2EORA

Solution structure of the c2h2 type zinc finger (region 255-287) of human zinc finger protein 224
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYNCEECGKAFIHDSQLQEHQRIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 255-287) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 224
total genus 9
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eorA01
5KL3A 1YUJA 4F6NA 4R2AA 1A1JA 2ADRA 2LVHA 2VRDA 4X9JA 2YRKA 2ENHA 2EOHA 4R2EA 2DLQA 2EMHA 1A1HA 2EM7A 2EQ0A 1P47A 2EQ3A 2EM3A 2WBSA 1YSAC 2JPAA 2DRPA 1Z1BA 2EM8A 1UN6B 2MDGA 2EM6A 1A1FA 2EM2A 2EL5A 2EOYA 2PRTA 1ZU1A 1YUIA 2EMLA 2EP3A 2EMAA 3MHSC 1A1KA 2EJ4A 2BB8A 2EOXA 2HGHA 2MKNA 1A1GA 2ENCA 4R2PA 2CT1A 4M9VC 2EN7A 2EE8A 2EOEA 2EMZA 2LV2A 1BB8A 2YTIA 2EPUA 1LLMC 4IJDA 3EPLA 2CSHA 1WJPA 2CTDA 1KJKA 2EPZA 1UBDC 1X6FA 2EMFA 2EMKA 2EL6A 2EM4A 3M99B 2WBTA 2EMBA 2D9HA 2R1FA 1X5WA 4FK5C 2YTNA 2NABA 1JK2A 2EPXA 2EPRA 2EOSA 2YTPA 2YRHA 2ELYA 2EL4A 2E72A 2WBUA 4IS1C 2EOQA 1AAYA 2LCEA 1ZR9A 2EQ1A 1F2IG 2EN1A 1TN9A 5KL2A 4R2RA 2EN4A 5KL5A 2EPCA 2EOJA 4F6MA 2J7JA 2EMCA 2EMIA 2EN3A 2RPCA 3MHHC 2LT7A 2EM5A 2YTGA 2EPPA 4R2QA 1B69A 2EOOA 2EOFA 2EMWA 2YTOA 3EPKA 1G2FC 1TF6A 2EMGA 2EN6A 2GLIA 2RSIA 4R2SA 1A1LA 3EPHA 4F2JC 2WCC3 2EM0A 5KL7A 1X6HA 2GHFA 1TF3A 1JK1A 1A1IA 2YU5A 2YTQA 2EOIA 2DMIA 1BBOA 2ELZA 2EMYA 4R2CA 2M9AA 2YTFA 2DGCA 2EMXA 4WSGA 2YSOA 2I13A 2YTDA 2MKDA 4GZNC 1X3CA 2YRMA 1ZAAC 1X6EA 2EN8A 2EOZA 3EPJA 2EN2A 2EOMA 2YU8A 2EPAA 2LO3A 5KL6A 1DGCA 3VHTB 2YTJA 2JP9A 2ENAA 1RMDA 2EM9A 2DLKA 5KL4A 2A25A 4R2DA 3UK3C 1MEYC 1G2DC 2YTEA 1NCSA 2YSPA 2EORA
chains in the Genus database with same CATH superfamily
3BGHA 4R03A 5KL3A 2DB2A 1A1JA 3HXLA 2VRDA 4Q28A 1T4LB 3BIDA 3LMLA 4DV0E 4DR4E 3AV0A 2EQ3A 4F9BB 4P78A 2EM8A 2EM6A 1A1FA 4JI6E 2E1MA 2EM2A 2EL5A 4BHCA 3THOB 5AE3A 2ODRC 1N36E 1A1KA 2EOXA 1A1GA 1J5EE 2LJHA 2CT1A 2VE7C 4WX9A 1RQ0A 2EE8A 2EOEA 2LV2A 2EPUA 1LLMC 3EPLA 2CSHA 1KJKA 2CTDA 1IQSA 2EPZA 2V85A 1UBDC 1XNRE 