3BIDA

Crystal structure of the nmb1088 protein from neisseria meningitidis. northeast structural genomics consortium target mr91
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
58
structure length
58
Chain Sequence
b'MYFEIYKDAKGEYRWRLKAANHEIIAQGEGYTSKQNCQHAVDLLKSTTAATPVKEVLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0339 protein NMB1088
publication title Crystal structure of the NMB1088 protein from Neisseria meningitidis.
rcsb
source organism Neisseria meningitidis mc58
molecule tags Structural genomics, unknown function
total genus 9
structure length 58
sequence length 58
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07411 DUF1508 Domain of unknown function (DUF1508)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.160 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain YegP-like 3bidA01
3BIDA 2K7IA
chains in the Genus database with same CATH superfamily
4N4RB 2EN4A 2EMYA 5LL6R 2MDGA 1KJKA 4F9AB 1X3CA 2LV2A 1EH6A 4NZVA 4MLQA 4R2AA 3C4BA 1A1GA 2K4VA 3BBGA 2JP9A 4B3RE 4NHRA 2V87A 1PJQA 4WSGA 4BS9A 2H36X 4BC7A 2MC6A 2L3CA 1SFEA 4R8OA 2EOEA 3DF6A 2ELYA 2LTSA 4KWYA 1X49A 2EM5A 2L8TA 1J5EE 4X9JA 5AASA 1HR0E 1X6HA 2VRDA 4R2DA 1WRJA 4F9CB 2EPCA 2WCC3 1G2FC 2BB8A 1DQ3A 4DR2E 1GQEA 2CT1A 1TF3A 2M1SA 4LU9A 2DLKA 3C6MA 4R2QA 4TUGA 4JI8E 2EE8A 2B7VA 2B9DA 4ZYHA 4LFBE 4WSPA 4P78A 4M9VC 4B3SE 3LMLA 2LUQA 2EMXA 1YZ9A 2DGCA 4R2PA 1EKZA 2V88A 4JI5E 2EPAA 3BIDA 4R2SA 4JI1E 2YTPA 5A6BA 3FIGA 5A6KA 1YPNA 4JI4E 1NEIA 5KL5A 4DR5E 1RC7A 1YYWA 4JI6E 1X5WA 2JR1A 3TQMA 5A6AA 4JI0E 2EM4A 4WYQB 4WX9A 1AH5A 2GLIA 4GKKE 2RQLA 3ZOQB 4M30A 4BC9A 4Q28A 3K6QA 2ENAA 3LLHA 2LCEA 4DV0E 1PKPA 1XNRE 1N33E 1BB8A 2YRMA 1BBGA 5CFFE 3THNA 1IBKE 2WZOA 2YTQA 4DR6E 2JXPA 2YPNA 2YTJA 4DV6E 2YU5A 2EN3A 3IWDA 2YT4A 5LMUE 4I8OA 2EM0A 2EN1A 2KHXA 4M0VA 4Q35B 2UUCE 1A1HA 1SR9A 2EOSA 2LT7A 5TSEA 2D9HA 4NXNE 4DV7E 5T6JA 4AQYE 2UXBE 5IXMB 4P7DA 4O24A 2B7TA 2EZ6A 3AV0A 2LJHA 3H09A 2EPOA 2RSMA 2YRHA 1O0WA 2NA2A 2G7HA 2YTFA 4JI2E 2EWLA 2RTXA 2EPKX 1P47A 4B3TE 1XMOE 1YSAC 