2EORA

Solution structure of the c2h2 type zinc finger (region 255-287) of human zinc finger protein 224
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYNCEECGKAFIHDSQLQEHQRIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 255-287) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 224
total genus 9
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eorA01
4R2RA 2DRPA 2LT7A 2RPCA 4IJDA 2R1FA 2EMHA 4R2QA 1TN9A 4R2EA 2YRMA 2DMIA 1TF6A 2MDGA 2EOQA 5KL4A 5KL5A 2EM7A 2EOEA 1G2FC 1YUJA 2M9AA 2EPUA 2MKNA 2WBTA 2YTPA 2EM3A 1G2DC 3VHTB 2DLQA 1BB8A 1A1GA 4R2AA 2YRHA 2EM9A 2YU5A 4FK5C 2WBSA 1X5WA 2EMKA 2EMWA 2J7JA 1Z1BA 2EPCA 1TF3A 3MHHC 4R2SA 3EPLA 4WSGA 2YRKA 2EM6A 1A1LA 1BBOA 2EN2A 1NCSA 2LCEA 3UK3C 2GHFA 2EOHA 2EM5A 2EORA 4R2DA 2EOIA 2DLKA 2EPXA 2YU8A 4R2PA 4R2CA 4GZNC 2EN4A 2EMIA 2EOYA 2DGCA 2EM8A 2ELYA 2EOSA 2EOMA 2EM2A 2LVHA 2EQ0A 4X9JA 2PRTA 2EMCA 2ENCA 2NABA 1JK2A 1ZR9A 2YTFA 5KL6A 1WJPA 2CT1A 2YSPA 4F6NA 1LLMC 1P47A 2EN6A 2ENAA 2RSIA 2LO3A 2EMAA 4F2JC 1UBDC 2EN3A 2YTGA 2ELZA 2HGHA 2A25A 2YTJA 1YSAC 2EOJA 2LV2A 1ZU1A 2EMYA 1A1JA 2EPPA 2EQ1A 2ADRA 4M9VC 1B69A 1KJKA 3EPJA 2EN8A 2EQ3A 1A1FA 2VRDA 2EL6A 2CTDA 2EOFA 2YTEA 2YTNA 4IS1C 2JPAA 2YTDA 2JP9A 1X3CA 1X6FA 1X6HA 2D9HA 1A1IA 1JK1A 1A1KA 1YUIA 2CSHA 2EN7A 1UN6B 2YSOA 2WBUA 2EMFA 1X6EA 1DGCA 2YTQA 1AAYA 2EL5A 3EPHA 5KL2A 2YTIA 2EPAA 2EMXA 5KL7A 2MKDA 2EMZA 2WCC3 5KL3A 2GLIA 2EM0A 3M99B 4F6MA 2EJ4A 3EPKA 2EOZA 1RMDA 2ENHA 2EMBA 2EE8A 1F2IG 1ZAAC 2YTOA 2EL4A 1MEYC 2EMLA 2EPZA 2E72A 2EN1A 2EM4A 2EPRA 2EP3A 2EMGA 2EOOA 2BB8A 2EOXA 1A1HA 3MHSC 2I13A
chains in the Genus database with same CATH superfamily
4IJDA 3TQMA 1UILA 4BC9A 2MC5A 4R2EA 2YRMA 2DMIA 3K6QA 1TF6A 4WXDA 2MDGA 1HNXE 2UU9E 4L8NA 2V89A 4JI3E 2YZTA 3ECRA 1YYOA 4LF8E 1G2DC 2G7HA 3VHTB 2EM9A 2N3GA 2EPCA 2NUEA 5A6AA 3MHHC 4X62E 2LTSA 2LBSB 4DV4E 2RTXA 2YRKA 3T1HE 1IQOA 4HTGA 4DV5E 3UK3C 2EOHA 2EM5A 2EORA 2DLKA 3J7AG 2YWQA 4R2CA 4Q28A 5AASA 5A6JA 4KWYA 