2Q8UA 3IWCA 3M99B 2FTXB 2WBTA 1YZ9A 2EMBA 3ADJA 1YYWA 4FK5C 1JK2A 2YTNA 2L3CA 1N33E 2YTPA 2E72A 4DR7E 4IS1C 4JI5E 5IT9C 2VF1A 4F9CB 4R2RA 3C4TA 2EOJA 2MC6A 2V83A 3HPSA 4L8NA 4R2QA 2EOFA 2FGGA 4ZYGA 1YYOA 2EN6A 3EPHA 4X8WA 1YPNA 1HR0E 4NHRA 2VQEE 5KL7A 4DR6E 4LF6E 5TSEA 5AE2A 4B3SE 1DI2A 2DMIA 3J80C 1BBOA 2EPNA 2EMYA 4B3TE 4JYAE 2YTFA 5AC5A 2DSYA 2YTDA 2MKDA 1X3CA 2EN8A 4X64E 2EOZA 2YU8A 2K7IA 2WZOA 4DV5E 5KL6A 4KZSA 2RSMA 5ADZA 2DLKA 4WXDA 2L6MA 1G2DC 2YTEA 1GTKA 5A6BA 4F6NA 4LU9A 4R2AA 2M1SA 2ADRA 2YRKA 1PDAA 2UXCE 2EOHA 3C6MA 5DNYA 4DR5E 2LBSB 2EM3A 1WHQA 5IV8B 1UN6B 2EPLX 4DV2E 2F8BA 4JI3E 5T6JA 2EOYA 1ZU1A 3ADLA 5LMNE 1EH8A 2KHXA 4JI7E 2UUBE 4X66E 2MKNA 1MGTA 3J81C 1WXRA 5A2QC 1X48A 2RQLA 4LF4E 4WYQB 2LUPB 2ZM6E 1BB8A 2YTIA 5BR8E 4JI2E 1WJPA 2YZTA 5FLXC 1X6FA 3VYXA 3ZOQB 2EMKA 2EL6A 2E5LE 3KZYA 2DMYA 2D9HA 1PJSA 5A6JA 4J8ZA 2UUCE 1XMQE 4B3RE 4LTYA 2LCEA 1ZR9A 4N4RB 3P1XA 3KZZA 4LF5E 5KL2A 3IWBA 2N3GA 1SR9A 1IQOA 4F9AB 4ZYEA 4DUZE 3J7AG 2JXPA 5A6KA 5LLQA 5AE1A 5A69A 3BF2A 2EMIA 3RMPA 1FJGE 1SFEA 2R76A 5F3WA 2LT7A 2EM5A 2YTGA 1MEYC 3EQ1A 3QG5C 3EPKA 2EMWA 2YTOA 1TF6A 4ZYDA 2LJUA 4O43A 2LTSA 1WRJA 2YWQA 2EPOA 1X6HA 2GHFA 1TF3A 1JK1A 2KOUA 1A1IA 2HC5A 4YHHE 2KONA 2JOBA 3DF6A 4B3ME 2EMXA 3F6HA 4KWYA 1ZBQA 2I13A 3L00A 1X6EA 3EPJA 1QNTA 2LMZA 2EPAA 3JTZA 2B3TB 2MDRA 3KWRA 4F54A 5IXMB 2JP9A 4NXNE 3ADGA 2RS7A 4LFCE 2EZ6A 5KL4A 2A25A 3UK3C 2N3HA 2EPMX 1NCSA 4BMJA 2EORA 4WXCA 2RTXA 1T4OA 1T4NA 2ENHA 1DQ3A 4R2EA 2DLQA 2EMHA 4LFAE 3MSWA 3OTOE 1P47A 2JY9A 2WBSA 3HPZA 5A6BD 2DRPA 2MDGA 5A6AA 1EH6A 1YYKA 4DR3E 2EMAA 3MHSC 2EJ4A 4TUGA 2HGHA 1BBGA 4L5NC 1HNWE 4BC7A 2L8TA 4R2PA 1L4SA 4M9VC 4X65E 4OOGC 1YFHA 2RS6A 5CFFE 3T1YE 2V89A 2EMFA 2EM4A 3C6KA 3ADIA 1J26A 3TQMA 1X5WA 1EKZA 2NABA 2L3JA 3FIGA 2EOSA 2YRHA 2EL4A 1NEIA 1UILA 2CPNA 2EOQA 3K6QA 1AH5A 1AAYA 2M7QA 4M30A 4BS9A 1F2IG 4GKJE 4DMIA 4MLVA 3J7Yp 2NA2A 4JI8E 4LF7E 1QU6A 2EPCA 3JU0A 2L2NA 1IBKE 1PJTA 4DUYE 1X47A 4GEQB 3OMLA 