3L00A 3THOB 1YFHA 4LF4E 4DR7E 1G2DC 3C4TA 2NABA 1XMQE 1GZ6A 4DUZE 4K0KE 2JOBA 2HHHE 1HNXE 2L2NA 5AE3A 2EM9A 2MKNA 2EOXA 5KL3A 2JYAA 4DV3E 1N34E 2EPMX 2KONA 3KZZA 2FV4B 3MHSC 2EQ3A 2YTEA 1BBOA 2MKDA 2EMLA 1IQSA 3ECRA 2EN6A 2DLQA 4LF7E 1N3GA 2EOFA 2EOZA 2YTGA 3RMPA 1A1LA 5IWAE 1FJGE 3QG5C 1XNQE 4JV5E 5AC4A 1WHNA 5AE2A 2L6MA 4HEIA 1X6EA 5LLQA 2LTRA 4X62E 3T1HE 3J7AG 1WXRA 1YUIA 2LO3A 2EORA 2I13A 2CPNA 2EMCA 4R2EA 4LF5E 1IBME 2EQ0A 1YYKA 2A25A 4DV5E 4L5NC 1A1FA 3BF2A 1T4OA 2V86A 2RS7A 4LF6E 1UBDC 2EQ1A 2DMYA 1GTKA 1STUA 2EP3A 4JI7E 4F54A 2FTXB 2F8BA 2UUBE 1UN6B 2EPUA 4YHHE 2EMIA 4ZYEA 2YTDA 3ADJA 2N8XA 4WXDA 2N3GA 2HC5A 2LE2A 3M99B 3J80C 2YRKA 2DRPA 2LUPB 4BCAA 4LF8E 1YYOA 1EH7A 4O4KA 1T4LB 4J8ZA 4L8NA 2R1FA 3ADGA 1MEYC 2EN2A 2MC5A 1HNWE 2WBTA 4DR1E 1T39A 2EJ4A 2NUFA 1FKAE 4BBYA 2V89A 2YTOA 3AUZA 4HTGA 1IBLE 2EPXA 3VYXA 4OX9E 2ENHA 4GKJE 3HQ1A 3EPLA 1AAYA 1ZAAC 4F6NA 2EPRA 1LLMC 3J7Yp 2EOMA 1MGTA 3HPSA 1QU6A 2RPCA 4B3ME 2EPNA 1PJSA 2DSYA 3OMLA 3VK6A 1T4NA 4X66E 2EMBA 2V8QB 3HTXA 3VHTB 4LTYA 4TUIA 2BBGA 2IHR1 4GZNC 2EMAA 2YU8A 2RSIA 1T38A 2J7JA 1X47A 4OOGC 2YTNA 3F6GA 4MLVA 4YY3E 4LF9E 3IWBA 4WXCA 2UUAE 2ENCA 3DJWA 3MHHC 3EPKA 2L2KB 2L3JA 2GPIA 5F3WA 1X48A 1WJPA 1ZBQA 3P1XA 4BHBA 2E1MA 1N36E 2EM7A 2E5LE 5AE1A 5LMNE 2MDRA 3EPHA 1N32E 1QNTA 2WBUA 4ZYGA 2M9AA 2EM3A 1DGCA 5FLXC 2JPAA 2PRTA 2YWQA 4WPYA 2JWOA 2Q8UA 1YUJA 2UU9E 4KZSA 2F4VE 1X6FA 2DMIA 2EPLX 4LFAE 2VQFE 3ADIA 1TF6A 2EOQA 1WHQA 1PDAA 2EPPA 4F9BB 1PJTA 1A1JA 2EPZA 3MSWA 4DUYE 1NCSA 2B3TB 2EN7A 2EOOA 2UXDE 5KL2A 2M7QA 2EL4A 4NXME 4DV2E 2VF1A 2YSPA 3HPZA 1KYQA 4JYAE 4M2ZA 2V83A 5IV8B 2EM6A 3EPJA 4DMIA 1HNZE 2M4IA 1A1IA 2ADRA 5KL4A 4DKKA 1UILA 1RMDA 3KZYA 2L33A 2YTIA 5A6BD 2RS6A 1IMUA 2CSHA 5A2QC 2UXCE 2EN8A 4DR4E 2YZTA 4KHPE 2ODRD 4ZYDA 4IS1C 4BHCA 5A6JA 2V85A 4R2RA 2EMGA 3EQ1A 2L2MA 4R2CA 4DR3E 3BGHA 4O5GA 2EMFA 2EMWA 3ADLA 2JOXA 1RQ0A 4WFTA 1I94E 1L4SA 2LVHA 1TN9A 2KOUA 1A1KA 2LBSB 4LFCE 3UK3C 2JVAA 1B69A 2DIXA 4FK5C 5BR8E 5KL6A 2L92A 3C6KA 2EMKA 2EOYA 4DV4E 2EM8A 2EMHA 1IQOA 2HGHA 1ZBTA 2ZM6E 1JK1A 