3BIDA

Crystal structure of the nmb1088 protein from neisseria meningitidis. northeast structural genomics consortium target mr91
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
58
structure length
58
Chain Sequence
MYFEIYKDAKGEYRWRLKAANHEIIAQGEGYTSKQNCQHAVDLLKSTTAATPVKEVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the NMB1088 protein from Neisseria meningitidis.
rcsb
source organism Neisseria meningitidis mc58
molecule tags Structural genomics, unknown function
molecule keywords UPF0339 protein NMB1088
total genus 9
structure length 58
sequence length 58
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07411 DUF1508 Domain of unknown function (DUF1508)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.160 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain YegP-like 3bidA01
2K7IA 3BIDA
chains in the Genus database with same CATH superfamily
2B9DA 4LFBE 5ADZA 2EN4A 1TF3A 2MKNA 2EPNA 4BS9A 4F6NA 2LUQA 5KL6A 2EOHA 4DV3E 1A1IA 2UXCE 4YY3E 1B69A 3EQ1A 3MSWA 2IHR1 2L2MA 4O4KA 2BBGA 2B3TB 2L2NA 4IJDA 3H09A 4DR7E 1BB8A 4BC7A 2EPAA 2HJJA 2EPRA 2EN2A 3EPKA 2YT4A 2JWOA 1KYQA 1X48A 1G2FC 1HNXE 1SFEA 3MHSC 3EPLA 2H36X 2KOUA 1A1JA 1XNRE 4JYAE 2EM0A 2YTFA 3KZYA 4LF7E 4L5NC 3TQMA 5LLQA 2L33A 5KL2A 1T38A 5LMUE 2EMYA 3F6HA 1JK1A 2CT1A 3K6QA 2EM3A 4B3SE 4F2JC 3FIGA 4P78A 1N33E 2EM9A 4LF6E 4OOGC 1DI2A 2EPPA 2EL5A 4F9CB 4WXDA 3VYYA 2YSOA 1AAYA 4KZSA 3J80C 2WBUA 4KWYA 5KL3A 5A69A 4R2DA 4DV1E 2GPIA 3F6GA 2VRDA 2EWLA 5IWAE 4JI2E 2DSYA 1EH6A 4J8ZA 2EE8A 2LO3A 2EORA 4KHPE 1KJKA 2CSHA 2EN7A 2F8BA 1IQOA 2G7HA 1RQ0A 2HGHA 2YTNA 3BIDA 4ZYGA 4JI5E 1YFHA 4OX9E 1FJGE 4BCAA 2E1MA 1GTKA 4M0VA 2EPOA 1ZAAC 1T4NA 5KL5A 4R2EA 4X66E 1AH5A 2EL6A 2DB2A 5AC5A 1ZBQA 4TUGA 2EPMX 2L92A 3IWCA 4X9JA 1UN6B 2EMXA 4BHCA 2R1FA 5A6AA 2D9HA 2V85A 2VQFE 2N3GA 2WCC3 2EN3A 4RHBB 4LU9A 5A6KA 2JR1A 1GZ6A 2EQ0A 2MDRA 1X3CA 4GKKE 2NABA 4NXNE 1UILA 2M4IA 1RC7A 2EMBA 5T6JA 2EMAA 4DR4E 1X47A 4WYQB 1UHZA 2EMLA 2VE7C 4F9AB 5LL6R 1PDAA 4HTGA 5AE3A 2YRKA 2DMYA 1XMQE 1L4SA 4NXME 2ELYA 