4DR2E 4DV3E 1UHZA 1GQEA 2EMCA 2LTRA 2F4VE 4OX9E 2RPCA 1B69A 2L2KB 2EOOA 4O24A 2EMGA 4M2ZA 2GLIA 4R2SA 1A1LA 4F2JC 2WCC3 4I8OA 2MC5A 1XMOE 1HNXE 5AASA 5IWAE 2G7HA 2EOIA 4Q35B 2M9AA 4TUIA 4LFBE 4WSGA 2YSOA 4R8OA 5AC4A 4HTGA 2YRMA 4WPYA 4X62E 3HTXA 3HQ1A 2EOMA 2V88A 2M4IA 3LLHA 3T1HE 2LO3A 1IBLE 4WSPA 3VHTB 4BC9A 4RHBB 2V87A 2ENAA 4MLQA 2UXDE 3C4BA 3IWDA 2IHR1 4M0VA 1YUJA 3AUZA 2JWOA 2DIXA 2LVHA 4X9JA 2YT4A 4NZVA 2I9IA 4P7DA 1ZBTA 1A1HA 2EM7A 2EQ0A 4DV4E 4RH8A 1YSAC 4DV6E 2JPAA 1Z1BA 3VYYA 2ODRD 3JAMC 1FKAE 2B9DA 2PRTA 2NUEA 1YUIA 2EMLA 2EP3A 2BB8A 1X49A 4O4KA 2JR1A 4WFTA 4BBYA 2ENCA 2NUGA 1XNQE 4KHPE 2EN7A 2EMZA 4DR1E 4IJDA 1N3GA 4YY3E 2JVAA 4ZYHA 4BCAA 1EH7A 1N34E 2B7VA 2HJJA 2LRSA 2H36X 4NXME 3BBGA 2R1FA 2EPXA 1PJQA 2EPRA 2ELYA 2VQFE 2WBUA 4JI4E 4DV7E 1N32E 2L2MA 1T39A 2EQ1A 1I94E 2EN1A 2LUQA 1TN9A 2NUFA 3THNA 1IMUA 2EN4A 5KL5A 4HEIA 4JV5E 2UUAE 1GZ6A 3VK6A 4F6MA 2J7JA 1PKPA 2EN3A 4LF9E 3MHHC 4AQYE 4DKKA 2EPPA 1G2FC 5LL6R 2RSIA 5LMUE 2YPNA 2L92A 2UU9E 4O5GA 2JOXA 3ECRA 3DJWA 2BBGA 2N8XA 4DV1E 1HNZE 2EM0A 4K0KE 1T38A 2LE2A 1STUA 2B7TA 3H09A 2YU5A 2YTQA 2UXBE 2K4VA 2EPKX 2ELZA 4R2CA 4JI0E 1O0WA 2DGCA 2FV4B 3F6GA 4GZNC 1ZAAC 1IBME 4GKKE 4LF8E 4JI1E 2EN2A 1RC7A 2EWLA 1DGCA 2YTJA 1WHNA 4BHBA 2GPIA 1RMDA 2EM9A 1KYQA 2V86A 4R2DA 2L33A 2V8QB 2HHHE 2YSPA 2JYAA
chains in the Genus database with same CATH topology
5KL3A 1YUJA 4F6NA 4R2AA 1A1JA 2ADRA 2LVHA 2VRDA 4X9JA 2YRKA 2ENHA 2EOHA 4R2EA 2DLQA 2EMHA 1A1HA 2EM7A 2EQ0A 1P47A 2EQ3A 2EM3A 2WBSA 1YSAC 2JPAA 2DRPA 1Z1BA 2EM8A 1UN6B 2MDGA 2EM6A 1A1FA 2EM2A 2EL5A 2EOYA 2PRTA 1ZU1A 1YUIA 2EMLA 2EP3A 2EMAA 3MHSC 1A1KA 2EJ4A 2BB8A 2EOXA 2HGHA 2MKNA 1A1GA 2ENCA 4R2PA 2CT1A 4M9VC 2EN7A 2EE8A 2EOEA 2EMZA 2LV2A 1BB8A 2YTIA 2EPUA 1LLMC 4IJDA 3EPLA 2CSHA 1WJPA 2CTDA 1KJKA 2EPZA 1UBDC 1X6FA 2EMFA 2EMKA 2EL6A 2EM4A 3M99B 2WBTA 2EMBA 2D9HA 2R1FA 1X5WA 4FK5C 2YTNA 2NABA 1JK2A 2EPXA 2EPRA 2EOSA 2YTPA 2YRHA 2ELYA 2EL4A 2E72A 2WBUA 4IS1C 2EOQA 