4JI6E 4O5GA 2ELYA 3OTOE 4O43A 2V86A 4JI8E 4KHPE 4JI2E 3HXLA 2V85A 2YTFA 4WSPA 4F6NA 2EN6A 2LJHA 1YYWA 2KOUA 2LO3A 3AV0A 2YTGA 2YTJA 4R8OA 3QG5C 1PJSA 2EPPA 1KJKA 2LUPB 1A1FA 2VRDA 2EL6A 3RMPA 1XNRE 1PKPA 4IS1C 5LMNE 1N33E 4DR5E 1J26A 2WZOA 2JYAA 2CSHA 4K0KE 4TUGA 5IV8B 2UUCE 2EMFA 1I94E 2EL5A 2F4VE 2YTIA 2EPAA 2B3TB 2EMXA 5A69A 4DV3E 4B3RE 2EMZA 2Q8UA 2L2KB 1QU6A 4DV0E 1IBKE 2GLIA 1O0WA 3T1YE 2E5LE 2ENHA 4YHHE 2EE8A 2JWOA 4ZYDA 2EL4A 3HPZA 1YYKA 1WXRA 5A6KA 2LMZA 2EN1A 1FJGE 2EZ6A 3ADIA 2EPRA 2RQLA 2EP3A 4DV6E 2EOOA 4X8WA 3BF2A 2DSYA 4ZYEA 4JI7E 5A6BD 1T4NA 2I13A 4R2RA 5ADZA 4GEQB 2RPCA 2R1FA 4R2QA 1TN9A 5F3WA 1GTKA 2B7TA 4DR6E 1YUJA 1N34E 2KONA 2E1MA 4DR2E 2WBTA 2JY9A 3C6MA 1BB8A 4TUIA 4R2AA 4FK5C 2JR1A 2WBSA 2EMKA 2HJJA 3EQ1A 3F6GA 2HC5A 4R2SA 2EPOA 4R03A 3EPLA 1XMOE 2KHXA 1A1LA 3FIGA 4B3TE 2JOBA 2EOIA 2DGCA 2EMIA 1MGTA 4RHBB 4BCAA 1X49A 4X9JA 2UUAE 1XNQE 2M7QA 4B3SE 3HPSA 3THOB 4DV2E 2CT1A 2YSPA 1EH7A 1LLMC 2RSIA 1BBGA 4DV7E 2K4VA 4F2JC 1UBDC 4M30A 2EN3A 2ELZA 2HHHE 2A25A 1X48A 4LU9A 2EOJA 4JYAE 2EMYA 2ADRA 1X47A 3EPJA 2EQ3A 2JOXA 1IBME 2EOFA 2YTEA 2JPAA 4F9AB 1X6HA 1A1KA 3ADJA 3BIDA 4NZVA 5AE3A 2YSOA 3JTZA 1DGCA 4DV1E 4NHRA 4N4RB 2WCC3 4LF7E 4DKKA 1T4OA 5IXMB 2NA2A 4F6MA 3KZYA 2EOZA 1RMDA 3HQ1A 4ZYHA 4JI5E 1ZAAC 3L00A 2BBGA 1J5EE 2B7VA 2EPZA 3IWCA 1IMUA 1WRJA 3MSWA 1T38A 3IWBA 4LF5E 4BHBA 1EH8A 2LT7A 2LJUA 3C6KA 2UXDE 1WHQA 2L3CA 2DMYA 2RS7A 1T39A 2N8XA 3DF6A 2L3JA 4I8OA 5FLXC 4WYQB 5KL5A 4DMIA 2MDRA 2JXPA 1RQ0A 3JU0A 2EPUA 1DI2A 2EPLX 3KZZA 2YTPA 1N32E 2L2MA 2EM3A 2N3HA 2DLQA 2YU5A 2J7JA 1TF3A 2UUBE 1ZBTA 1QNTA 2VQFE 1HNZE 4RH8A 4JI1E 2RS6A 1BBOA 3H09A 3VYXA 5TSEA 4BHCA 2EN2A 2LCEA 2GHFA 2EPXA 2YU8A 4KZSA 4M0VA 4DUYE 2EPNA 2EOYA 4BMJA 1KYQA 4LF6E 3J80C 4J8ZA 2EOSA 3BBGA 2LVHA 1FKAE 4LF9E 2ENCA 2NABA 1JK2A 4B3ME 1ZR9A 4BBYA 5KL6A 4F9BB 2ZM6E 2FV4B 4HEIA 2RSMA 2YPNA 2HGHA 2UXBE 2VE7C 3LMLA 1YSAC 2V88A 2FGGA 1ZU1A 1A1JA 3VK6A 4M9VC 1B69A 2L2NA 2EN8A 4O24A 2CTDA 