2NUEA 1EH8A 2HJJA 2EM2A 3JAMC 2JY9A 1DI2A 4F2JC 3JTZA 1Z1BA 4RHBB 5KL7A 4DV1E 2EMZA 2EOIA 2I9IA 5A69A 2K7IA 2E72A 2WBSA 3T1YE 2EOJA 2LJUA 2EL6A 1F2IG 1UHZA 1J26A 3KWRA 2LRSA 2CTDA 3VYYA 4X64E 4X65E 3JU0A 5AC5A 2EOHA 2FGGA 1ZU1A 4IJDA 2R76A 3HXLA 3J81C 3F6HA 2ODRC 4R03A 4F6MA 2N3HA 2DB2A 4RH8A 2VE7C 2VQEE 4GEQB 3IWCA 3OTOE 2EL5A 2NUGA 4BMJA 5IT9C 2LMZA 2ELZA 4X8WA 2YSOA 4O43A 1ZR9A 2GHFA 5DNYA 5ADZA 1JK2A 4JI3E
chains in the Genus database with same CATH topology
3BIDA 2K7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BID A;  2K7I A; 
#chains in the Genus database with same CATH topology
 4N4R B;  2EN4 A;  2EMY A;  5LL6 R;  2MDG A;  1KJK A;  4F9A B;  1X3C A;  2LV2 A;  1EH6 A;  4NZV A;  4MLQ A;  4R2A A;  3C4B A;  1A1G A;  2K4V A;  3BBG A;  2JP9 A;  4B3R E;  4NHR A;  2V87 A;  1PJQ A;  4WSG A;  4BS9 A;  2H36 X;  4BC7 A;  2MC6 A;  2L3C A;  1SFE A;  4R8O A;  2EOE A;  3DF6 A;  2ELY A;  2LTS A;  4KWY A;  1X49 A;  2EM5 A;  2L8T A;  1J5E E;  4X9J A;  5AAS A;  1HR0 E;  1X6H A;  2VRD A;  4R2D A;  1WRJ A;  4F9C B;  2EPC A;  2WCC 3;  1G2F C;  2BB8 A;  1DQ3 A;  4DR2 E;  1GQE A;  2CT1 A;  1TF3 A;  2M1S A;  4LU9 A;  2DLK A;  3C6M A;  4R2Q A;  4TUG A;  4JI8 E;  2EE8 A;  2B7V A;  2B9D A;  4ZYH A;  4LFB E;  4WSP A;  4P78 A;  4M9V C;  4B3S E;  3LML A;  2LUQ A;  2EMX A;  1YZ9 A;  2DGC A;  4R2P A;  1EKZ A;  2V88 A;  4JI5 E;  2EPA A;  3BID A;  4R2S A;  4JI1 E;  2YTP A;  5A6B A;  3FIG A;  5A6K A;  1YPN A;  4JI4 E;  1NEI A;  5KL5 A;  4DR5 E;  1RC7 A;  1YYW A;  4JI6 E;  1X5W A;  2JR1 A;  3TQM A;  5A6A A;  4JI0 E;  2EM4 A;  4WYQ B;  4WX9 A;  1AH5 A;  2GLI A;  4GKK E;  2RQL A;  3ZOQ B;  4M30 A;  4BC9 A;  4Q28 A;  3K6Q A;  2ENA A;  3LLH A;  2LCE A;  4DV0 E;  1PKP A;  1XNR E;  1N33 E;  1BB8 A;  2YRM A;  1BBG A;  5CFF E;  3THN A;  1IBK E;  2WZO A;  2YTQ A;  4DR6 E;  2JXP A;  2YPN A;  2YTJ A;  4DV6 E;  2YU5 A;  2EN3 A;  3IWD A;  2YT4 A;  5LMU E;  4I8O A;  2EM0 A;  2EN1 A;  2KHX A;  4M0V A;  4Q35 B;  2UUC E;  1A1H A;  1SR9 A;  2EOS A;  2LT7 A;  5TSE A;  2D9H A;  4NXN E;  