1AAYA 2LCEA 1ZR9A 2EQ1A 1F2IG 2EN1A 1TN9A 5KL2A 4R2RA 2EN4A 5KL5A 2EPCA 2EOJA 4F6MA 2J7JA 2EMCA 2EMIA 2EN3A 2RPCA 3MHHC 2LT7A 2EM5A 2YTGA 2EPPA 4R2QA 1B69A 2EOOA 2EOFA 2EMWA 2YTOA 3EPKA 1G2FC 1TF6A 2EMGA 2EN6A 2GLIA 2RSIA 4R2SA 1A1LA 3EPHA 4F2JC 2WCC3 2EM0A 5KL7A 1X6HA 2GHFA 1TF3A 1JK1A 1A1IA 2YU5A 2YTQA 2EOIA 2DMIA 1BBOA 2ELZA 2EMYA 4R2CA 2M9AA 2YTFA 2DGCA 2EMXA 4WSGA 2YSOA 2I13A 2YTDA 2MKDA 4GZNC 1X3CA 2YRMA 1ZAAC 1X6EA 2EN8A 2EOZA 3EPJA 2EN2A 2EOMA 2YU8A 2EPAA 2LO3A 5KL6A 1DGCA 3VHTB 2YTJA 2JP9A 2ENAA 1RMDA 2EM9A 2DLKA 5KL4A 2A25A 4R2DA 3UK3C 1MEYC 1G2DC 2YTEA 1NCSA 2YSPA 2EORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KL3 A;  1YUJ A;  4F6N A;  4R2A A;  1A1J A;  2ADR A;  2LVH A;  2VRD A;  4X9J A;  2YRK A;  2ENH A;  2EOH A;  4R2E A;  2DLQ A;  2EMH A;  1A1H A;  2EM7 A;  2EQ0 A;  1P47 A;  2EQ3 A;  2EM3 A;  2WBS A;  1YSA C;  2JPA A;  2DRP A;  1Z1B A;  2EM8 A;  1UN6 B;  2MDG A;  2EM6 A;  1A1F A;  2EM2 A;  2EL5 A;  2EOY A;  2PRT A;  1ZU1 A;  1YUI A;  2EML A;  2EP3 A;  2EMA A;  3MHS C;  1A1K A;  2EJ4 A;  2BB8 A;  2EOX A;  2HGH A;  2MKN A;  1A1G A;  2ENC A;  4R2P A;  2CT1 A;  4M9V C;  2EN7 A;  2EE8 A;  2EOE A;  2EMZ A;  2LV2 A;  1BB8 A;  2YTI A;  2EPU A;  1LLM C;  4IJD A;  3EPL A;  2CSH A;  1WJP A;  2CTD A;  1KJK A;  2EPZ A;  1UBD C;  1X6F A;  2EMF A;  2EMK A;  2EL6 A;  2EM4 A;  3M99 B;  2WBT A;  2EMB A;  2D9H A;  2R1F A;  1X5W A;  4FK5 C;  2YTN A;  2NAB A;  1JK2 A;  2EPX A;  2EPR A;  2EOS A;  2YTP A;  2YRH A;  2ELY A;  2EL4 A;  2E72 A;  2WBU A;  4IS1 C;  2EOQ A;  1AAY A;  2LCE A;  1ZR9 A;  2EQ1 A;  1F2I G;  2EN1 A;  1TN9 A;  5KL2 A;  4R2R A;  2EN4 A;  5KL5 A;  2EPC A;  2EOJ A;  4F6M A;  2J7J A;  2EMC A;  2EMI A;  2EN3 A;  2RPC A;  3MHH C;  2LT7 A;  2EM5 A;  2YTG A;  2EPP A;  4R2Q A;  1B69 A;  2EOO A;  2EOF A;  2EMW A;  2YTO A;  3EPK A;  1G2F C;  1TF6 A;  2EMG A;  2EN6 A;  2GLI A;  2RSI A;  4R2S A;  1A1L A;  3EPH A;  4F2J C;  2WCC 3;  2EM0 A;  5KL7 A;  1X6H A;  