3BIDA

Crystal structure of the nmb1088 protein from neisseria meningitidis. northeast structural genomics consortium target mr91
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
58
structure length
58
Chain Sequence
MYFEIYKDAKGEYRWRLKAANHEIIAQGEGYTSKQNCQHAVDLLKSTTAATPVKEVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords UPF0339 protein NMB1088
publication title Crystal structure of the NMB1088 protein from Neisseria meningitidis.
rcsb
source organism Neisseria meningitidis mc58
total genus 9
structure length 58
sequence length 58
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07411 DUF1508 Domain of unknown function (DUF1508)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.160 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain YegP-like 3bidA01
3BIDA 2K7IA
chains in the Genus database with same CATH superfamily
2WBUA 1WHQA 3THNA 1IQOA 2G7HA 3M99B 2EOOA 5BR8E 2EMBA 3OMLA 2LBSB 2YTEA 4P7DA 2JYAA 4X65E 2ODRC 4JI2E 1ZAAC 2EMKA 2M7QA 2ADRA 2M4IA 4KWYA 3KZYA 2JXPA 1STUA 4DV0E 4JI6E 2VRDA 4YHHE 3TQMA 4GEQB 3UK3C 4R2CA 2V85A 1T39A 4WFTA 1B69A 2VQFE 3MSWA 2JOBA 5A6BA 4B3TE 4M9VC 2LUPB 2B9DA 1HR0E 2EPKX 2EL5A 4MLQA 1ZBQA 4F54A 1IBKE 4KHPE 4DUZE 4BMJA 5AC4A 1BBGA 2EM4A 2EMLA 2EQ1A 4ZYEA 2V88A 3ADIA 2K4VA 2E1MA 2ODRD 2B7TA 2EN2A 4O4KA 4NHRA 2EPOA 1IBLE 2EP3A 2NABA 3VK6A 2DLKA 4B3RE 2LRSA 2HJJA 2YSOA 1PDAA 2L33A 2RTXA 1ZR9A 3C6KA 1RMDA 1QNTA 3HXLA 2EQ0A 2JOXA 2RPCA 1A1JA 1J5EE 2F8BA 2D9HA 4GKJE 2L2KB 2EOJA 3ZOQB 1TF6A 3HTXA 1YYOA 2UUAE 3MHSC 3ADLA 2YZTA 3J7Yp 4JI4E 4O43A 2MDRA 2DLQA 1I94E 4LF6E 5LLQA 4DV2E 2YTIA 2YTPA 1XMQE 5A69A 1X6FA 1DQ3A 4BC9A 4LF9E 2EN4A 2NUEA 4LFCE 2I9IA 4O24A 4NXME 2EM8A 2YTFA 2KHXA 4BHBA 2ENAA 2V83A 3LMLA 2VE7C 1JK1A 2L6MA 2DGCA 3DJWA 2EL6A 2WBSA 1HNWE 2MC6A 2HC5A 5IXMB 2ELYA 5KL7A 2EN7A 2RSIA 3P1XA 1NEIA 2LE2A 2E5LE 4DMIA 3AUZA 1EH7A 4KZSA 5A2QC 2JY9A 5DNYA 2EMXA 1X47A 1XMOE 1HNXE 1A1FA 2M9AA 4O5GA 2NUGA 2L3CA 5AASA 2EM0A 2WBTA 2EWLA 1GTKA 2EM3A 4R2PA 1Z1BA 2RSMA 3H09A 3KWRA 2LT7A 2CPNA 2FGGA 