2EORA

Solution structure of the c2h2 type zinc finger (region 255-287) of human zinc finger protein 224
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGTGEKPYNCEECGKAFIHDSQLQEHQRIHTGEKPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 255-287) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 9
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eorA01
4IS1C 4F6MA 2DGCA 3EPLA 2ELZA 4FK5C 1YUJA 2EMYA 2BB8A 3EPKA 2VRDA 2YU8A 2GHFA 1UBDC 2D9HA 2EOOA 2EPXA 1RMDA 2EMGA 2EOXA 2EQ0A 1X5WA 2MDGA 2WBTA 2YTQA 2YRMA 2WBUA 1A1JA 2LVHA 2JP9A 2EN7A 2LO3A 2EMAA 1WJPA 5KL2A 2EM4A 2M9AA 1TN9A 2JPAA 1B69A 5KL5A 4R2EA 1A1GA 2MKNA 1X6FA 1ZAAC 2EM6A 4R2DA 2ENCA 4R2CA 2EL4A 2LCEA 5KL7A 2YU5A 4M9VC 1BBOA 1AAYA 1X6EA 2EN6A 1X6HA 2EPUA 2YTJA 5KL4A 1ZU1A 3UK3C 1UN6B 2YTPA 2YTOA 2EJ4A 2YTNA 2DLQA 2EN1A 2EL5A 2EOJA 1ZR9A 2YTFA 2EOMA 2WBSA 2HGHA 2EMZA 2NABA 2EQ3A 2EMFA 4F2JC 2YSPA 2YTEA 2EM7A 2EOFA 2ADRA 4GZNC 2EPRA 2J7JA 2CSHA 1Z1BA 2EMXA 2EN4A 2PRTA 2I13A 2EN3A 1P47A 1A1LA 2EM9A 2EM8A 1JK1A 1MEYC 1YUIA 2EM3A 2EPPA 2YTGA 1TF6A 1JK2A 2E72A 1A1HA 2EMHA 2EPCA 2EN2A 2YTDA 5KL3A 4R2AA 2EOHA 2EM5A 2EORA 2DRPA 2RPCA 2ENHA 2DMIA 2LV2A 4WSGA 1G2FC 2LT7A 2EOSA 2RSIA 2CTDA 4R2RA 2EMLA 1G2DC 2EOZA 2ENAA 2EOQA 1BB8A 2YRKA 2DLKA 4R2QA 1YSAC 2EN8A 4R2PA 1F2IG 4R2SA 1TF3A 2R1FA 2EOEA 2GLIA 2A25A 3M99B 3EPHA 2EMKA 2EMCA 3VHTB 2EE8A 2EMIA 2EPZA 4X9JA 1A1KA 2EM2A 2YRHA 2CT1A 3MHSC 2EP3A 2YTIA 2EMBA 3MHHC 3EPJA 2YSOA 4F6NA 2MKDA 1A1FA 2ELYA 2EM0A 2EL6A 4IJDA 1LLMC 1A1IA 5KL6A 2EQ1A 1X3CA 2WCC3 1DGCA 1KJKA 2EMWA 1NCSA 2EOYA 2EOIA 2EPAA
chains in the Genus database with same CATH superfamily
1XMQE 4F6MA 3EPLA 2IHR1 3HPSA 1UILA 1IQOA 4GKJE 1DI2A 2BB8A 1EKZA 2YU8A 4F9CB 2GHFA 4L5NC 1J5EE 1UBDC 1T4NA 2EQ0A 1N34E 4B3ME 4JV5E 4DV4E 2RTXA 3P1XA 2EMAA 2EM4A 1FKAE 1TN9A 1YFHA 1B69A 1N32E 1A1GA 4ZYHA 2MKNA 2LRSA 5IXMB 4WPYA 1J26A 2MDRA 4ZYGA 1GZ6A 2UXCE 1X6EA 3VYYA 5A6BA 2EPUA 1WHNA 1YYKA 5KL4A 1ZU1A 2YTPA 2EJ4A 2DLQA 3J80C 1T38A 2EN1A 2EOJA 2YTFA 2VF1A 2WBSA 2B3TB 2EPLX 1ZBTA 