2GHF A;  1TF3 A;  1JK1 A;  1A1I A;  2YU5 A;  2YTQ A;  2EOI A;  2DMI A;  1BBO A;  2ELZ A;  2EMY A;  4R2C A;  2M9A A;  2YTF A;  2DGC A;  2EMX A;  4WSG A;  2YSO A;  2I13 A;  2YTD A;  2MKD A;  4GZN C;  1X3C A;  2YRM A;  1ZAA C;  1X6E A;  2EN8 A;  2EOZ A;  3EPJ A;  2EN2 A;  2EOM A;  2YU8 A;  2EPA A;  2LO3 A;  5KL6 A;  1DGC A;  3VHT B;  2YTJ A;  2JP9 A;  2ENA A;  1RMD A;  2EM9 A;  2DLK A;  5KL4 A;  2A25 A;  4R2D A;  3UK3 C;  1MEY C;  1G2D C;  2YTE A;  1NCS A;  2YSP A;  2EOR A; 
#chains in the Genus database with same CATH topology
 3BGH A;  4R03 A;  5KL3 A;  2DB2 A;  1A1J A;  3HXL A;  2VRD A;  4Q28 A;  1T4L B;  3BID A;  3LML A;  4DV0 E;  4DR4 E;  3AV0 A;  2EQ3 A;  4F9B B;  4P78 A;  2EM8 A;  2EM6 A;  1A1F A;  4JI6 E;  2E1M A;  2EM2 A;  2EL5 A;  4BHC A;  3THO B;  5AE3 A;  2ODR C;  1N36 E;  1A1K A;  2EOX A;  1A1G A;  1J5E E;  2LJH A;  2CT1 A;  2VE7 C;  4WX9 A;  1RQ0 A;  2EE8 A;  2EOE A;  2LV2 A;  2EPU A;  1LLM C;  3EPL A;  2CSH A;  1KJK A;  2CTD A;  1IQS A;  2EPZ A;  2V85 A;  1UBD C;  1XNR E;  2Q8U A;  3IWC A;  3M99 B;  2FTX B;  2WBT A;  1YZ9 A;  2EMB A;  3ADJ A;  1YYW A;  4FK5 C;  1JK2 A;  2YTN A;  2L3C A;  1N33 E;  2YTP A;  2E72 A;  4DR7 E;  4IS1 C;  4JI5 E;  5IT9 C;  2VF1 A;  4F9C B;  4R2R A;  3C4T A;  2EOJ A;  2MC6 A;  2V83 A;  3HPS A;  4L8N A;  4R2Q A;  2EOF A;  2FGG A;  4ZYG A;  1YYO A;  2EN6 A;  3EPH A;  4X8W A;  1YPN A;  1HR0 E;  4NHR A;  2VQE E;  5KL7 A;  4DR6 E;  4LF6 E;  5TSE A;  5AE2 A;  4B3S E;  1DI2 A;  2DMI A;  3J80 C;  1BBO A;  2EPN A;  2EMY A;  4B3T E;  4JYA E;  2YTF A;  5AC5 A;  2DSY A;  2YTD A;  2MKD A;  1X3C A;  2EN8 A;  4X64 E;  2EOZ A;  2YU8 A;  2K7I A;  2WZO A;  4DV5 E;  5KL6 A;  4KZS A;  2RSM A;  5ADZ A;  2DLK A;  4WXD A;  2L6M A;  1G2D C;  2YTE A;  1GTK A;  5A6B A;  4F6N A;  4LU9 A;  4R2A A;  2M1S A;  2ADR A;  2YRK A;  1PDA A;  2UXC E;  2EOH A;  3C6M A;  5DNY A;  4DR5 E;  2LBS B;  2EM3 A;  1WHQ A;  5IV8 B;  1UN6 B;  2EPL X;  4DV2 E;  2F8B A;  4JI3 E;  