1WXRA 1YPNA 5LMNE 3K6QA 1N36E 3J81C 2L8TA 1X6HA 2ELZA 2JP9A 2EM6A 2RS7A 3F6HA 4HEIA 4F9BB 4DV3E 3C6MA 2YRMA 4ZYGA 4AQYE 2EMYA 4R2EA 3THOB 1TN9A 3HQ1A 1A1GA 2NUFA 3EPLA 4LFBE 2YSPA 5IWAE 5T6JA 5TSEA 1MEYC 2EMHA 4IJDA 4DR1E 4X62E 2RS6A 2EMAA 4M0VA 1F2IG 3IWCA 5ADZA 2HGHA 2YRKA 1DGCA 4OX9E 1ZBTA 1T4NA 4RHBB 1N33E 1X3CA 5IV8B 3KZZA 1UILA 4LF8E 3JAMC 2F4VE 4DV1E 1X6EA 2BBGA 1YFHA 5LL6R 1N34E 2UXCE 4DR2E 4TUGA 1X5WA 3ADGA 4DV5E 4DR7E 2L2NA 1AH5A 4WXDA 2KONA 2PRTA 5AC5A 2VQEE 2E72A 3ECRA 4F9CB 2LJUA 4OOGC 1P47A 2VF1A 1J26A 2EPUA 2EOEA 4NXNE 1UHZA 4M30A 5AE1A 5A6KA 3EPKA 4R2QA 2NA2A 1DI2A 2WZOA 2EQ3A 2EPRA 1PJSA 4I8OA 4F2JC 4LF4E 2EE8A 4LF5E 2EPXA 4B3SE 4JI0E 2EOIA 2EMWA 1BBOA 4DR5E 4GKKE 2EOHA 2UXBE 4WSPA 1A1IA 1RC7A 1WRJA 2DMYA 2UUBE 2EN6A 2YT4A 4WX9A 2YTDA 2KOUA 5AE2A 2EPZA 1XNRE 3RMPA 2FV4B 4R2AA 3BGHA 2YU8A 1T4LB 3BIDA 5A6JA 2EMFA 1IMUA 2CT1A 4BHCA 1KJKA 5KL3A 1GQEA 2B7VA 3ADJA 2EL4A 1X48A 4DV4E 2EOMA 1QU6A 5IT9C 1N32E 3EQ1A 4JV5E 4LU9A 2EPNA 4WPYA 1FJGE 4YY3E 2RQLA 1BB8A 2EPCA 2YPNA 2EPAA 2EPLX 2ZM6E 2EJ4A 4Q35B 4DKKA 2IHR1 2DIXA 1YYKA 4WXCA 1XNQE 4NZVA 1YSAC 4WYQB 4X9JA 2B3TB 2R76A 2YTOA 2EORA 4BC7A 5A6BD 3VYYA 2LTSA 2EMIA 3BBGA 1YUJA 2N3GA 3QG5C 3JTZA 2I13A 1A1LA 4K0KE 5KL2A 2V87A 2UUCE 3HPZA 1ZU1A 2EMGA 1JK2A 1L4SA 2EOFA 2EN1A 3L00A 2JPAA 2H36X 1SFEA 4R2SA 1G2DC 1UN6B 2EOYA 1YZ9A 2EMCA 1O0WA 4GZNC 3C4TA 2DSYA 2V8QB 2CSHA 2YTNA 1G2FC 5CFFE 5A6AA 2L2MA 4BBYA 1YUIA 3HPSA 2CTDA 4JI1E 3VHTB 4DV7E 5KL4A 2J7JA 4RH8A 2MKNA 3F6GA 2FTXB 2EPMX 4WSGA 3AV0A 2YTQA 1T4OA 4JI7E 5FLXC 2GLIA 1MGTA 2M1SA 2MC5A 2LUQA 4R8OA 4F6NA 2DMIA 5F3WA 1WHNA 2EMZA 3MHHC 4TUIA 2YRHA 2LO3A 4X66E 2A25A 4LTYA 1EKZA 2EN8A 3JU0A 4DR6E 4R2RA 2HHHE 2Q8UA 1TF3A 2JWOA 1WJPA 4L5NC 2EM7A 1LLMC 2EOQA 2UU9E 2MDGA 4JI3E 4JI8E 4M2ZA 1A1HA 2R1FA 1SR9A 4Q28A 2DRPA 2JR1A 1IQSA 2K7IA 2UXDE 4J8ZA 4ZYDA 1UBDC 1PJTA 4F9AB 2GPIA 4X8WA 2EM2A 2EPPA 3IWDA 4FK5C 2LJHA 4JYAE 5AE3A 1NCSA 2V89A 2YTJA 1T38A 5LMUE 4DUYE 1N3GA 3J80C 4LFAE 4L8NA 1RQ0A 3T1YE 3DF6A 5KL6A 2EOZA 2N8XA 3FIGA 5KL5A 2LTRA 1X49A 