2MC6A 1A1FA 2LUPB 4WX9A 4R2AA 3ECRA 3BGHA 4BBYA 3T1YE 4JI8E 1WHQA 1WHNA 1PJSA 3C6MA 2EOXA 2E72A 2UUAE 4O43A 3THOB 2UXBE 1T39A 4JI6E 4X64E 2CTDA 2A25A 3HQ1A 2RQLA 4DV2E 5F3WA 3T1HE 1NEIA 1X6FA 2EOFA 4DV5E 1STUA 3KZZA 1RMDA 2EM2A 1I94E 1MEYC 4B3ME 4ZYEA 4B3TE 2EMFA 1N36E 1YZ9A 2EL4A 2MKDA 4HEIA 4Q28A 5AC4A 4K0KE 3C6KA 1YSAC 4O5GA 2V83A 2K7IA 3AUZA 4MLQA 2YU8A 2L8TA 2M9AA 1A1KA 2EN8A 2VF1A 1X6HA 3KWRA 2DRPA 1X49A 4DV0E 2RS7A 3VK6A 2EPCA 2UU9E 4LF9E 1BBGA 3ADGA 1ZR9A 2DLQA 4WXCA 3MHHC 2LCEA 1EH7A 2WBSA 4M2ZA 1X6EA 2YTJA 1PJTA 4WPYA 2YTDA 1PKPA 1QU6A 3JU0A 4M30A 2YRMA 2LTRA 4BC9A 2L3CA 2F4VE 3EPJA 2B7TA 3ADJA 2EOJA 3JAMC 2YTGA 2Q8UA 2EPXA 2V87A 5KL7A 5BR8E 1G2DC 3P1XA 3M99B 3C4BA 2LT7A 4BMJA 4M9VC 2ELZA 2EM4A 4LFCE 2JY9A 2BB8A 2UUCE 1F2IG 2NA2A 4DR3E 4TUIA 2V88A 4JV5E 2FTXB 5A2QC 1TN9A 4JI3E 2EZ6A 1EKZA 2EN6A 2MC5A 4YHHE 5AASA 3L00A 2LJUA 3IWBA 2M1SA 4X62E 2RSIA 1EH8A 2EOMA 1IBME 2YSPA 5IXMB 4JI0E 2JPAA 4Q35B 2L6MA 2EOYA 3VHTB 2DIXA 2UUBE 2EMGA 2L2KB 1WXRA 5KL4A 4F9BB 3VYXA 3DJWA 2MDGA 2LRSA 4DR6E 4R8OA 2EM6A 4DV4E 2LTSA 3LMLA 2JXPA 2YU5A 2ENCA 2EMIA 1ZU1A 2ENAA 4MLVA 2LV2A 2GLIA 2YTPA 2EMZA 1O0WA 3BBGA 2EP3A 2RTXA 2WBTA 1YUIA 2K4VA 2EQ1A 1J26A 1DGCA 2EPZA 1YPNA 2I13A 3ZOQB 2YTQA 5AE2A 3ADIA 3LLHA 2N8XA 2JVAA 4B3RE 2JYAA 1N3GA 4DV6E 4ZYHA 2JP9A 5TSEA 2CPNA 1IMUA 2JOBA 4JI4E 2EOZA 2YWQA 2NUEA 4LF5E 2KONA 1T4OA 2R76A 1J5EE 2EOOA 2UXDE 4P7DA 3OMLA 1IQSA 5CFFE 4DUZE 1ZBTA 2GHFA 2DLKA 2EOSA 4JI7E 4R03A 3J7Yp 4LF8E 1WJPA 3QG5C 2M7QA 2HHHE 2EOEA 3RMPA 4R2SA 2LE2A 4F6MA 4R2PA 1N34E 4DUYE 4I8OA 2DGCA 2EPUA 4GEQB 3IWDA 1HR0E 1UBDC 2ADRA 1GQEA 2NUFA 2LBSB 2EM7A 1YUJA 1XNQE 4WFTA 1PJQA 1A1GA 2JOXA 2E5LE 1IBLE 1FKAE 5IT9C 1Z1BA 2V8QB 1P47A 1SR9A 4DMIA 1WRJA 2RPCA 1JK2A 2ODRD 2VQEE 2PRTA 4LFAE 1YYKA 2J7JA 2ODRC 3HXLA 2YTOA 3HTXA 3AV0A 1A1HA 1NCSA 4LF4E 1A1LA 4R2CA 3HPZA 1MGTA 2LJHA 2LVHA 3J81C 3J7AG 2RS6A 4FK5C 3THNA 2EMHA 4IS1C 3EPHA 4R2QA 4R2RA 4DV7E 2EOQA 4N4RB 3BF2A 2EPKX 4BHBA 4X8WA 4O24A 4RH8A 4JI1E 4GZNC 4DR1E 2V86A 4WSGA 4NZVA 5A6BD 1IBKE 2I9IA 5FLXC 3C4TA 