5T6J A;  2EOY A;  1ZU1 A;  3ADL A;  5LMN E;  1EH8 A;  2KHX A;  4JI7 E;  2UUB E;  4X66 E;  2MKN A;  1MGT A;  3J81 C;  1WXR A;  5A2Q C;  1X48 A;  2RQL A;  4LF4 E;  4WYQ B;  2LUP B;  2ZM6 E;  1BB8 A;  2YTI A;  5BR8 E;  4JI2 E;  1WJP A;  2YZT A;  5FLX C;  1X6F A;  3VYX A;  3ZOQ B;  2EMK A;  2EL6 A;  2E5L E;  3KZY A;  2DMY A;  2D9H A;  1PJS A;  5A6J A;  4J8Z A;  2UUC E;  1XMQ E;  4B3R E;  4LTY A;  2LCE A;  1ZR9 A;  4N4R B;  3P1X A;  3KZZ A;  4LF5 E;  5KL2 A;  3IWB A;  2N3G A;  1SR9 A;  1IQO A;  4F9A B;  4ZYE A;  4DUZ E;  3J7A G;  2JXP A;  5A6K A;  5LLQ A;  5AE1 A;  5A69 A;  3BF2 A;  2EMI A;  3RMP A;  1FJG E;  1SFE A;  2R76 A;  5F3W A;  2LT7 A;  2EM5 A;  2YTG A;  1MEY C;  3EQ1 A;  3QG5 C;  3EPK A;  2EMW A;  2YTO A;  1TF6 A;  4ZYD A;  2LJU A;  4O43 A;  2LTS A;  1WRJ A;  2YWQ A;  2EPO A;  1X6H A;  2GHF A;  1TF3 A;  1JK1 A;  2KOU A;  1A1I A;  2HC5 A;  4YHH E;  2KON A;  2JOB A;  3DF6 A;  4B3M E;  2EMX A;  3F6H A;  4KWY A;  1ZBQ A;  2I13 A;  3L00 A;  1X6E A;  3EPJ A;  1QNT A;  2LMZ A;  2EPA A;  3JTZ A;  2B3T B;  2MDR A;  3KWR A;  4F54 A;  5IXM B;  2JP9 A;  4NXN E;  3ADG A;  2RS7 A;  4LFC E;  2EZ6 A;  5KL4 A;  2A25 A;  3UK3 C;  2N3H A;  2EPM X;  1NCS A;  4BMJ A;  2EOR A;  4WXC A;  2RTX A;  1T4O A;  1T4N A;  2ENH A;  1DQ3 A;  4R2E A;  2DLQ A;  2EMH A;  4LFA E;  3MSW A;  3OTO E;  1P47 A;  2JY9 A;  2WBS A;  3HPZ A;  5A6B D;  2DRP A;  2MDG A;  5A6A A;  1EH6 A;  1YYK A;  4DR3 E;  2EMA A;  3MHS C;  2EJ4 A;  4TUG A;  2HGH A;  1BBG A;  4L5N C;  1HNW E;  4BC7 A;  2L8T A;  4R2P A;  1L4S A;  4M9V C;  4X65 E;  4OOG C;  1YFH A;  2RS6 A;  5CFF E;  3T1Y E;  2V89 A;  2EMF A;  2EM4 A;  3C6K A;  3ADI A;  1J26 A;  3TQM A;  1X5W A;  1EKZ A;  2NAB A;  2L3J A;  3FIG A;  2EOS A;  2YRH A;  2EL4 A;  1NEI A;  1UIL A;  2CPN A;  2EOQ A;  3K6Q A;  1AH5 A;  1AAY A;  2M7Q A;  4M30 A;  4BS9 A;  1F2I G;  4GKJ E;  4DMI A;  4MLV A;  3J7Y p;  2NA2 A;  4JI8 E;  4LF7 E;  1QU6 A;  2EPC A;  3JU0 A;  2L2N A;  1IBK E;  