4DV6E 4X64E 2LCEA 1KYQA 2ENHA 1IBME 1YYWA 2MKDA 2YWQA 4R2DA 2EM9A 4DR4E 2N3HA 2YU5A 2V86A 4JI5E 2JVAA 2L92A 3EPJA 1A1KA 2EN3A 4DR3E 3VYXA 2LV2A 2YTGA 4ZYHA 2ENCA 3IWBA 4R03A 1EH8A 4IS1C 3BF2A 1PJQA 1PKPA 2L3JA 2EM5A 3T1HE 4N4RB 2EZ6A 1AAYA 2LMZA 2LVHA 4P78A 3J7AG 2WCC3 4F6MA 4BS9A 4B3ME 2EOXA 1GZ6A 2BB8A 3LLHA 4HTGA 2EOSA 4LF7E 1FKAE 1EH6A 4MLVA 4BCAA 2DB2A 2GHFA 1HNZE 3C4BA 3OTOE 3EPHA
chains in the Genus database with same CATH topology
3BIDA 2K7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BID A;  2K7I A; 
#chains in the Genus database with same CATH topology
 2WBU A;  1WHQ A;  3THN A;  1IQO A;  2G7H A;  3M99 B;  2EOO A;  5BR8 E;  2EMB A;  3OML A;  2LBS B;  2YTE A;  4P7D A;  2JYA A;  4X65 E;  2ODR C;  4JI2 E;  1ZAA C;  2EMK A;  2M7Q A;  2ADR A;  2M4I A;  4KWY A;  3KZY A;  2JXP A;  1STU A;  4DV0 E;  4JI6 E;  2VRD A;  4YHH E;  3TQM A;  4GEQ B;  3UK3 C;  4R2C A;  2V85 A;  1T39 A;  4WFT A;  1B69 A;  2VQF E;  3MSW A;  2JOB A;  5A6B A;  4B3T E;  4M9V C;  2LUP B;  2B9D A;  1HR0 E;  2EPK X;  2EL5 A;  4MLQ A;  1ZBQ A;  4F54 A;  1IBK E;  4KHP E;  4DUZ E;  4BMJ A;  5AC4 A;  1BBG A;  2EM4 A;  2EML A;  2EQ1 A;  4ZYE A;  2V88 A;  3ADI A;  2K4V A;  2E1M A;  2ODR D;  2B7T A;  2EN2 A;  4O4K A;  4NHR A;  2EPO A;  1IBL E;  2EP3 A;  2NAB A;  3VK6 A;  2DLK A;  4B3R E;  2LRS A;  2HJJ A;  2YSO A;  1PDA A;  2L33 A;  2RTX A;  1ZR9 A;  3C6K A;  1RMD A;  1QNT A;  3HXL A;  2EQ0 A;  2JOX A;  2RPC A;  1A1J A;  1J5E E;  2F8B A;  2D9H A;  4GKJ E;  2L2K B;  2EOJ A;  3ZOQ B;  1TF6 A;  3HTX A;  1YYO A;  2UUA E;  3MHS C;  3ADL A;  2YZT A;  3J7Y p;  4JI4 E;  4O43 A;  2MDR A;  2DLQ A;  1I94 E;  4LF6 E;  5LLQ A;  4DV2 E;  2YTI A;  2YTP A;  1XMQ E;  5A69 A;  1X6F A;  1DQ3 A;  4BC9 A;  4LF9 E;  2EN4 A;  2NUE A;  4LFC E;  2I9I A;  4O24 A;  4NXM E;  2EM8 A;  2YTF A;  2KHX A;  4BHB A;  2ENA A;  2V83 A;  3LML A;  2VE7 C;  1JK1 A;  2L6M A;  2DGC A;  3DJW A;  2EL6 A;  2WBS A;  1HNW E;  2MC6 A;  2HC5 A;  5IXM B;  2ELY A;  5KL7 A;  2EN7 A;  2RSI A;  3P1X A;  1NEI A;  2LE2 A;  