2EORA

Solution structure of the c2h2 type zinc finger (region 255-287) of human zinc finger protein 224
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYNCEECGKAFIHDSQLQEHQRIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 255-287) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
total genus 9
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eorA01
2EOFA 2RSIA 2EMGA 3EPKA 2GLIA 2J7JA 1TF6A 4M9VC 1KJKA 2EPRA 2EOJA 2EPPA 2EOQA 5KL6A 2NABA 2CT1A 2DMIA 2EMXA 1YUIA 2EORA 2EOHA 2EQ1A 1A1IA 2PRTA 4R2CA 2EOXA 2YRHA 2EMWA 2EM6A 2YTIA 2LCEA 1X5WA 2JP9A 4FK5C 2YTGA 4X9JA 2EOIA 1AAYA 1X6HA 2WCC3 2EN1A 2ELZA 1A1GA 2YTOA 5KL2A 2EN4A 1BBOA 1TF3A 2EQ3A 2EPCA 1ZR9A 2ENAA 4IJDA 2EOOA 1YSAC 2JPAA 2EOEA 4F2JC 1JK2A 1X3CA 2YU5A 1RMDA 1UBDC 2EPZA 4F6MA 2CTDA 2HGHA 2D9HA 3UK3C 2YTPA 2ENHA 2M9AA 2EJ4A 2EMAA 1DGCA 1X6FA 2EPAA 2I13A 4R2PA 1ZU1A 5KL7A 2YTFA 1WJPA 1MEYC 1NCSA 2EE8A 2LO3A 2EMYA 4IS1C 1Z1BA 2EOMA 2YTJA 4F6NA 2MDGA 2GHFA 1A1FA 2A25A 2EOSA 2ENCA 3EPHA 4R2AA 2YTQA 2EL5A 1ZAAC 2EMBA 1LLMC 2EOYA 3VHTB 2DRPA 2MKDA 1P47A 2YRKA 1X6EA 2EMFA 2EN7A 2EP3A 2EN8A 2YTEA 1A1JA 2EMCA 2LVHA 1A1KA 4R2DA 1B69A 2EMLA 4R2EA 2EOZA 2YU8A 2EMZA 2EN6A 2EM7A 2E72A 2WBSA 2LT7A 1G2FC 1BB8A 2EMIA 2EMHA 3MHHC 1UN6B 2DGCA 2R1FA 2YSOA 4R2SA 2EM9A 2EQ0A 2RPCA 1A1LA 2EM2A 3MHSC 2DLQA 2ELYA 2ADRA 2YRMA 5KL4A 1A1HA 2YTNA 2EPXA 2EN3A 2EM3A 4R2QA 4R2RA 1TN9A 2MKNA 2EM4A 1F2IG 2CSHA 2EM5A 1G2DC 2LV2A 2WBUA 5KL5A 2EL6A 3M99B 2EMKA 2EL4A 5KL3A 2DLKA 2EM0A 2YTDA 4WSGA 2EPUA 2BB8A 1YUJA 2WBTA 2EM8A 3EPLA 2EN2A 3EPJA 2VRDA 2YSPA 4GZNC 1JK1A
chains in the Genus database with same CATH superfamily
2LTRA 2RSIA 1IMUA 1WHNA 2J7JA 4M9VC 1GZ6A 5A6KA 2CT1A 1XNQE 2IHR1 4LFAE 2PRTA 4DR1E 1X49A 2YTIA 4BS9A 2VE7C 5LLQA 1X5WA 2B7VA 5F3WA 2VQEE 3MSWA 2HHHE 2FTXB 1A1GA 2YTOA 4X65E 1WRJA 2EPKX 2KHXA 2N3HA 2EPCA 2ENAA 1ZBTA 2EOOA 3JU0A 2JPAA 5A6JA 2EOEA 2L92A 4X66E 1X3CA 2EWLA 2UXBE 4NHRA 2EPLX 3THNA 4ZYHA 4DV5E 1RC7A 