3JTZA 5A6JA 1YYWA 2LMZA 2NUGA 3OTOE 2YTEA 4DKKA 2EMCA 3ADLA 4WSPA 2WZOA 2HC5A 2YZTA 4ZYDA 5IV8B 5LMNE 1YYOA 4GKJE 2EMKA 2YTIA 1DQ3A 2EOIA 1X5WA 2N3HA 4L8NA 4LTYA 5AE1A 5A6BA 5DNYA 3UK3C 1LLMC 1HNWE 2DMIA 1BBOA 2EPLX 2EMWA 2YRHA 4F54A 2KHXA 1T4LB 2ENHA 1N32E 2EJ4A 4X65E 2V89A 1QNTA 2FGGA 1HNZE 3DF6A 2YPNA 2L3JA 2ZM6E 2B7VA 1TF6A 2RSMA 2EN1A 2EQ3A 3HPSA 4AQYE 2FV4B 4DR2E 4NHRA 4DR5E 2EM8A 2EM5A 1XMOE
chains in the Genus database with same CATH topology
2K7IA 3BIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K7I A;  3BID A; 
#chains in the Genus database with same CATH topology
 2B9D A;  4LFB E;  5ADZ A;  2EN4 A;  1TF3 A;  2MKN A;  2EPN A;  4BS9 A;  4F6N A;  2LUQ A;  5KL6 A;  2EOH A;  4DV3 E;  1A1I A;  2UXC E;  4YY3 E;  1B69 A;  3EQ1 A;  3MSW A;  2IHR 1;  2L2M A;  4O4K A;  2BBG A;  2B3T B;  2L2N A;  4IJD A;  3H09 A;  4DR7 E;  1BB8 A;  4BC7 A;  2EPA A;  2HJJ A;  2EPR A;  2EN2 A;  3EPK A;  2YT4 A;  2JWO A;  1KYQ A;  1X48 A;  1G2F C;  1HNX E;  1SFE A;  3MHS C;  3EPL A;  2H36 X;  2KOU A;  1A1J A;  1XNR E;  4JYA E;  2EM0 A;  2YTF A;  3KZY A;  4LF7 E;  4L5N C;  3TQM A;  5LLQ A;  2L33 A;  5KL2 A;  1T38 A;  5LMU E;  2EMY A;  3F6H A;  1JK1 A;  2CT1 A;  3K6Q A;  2EM3 A;  4B3S E;  4F2J C;  3FIG A;  4P78 A;  1N33 E;  2EM9 A;  4LF6 E;  4OOG C;  1DI2 A;  2EPP A;  2EL5 A;  4F9C B;  4WXD A;  3VYY A;  2YSO A;  1AAY A;  4KZS A;  3J80 C;  2WBU A;  4KWY A;  5KL3 A;  5A69 A;  4R2D A;  4DV1 E;  2GPI A;  3F6G A;  2VRD A;  2EWL A;  5IWA E;  4JI2 E;  2DSY A;  1EH6 A;  4J8Z A;  2EE8 A;  2LO3 A;  2EOR A;  4KHP E;  1KJK A;  2CSH A;  2EN7 A;  2F8B A;  1IQO A;  2G7H A;  1RQ0 A;  2HGH A;  2YTN A;  3BID A;  4ZYG A;  4JI5 E;  1YFH A;  4OX9 E;  1FJG E;  4BCA A;  2E1M A;  1GTK A;  4M0V A;  2EPO A;  1ZAA C;  1T4N A;  5KL5 A;  4R2E A;  4X66 E;  1AH5 A;  2EL6 A;  2DB2 A;  5AC5 A;  1ZBQ A;  4TUG A;  2EPM X;  2L92 A;  3IWC A;  4X9J A;  1UN6 B;  2EMX A;  4BHC A;  2R1F A;  5A6A A;  2D9H A;  2V85 A;  2VQF E;  2N3G A;  2WCC 3;  2EN3 A;  4RHB B;  4LU9 A;  5A6K A;  2JR1 A;  1GZ6 A;  