2E5L E;  4DMI A;  3AUZ A;  1EH7 A;  4KZS A;  5A2Q C;  2JY9 A;  5DNY A;  2EMX A;  1X47 A;  1XMO E;  1HNX E;  1A1F A;  2M9A A;  4O5G A;  2NUG A;  2L3C A;  5AAS A;  2EM0 A;  2WBT A;  2EWL A;  1GTK A;  2EM3 A;  4R2P A;  1Z1B A;  2RSM A;  3H09 A;  3KWR A;  2LT7 A;  2CPN A;  2FGG A;  1WXR A;  1YPN A;  5LMN E;  3K6Q A;  1N36 E;  3J81 C;  2L8T A;  1X6H A;  2ELZ A;  2JP9 A;  2EM6 A;  2RS7 A;  3F6H A;  4HEI A;  4F9B B;  4DV3 E;  3C6M A;  2YRM A;  4ZYG A;  4AQY E;  2EMY A;  4R2E A;  3THO B;  1TN9 A;  3HQ1 A;  1A1G A;  2NUF A;  3EPL A;  4LFB E;  2YSP A;  5IWA E;  5T6J A;  5TSE A;  1MEY C;  2EMH A;  4IJD A;  4DR1 E;  4X62 E;  2RS6 A;  2EMA A;  4M0V A;  1F2I G;  3IWC A;  5ADZ A;  2HGH A;  2YRK A;  1DGC A;  4OX9 E;  1ZBT A;  1T4N A;  4RHB B;  1N33 E;  1X3C A;  5IV8 B;  3KZZ A;  1UIL A;  4LF8 E;  3JAM C;  2F4V E;  4DV1 E;  1X6E A;  2BBG A;  1YFH A;  5LL6 R;  1N34 E;  2UXC E;  4DR2 E;  4TUG A;  1X5W A;  3ADG A;  4DV5 E;  4DR7 E;  2L2N A;  1AH5 A;  4WXD A;  2KON A;  2PRT A;  5AC5 A;  2VQE E;  2E72 A;  3ECR A;  4F9C B;  2LJU A;  4OOG C;  1P47 A;  2VF1 A;  1J26 A;  2EPU A;  2EOE A;  4NXN E;  1UHZ A;  4M30 A;  5AE1 A;  5A6K A;  3EPK A;  4R2Q A;  2NA2 A;  1DI2 A;  2WZO A;  2EQ3 A;  2EPR A;  1PJS A;  4I8O A;  4F2J C;  4LF4 E;  2EE8 A;  4LF5 E;  2EPX A;  4B3S E;  4JI0 E;  2EOI A;  2EMW A;  1BBO A;  4DR5 E;  4GKK E;  2EOH A;  2UXB E;  4WSP A;  1A1I A;  1RC7 A;  1WRJ A;  2DMY A;  2UUB E;  2EN6 A;  2YT4 A;  4WX9 A;  2YTD A;  2KOU A;  5AE2 A;  2EPZ A;  1XNR E;  3RMP A;  2FV4 B;  4R2A A;  3BGH A;  2YU8 A;  1T4L B;  3BID A;  5A6J A;  2EMF A;  1IMU A;  2CT1 A;  4BHC A;  1KJK A;  5KL3 A;  1GQE A;  2B7V A;  3ADJ A;  2EL4 A;  1X48 A;  4DV4 E;  2EOM A;  1QU6 A;  5IT9 C;  1N32 E;  3EQ1 A;  4JV5 E;  4LU9 A;  2EPN A;  4WPY A;  1FJG E;  4YY3 E;  2RQL A;  1BB8 A;  2EPC A;  2YPN A;  2EPA A;  2EPL X;  2ZM6 E;  2EJ4 A;  4Q35 B;  4DKK A;  2IHR 1;  2DIX A;  1YYK A;  4WXC A;  1XNQ E;  4NZV A;  1YSA C;  4WYQ B;  4X9J A;  2B3T B;  2R76 A;  2YTO A;  2EOR A;  4BC7 A;  5A6B D;  3VYY A;  2LTS