2M9AA 4DR4E 3JAMC 4OOGC 4KHPE 3THOB 4DV6E 4DUZE 1MEYC 1YFHA 2LO3A 4LF7E 4BMJA 2LJHA 3RMPA 1QNTA 2HC5A 3ADJA 2B9DA 2LUPB 1HNWE 4P7DA 1LLMC 4WXCA 2L3JA 2DRPA 4LFBE 4GEQB 1IQOA 4LF6E 1A1JA 5AE3A 2YT4A 1ZBQA 2LT7A 1G2FC 5IWAE 1BB8A 3MHHC 1UN6B 2YSOA 4ZYGA 1A1LA 2DIXA 5A6BD 4F9AB 2EN3A 2EM3A 1PJSA 4DV1E 3KZYA 3AV0A 2MKNA 2CSHA 4L5NC 4F9BB 1KYQA 3J81C 2EL6A 3M99B 5IXMB 5KL3A 2YTDA 1N34E 4BBYA 2F4VE 1T4LB 4DV0E 3HTXA 2EOFA 5A69A 2YPNA 1J5EE 2GLIA 1N33E 1SR9A 1KJKA 1WHQA 2V8QB 1T4OA 2EPRA 2JOBA 4M2ZA 1BBGA 1HNZE 2NABA 4X62E 2DMIA 2GPIA 2EOHA 1A1IA 3JTZA 4R2CA 2EOXA 2YRHA 4MLQA 1XMOE 2EMWA 3DF6A 4FK5C 4YY3E 2JR1A 2RQLA 4X9JA 2EOIA 1AAYA 4OX9E 4LF8E 2EN1A 1EH8A 2EPOA 4R03A 4ZYDA 2E1MA 1AH5A 4IJDA 4LF4E 1SFEA 4BC7A 3AUZA 3BIDA 1YSAC 2G7HA 1JK2A 2YU5A 2LJUA 1DI2A 2EPZA 4F6MA 2CTDA 4JI2E 2D9HA 2YTPA 2KONA 2EJ4A 2EMAA 1DGCA 1X6FA 2I13A 1ZU1A 5KL7A 2DMYA 3VK6A 1IBKE 1WJPA 1I94E 1PDAA 4TUGA 1XMQE 4O24A 3IWBA 2K7IA 3TQMA 2L2MA 3K6QA 2EOSA 5BR8E 2ENCA 4R2AA 2MC5A 1MGTA 2R76A 1UILA 5TSEA 1WXRA 2EN7A 2EP3A 2EMCA 1A1KA 1B69A 4R2EA 5LMUE 2M7QA 4JI8E 3HPZA 2EM7A 2E72A 4L8NA 4JI1E 2EMIA 5A6BA 2R1FA 5LMNE 2B7TA 4HEIA 2EQ0A 1A1HA 2YRMA 2K4VA 3L00A 4Q35B 5A2QC 2YTNA 2EPXA 4R8OA 4R2RA 4GKKE 2L8TA 2EPNA 2EM4A 1F2IG 3H09A 4RH8A 4O5GA 4B3ME 5KL5A 1RQ0A 4X64E 3ADGA 2EPUA 1PKPA 5DNYA 2WBTA 2V88A 4F9CB 5IV8B 2H36X 4N4RB 2VRDA 4YHHE 2YSPA 2NUGA 1L4SA 2EMGA 1TF6A 2MDRA 2EOJA 5KL6A 1YUIA 5IT9C 1GQEA 2EQ1A 4WPYA 4DV3E 1EH7A 4WXDA 3HQ1A 3ECRA 4DR3E 1X48A 2EM6A 2VQFE 4K0KE 1GTKA 1YYKA 2JP9A 4DR5E 4JV5E 1X6HA 2WCC3 4JI5E 2N3GA 2ODRC 5KL2A 2EN4A 3ADLA 4JI0E 4B3TE 2LE2A 2I9IA 4F2JC 2LBSB 2M1SA 4LU9A 3BBGA 1YPNA 5AC5A 1UBDC 4LF9E 3T1YE 3C6MA 3UK3C 2ODRD 2ENHA 4LFCE 2NUEA 3F6HA 4R2PA 2M4IA 3T1HE 4JI4E 1NEIA 1NCSA 2EE8A 4TUIA 4IS1C 2VF1A 3HXLA 4X8WA 1Z1BA 2UUCE 4F6NA 4NZVA 2MDGA 5ADZA 2A25A 2WZOA 2FGGA 3LMLA 3EPHA 2FV4B 2LRSA 1ZAAC 3FIGA 1YZ9A 3HPSA 4DR6E 2YZTA 3BGHA 2YRKA 1X6EA 4DKKA 2YWQA 2LVHA 1IBME 4R2DA 