1PJT A;  4DUY E;  1X47 A;  4GEQ B;  3OML A;  4DR2 E;  4DV3 E;  1UHZ A;  1GQE A;  2EMC A;  2LTR A;  2F4V E;  4OX9 E;  2RPC A;  1B69 A;  2L2K B;  2EOO A;  4O24 A;  2EMG A;  4M2Z A;  2GLI A;  4R2S A;  1A1L A;  4F2J C;  2WCC 3;  4I8O A;  2MC5 A;  1XMO E;  1HNX E;  5AAS A;  5IWA E;  2G7H A;  2EOI A;  4Q35 B;  2M9A A;  4TUI A;  4LFB E;  4WSG A;  2YSO A;  4R8O A;  5AC4 A;  4HTG A;  2YRM A;  4WPY A;  4X62 E;  3HTX A;  3HQ1 A;  2EOM A;  2V88 A;  2M4I A;  3LLH A;  3T1H E;  2LO3 A;  1IBL E;  4WSP A;  3VHT B;  4BC9 A;  4RHB B;  2V87 A;  2ENA A;  4MLQ A;  2UXD E;  3C4B A;  3IWD A;  2IHR 1;  4M0V A;  1YUJ A;  3AUZ A;  2JWO A;  2DIX A;  2LVH A;  4X9J A;  2YT4 A;  4NZV A;  2I9I A;  4P7D A;  1ZBT A;  1A1H A;  2EM7 A;  2EQ0 A;  4DV4 E;  4RH8 A;  1YSA C;  4DV6 E;  2JPA A;  1Z1B A;  3VYY A;  2ODR D;  3JAM C;  1FKA E;  2B9D A;  2PRT A;  2NUE A;  1YUI A;  2EML A;  2EP3 A;  2BB8 A;  1X49 A;  4O4K A;  2JR1 A;  4WFT A;  4BBY A;  2ENC A;  2NUG A;  1XNQ E;  4KHP E;  2EN7 A;  2EMZ A;  4DR1 E;  4IJD A;  1N3G A;  4YY3 E;  2JVA A;  4ZYH A;  4BCA A;  1EH7 A;  1N34 E;  2B7V A;  2HJJ A;  2LRS A;  2H36 X;  4NXM E;  3BBG A;  2R1F A;  2EPX A;  1PJQ A;  2EPR A;  2ELY A;  2VQF E;  2WBU A;  4JI4 E;  4DV7 E;  1N32 E;  2L2M A;  1T39 A;  2EQ1 A;  1I94 E;  2EN1 A;  2LUQ A;  1TN9 A;  2NUF A;  3THN A;  1IMU A;  2EN4 A;  5KL5 A;  4HEI A;  4JV5 E;  2UUA E;  1GZ6 A;  3VK6 A;  4F6M A;  2J7J A;  1PKP A;  2EN3 A;  4LF9 E;  3MHH C;  4AQY E;  4DKK A;  2EPP A;  1G2F C;  5LL6 R;  2RSI A;  5LMU E;  2YPN A;  2L92 A;  2UU9 E;  4O5G A;  2JOX A;  3ECR A;  3DJW A;  2BBG A;  2N8X A;  4DV1 E;  1HNZ E;  2EM0 A;  4K0K E;  1T38 A;  2LE2 A;  1STU A;  2B7T A;  3H09 A;  2YU5 A;  2YTQ A;  2UXB E;  2K4V A;  2EPK X;  2ELZ A;  4R2C A;  4JI0 E;  1O0W A;  2DGC A;  2FV4 B;  3F6G A;  4GZN C;  1ZAA C;  1IBM E;  4GKK E;  4LF8 E;  4JI1 E;  2EN2 A;  1RC7 A;  2EWL A;  1DGC A;  2YTJ A;  1WHN A;  4BHB A;  2GPI A;  1RMD A;  2EM9 A;  1KYQ A;  2V86 A;  4R2D A;  2L33 A;  2V8Q B;  2HHH E;  2YSP A;  2JYA A; 