1PJTA 3OMLA 5AE2A 1STUA 2I9IA 1X3CA 2D9HA 3LLHA 2ODRD 2V87A 1YUIA 2NUGA 2NUFA 4OOGC 4WPYA 1XMQE 2WBUA 2YTQA 1AAYA 4LFCE 4OX9E 3EPHA 4DR4E 4JI4E 2EPKX 5KL7A 3AUZA 2MC6A 2MKDA 5KL3A 2V8QB 1GZ6A 1IBLE 2YT4A 3M99B 2EJ4A 2EMBA 4BC7A 1GQEA 3J7Yp 2YTOA 5AC5A 2F8BA 3HTXA 1MEYC 2EMLA 4MLVA 4L5NC 2E72A 2EM4A 1YPNA 2GPIA 4YY3E 2LE2A 3ADGA 2DB2A 2EWLA 1A1HA 2L33A 3IWDA 3P1XA 4DR1E 1RC7A 1SFEA 3MHSC 1UN6B 2DRPA 2EMHA 2L8TA 4ZYGA 5IWAE 4NXME 2LUQA 1ZBQA 3ZOQB 2EOQA 5KL4A 3BGHA 4DR3E 2EM7A 1EH6A 2EOEA 1G2FC 2VF1A 5IT9C 1T4LB 2M9AA 2MKNA 1WHNA 3ADLA 4JI0E 5LMUE 1A1GA 2YRHA 1X5WA 2EMWA 4X65E 1Z1BA 4Q35B 2VQEE 4WSGA 2EM6A 4NXNE 1PJQA 1NCSA 4DR7E 1UHZA 2DIXA 3C4TA 4GKJE 5BR8E 1N36E 4LFBE 2CPNA 4GZNC 4R2DA 4M2ZA 4R2PA 2EN4A 2K7IA 2EM8A 4WXCA 4MLQA 1IQSA 2EOMA 3C4BA 2EM2A 2EQ0A 2L6MA 2PRTA 2EMCA 3THNA 2B9DA 2LTRA 1WJPA 1P47A 2ENAA 4LFAE 5T6JA 2EMAA 4LF4E 2JVAA 4JV5E 2M4IA 3J81C 2LV2A 2EQ1A 4P7DA 1PDAA 4LTYA 3JAMC 5AC4A 1EKZA 5DNYA 4WFTA 2UXCE 5CFFE 2YTNA 2YTDA 2JP9A 2ODRC 1X6FA 4BS9A 1A1IA 3F6HA 1JK1A 5AE1A 1YFHA 1DQ3A 1AH5A 2EN7A 4WX9A 4X66E 1NEIA 4X64E 1X6EA 1YZ9A 5KL2A 5A2QC 2LRSA 1HR0E 2R76A 5LL6R 4F54A 3VYYA 3DJWA 1SR9A 2EM0A 4O4KA 3EPKA 1F2IG 1HNWE 4AQYE 1N3GA 2EPMX 2L92A 5LLQA 2V83A 4GKKE 4F9CB 2H36X 2M1SA 4DUZE 5A6BA 2FTXB 2EMGA 2BB8A 3KWRA 2EOXA 4P78A 2IHR1 1L4SA
chains in the Genus database with same CATH topology
4R2RA 2DRPA 2LT7A 2RPCA 4IJDA 2R1FA 2EMHA 4R2QA 1TN9A 4R2EA 2YRMA 2DMIA 1TF6A 2MDGA 2EOQA 5KL4A 5KL5A 2EM7A 2EOEA 1G2FC 1YUJA 2M9AA 2EPUA 2MKNA 2WBTA 2YTPA 2EM3A 1G2DC 3VHTB 2DLQA 1BB8A 1A1GA 4R2AA 2YRHA 2EM9A 2YU5A 4FK5C 2WBSA 1X5WA 2EMKA 2EMWA 2J7JA 1Z1BA 2EPCA 1TF3A 3MHHC 4R2SA 3EPLA 4WSGA 2YRKA 2EM6A 1A1LA 1BBOA 2EN2A 1NCSA 2LCEA 3UK3C 2GHFA 2EOHA 2EM5A 2EORA 4R2DA 2EOIA 2DLKA 2EPXA 2YU8A 4R2PA 4R2CA 4GZNC 2EN4A 2EMIA 2EOYA 2DGCA 2EM8A 2ELYA 2EOSA 2EOMA 2EM2A 2LVHA 2EQ0A 4X9JA 2PRTA 2EMCA 2ENCA 2NABA 1JK2A 1ZR9A 2YTFA 5KL6A 1WJPA 2CT1A 2YSPA 4F6NA 1LLMC 1P47A 