2NABA 4TUGA 4ZYDA 1N36E 2UUAE 4OOGC 2ADRA 2L2MA 2EPRA 2L6MA 2CSHA 1Z1BA 2EMXA 2EN4A 3HQ1A 3T1YE 4JI6E 2I13A 2EN3A 1JK1A 4O24A 4NXME 1YUIA 4O43A 5FLXC 3ZOQB 1EH8A 2JOXA 2E72A 2LJUA 1JK2A 2YTDA 5KL3A 2EOHA 4DR7E 2DRPA 4LF5E 5A6BD 2LT7A 2EOSA 2MC6A 2JY9A 2EOQA 3AUZA 4WXCA 2DLKA 2JXPA 3HPZA 4BMJA 4R2QA 4DUZE 4AQYE 3THOB 1YSAC 3ADGA 2EN8A 2R1FA 1XMOE 4K0KE 4TUIA 2KHXA 2RSMA 3KWRA 4B3RE 2YRHA 1PJQA 3MHSC 2MKDA 2UXBE 3QG5C 1X3CA 4DV3E 4BC7A 2LJHA 5A2QC 2L2KB 1I94E 1EH6A 4DR1E 4LF8E 3BBGA 4L8NA 2LE2A 2EOIA 2EPAA 2YSOA 4IS1C 5A69A 4JI3E 1HNWE 3BGHA 3VK6A 1YPNA 2K4VA 2EPXA 3JAMC 5F3WA 4LFBE 2MDGA 3J81C 4F54A 1A1JA 2L92A 4LF9E 2M1SA 2ZM6E 2LTRA 5KL2A 5LL6R 2LBSB 4JI8E 5AE1A 2JPAA 3RMPA 4Q35B 4RH8A 3C4TA 2B7VA 2ENCA 4DR4E 2HC5A 2YU5A 4N4RB 4M9VC 4DV7E 1AAYA 4GEQB 5IV8B 1HR0E 4X8WA 2YTNA 2FGGA 2YPNA 5AE2A 1ZR9A 5IWAE 4J8ZA 3H09A 1UHZA 2WZOA 2NUEA 3THNA 3DF6A 4NHRA 2GPIA 2PRTA 1YYOA 1P47A 2KONA 1A1LA 2UU9E 5A6AA 2UUCE 2EM3A 2EPPA 4LU9A 1TF6A 2EPCA 2EN2A 1HNZE 2UUBE 5AE3A 2L3CA 2RPCA 2DMIA 1G2FC 1IMUA 1STUA 2FTXB 2RSIA 1YZ9A 2EPMX 4WSPA 2JYAA 5TSEA 3C6KA 2E5LE 1G2DC 2EOZA 2HJJA 1WRJA 4JI0E 2N8XA 4ZYEA 3ADJA 2NA2A 4KZSA 2V86A 4R2PA 1F2IG 4R2SA 2EOEA 4HEIA 1EH7A 3M99B 3EPHA 5AASA 4X65E 2EE8A 2EPZA 3AV0A 4KWYA 1XNRE 1PJTA 1T4OA 2RS7A 1A1FA 4X62E 2DSYA 2VQFE 1N33E 5A6JA 1KJKA 2EMWA 1GTKA 4BS9A 2LTSA 2EPKX 2MC5A 2DIXA 1X48A 1YUJA 2EOOA 1DQ3A 1RMDA 2EMGA 3BF2A 4M0VA 3MSWA 3LMLA 1WHQA 2LVHA 1O0WA 2JP9A 4R8OA 3FIGA 2EWLA 2H36X 3EQ1A 1WJPA 3BIDA 2F4VE 3KZZA 2I9IA 4R2EA 1ZBQA 1X6FA 1ZAAC 2FV4B 1BBGA 2EL4A 2LCEA 2NUFA 3JTZA 2KOUA 4JI5E 4O4KA 2UXDE 4DR2E 4F9AB 2ODRD 2V87A 5CFFE 2EOMA 2HGHA 2EMFA 2YTEA 1GQEA 2L2NA 4DKKA 2R76A 1IBKE 2JWOA 2YT4A 4GZNC 1T39A 2Q8UA 2J7JA 2EM9A 2EM8A 4DV6E 2YTGA 1IBME 1A1HA 4LFCE 2V88A 3OMLA 1RQ0A 4R2AA 4M2ZA 2G7HA 4JI1E 4MLQA 4BBYA 2EM5A 3LLHA 1X47A 2ENHA 2LV2A 4WSGA 3KZYA 5LMUE 2VE7C 4LF6E 4JI4E 2CTDA 4Q28A 3IWDA 2EMLA 3F6GA 4JI7E 4B3TE 2L8TA 2B7TA 1BB8A 2YRKA 1IBLE 4OX9E 4HTGA 1XNQE 1PJSA 4BHBA 2V8QB 3J7AG 3IWCA 2A25A 2EMCA 