2EMLA 3C4BA 4WFTA 2YU8A 2RS7A 4DR2E 1EKZA 2L3CA 4DMIA 2NA2A 1YYWA 4KWYA 2DGCA 2V87A 2RPCA 2EM2A 2N8XA 2DLQA 5A6AA 2ADRA 5KL4A 4NXME 4JYAE 2L33A 1N3GA 4GKJE 1T38A 4DV4E 4R2QA 2NUFA 4BHBA 4JI3E 2B3TB 1J26A 2EM5A 1G2DC 4JI6E 1EH6A 3J80C 2KOUA 3C6KA 1X47A 2DLKA 2EM0A 3OTOE 1UHZA 4WSGA 3IWDA 2EM8A 1HNXE 2EN2A 2ZM6E 4B3RE 5AE1A 3F6GA 4P78A 1JK1A 4M30A 3QG5C 3EPKA 3P1XA 1XNRE 2EPPA 2EOQA 4KZSA 2EMXA 2EORA 3C4TA 2LUQA 3OMLA 4MLVA 4B3SE 2LCEA 4DV2E 5T6JA 3J7AG 2UUAE 2UXCE 2YTGA 4M0VA 2L2KB 4WX9A 2MC6A 2DB2A 4DR7E 1FJGE 2ELZA 1IBLE 1T4NA 1BBOA 1IQSA 1TF3A 2EQ3A 2RSMA 1ZR9A 2F8BA 2UU9E 2CPNA 2LMZA 2Q8UA 1RMDA 1STUA 2JVAA 2HGHA 4Q28A 2JYAA 1N32E 2JXPA 2EPAA 2JOXA 3IWCA 4JI7E 2BBGA 2YTFA 2RTXA 4O4KA 1PJTA 2JY9A 5AASA 2V86A 4HTGA 2EMYA 2LTSA 2EOMA 1O0WA 2YTJA 2JWOA 3ZOQB 2E5LE 4AQYE 2GHFA 1A1FA 3VYXA 2L2NA 1YYOA 2V85A 4BCAA 2YTQA 2EL5A 2EMBA 2EOYA 4LF5E 5AE2A 3VHTB 2MKDA 2UUBE 1P47A 2EMFA 3J7Yp 2EPMX 2EN8A 2YTEA 3KZZA 3VYYA 3EQ1A 2EOZA 2EMZA 2EN6A 2V83A 4F54A 3ADIA 4NXNE 2WBSA 5CFFE 4ZYEA 1T39A 2EMHA 2L6MA 1PJQA 4J8ZA 4R2SA 2EM9A 2EZ6A 4WYQB 3MHSC 2RS6A 2ELYA 1DQ3A 4DUYE 4BC9A 5FLXC 1HR0E 1N36E 3KWRA 3LLHA 4O43A 4DV7E 1TN9A 1QU6A 2UXDE 2LV2A 2WBUA 5LL6R 4RHBB 2EMKA 2EL4A 4LTYA 2V89A 4WSPA 4BHCA 3DJWA 2BB8A 1YUJA 3BF2A 4I8OA 5AC4A 3EPLA 3EPJA 2DSYA 1FKAE 4GZNC 2HJJA
chains in the Genus database with same CATH topology
2EOFA 2RSIA 2EMGA 3EPKA 2GLIA 2J7JA 1TF6A 4M9VC 1KJKA 2EPRA 2EOJA 2EPPA 2EOQA 5KL6A 2NABA 2CT1A 2DMIA 2EMXA 1YUIA 2EORA 2EOHA 2EQ1A 1A1IA 2PRTA 4R2CA 2EOXA 2YRHA 2EMWA 2EM6A 2YTIA 2LCEA 1X5WA 2JP9A 4FK5C 2YTGA 4X9JA 2EOIA 1AAYA 1X6HA 2WCC3 2EN1A 2ELZA 1A1GA 2YTOA 5KL2A 2EN4A 1BBOA 1TF3A 2EQ3A 2EPCA 1ZR9A 2ENAA 4IJDA 2EOOA 1YSAC 2JPAA 2EOEA 4F2JC 1JK2A 1X3CA 2YU5A 1RMDA 1UBDC 2EPZA 4F6MA 2CTDA 2HGHA 2D9HA 3UK3C 2YTPA 2ENHA 2M9AA 2EJ4A 2EMAA 1DGCA 1X6FA 2EPAA 2I13A 4R2PA 1ZU1A 5KL7A 2YTFA 1WJPA 1MEYC 1NCSA 2EE8A 2LO3A 2EMYA 4IS1C 1Z1BA 2EOMA 2YTJA 4F6NA 2MDGA 2GHFA 1A1FA 