#chains in the Genus database with same CATH homology
 5KL3 A;  1YUJ A;  4F6N A;  4R2A A;  1A1J A;  2ADR A;  2LVH A;  2VRD A;  4X9J A;  2YRK A;  2ENH A;  2EOH A;  4R2E A;  2DLQ A;  2EMH A;  1A1H A;  2EM7 A;  2EQ0 A;  1P47 A;  2EQ3 A;  2EM3 A;  2WBS A;  1YSA C;  2JPA A;  2DRP A;  1Z1B A;  2EM8 A;  1UN6 B;  2MDG A;  2EM6 A;  1A1F A;  2EM2 A;  2EL5 A;  2EOY A;  2PRT A;  1ZU1 A;  1YUI A;  2EML A;  2EP3 A;  2EMA A;  3MHS C;  1A1K A;  2EJ4 A;  2BB8 A;  2EOX A;  2HGH A;  2MKN A;  1A1G A;  2ENC A;  4R2P A;  2CT1 A;  4M9V C;  2EN7 A;  2EE8 A;  2EOE A;  2EMZ A;  2LV2 A;  1BB8 A;  2YTI A;  2EPU A;  1LLM C;  4IJD A;  3EPL A;  2CSH A;  1WJP A;  2CTD A;  1KJK A;  2EPZ A;  1UBD C;  1X6F A;  2EMF A;  2EMK A;  2EL6 A;  2EM4 A;  3M99 B;  2WBT A;  2EMB A;  2D9H A;  2R1F A;  1X5W A;  4FK5 C;  2YTN A;  2NAB A;  1JK2 A;  2EPX A;  2EPR A;  2EOS A;  2YTP A;  2YRH A;  2ELY A;  2EL4 A;  2E72 A;  2WBU A;  4IS1 C;  2EOQ A;  1AAY A;  2LCE A;  1ZR9 A;  2EQ1 A;  1F2I G;  2EN1 A;  1TN9 A;  5KL2 A;  4R2R A;  2EN4 A;  5KL5 A;  2EPC A;  2EOJ A;  4F6M A;  2J7J A;  2EMC A;  2EMI A;  2EN3 A;  2RPC A;  3MHH C;  2LT7 A;  2EM5 A;  2YTG A;  2EPP A;  4R2Q A;  1B69 A;  2EOO A;  2EOF A;  2EMW A;  2YTO A;  3EPK A;  1G2F C;  1TF6 A;  2EMG A;  2EN6 A;  2GLI A;  2RSI A;  4R2S A;  1A1L A;  3EPH A;  4F2J C;  2WCC 3;  2EM0 A;  5KL7 A;  1X6H A;  2GHF A;  1TF3 A;  1JK1 A;  1A1I A;  2YU5 A;  2YTQ A;  2EOI A;  2DMI A;  1BBO A;  2ELZ A;  2EMY A;  4R2C A;  2M9A A;  2YTF A;  2DGC A;  2EMX A;  4WSG A;  2YSO A;  2I13 A;  2YTD A;  2MKD A;  4GZN C;  1X3C A;  2YRM A;  1ZAA C;  1X6E A;  2EN8 A;  2EOZ A;  3EPJ A;  2EN2 A;  2EOM A;  2YU8 A;  2EPA A;  2LO3 A;  5KL6 A;  1DGC A;  3VHT B;  2YTJ A;  2JP9 A;  2ENA A;  1RMD A;  2EM9 A;  2DLK A;  5KL4 A;  2A25 A;  4R2D A;  3UK3 C;  1MEY C;  1G2D C;  2YTE A;  1NCS A;  2YSP A;  2EOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...