2EN6A 2ENAA 2RSIA 2LO3A 2EMAA 4F2JC 1UBDC 2EN3A 2YTGA 2ELZA 2HGHA 2A25A 2YTJA 1YSAC 2EOJA 2LV2A 1ZU1A 2EMYA 1A1JA 2EPPA 2EQ1A 2ADRA 4M9VC 1B69A 1KJKA 3EPJA 2EN8A 2EQ3A 1A1FA 2VRDA 2EL6A 2CTDA 2EOFA 2YTEA 2YTNA 4IS1C 2JPAA 2YTDA 2JP9A 1X3CA 1X6FA 1X6HA 2D9HA 1A1IA 1JK1A 1A1KA 1YUIA 2CSHA 2EN7A 1UN6B 2YSOA 2WBUA 2EMFA 1X6EA 1DGCA 2YTQA 1AAYA 2EL5A 3EPHA 5KL2A 2YTIA 2EPAA 2EMXA 5KL7A 2MKDA 2EMZA 2WCC3 5KL3A 2GLIA 2EM0A 3M99B 4F6MA 2EJ4A 3EPKA 2EOZA 1RMDA 2ENHA 2EMBA 2EE8A 1F2IG 1ZAAC 2YTOA 2EL4A 1MEYC 2EMLA 2EPZA 2E72A 2EN1A 2EM4A 2EPRA 2EP3A 2EMGA 2EOOA 2BB8A 2EOXA 1A1HA 3MHSC 2I13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2R A;  2DRP A;  2LT7 A;  2RPC A;  4IJD A;  2R1F A;  2EMH A;  4R2Q A;  1TN9 A;  4R2E A;  2YRM A;  2DMI A;  1TF6 A;  2MDG A;  2EOQ A;  5KL4 A;  5KL5 A;  2EM7 A;  2EOE A;  1G2F C;  1YUJ A;  2M9A A;  2EPU A;  2MKN A;  2WBT A;  2YTP A;  2EM3 A;  1G2D C;  3VHT B;  2DLQ A;  1BB8 A;  1A1G A;  4R2A A;  2YRH A;  2EM9 A;  2YU5 A;  4FK5 C;  2WBS A;  1X5W A;  2EMK A;  2EMW A;  2J7J A;  1Z1B A;  2EPC A;  1TF3 A;  3MHH C;  4R2S A;  3EPL A;  4WSG A;  2YRK A;  2EM6 A;  1A1L A;  1BBO A;  2EN2 A;  1NCS A;  2LCE A;  3UK3 C;  2GHF A;  2EOH A;  2EM5 A;  2EOR A;  4R2D A;  2EOI A;  2DLK A;  2EPX A;  2YU8 A;  4R2P A;  4R2C A;  4GZN C;  2EN4 A;  2EMI A;  2EOY A;  2DGC A;  2EM8 A;  2ELY A;  2EOS A;  2EOM A;  2EM2 A;  2LVH A;  2EQ0 A;  4X9J A;  2PRT A;  2EMC A;  2ENC A;  2NAB A;  1JK2 A;  1ZR9 A;  2YTF A;  5KL6 A;  1WJP A;  2CT1 A;  2YSP A;  4F6N A;  1LLM C;  1P47 A;  2EN6 A;  2ENA A;  2RSI A;  2LO3 A;  2EMA A;  4F2J C;  1UBD C;  2EN3 A;  2YTG A;  2ELZ A;  2HGH A;  2A25 A;  2YTJ A;  1YSA C;  2EOJ A;  2LV2 A;  1ZU1 A;  2EMY A;  1A1J A;  2EPP A;  2EQ1 A;  2ADR A;  4M9V C;  1B69 A;  1KJK A;  3EPJ A;  2EN8 A;  2EQ3 A;  1A1F A;  2VRD A;  2EL6 A;  2CTD A;  2EOF A;  2YTE A;  2YTN A;  4IS1 C;  2JPA A;  2YTD A;  2JP9 A;  1X3C A;  1X6F A;  1X6H A;  2D9H A;  1A1I A;  1JK1 A;  1A1K