A;  1WRJ A;  1PDA A;  3JAM C;  2EM0 A;  4J8Z A;  2CPN A;  2L3J A;  2N3H A;  4GKJ E;  2LT7 A;  2EN8 A;  2E1M A;  1X6E A;  1YUI A;  4FK5 C;  4L8N A;  1LLM C;  2EZ6 A;  2DIX A;  2JPA A;  2ELY A;  2UU9 E;  5A6J A;  4WXD A;  2VF1 A;  5A2Q C;  2RQL A;  2RSI A;  3VHT B;  2EMC A;  2M9A A;  2UUC E;  5LLQ A;  2EM2 A;  4P78 A;  2BB8 A;  2WBU A;  1Z1B A;  1SR9 A;  2EML A;  3KZY A;  4B3M E;  3FIG A;  4DV1 E;  2RSM A;  2VRD A;  3HXL A;  2D9H A;  2RS7 A;  4NXN E;  1SFE A;  2JY9 A;  1B69 A;  1EH8 A;  1DI2 A;  3HQ1 A;  1N32 E;  4DV3 E;  1WXR A;  4R2D A;  2EOI A;  1T4L B;  3MHH C;  3J7Y p;  1A1H A;  4YHH E;  4BCA A;  4L5N C;  1QNT A;  3UK3 C;  1YFH A;  2EPX A;  1KJK A;  2YTO A;  2MDG A;  4WXC A;  1PJS A;  1X6H A;  3BID A;  4LF9 E;  1HNZ E;  2EL4 A;  4NHR A;  5A6B A;  2ODR C;  2EM3 A;  2EMF A;  1WJP A;  4R2C A;  4BHB A;  2PRT A;  4F9B B;  4MLQ A;  2V88 A;  4MLV A;  1AH5 A;  2JOB A;  2M4I A;  2YPN A;  4R2Q A;  2V85 A;  2YTJ A;  1A1G A;  3TQM A;  2ENC A;  2EMZ A;  2JYA A;  2DGC A;  2DSY A;  2L3C A;  4O43 A;  2EOZ A;  2HC5 A;  3QG5 C;  5IT9 C;  2EPC A;  2FGG A;  5A69 A;  1XMQ E;  2VE7 C;  2EN2 A;  3OML A;  1UHZ A;  2L33 A;  4Q28 A;  1XMO E;  2B3T B;  1XNQ E;  4X64 E;  4DV5 E;  2F8B A;  1AAY A;  2EMX A;  2UXD E;  5AE2 A;  1UBD C;  1RC7 A;  4DMI A;  2VQF E;  1ZU1 A;  2EMK A;  4JI3 E;  3C4B A;  4LF7 E;  4JYA E;  4DR6 E;  1BB8 A;  4LF4 E;  3THO B;  2YRM A;  3LLH A;  1YSA C;  4IJD A;  1WHQ A;  4WYQ B;  3AV0 A;  3C4T A;  2WBT A;  3EPH A;  4DV7 E;  5KL5 A;  1YUJ A;  2EM5 A;  2LTR A;  4BC9 A;  2NUE A;  1DQ3 A;  1A1F A;  2MKN A;  3BF2 A;  2EMH A;  4DV6 E;  1GQE A;  4DR1 E;  4GEQ B;  2EN1 A;  4P7D A;  5KL4 A;  1STU A;  1YZ9 A;  1ZAA C;  4KHP E;  1J5E E;  2YWQ A;  3THN A;  2VQE E;  2RPC A;  4X65 E;  4F6N A;  2LRS A;  1X49 A;  1RQ0 A;  4OX9 E;  1YYO A;  4B3S E;  2EQ0 A;  1BBG A;  2LVH A;  4RH8 A;  2MC5 A;  5KL3 A;  4N4R B;  1FKA E;  3C6K A;  1J26 A;  2EOQ A;  4F2J C;  2EJ4 A;  4BS9 A;  2YTE A;  4DV4 E;  1YYW A;  1NCS A;  1X6F A;  2UXB E;  1IBK E;  2EP3 A;  2V86 A;  4X9J A;  