4DV7 E;  5T6J A;  4AQY E;  2UXB E;  5IXM B;  4P7D A;  4O24 A;  2B7T A;  2EZ6 A;  3AV0 A;  2LJH A;  3H09 A;  2EPO A;  2RSM A;  2YRH A;  1O0W A;  2NA2 A;  2G7H A;  2YTF A;  4JI2 E;  2EWL A;  2RTX A;  2EPK X;  1P47 A;  4B3T E;  1XMO E;  1YSA C;  3L00 A;  3THO B;  1YFH A;  4LF4 E;  4DR7 E;  1G2D C;  3C4T A;  2NAB A;  1XMQ E;  1GZ6 A;  4DUZ E;  4K0K E;  2JOB A;  2HHH E;  1HNX E;  2L2N A;  5AE3 A;  2EM9 A;  2MKN A;  2EOX A;  5KL3 A;  2JYA A;  4DV3 E;  1N34 E;  2EPM X;  2KON A;  3KZZ A;  2FV4 B;  3MHS C;  2EQ3 A;  2YTE A;  1BBO A;  2MKD A;  2EML A;  1IQS A;  3ECR A;  2EN6 A;  2DLQ A;  4LF7 E;  1N3G A;  2EOF A;  2EOZ A;  2YTG A;  3RMP A;  1A1L A;  5IWA E;  1FJG E;  3QG5 C;  1XNQ E;  4JV5 E;  5AC4 A;  1WHN A;  5AE2 A;  2L6M A;  4HEI A;  1X6E A;  5LLQ A;  2LTR A;  4X62 E;  3T1H E;  3J7A G;  1WXR A;  1YUI A;  2LO3 A;  2EOR A;  2I13 A;  2CPN A;  2EMC A;  4R2E A;  4LF5 E;  1IBM E;  2EQ0 A;  1YYK A;  2A25 A;  4DV5 E;  4L5N C;  1A1F A;  3BF2 A;  1T4O A;  2V86 A;  2RS7 A;  4LF6 E;  1UBD C;  2EQ1 A;  2DMY A;  1GTK A;  1STU A;  2EP3 A;  4JI7 E;  4F54 A;  2FTX B;  2F8B A;  2UUB E;  1UN6 B;  2EPU A;  4YHH E;  2EMI A;  4ZYE A;  2YTD A;  3ADJ A;  2N8X A;  4WXD A;  2N3G A;  2HC5 A;  2LE2 A;  3M99 B;  3J80 C;  2YRK A;  2DRP A;  2LUP B;  4BCA A;  4LF8 E;  1YYO A;  1EH7 A;  4O4K A;  1T4L B;  4J8Z A;  4L8N A;  2R1F A;  3ADG A;  1MEY C;  2EN2 A;  2MC5 A;  1HNW E;  2WBT A;  4DR1 E;  1T39 A;  2EJ4 A;  2NUF A;  1FKA E;  4BBY A;  2V89 A;  2YTO A;  3AUZ A;  4HTG A;  1IBL E;  2EPX A;  3VYX A;  4OX9 E;  2ENH A;  4GKJ E;  3HQ1 A;  3EPL A;  1AAY A;  1ZAA C;  4F6N A;  2EPR A;  1LLM C;  3J7Y p;  2EOM A;  1MGT A;  3HPS A;  1QU6 A;  2RPC A;  4B3M E;  2EPN A;  1PJS A;  2DSY A;  3OML A;  3VK6 A;  1T4N A;  4X66 E;  2EMB A;  2V8Q B;  3HTX A;  3VHT B;  4LTY A;  4TUI A;  2BBG A;  2IHR 1;  4GZN C;  2EMA A;  2YU8 A;  2RSI A;  1T38 A;  2J7J A;  1X47 A;  4OOG C;  2YTN A;  3F6G A;  4MLV A;  4YY3 E;  4LF9 E;  3IWB A;  4WXC A;  2UUA E;  2ENC A;  3DJW A;  3MHH C;  3EPK A;  2L2K B;  2L3J A;  2GPI A;  5F3W