2EQ0 A;  2MDR A;  1X3C A;  4GKK E;  2NAB A;  4NXN E;  1UIL A;  2M4I A;  1RC7 A;  2EMB A;  5T6J A;  2EMA A;  4DR4 E;  1X47 A;  4WYQ B;  1UHZ A;  2EML A;  2VE7 C;  4F9A B;  5LL6 R;  1PDA A;  4HTG A;  5AE3 A;  2YRK A;  2DMY A;  1XMQ E;  1L4S A;  4NXM E;  2ELY A;  2MC6 A;  1A1F A;  2LUP B;  4WX9 A;  4R2A A;  3ECR A;  3BGH A;  4BBY A;  3T1Y E;  4JI8 E;  1WHQ A;  1WHN A;  1PJS A;  3C6M A;  2EOX A;  2E72 A;  2UUA E;  4O43 A;  3THO B;  2UXB E;  1T39 A;  4JI6 E;  4X64 E;  2CTD A;  2A25 A;  3HQ1 A;  2RQL A;  4DV2 E;  5F3W A;  3T1H E;  1NEI A;  1X6F A;  2EOF A;  4DV5 E;  1STU A;  3KZZ A;  1RMD A;  2EM2 A;  1I94 E;  1MEY C;  4B3M E;  4ZYE A;  4B3T E;  2EMF A;  1N36 E;  1YZ9 A;  2EL4 A;  2MKD A;  4HEI A;  4Q28 A;  5AC4 A;  4K0K E;  3C6K A;  1YSA C;  4O5G A;  2V83 A;  2K7I A;  3AUZ A;  4MLQ A;  2YU8 A;  2L8T A;  2M9A A;  1A1K A;  2EN8 A;  2VF1 A;  1X6H A;  3KWR A;  2DRP A;  1X49 A;  4DV0 E;  2RS7 A;  3VK6 A;  2EPC A;  2UU9 E;  4LF9 E;  1BBG A;  3ADG A;  1ZR9 A;  2DLQ A;  4WXC A;  3MHH C;  2LCE A;  1EH7 A;  2WBS A;  4M2Z A;  1X6E A;  2YTJ A;  1PJT A;  4WPY A;  2YTD A;  1PKP A;  1QU6 A;  3JU0 A;  4M30 A;  2YRM A;  2LTR A;  4BC9 A;  2L3C A;  2F4V E;  3EPJ A;  2B7T A;  3ADJ A;  2EOJ A;  3JAM C;  2YTG A;  2Q8U A;  2EPX A;  2V87 A;  5KL7 A;  5BR8 E;  1G2D C;  3P1X A;  3M99 B;  3C4B A;  2LT7 A;  4BMJ A;  4M9V C;  2ELZ A;  2EM4 A;  4LFC E;  2JY9 A;  2BB8 A;  2UUC E;  1F2I G;  2NA2 A;  4DR3 E;  4TUI A;  2V88 A;  4JV5 E;  2FTX B;  5A2Q C;  1TN9 A;  4JI3 E;  2EZ6 A;  1EKZ A;  2EN6 A;  2MC5 A;  4YHH E;  5AAS A;  3L00 A;  2LJU A;  3IWB A;  2M1S A;  4X62 E;  2RSI A;  1EH8 A;  2EOM A;  1IBM E;  2YSP A;  5IXM B;  4JI0 E;  2JPA A;  4Q35 B;  2L6M A;  2EOY A;  3VHT B;  2DIX A;  2UUB E;  2EMG A;  2L2K B;  1WXR A;  5KL4 A;  4F9B B;  3VYX A;  3DJW A;  2MDG A;  2LRS A;  4DR6 E;  4R8O A;  2EM6 A;  4DV4 E;  2LTS A;  3LML A;  2JXP A;  2YU5 A;  2ENC A;  2EMI A;  1ZU1 A;  2ENA A;  4MLV A;  2LV2 A;  2GLI A;  2YTP A;  2EMZ A;  1O0W A;  3BBG A;  2EP3 A;  2RTX A;  2WBT A;  1YUI A;  2K4V A;  