5CFF E;  1N34 E;  4X66 E;  2EOJ A;  2EPR A;  4KWY A;  1MGT A;  2EL6 A;  2KHX A;  4R8O A;  5TSE A;  2EN3 A;  2ODR D;  2YSP A;  1O0W A;  3HTX A;  5A6A A;  5LL6 R;  1YPN A;  2JXP A;  3L00 A;  4WPY A;  2YZT A;  1A1J A;  2YTF A;  1IBL E;  1P47 A;  4O5G A;  3IWB A;  2K7I A;  4DV0 E;  4DUY E;  4F6M A;  4JI2 E;  2YTG A;  3BGH A;  2EWL A;  4JV5 E;  3IWD A;  2B7T A;  4R2P A;  2EPO A;  2YTD A;  4M2Z A;  2CTD A;  4TUI A;  4OOG C;  4RHB B;  2EE8 A;  3EPJ A;  2ADR A;  2MC6 A;  2YTQ A;  1HNX E;  4R2S A;  1T39 A;  2EL5 A;  3BBG A;  1N36 E;  3ADG A;  2EOF A;  2LE2 A;  2M1S A;  2IHR 1;  3C6M A;  4LU9 A;  3ADJ A;  3ZOQ B;  4M0V A;  4JI8 E;  4GZN C;  1L4S A;  3MSW A;  5KL2 A;  2LJU A;  2EPP A;  4DR5 E;  2V8Q B;  1XNR E;  2EOE A;  2DMY A;  2NA2 A;  2JOX A;  1T4N A;  2DMI A;  5KL7 A;  2EN6 A;  1A1K A;  2EMG A;  1TF3 A;  2EN4 A;  4LTY A;  2EOS A;  1N3G A;  3EPK A;  4WFT A;  1UIL A;  1UN6 B;  2JWO A;  2JP9 A;  2EM8 A;  4K0K E;  2L2M A;  4IS1 C;  4R03 A;  1IMU A;  2EOR A;  4ZYH A;  3IWC A;  1MEY C;  1YYK A;  4DR4 E;  2YT4 A;  2EOM A;  2MDR A;  1G2D C;  4JI6 E;  5AC4 A;  2V87 A;  4O4K A;  4DR7 E;  2EMA A;  4DV2 E;  2EM9 A;  1TN9 A;  2BBG A;  2I13 A;  2EPM X;  2WBS A;  5A6K A;  2GHF A;  2HHH E;  2EPA A;  1HNW E;  4JI4 E;  2EPN A; 
#chains in the Genus database with same CATH homology
 4DV3 E;  5IWA E;  2DB2 A;  2V83 A;  1WXR A;  1PKP A;  5ADZ A;  4KZS A;  4BS9 A;  1T4L B;  1N32 E;  2WZO A;  2L2K B;  2F4V E;  4DV4 E;  4F9A B;  1YYW A;  4X62 E;  3J7Y p;  3VYX A;  2UXB E;  5AE3 A;  4JI7 E;  1IBK E;  2L6M A;  4YHH E;  5BR8 E;  4BCA A;  3J81 C;  4DR3 E;  4B3R E;  2V86 A;  4L5N C;  1N34 E;  5CFF E;  4X66 E;  4BC7 A;  2G7H A;  4M30 A;  3F6G A;  3OTO E;  1DI2 A;  1I94 E;  2L2N A;  3ADL A;  2KHX A;  3DF6 A;  4LF5 E;  4LF9 E;  4R8O A;  3T1Y E;  1HNZ E;  4JI1 E;  2ODR D;  3JU0 A;  1HR0 E;  5F3W A;  2M7Q A;  1O0W A;  2ODR C;  4B3T E;  3HTX A;  3J7A G;  2B7V A;  5LL6 R;  3VK6 A;  4WPY A;  2YZT A;  4LFA E;  4JI0 E;  1IBL E;  4F9B B;  2L92 A;  2KOU A;  2V88 A;  2JOB A;  4X8W A;  