A;  2EMI A;  3BBG A;  1YUJ A;  2N3G A;  3QG5 C;  3JTZ A;  2I13 A;  1A1L A;  4K0K E;  5KL2 A;  2V87 A;  2UUC E;  3HPZ A;  1ZU1 A;  2EMG A;  1JK2 A;  1L4S A;  2EOF A;  2EN1 A;  3L00 A;  2JPA A;  2H36 X;  1SFE A;  4R2S A;  1G2D C;  1UN6 B;  2EOY A;  1YZ9 A;  2EMC A;  1O0W A;  4GZN C;  3C4T A;  2DSY A;  2V8Q B;  2CSH A;  2YTN A;  1G2F C;  5CFF E;  5A6A A;  2L2M A;  4BBY A;  1YUI A;  3HPS A;  2CTD A;  4JI1 E;  3VHT B;  4DV7 E;  5KL4 A;  2J7J A;  4RH8 A;  2MKN A;  3F6G A;  2FTX B;  2EPM X;  4WSG A;  3AV0 A;  2YTQ A;  1T4O A;  4JI7 E;  5FLX C;  2GLI A;  1MGT A;  2M1S A;  2MC5 A;  2LUQ A;  4R8O A;  4F6N A;  2DMI A;  5F3W A;  1WHN A;  2EMZ A;  3MHH C;  4TUI A;  2YRH A;  2LO3 A;  4X66 E;  2A25 A;  4LTY A;  1EKZ A;  2EN8 A;  3JU0 A;  4DR6 E;  4R2R A;  2HHH E;  2Q8U A;  1TF3 A;  2JWO A;  1WJP A;  4L5N C;  2EM7 A;  1LLM C;  2EOQ A;  2UU9 E;  2MDG A;  4JI3 E;  4JI8 E;  4M2Z A;  1A1H A;  2R1F A;  1SR9 A;  4Q28 A;  2DRP A;  2JR1 A;  1IQS A;  2K7I A;  2UXD E;  4J8Z A;  4ZYD A;  1UBD C;  1PJT A;  4F9A B;  2GPI A;  4X8W A;  2EM2 A;  2EPP A;  3IWD A;  4FK5 C;  2LJH A;  4JYA E;  5AE3 A;  1NCS A;  2V89 A;  2YTJ A;  1T38 A;  5LMU E;  4DUY E;  1N3G A;  3J80 C;  4LFA E;  4L8N A;  1RQ0 A;  3T1Y E;  3DF6 A;  5KL6 A;  2EOZ A;  2N8X A;  3FIG A;  5KL5 A;  2LTR A;  1X49 A;  4DV6 E;  4X64 E;  2LCE A;  1KYQ A;  2ENH A;  1IBM E;  1YYW A;  2MKD A;  2YWQ A;  4R2D A;  2EM9 A;  4DR4 E;  2N3H A;  2YU5 A;  2V86 A;  4JI5 E;  2JVA A;  2L92 A;  3EPJ A;  1A1K A;  2EN3 A;  4DR3 E;  3VYX A;  2LV2 A;  2YTG A;  4ZYH A;  2ENC A;  3IWB A;  4R03 A;  1EH8 A;  4IS1 C;  3BF2 A;  1PJQ A;  1PKP A;  2L3J A;  2EM5 A;  3T1H E;  4N4R B;  2EZ6 A;  1AAY A;  2LMZ A;  2LVH A;  4P78 A;  3J7A G;  2WCC 3;  4F6M A;  4BS9 A;  4B3M E;  2EOX A;  1GZ6 A;  2BB8 A;  3LLH A;  4HTG A;  2EOS A;  4LF7 E;  1FKA E;  1EH6 A;  4MLV A;  4BCA A;  2DB2 A;  2GHF A;  1HNZ E;  3C4B A;  3OTO E;  3EPH A; 
#chains in the Genus database with same CATH homology
 3BID A;  2K7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...