2EQ1 A;  1J26 A;  1DGC A;  2EPZ A;  1YPN A;  2I13 A;  3ZOQ B;  2YTQ A;  5AE2 A;  3ADI A;  3LLH A;  2N8X A;  2JVA A;  4B3R E;  2JYA A;  1N3G A;  4DV6 E;  4ZYH A;  2JP9 A;  5TSE A;  2CPN A;  1IMU A;  2JOB A;  4JI4 E;  2EOZ A;  2YWQ A;  2NUE A;  4LF5 E;  2KON A;  1T4O A;  2R76 A;  1J5E E;  2EOO A;  2UXD E;  4P7D A;  3OML A;  1IQS A;  5CFF E;  4DUZ E;  1ZBT A;  2GHF A;  2DLK A;  2EOS A;  4JI7 E;  4R03 A;  3J7Y p;  4LF8 E;  1WJP A;  3QG5 C;  2M7Q A;  2HHH E;  2EOE A;  3RMP A;  4R2S A;  2LE2 A;  4F6M A;  4R2P A;  1N34 E;  4DUY E;  4I8O A;  2DGC A;  2EPU A;  4GEQ B;  3IWD A;  1HR0 E;  1UBD C;  2ADR A;  1GQE A;  2NUF A;  2LBS B;  2EM7 A;  1YUJ A;  1XNQ E;  4WFT A;  1PJQ A;  1A1G A;  2JOX A;  2E5L E;  1IBL E;  1FKA E;  5IT9 C;  1Z1B A;  2V8Q B;  1P47 A;  1SR9 A;  4DMI A;  1WRJ A;  2RPC A;  1JK2 A;  2ODR D;  2VQE E;  2PRT A;  4LFA E;  1YYK A;  2J7J A;  2ODR C;  3HXL A;  2YTO A;  3HTX A;  3AV0 A;  1A1H A;  1NCS A;  4LF4 E;  1A1L A;  4R2C A;  3HPZ A;  1MGT A;  2LJH A;  2LVH A;  3J81 C;  3J7A G;  2RS6 A;  4FK5 C;  3THN A;  2EMH A;  4IS1 C;  3EPH A;  4R2Q A;  4R2R A;  4DV7 E;  2EOQ A;  4N4R B;  3BF2 A;  2EPK X;  4BHB A;  4X8W A;  4O24 A;  4RH8 A;  4JI1 E;  4GZN C;  4DR1 E;  2V86 A;  4WSG A;  4NZV A;  5A6B D;  1IBK E;  2I9I A;  5FLX C;  3C4T A;  3JTZ A;  5A6J A;  1YYW A;  2LMZ A;  2NUG A;  3OTO E;  2YTE A;  4DKK A;  2EMC A;  3ADL A;  4WSP A;  2WZO A;  2HC5 A;  2YZT A;  4ZYD A;  5IV8 B;  5LMN E;  1YYO A;  4GKJ E;  2EMK A;  2YTI A;  1DQ3 A;  2EOI A;  1X5W A;  2N3H A;  4L8N A;  4LTY A;  5AE1 A;  5A6B A;  5DNY A;  3UK3 C;  1LLM C;  1HNW E;  2DMI A;  1BBO A;  2EPL X;  2EMW A;  2YRH A;  4F54 A;  2KHX A;  1T4L B;  2ENH A;  1N32 E;  2EJ4 A;  4X65 E;  2V89 A;  1QNT A;  2FGG A;  1HNZ E;  3DF6 A;  2YPN A;  2L3J A;  2ZM6 E;  2B7V A;  1TF6 A;  2RSM A;  2EN1 A;  2EQ3 A;  3HPS A;  4AQY E;  2FV4 B;  4DR2 E;  4NHR A;  4DR5 E;  2EM8 A;  2EM5 A;  1XMO E; 
#chains in the Genus database with same CATH homology
 2K7I A;  3BID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...