2A25A 2EOSA 2ENCA 3EPHA 4R2AA 2YTQA 2EL5A 1ZAAC 2EMBA 1LLMC 2EOYA 3VHTB 2DRPA 2MKDA 1P47A 2YRKA 1X6EA 2EMFA 2EN7A 2EP3A 2EN8A 2YTEA 1A1JA 2EMCA 2LVHA 1A1KA 4R2DA 1B69A 2EMLA 4R2EA 2EOZA 2YU8A 2EMZA 2EN6A 2EM7A 2E72A 2WBSA 2LT7A 1G2FC 1BB8A 2EMIA 2EMHA 3MHHC 1UN6B 2DGCA 2R1FA 2YSOA 4R2SA 2EM9A 2EQ0A 2RPCA 1A1LA 2EM2A 3MHSC 2DLQA 2ELYA 2ADRA 2YRMA 5KL4A 1A1HA 2YTNA 2EPXA 2EN3A 2EM3A 4R2QA 4R2RA 1TN9A 2MKNA 2EM4A 1F2IG 2CSHA 2EM5A 1G2DC 2LV2A 2WBUA 5KL5A 2EL6A 3M99B 2EMKA 2EL4A 5KL3A 2DLKA 2EM0A 2YTDA 4WSGA 2EPUA 2BB8A 1YUJA 2WBTA 2EM8A 3EPLA 2EN2A 3EPJA 2VRDA 2YSPA 4GZNC 1JK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOF A;  2RSI A;  2EMG A;  3EPK A;  2GLI A;  2J7J A;  1TF6 A;  4M9V C;  1KJK A;  2EPR A;  2EOJ A;  2EPP A;  2EOQ A;  5KL6 A;  2NAB A;  2CT1 A;  2DMI A;  2EMX A;  1YUI A;  2EOR A;  2EOH A;  2EQ1 A;  1A1I A;  2PRT A;  4R2C A;  2EOX A;  2YRH A;  2EMW A;  2EM6 A;  2YTI A;  2LCE A;  1X5W A;  2JP9 A;  4FK5 C;  2YTG A;  4X9J A;  2EOI A;  1AAY A;  1X6H A;  2WCC 3;  2EN1 A;  2ELZ A;  1A1G A;  2YTO A;  5KL2 A;  2EN4 A;  1BBO A;  1TF3 A;  2EQ3 A;  2EPC A;  1ZR9 A;  2ENA A;  4IJD A;  2EOO A;  1YSA C;  2JPA A;  2EOE A;  4F2J C;  1JK2 A;  1X3C A;  2YU5 A;  1RMD A;  1UBD C;  2EPZ A;  4F6M A;  2CTD A;  2HGH A;  2D9H A;  3UK3 C;  2YTP A;  2ENH A;  2M9A A;  2EJ4 A;  2EMA A;  1DGC A;  1X6F A;  2EPA A;  2I13 A;  4R2P A;  1ZU1 A;  5KL7 A;  2YTF A;  1WJP A;  1MEY C;  1NCS A;  2EE8 A;  2LO3 A;  2EMY A;  4IS1 C;  1Z1B A;  2EOM A;  2YTJ A;  4F6N A;  2MDG A;  2GHF A;  1A1F A;  2A25 A;  2EOS A;  2ENC A;  3EPH A;  4R2A A;  2YTQ A;  2EL5 A;  1ZAA C;  2EMB A;  1LLM C;  2EOY A;  3VHT B;  2DRP A;  2MKD A;  1P47 A;  2YRK A;  1X6E A;  2EMF A;  2EN7 A;  2EP3 A;  2EN8 A;  2YTE A;  1A1J A;  2EMC A;  2LVH A;  1A1K A;  4R2D A;  1B69 A;  2EML A;  4R2E A;  2EOZ A;  2YU8 A;  2EMZ A;  2EN6 A;  2EM7 A;  2E72 A;  2WBS A;  2LT7 A;  1G2F C;  1BB8 A;  2EMI A;  2EMH A;  3MHH C;  1UN6 B;  2DGC