A;  1YUI A;  2CSH A;  2EN7 A;  1UN6 B;  2YSO A;  2WBU A;  2EMF A;  1X6E A;  1DGC A;  2YTQ A;  1AAY A;  2EL5 A;  3EPH A;  5KL2 A;  2YTI A;  2EPA A;  2EMX A;  5KL7 A;  2MKD A;  2EMZ A;  2WCC 3;  5KL3 A;  2GLI A;  2EM0 A;  3M99 B;  4F6M A;  2EJ4 A;  3EPK A;  2EOZ A;  1RMD A;  2ENH A;  2EMB A;  2EE8 A;  1F2I G;  1ZAA C;  2YTO A;  2EL4 A;  1MEY C;  2EML A;  2EPZ A;  2E72 A;  2EN1 A;  2EM4 A;  2EPR A;  2EP3 A;  2EMG A;  2EOO A;  2BB8 A;  2EOX A;  1A1H A;  3MHS C;  2I13 A; 
#chains in the Genus database with same CATH topology
 4IJD A;  3TQM A;  1UIL A;  4BC9 A;  2MC5 A;  4R2E A;  2YRM A;  2DMI A;  3K6Q A;  1TF6 A;  4WXD A;  2MDG A;  1HNX E;  2UU9 E;  4L8N A;  2V89 A;  4JI3 E;  2YZT A;  3ECR A;  1YYO A;  4LF8 E;  1G2D C;  2G7H A;  3VHT B;  2EM9 A;  2N3G A;  2EPC A;  2NUE A;  5A6A A;  3MHH C;  4X62 E;  2LTS A;  2LBS B;  4DV4 E;  2RTX A;  2YRK A;  3T1H E;  1IQO A;  4HTG A;  4DV5 E;  3UK3 C;  2EOH A;  2EM5 A;  2EOR A;  2DLK A;  3J7A G;  2YWQ A;  4R2C A;  4Q28 A;  5AAS A;  5A6J A;  4KWY A;  4JI6 E;  4O5G A;  2ELY A;  3OTO E;  4O43 A;  2V86 A;  4JI8 E;  4KHP E;  4JI2 E;  3HXL A;  2V85 A;  2YTF A;  4WSP A;  4F6N A;  2EN6 A;  2LJH A;  1YYW A;  2KOU A;  2LO3 A;  3AV0 A;  2YTG A;  2YTJ A;  4R8O A;  3QG5 C;  1PJS A;  2EPP A;  1KJK A;  2LUP B;  1A1F A;  2VRD A;  2EL6 A;  3RMP A;  1XNR E;  1PKP A;  4IS1 C;  5LMN E;  1N33 E;  4DR5 E;  1J26 A;  2WZO A;  2JYA A;  2CSH A;  4K0K E;  4TUG A;  5IV8 B;  2UUC E;  2EMF A;  1I94 E;  2EL5 A;  2F4V E;  2YTI A;  2EPA A;  2B3T B;  2EMX A;  5A69 A;  4DV3 E;  4B3R E;  2EMZ A;  2Q8U A;  2L2K B;  1QU6 A;  4DV0 E;  1IBK E;  2GLI A;  1O0W A;  3T1Y E;  2E5L E;  2ENH A;  4YHH E;  2EE8 A;  2JWO A;  4ZYD A;  2EL4 A;  3HPZ A;  1YYK A;  1WXR A;  5A6K A;  2LMZ A;  2EN1 A;  1FJG E;  2EZ6 A;  3ADI A;  2EPR A;  2RQL A;  2EP3 A;  4DV6 E;  2EOO A;  4X8W A;  3BF2 A;  2DSY A;  4ZYE A;  4JI7 E;  5A6B D;  1T4N A;  2I13 A;  4R2R A;  5ADZ A;  4GEQ B;  2RPC A;  2R1F A;  