3K6QA 3DJWA 2L33A 3VHTB 2EMIA 2V85A 2EZ6A 1A1KA 1NEIA 2EM2A 4GKKE 2V89A 4KHPE 2EMBA 3EPJA 4F6NA 5A6KA 1L4SA 2RQLA 4BCAA 2EM0A 4IJDA 5LMNE 1LLMC 2EQ1A 4DV1E 4P78A 4WYQB 4LTYA 1SR9A 3F6HA 1NCSA 2EOYA 2D9HA 1QNTA 3HXLA 2DGCA 4NXNE 2ELZA 4FK5C 2EMYA 1MGTA 2M4IA 2DMYA 3EPKA 2VRDA 5AC5A 4X64E 1HNXE 4YY3E 1YYWA 2YTQA 2YRMA 2EOXA 2WBTA 1X5WA 3ECRA 2WBUA 4RHBB 4YHHE 4WXDA 2DB2A 2EN7A 2LO3A 4NZVA 1WXRA 5AC4A 1FJGE 2LUQA 2M9AA 1T4LB 2CPNA 5KL5A 2JVAA 4BHCA 3L00A 5BR8E 2VQEE 2EM6A 2LUPB 4R2DA 4R2CA 2NUGA 5KL7A 2N3HA 1BBOA 4LFAE 4M30A 2K7IA 2ODRC 4DUYE 2EN6A 1X6HA 4LF7E 2YTJA 1UN6B 2L3JA 3UK3C 1AH5A 2YTOA 2YWQA 3OTOE 1QU6A 2EL5A 4DV2E 4LF4E 2EPNA 2EMZA 4DR6E 5ADZA 2EQ3A 4F2JC 2V83A 2YSPA 2F8BA 3T1HE 2EM7A 2HHHE 4X66E 2EOFA 1PDAA 5DNYA 1MEYC 4DV0E 3J7Yp 4DR3E 2YZTA 4DV5E 1X49A 3C6MA 4DMIA 2EMHA 3ADLA 2RS6A 3C4BA 1N3GA 4WX9A 3JU0A 2EORA 1KYQA 2BBGA 2M7QA 4JI2E 4MLVA 2EPOA 1PKPA 3ADIA 5T6JA 4R2RA 3IWBA 2ENAA 5LLQA 1IQSA 2JOBA 2LMZA 2E1MA 4O5GA 4I8OA 1TF3A 4R03A 2GLIA 3HTXA 4P7DA 4DR5E 1RC7A 1SFEA 2EMKA 3VYXA 4JYAE 2B9DA 4X9JA 2CT1A 4F9BB 4BC9A 2EP3A 2YTIA 3MHHC 4B3SE 3TQMA 2ELYA 2EL6A 1A1IA 1DGCA 5KL6A 2WCC3 2N3GA 5IT9C 2JR1A 4WFTA
chains in the Genus database with same CATH topology
4IS1C 4F6MA 2DGCA 3EPLA 2ELZA 4FK5C 1YUJA 2EMYA 2BB8A 3EPKA 2VRDA 2YU8A 2GHFA 1UBDC 2D9HA 2EOOA 2EPXA 1RMDA 2EMGA 2EOXA 2EQ0A 1X5WA 2MDGA 2WBTA 2YTQA 2YRMA 2WBUA 1A1JA 2LVHA 2JP9A 2EN7A 2LO3A 2EMAA 1WJPA 5KL2A 2EM4A 2M9AA 1TN9A 2JPAA 1B69A 5KL5A 4R2EA 1A1GA 2MKNA 1X6FA 1ZAAC 2EM6A 4R2DA 2ENCA 4R2CA 2EL4A 2LCEA 5KL7A 2YU5A 4M9VC 1BBOA 1AAYA 1X6EA 2EN6A 1X6HA 2EPUA 2YTJA 5KL4A 1ZU1A 3UK3C 1UN6B 2YTPA 2YTOA 2EJ4A 2YTNA 2DLQA 2EN1A 2EL5A 2EOJA 1ZR9A 2YTFA 2EOMA 2WBSA 2HGHA 2EMZA 2NABA 2EQ3A 2EMFA 4F2JC 2YSPA 2YTEA 2EM7A 2EOFA 2ADRA 4GZNC 2EPRA 2J7JA 2CSHA 1Z1BA 2EMXA 2EN4A 2PRTA 2I13A 2EN3A 1P47A 1A1LA 2EM9A 2EM8A 1JK1A 1MEYC 1YUIA 2EM3A 2EPPA 2YTGA 1TF6A 1JK2A 2E72A 1A1HA 2EMHA 2EPCA 2EN2A 2YTDA 5KL3A 4R2AA 2EOHA 2EM5A 2EORA 2DRPA 2RPCA 2ENHA 2DMIA 2LV2A 4WSGA 1G2FC 2LT7A 