A;  2R1F A;  2YSO A;  4R2S A;  2EM9 A;  2EQ0 A;  2RPC A;  1A1L A;  2EM2 A;  3MHS C;  2DLQ A;  2ELY A;  2ADR A;  2YRM A;  5KL4 A;  1A1H A;  2YTN A;  2EPX A;  2EN3 A;  2EM3 A;  4R2Q A;  4R2R A;  1TN9 A;  2MKN A;  2EM4 A;  1F2I G;  2CSH A;  2EM5 A;  1G2D C;  2LV2 A;  2WBU A;  5KL5 A;  2EL6 A;  3M99 B;  2EMK A;  2EL4 A;  5KL3 A;  2DLK A;  2EM0 A;  2YTD A;  4WSG A;  2EPU A;  2BB8 A;  1YUJ A;  2WBT A;  2EM8 A;  3EPL A;  2EN2 A;  3EPJ A;  2VRD A;  2YSP A;  4GZN C;  1JK1 A; 
#chains in the Genus database with same CATH topology
 2LTR A;  2RSI A;  1IMU A;  1WHN A;  2J7J A;  4M9V C;  1GZ6 A;  5A6K A;  2CT1 A;  1XNQ E;  2IHR 1;  4LFA E;  2PRT A;  4DR1 E;  1X49 A;  2YTI A;  4BS9 A;  2VE7 C;  5LLQ A;  1X5W A;  2B7V A;  5F3W A;  2VQE E;  3MSW A;  2HHH E;  2FTX B;  1A1G A;  2YTO A;  4X65 E;  1WRJ A;  2EPK X;  2KHX A;  2N3H A;  2EPC A;  2ENA A;  1ZBT A;  2EOO A;  3JU0 A;  2JPA A;  5A6J A;  2EOE A;  2L92 A;  4X66 E;  1X3C A;  2EWL A;  2UXB E;  4NHR A;  2EPL X;  3THN A;  4ZYH A;  4DV5 E;  1RC7 A;  2M9A A;  4DR4 E;  3JAM C;  4OOG C;  4KHP E;  3THO B;  4DV6 E;  4DUZ E;  1MEY C;  1YFH A;  2LO3 A;  4LF7 E;  4BMJ A;  2LJH A;  3RMP A;  1QNT A;  2HC5 A;  3ADJ A;  2B9D A;  2LUP B;  1HNW E;  4P7D A;  1LLM C;  4WXC A;  2L3J A;  2DRP A;  4LFB E;  4GEQ B;  1IQO A;  4LF6 E;  1A1J A;  5AE3 A;  2YT4 A;  1ZBQ A;  2LT7 A;  1G2F C;  5IWA E;  1BB8 A;  3MHH C;  1UN6 B;  2YSO A;  4ZYG A;  1A1L A;  2DIX A;  5A6B D;  4F9A B;  2EN3 A;  2EM3 A;  1PJS A;  4DV1 E;  3KZY A;  3AV0 A;  2MKN A;  2CSH A;  4L5N C;  4F9B B;  1KYQ A;  3J81 C;  2EL6 A;  3M99 B;  5IXM B;  5KL3 A;  2YTD A;  1N34 E;  4BBY A;  2F4V E;  1T4L B;  4DV0 E;  3HTX A;  2EOF A;  5A69 A;  2YPN A;  1J5E E;  2GLI A;  1N33 E;  1SR9 A;  1KJK A;  1WHQ A;  2V8Q B;  1T4O A;  2EPR A;  2JOB A;  4M2Z A;  1BBG A;  1HNZ E;  2NAB A;  4X62 E;  2DMI A;  2GPI A;  2EOH A;  1A1I A;  3JTZ A;  4R2C A;  2EOX A;  2YRH A;  4MLQ A;  1XMO E;  2EMW A;  3DF6 A;  4FK5 C;  4YY3 