4R2Q A;  1TN9 A;  5F3W A;  1GTK A;  2B7T A;  4DR6 E;  1YUJ A;  1N34 E;  2KON A;  2E1M A;  4DR2 E;  2WBT A;  2JY9 A;  3C6M A;  1BB8 A;  4TUI A;  4R2A A;  4FK5 C;  2JR1 A;  2WBS A;  2EMK A;  2HJJ A;  3EQ1 A;  3F6G A;  2HC5 A;  4R2S A;  2EPO A;  4R03 A;  3EPL A;  1XMO E;  2KHX A;  1A1L A;  3FIG A;  4B3T E;  2JOB A;  2EOI A;  2DGC A;  2EMI A;  1MGT A;  4RHB B;  4BCA A;  1X49 A;  4X9J A;  2UUA E;  1XNQ E;  2M7Q A;  4B3S E;  3HPS A;  3THO B;  4DV2 E;  2CT1 A;  2YSP A;  1EH7 A;  1LLM C;  2RSI A;  1BBG A;  4DV7 E;  2K4V A;  4F2J C;  1UBD C;  4M30 A;  2EN3 A;  2ELZ A;  2HHH E;  2A25 A;  1X48 A;  4LU9 A;  2EOJ A;  4JYA E;  2EMY A;  2ADR A;  1X47 A;  3EPJ A;  2EQ3 A;  2JOX A;  1IBM E;  2EOF A;  2YTE A;  2JPA A;  4F9A B;  1X6H A;  1A1K A;  3ADJ A;  3BID A;  4NZV A;  5AE3 A;  2YSO A;  3JTZ A;  1DGC A;  4DV1 E;  4NHR A;  4N4R B;  2WCC 3;  4LF7 E;  4DKK A;  1T4O A;  5IXM B;  2NA2 A;  4F6M A;  3KZY A;  2EOZ A;  1RMD A;  3HQ1 A;  4ZYH A;  4JI5 E;  1ZAA C;  3L00 A;  2BBG A;  1J5E E;  2B7V A;  2EPZ A;  3IWC A;  1IMU A;  1WRJ A;  3MSW A;  1T38 A;  3IWB A;  4LF5 E;  4BHB A;  1EH8 A;  2LT7 A;  2LJU A;  3C6K A;  2UXD E;  1WHQ A;  2L3C A;  2DMY A;  2RS7 A;  1T39 A;  2N8X A;  3DF6 A;  2L3J A;  4I8O A;  5FLX C;  4WYQ B;  5KL5 A;  4DMI A;  2MDR A;  2JXP A;  1RQ0 A;  3JU0 A;  2EPU A;  1DI2 A;  2EPL X;  3KZZ A;  2YTP A;  1N32 E;  2L2M A;  2EM3 A;  2N3H A;  2DLQ A;  2YU5 A;  2J7J A;  1TF3 A;  2UUB E;  1ZBT A;  1QNT A;  2VQF E;  1HNZ E;  4RH8 A;  4JI1 E;  2RS6 A;  1BBO A;  3H09 A;  3VYX A;  5TSE A;  4BHC A;  2EN2 A;  2LCE A;  2GHF A;  2EPX A;  2YU8 A;  4KZS A;  4M0V A;  4DUY E;  2EPN A;  2EOY A;  4BMJ A;  1KYQ A;  4LF6 E;  3J80 C;  4J8Z A;  2EOS A;  3BBG A;  2LVH A;  1FKA E;  4LF9 E;  2ENC A;  2NAB A;  1JK2 A;  4B3M E;  1ZR9 A;  4BBY A;  5KL6 A;  4F9B B;  2ZM6 E;  2FV4 B;  4HEI A;  2RSM A;  2YPN A;  2HGH A;  2UXB E;  2VE7 C;  3LML A;  1YSA C;  2V88 A;  2FGG A;  1ZU1 A;  1A1J A;  3VK6 A;  4M9V C;  