2M4I A;  5FLX C;  3HPZ A;  1QU6 A;  3IWB A;  2V85 A;  5DNY A;  4DUY E;  4DV0 E;  2NUG A;  4JI2 E;  3ADI A;  2EWL A;  5T6J A;  3LML A;  3H09 A;  4JV5 E;  3IWD A;  2B7T A;  2N3G A;  2NUF A;  2DSY A;  2UUA E;  2L3C A;  2LUP B;  2LUQ A;  3K6Q A;  3T1H E;  4LFB E;  4M2Z A;  4TUI A;  3AUZ A;  4OOG C;  2JR1 A;  5IT9 C;  2FGG A;  1XMQ E;  4TUG A;  2MC6 A;  3VYY A;  1X47 A;  2VE7 C;  5AE1 A;  4AQY E;  1EKZ A;  1WHN A;  3OML A;  3KWR A;  1HNX E;  2KON A;  1J26 A;  1UHZ A;  2H36 X;  3P1X A;  4GKK E;  4F9C B;  4DR2 E;  1N36 E;  3ADG A;  4LF8 E;  2L33 A;  2LTS A;  4LF6 E;  1ZBT A;  2LE2 A;  4DUZ E;  4Q28 A;  2M1S A;  1X48 A;  2IHR 1;  2B3T B;  1XMO E;  4X64 E;  1T4O A;  2F8B A;  4LU9 A;  5LMU E;  4DV5 E;  1XNQ E;  3ADJ A;  2RTX A;  2UXD E;  3ZOQ B;  4M0V A;  5AE2 A;  4JI8 E;  2LMZ A;  3J80 C;  3MSW A;  1RC7 A;  2B9D A;  2JVA A;  4DMI A;  3JAM C;  2ZM6 E;  1GZ6 A;  4BBY A;  2VQF E;  2V8Q B;  4DKK A;  4DR5 E;  4JI3 E;  1XNR E;  3C4B A;  4NXM E;  4J8Z A;  2DMY A;  2NA2 A;  2CPN A;  2L3J A;  2UUB E;  2FTX B;  1T4N A;  2JOX A;  2N3H A;  4LF7 E;  4JYA E;  4DR6 E;  4GKJ E;  4LF4 E;  2E1M A;  3LLH A;  4WSP A;  1WHQ A;  4L8N A;  4WYQ B;  1IBM E;  3AV0 A;  3C4T A;  4BMJ A;  4LTY A;  2EZ6 A;  2DIX A;  4DV7 E;  1FKA E;  4JI4 E;  2LTR A;  4BC9 A;  3RMP A;  2NUE A;  4WFT A;  1DQ3 A;  3HPS A;  1UIL A;  2UU9 E;  2JWO A;  4YY3 E;  4DV6 E;  1GQE A;  2L2M A;  4DR1 E;  4K0K E;  4GEQ B;  2VF1 A;  4R03 A;  4P7D A;  1FJG E;  1STU A;  5A2Q C;  1YZ9 A;  2LBS B;  4JI5 E;  4KHP E;  1J5E E;  3IWC A;  2UUC E;  1YYK A;  4DR4 E;  2K4V A;  5AAS A;  2VQE E;  2YT4 A;  2MDR A;  1ZBQ A;  2L8T A;  3DJW A;  4JI6 E;  4P78 A;  5LMN E;  2FV4 B;  2V87 A;  4X65 E;  2LRS A;  4F54 A;  4DR7 E;  1X49 A;  2E5L E;  1RQ0 A;  1SR9 A;  4DV2 E;  1N33 E;  4OX9 E;  4B3M E;  3FIG A;  1YYO A;  4DV1 E;  4B3S E;  2RSM A;  3HXL A;  2RS6 A;  2HHH E;  4LFC E;  2LJH A;  1HNW E;  2RS7 A;  4NXN E;  2MC5 A;  2JY9 A;  2UXC E;  2V89 A;  4I8O A;  3JTZ A;  3HQ1 A;  3F6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...