E;  2JR1 A;  2RQL A;  4X9J A;  2EOI A;  1AAY A;  4OX9 E;  4LF8 E;  2EN1 A;  1EH8 A;  2EPO A;  4R03 A;  4ZYD A;  2E1M A;  1AH5 A;  4IJD A;  4LF4 E;  1SFE A;  4BC7 A;  3AUZ A;  3BID A;  1YSA C;  2G7H A;  1JK2 A;  2YU5 A;  2LJU A;  1DI2 A;  2EPZ A;  4F6M A;  2CTD A;  4JI2 E;  2D9H A;  2YTP A;  2KON A;  2EJ4 A;  2EMA A;  1DGC A;  1X6F A;  2I13 A;  1ZU1 A;  5KL7 A;  2DMY A;  3VK6 A;  1IBK E;  1WJP A;  1I94 E;  1PDA A;  4TUG A;  1XMQ E;  4O24 A;  3IWB A;  2K7I A;  3TQM A;  2L2M A;  3K6Q A;  2EOS A;  5BR8 E;  2ENC A;  4R2A A;  2MC5 A;  1MGT A;  2R76 A;  1UIL A;  5TSE A;  1WXR A;  2EN7 A;  2EP3 A;  2EMC A;  1A1K A;  1B69 A;  4R2E A;  5LMU E;  2M7Q A;  4JI8 E;  3HPZ A;  2EM7 A;  2E72 A;  4L8N A;  4JI1 E;  2EMI A;  5A6B A;  2R1F A;  5LMN E;  2B7T A;  4HEI A;  2EQ0 A;  1A1H A;  2YRM A;  2K4V A;  3L00 A;  4Q35 B;  5A2Q C;  2YTN A;  2EPX A;  4R8O A;  4R2R A;  4GKK E;  2L8T A;  2EPN A;  2EM4 A;  1F2I G;  3H09 A;  4RH8 A;  4O5G A;  4B3M E;  5KL5 A;  1RQ0 A;  4X64 E;  3ADG A;  2EPU A;  1PKP A;  5DNY A;  2WBT A;  2V88 A;  4F9C B;  5IV8 B;  2H36 X;  4N4R B;  2VRD A;  4YHH E;  2YSP A;  2NUG A;  1L4S A;  2EMG A;  1TF6 A;  2MDR A;  2EOJ A;  5KL6 A;  1YUI A;  5IT9 C;  1GQE A;  2EQ1 A;  4WPY A;  4DV3 E;  1EH7 A;  4WXD A;  3HQ1 A;  3ECR A;  4DR3 E;  1X48 A;  2EM6 A;  2VQF E;  4K0K E;  1GTK A;  1YYK A;  2JP9 A;  4DR5 E;  4JV5 E;  1X6H A;  2WCC 3;  4JI5 E;  2N3G A;  2ODR C;  5KL2 A;  2EN4 A;  3ADL A;  4JI0 E;  4B3T E;  2LE2 A;  2I9I A;  4F2J C;  2LBS B;  2M1S A;  4LU9 A;  3BBG A;  1YPN A;  5AC5 A;  1UBD C;  4LF9 E;  3T1Y E;  3C6M A;  3UK3 C;  2ODR D;  2ENH A;  4LFC E;  2NUE A;  3F6H A;  4R2P A;  2M4I A;  3T1H E;  4JI4 E;  1NEI A;  1NCS A;  2EE8 A;  4TUI A;  4IS1 C;  2VF1 A;  3HXL A;  4X8W A;  1Z1B A;  2UUC E;  4F6N A;  4NZV A;  2MDG A;  5ADZ A;  2A25 A;  2WZO A;  2FGG A;  3LML A;  3EPH A;  2FV4 B;  2LRS A;  1ZAA C;  3FIG A;  1YZ9 A;  3HPS A;  4DR6 E;  2YZT A;  3BGH A;  2YRK A;  1X6E A;  