1B69 A;  2L2N A;  2EN8 A;  4O24 A;  2CTD A;  1PJT A;  3OML A;  5AE2 A;  1STU A;  2I9I A;  1X3C A;  2D9H A;  3LLH A;  2ODR D;  2V87 A;  1YUI A;  2NUG A;  2NUF A;  4OOG C;  4WPY A;  1XMQ E;  2WBU A;  2YTQ A;  1AAY A;  4LFC E;  4OX9 E;  3EPH A;  4DR4 E;  4JI4 E;  2EPK X;  5KL7 A;  3AUZ A;  2MC6 A;  2MKD A;  5KL3 A;  2V8Q B;  1GZ6 A;  1IBL E;  2YT4 A;  3M99 B;  2EJ4 A;  2EMB A;  4BC7 A;  1GQE A;  3J7Y p;  2YTO A;  5AC5 A;  2F8B A;  3HTX A;  1MEY C;  2EML A;  4MLV A;  4L5N C;  2E72 A;  2EM4 A;  1YPN A;  2GPI A;  4YY3 E;  2LE2 A;  3ADG A;  2DB2 A;  2EWL A;  1A1H A;  2L33 A;  3IWD A;  3P1X A;  4DR1 E;  1RC7 A;  1SFE A;  3MHS C;  1UN6 B;  2DRP A;  2EMH A;  2L8T A;  4ZYG A;  5IWA E;  4NXM E;  2LUQ A;  1ZBQ A;  3ZOQ B;  2EOQ A;  5KL4 A;  3BGH A;  4DR3 E;  2EM7 A;  1EH6 A;  2EOE A;  1G2F C;  2VF1 A;  5IT9 C;  1T4L B;  2M9A A;  2MKN A;  1WHN A;  3ADL A;  4JI0 E;  5LMU E;  1A1G A;  2YRH A;  1X5W A;  2EMW A;  4X65 E;  1Z1B A;  4Q35 B;  2VQE E;  4WSG A;  2EM6 A;  4NXN E;  1PJQ A;  1NCS A;  4DR7 E;  1UHZ A;  2DIX A;  3C4T A;  4GKJ E;  5BR8 E;  1N36 E;  4LFB E;  2CPN A;  4GZN C;  4R2D A;  4M2Z A;  4R2P A;  2EN4 A;  2K7I A;  2EM8 A;  4WXC A;  4MLQ A;  1IQS A;  2EOM A;  3C4B A;  2EM2 A;  2EQ0 A;  2L6M A;  2PRT A;  2EMC A;  3THN A;  2B9D A;  2LTR A;  1WJP A;  1P47 A;  2ENA A;  4LFA E;  5T6J A;  2EMA A;  4LF4 E;  2JVA A;  4JV5 E;  2M4I A;  3J81 C;  2LV2 A;  2EQ1 A;  4P7D A;  1PDA A;  4LTY A;  3JAM C;  5AC4 A;  1EKZ A;  5DNY A;  4WFT A;  2UXC E;  5CFF E;  2YTN A;  2YTD A;  2JP9 A;  2ODR C;  1X6F A;  4BS9 A;  1A1I A;  3F6H A;  1JK1 A;  5AE1 A;  1YFH A;  1DQ3 A;  1AH5 A;  2EN7 A;  4WX9 A;  4X66 E;  1NEI A;  4X64 E;  1X6E A;  1YZ9 A;  5KL2 A;  5A2Q C;  2LRS A;  1HR0 E;  2R76 A;  5LL6 R;  4F54 A;  3VYY A;  3DJW A;  1SR9 A;  2EM0 A;  4O4K A;  3EPK A;  1F2I G;  1HNW E;  4AQY E;  1N3G A;  2EPM X;  2L92 A;  5LLQ A;  2V83 A;  4GKK E;  4F9C B;  2H36 X;  2M1S A;  4DUZ E;  5A6B A;  2FTX B;  2EMG A;  2BB8 A;  3KWR A;  2EOX A;  4P78 A;  2IHR 1;  1L4S A; 