A;  1X48 A;  1WJP A;  1ZBQ A;  3P1X A;  4BHB A;  2E1M A;  1N36 E;  2EM7 A;  2E5L E;  5AE1 A;  5LMN E;  2MDR A;  3EPH A;  1N32 E;  1QNT A;  2WBU A;  4ZYG A;  2M9A A;  2EM3 A;  1DGC A;  5FLX C;  2JPA A;  2PRT A;  2YWQ A;  4WPY A;  2JWO A;  2Q8U A;  1YUJ A;  2UU9 E;  4KZS A;  2F4V E;  1X6F A;  2DMI A;  2EPL X;  4LFA E;  2VQF E;  3ADI A;  1TF6 A;  2EOQ A;  1WHQ A;  1PDA A;  2EPP A;  4F9B B;  1PJT A;  1A1J A;  2EPZ A;  3MSW A;  4DUY E;  1NCS A;  2B3T B;  2EN7 A;  2EOO A;  2UXD E;  5KL2 A;  2M7Q A;  2EL4 A;  4NXM E;  4DV2 E;  2VF1 A;  2YSP A;  3HPZ A;  1KYQ A;  4JYA E;  4M2Z A;  2V83 A;  5IV8 B;  2EM6 A;  3EPJ A;  4DMI A;  1HNZ E;  2M4I A;  1A1I A;  2ADR A;  5KL4 A;  4DKK A;  1UIL A;  1RMD A;  3KZY A;  2L33 A;  2YTI A;  5A6B D;  2RS6 A;  1IMU A;  2CSH A;  5A2Q C;  2UXC E;  2EN8 A;  4DR4 E;  2YZT A;  4KHP E;  2ODR D;  4ZYD A;  4IS1 C;  4BHC A;  5A6J A;  2V85 A;  4R2R A;  2EMG A;  3EQ1 A;  2L2M A;  4R2C A;  4DR3 E;  3BGH A;  4O5G A;  2EMF A;  2EMW A;  3ADL A;  2JOX A;  1RQ0 A;  4WFT A;  1I94 E;  1L4S A;  2LVH A;  1TN9 A;  2KOU A;  1A1K A;  2LBS B;  4LFC E;  3UK3 C;  2JVA A;  1B69 A;  2DIX A;  4FK5 C;  5BR8 E;  5KL6 A;  2L92 A;  3C6K A;  2EMK A;  2EOY A;  4DV4 E;  2EM8 A;  2EMH A;  1IQO A;  2HGH A;  1ZBT A;  2ZM6 E;  1JK1 A;  2NUE A;  1EH8 A;  2HJJ A;  2EM2 A;  3JAM C;  2JY9 A;  1DI2 A;  4F2J C;  3JTZ A;  1Z1B A;  4RHB B;  5KL7 A;  4DV1 E;  2EMZ A;  2EOI A;  2I9I A;  5A69 A;  2K7I A;  2E72 A;  2WBS A;  3T1Y E;  2EOJ A;  2LJU A;  2EL6 A;  1F2I G;  1UHZ A;  1J26 A;  3KWR A;  2LRS A;  2CTD A;  3VYY A;  4X64 E;  4X65 E;  3JU0 A;  5AC5 A;  2EOH A;  2FGG A;  1ZU1 A;  4IJD A;  2R76 A;  3HXL A;  3J81 C;  3F6H A;  2ODR C;  4R03 A;  4F6M A;  2N3H A;  2DB2 A;  4RH8 A;  2VE7 C;  2VQE E;  4GEQ B;  3IWC A;  3OTO E;  2EL5 A;  2NUG A;  4BMJ A;  5IT9 C;  2LMZ A;  2ELZ A;  4X8W A;  2YSO A;  4O43 A;  1ZR9 A;  2GHF A;  5DNY A;  5ADZ A;  1JK2 A;  4JI3 E; 
#chains in the Genus database with same CATH homology
 3BID A;  2K7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...