4DKK A;  2YWQ A;  2LVH A;  1IBM E;  4R2D A;  2EML A;  3C4B A;  4WFT A;  2YU8 A;  2RS7 A;  4DR2 E;  1EKZ A;  2L3C A;  4DMI A;  2NA2 A;  1YYW A;  4KWY A;  2DGC A;  2V87 A;  2RPC A;  2EM2 A;  2N8X A;  2DLQ A;  5A6A A;  2ADR A;  5KL4 A;  4NXM E;  4JYA E;  2L33 A;  1N3G A;  4GKJ E;  1T38 A;  4DV4 E;  4R2Q A;  2NUF A;  4BHB A;  4JI3 E;  2B3T B;  1J26 A;  2EM5 A;  1G2D C;  4JI6 E;  1EH6 A;  3J80 C;  2KOU A;  3C6K A;  1X47 A;  2DLK A;  2EM0 A;  3OTO E;  1UHZ A;  4WSG A;  3IWD A;  2EM8 A;  1HNX E;  2EN2 A;  2ZM6 E;  4B3R E;  5AE1 A;  3F6G A;  4P78 A;  1JK1 A;  4M30 A;  3QG5 C;  3EPK A;  3P1X A;  1XNR E;  2EPP A;  2EOQ A;  4KZS A;  2EMX A;  2EOR A;  3C4T A;  2LUQ A;  3OML A;  4MLV A;  4B3S E;  2LCE A;  4DV2 E;  5T6J A;  3J7A G;  2UUA E;  2UXC E;  2YTG A;  4M0V A;  2L2K B;  4WX9 A;  2MC6 A;  2DB2 A;  4DR7 E;  1FJG E;  2ELZ A;  1IBL E;  1T4N A;  1BBO A;  1IQS A;  1TF3 A;  2EQ3 A;  2RSM A;  1ZR9 A;  2F8B A;  2UU9 E;  2CPN A;  2LMZ A;  2Q8U A;  1RMD A;  1STU A;  2JVA A;  2HGH A;  4Q28 A;  2JYA A;  1N32 E;  2JXP A;  2EPA A;  2JOX A;  3IWC A;  4JI7 E;  2BBG A;  2YTF A;  2RTX A;  4O4K A;  1PJT A;  2JY9 A;  5AAS A;  2V86 A;  4HTG A;  2EMY A;  2LTS A;  2EOM A;  1O0W A;  2YTJ A;  2JWO A;  3ZOQ B;  2E5L E;  4AQY E;  2GHF A;  1A1F A;  3VYX A;  2L2N A;  1YYO A;  2V85 A;  4BCA A;  2YTQ A;  2EL5 A;  2EMB A;  2EOY A;  4LF5 E;  5AE2 A;  3VHT B;  2MKD A;  2UUB E;  1P47 A;  2EMF A;  3J7Y p;  2EPM X;  2EN8 A;  2YTE A;  3KZZ A;  3VYY A;  3EQ1 A;  2EOZ A;  2EMZ A;  2EN6 A;  2V83 A;  4F54 A;  3ADI A;  4NXN E;  2WBS A;  5CFF E;  4ZYE A;  1T39 A;  2EMH A;  2L6M A;  1PJQ A;  4J8Z A;  4R2S A;  2EM9 A;  2EZ6 A;  4WYQ B;  3MHS C;  2RS6 A;  2ELY A;  1DQ3 A;  4DUY E;  4BC9 A;  5FLX C;  1HR0 E;  1N36 E;  3KWR A;  3LLH A;  4O43 A;  4DV7 E;  1TN9 A;  1QU6 A;  2UXD E;  2LV2 A;  2WBU A;  5LL6 R;  4RHB B;  2EMK A;  2EL4 A;  4LTY A;  2V89 A;  4WSP A;  4BHC A;  3DJW A;  2BB8 A;  1YUJ A;  3BF2 A;  4I8O A;  5AC4 A;  3EPL A;  3EPJ A;  2DSY A;  1FKA E;  4GZN C;  2HJJ A; 