#chains in the Genus database with same CATH homology
 4R2R A;  2DRP A;  2LT7 A;  2RPC A;  4IJD A;  2R1F A;  2EMH A;  4R2Q A;  1TN9 A;  4R2E A;  2YRM A;  2DMI A;  1TF6 A;  2MDG A;  2EOQ A;  5KL4 A;  5KL5 A;  2EM7 A;  2EOE A;  1G2F C;  1YUJ A;  2M9A A;  2EPU A;  2MKN A;  2WBT A;  2YTP A;  2EM3 A;  1G2D C;  3VHT B;  2DLQ A;  1BB8 A;  1A1G A;  4R2A A;  2YRH A;  2EM9 A;  2YU5 A;  4FK5 C;  2WBS A;  1X5W A;  2EMK A;  2EMW A;  2J7J A;  1Z1B A;  2EPC A;  1TF3 A;  3MHH C;  4R2S A;  3EPL A;  4WSG A;  2YRK A;  2EM6 A;  1A1L A;  1BBO A;  2EN2 A;  1NCS A;  2LCE A;  3UK3 C;  2GHF A;  2EOH A;  2EM5 A;  2EOR A;  4R2D A;  2EOI A;  2DLK A;  2EPX A;  2YU8 A;  4R2P A;  4R2C A;  4GZN C;  2EN4 A;  2EMI A;  2EOY A;  2DGC A;  2EM8 A;  2ELY A;  2EOS A;  2EOM A;  2EM2 A;  2LVH A;  2EQ0 A;  4X9J A;  2PRT A;  2EMC A;  2ENC A;  2NAB A;  1JK2 A;  1ZR9 A;  2YTF A;  5KL6 A;  1WJP A;  2CT1 A;  2YSP A;  4F6N A;  1LLM C;  1P47 A;  2EN6 A;  2ENA A;  2RSI A;  2LO3 A;  2EMA A;  4F2J C;  1UBD C;  2EN3 A;  2YTG A;  2ELZ A;  2HGH A;  2A25 A;  2YTJ A;  1YSA C;  2EOJ A;  2LV2 A;  1ZU1 A;  2EMY A;  1A1J A;  2EPP A;  2EQ1 A;  2ADR A;  4M9V C;  1B69 A;  1KJK A;  3EPJ A;  2EN8 A;  2EQ3 A;  1A1F A;  2VRD A;  2EL6 A;  2CTD A;  2EOF A;  2YTE A;  2YTN A;  4IS1 C;  2JPA A;  2YTD A;  2JP9 A;  1X3C A;  1X6F A;  1X6H A;  2D9H A;  1A1I A;  1JK1 A;  1A1K A;  1YUI A;  2CSH A;  2EN7 A;  1UN6 B;  2YSO A;  2WBU A;  2EMF A;  1X6E A;  1DGC A;  2YTQ A;  1AAY A;  2EL5 A;  3EPH A;  5KL2 A;  2YTI A;  2EPA A;  2EMX A;  5KL7 A;  2MKD A;  2EMZ A;  2WCC 3;  5KL3 A;  2GLI A;  2EM0 A;  3M99 B;  4F6M A;  2EJ4 A;  3EPK A;  2EOZ A;  1RMD A;  2ENH A;  2EMB A;  2EE8 A;  1F2I G;  1ZAA C;  2YTO A;  2EL4 A;  1MEY C;  2EML A;  2EPZ A;  2E72 A;  2EN1 A;  2EM4 A;  2EPR A;  2EP3 A;  2EMG A;  2EOO A;  2BB8 A;  2EOX A;  1A1H A;  3MHS C;  2I13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...