#chains in the Genus database with same CATH homology
 2EOF A;  2RSI A;  2EMG A;  3EPK A;  2GLI A;  2J7J A;  1TF6 A;  4M9V C;  1KJK A;  2EPR A;  2EOJ A;  2EPP A;  2EOQ A;  5KL6 A;  2NAB A;  2CT1 A;  2DMI A;  2EMX A;  1YUI A;  2EOR A;  2EOH A;  2EQ1 A;  1A1I A;  2PRT A;  4R2C A;  2EOX A;  2YRH A;  2EMW A;  2EM6 A;  2YTI A;  2LCE A;  1X5W A;  2JP9 A;  4FK5 C;  2YTG A;  4X9J A;  2EOI A;  1AAY A;  1X6H A;  2WCC 3;  2EN1 A;  2ELZ A;  1A1G A;  2YTO A;  5KL2 A;  2EN4 A;  1BBO A;  1TF3 A;  2EQ3 A;  2EPC A;  1ZR9 A;  2ENA A;  4IJD A;  2EOO A;  1YSA C;  2JPA A;  2EOE A;  4F2J C;  1JK2 A;  1X3C A;  2YU5 A;  1RMD A;  1UBD C;  2EPZ A;  4F6M A;  2CTD A;  2HGH A;  2D9H A;  3UK3 C;  2YTP A;  2ENH A;  2M9A A;  2EJ4 A;  2EMA A;  1DGC A;  1X6F A;  2EPA A;  2I13 A;  4R2P A;  1ZU1 A;  5KL7 A;  2YTF A;  1WJP A;  1MEY C;  1NCS A;  2EE8 A;  2LO3 A;  2EMY A;  4IS1 C;  1Z1B A;  2EOM A;  2YTJ A;  4F6N A;  2MDG A;  2GHF A;  1A1F A;  2A25 A;  2EOS A;  2ENC A;  3EPH A;  4R2A A;  2YTQ A;  2EL5 A;  1ZAA C;  2EMB A;  1LLM C;  2EOY A;  3VHT B;  2DRP A;  2MKD A;  1P47 A;  2YRK A;  1X6E A;  2EMF A;  2EN7 A;  2EP3 A;  2EN8 A;  2YTE A;  1A1J A;  2EMC A;  2LVH A;  1A1K A;  4R2D A;  1B69 A;  2EML A;  4R2E A;  2EOZ A;  2YU8 A;  2EMZ A;  2EN6 A;  2EM7 A;  2E72 A;  2WBS A;  2LT7 A;  1G2F C;  1BB8 A;  2EMI A;  2EMH A;  3MHH C;  1UN6 B;  2DGC A;  2R1F A;  2YSO A;  4R2S A;  2EM9 A;  2EQ0 A;  2RPC A;  1A1L A;  2EM2 A;  3MHS C;  2DLQ A;  2ELY A;  2ADR A;  2YRM A;  5KL4 A;  1A1H A;  2YTN A;  2EPX A;  2EN3 A;  2EM3 A;  4R2Q A;  4R2R A;  1TN9 A;  2MKN A;  2EM4 A;  1F2I G;  2CSH A;  2EM5 A;  1G2D C;  2LV2 A;  2WBU A;  5KL5 A;  2EL6 A;  3M99 B;  2EMK A;  2EL4 A;  5KL3 A;  2DLK A;  2EM0 A;  2YTD A;  4WSG A;  2EPU A;  2BB8 A;  1YUJ A;  2WBT A;  2EM8 A;  3EPL A;  2EN2 A;  3EPJ A;  2VRD A;  2YSP A;  4GZN C;  1JK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...