2EOSA 2RSIA 2CTDA 4R2RA 2EMLA 1G2DC 2EOZA 2ENAA 2EOQA 1BB8A 2YRKA 2DLKA 4R2QA 1YSAC 2EN8A 4R2PA 1F2IG 4R2SA 1TF3A 2R1FA 2EOEA 2GLIA 2A25A 3M99B 3EPHA 2EMKA 2EMCA 3VHTB 2EE8A 2EMIA 2EPZA 4X9JA 1A1KA 2EM2A 2YRHA 2CT1A 3MHSC 2EP3A 2YTIA 2EMBA 3MHHC 3EPJA 2YSOA 4F6NA 2MKDA 1A1FA 2ELYA 2EM0A 2EL6A 4IJDA 1LLMC 1A1IA 5KL6A 2EQ1A 1X3CA 2WCC3 1DGCA 1KJKA 2EMWA 1NCSA 2EOYA 2EOIA 2EPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IS1 C;  4F6M A;  2DGC A;  3EPL A;  2ELZ A;  4FK5 C;  1YUJ A;  2EMY A;  2BB8 A;  3EPK A;  2VRD A;  2YU8 A;  2GHF A;  1UBD C;  2D9H A;  2EOO A;  2EPX A;  1RMD A;  2EMG A;  2EOX A;  2EQ0 A;  1X5W A;  2MDG A;  2WBT A;  2YTQ A;  2YRM A;  2WBU A;  1A1J A;  2LVH A;  2JP9 A;  2EN7 A;  2LO3 A;  2EMA A;  1WJP A;  5KL2 A;  2EM4 A;  2M9A A;  1TN9 A;  2JPA A;  1B69 A;  5KL5 A;  4R2E A;  1A1G A;  2MKN A;  1X6F A;  1ZAA C;  2EM6 A;  4R2D A;  2ENC A;  4R2C A;  2EL4 A;  2LCE A;  5KL7 A;  2YU5 A;  4M9V C;  1BBO A;  1AAY A;  1X6E A;  2EN6 A;  1X6H A;  2EPU A;  2YTJ A;  5KL4 A;  1ZU1 A;  3UK3 C;  1UN6 B;  2YTP A;  2YTO A;  2EJ4 A;  2YTN A;  2DLQ A;  2EN1 A;  2EL5 A;  2EOJ A;  1ZR9 A;  2YTF A;  2EOM A;  2WBS A;  2HGH A;  2EMZ A;  2NAB A;  2EQ3 A;  2EMF A;  4F2J C;  2YSP A;  2YTE A;  2EM7 A;  2EOF A;  2ADR A;  4GZN C;  2EPR A;  2J7J A;  2CSH A;  1Z1B A;  2EMX A;  2EN4 A;  2PRT A;  2I13 A;  2EN3 A;  1P47 A;  1A1L A;  2EM9 A;  2EM8 A;  1JK1 A;  1MEY C;  1YUI A;  2EM3 A;  2EPP A;  2YTG A;  1TF6 A;  1JK2 A;  2E72 A;  1A1H A;  2EMH A;  2EPC A;  2EN2 A;  2YTD A;  5KL3 A;  4R2A A;  2EOH A;  2EM5 A;  2EOR A;  2DRP A;  2RPC A;  2ENH A;  2DMI A;  2LV2 A;  4WSG A;  1G2F C;  2LT7 A;  2EOS A;  2RSI A;  2CTD A;  4R2R A;  2EML A;  1G2D C;  2EOZ A;  2ENA A;  2EOQ A;  1BB8 A;  2YRK A;  2DLK A;  4R2Q A;  1YSA C;  2EN8 A;  4R2P A;  1F2I G;  4R2S A;  1TF3 A;  2R1F A;  2EOE A;  2GLI A;  2A25 A;  3M99 B;  3EPH A;  2EMK A;  2EMC A;  3VHT B;  2EE8 A;  2EMI A;  2EPZ A;  4X9J A;  1A1K A;  2EM2 A;  2YRH A;  2CT1 A;  3MHS C;  2EP3 A;  2YTI A;  2EMB A;  3MHH C;  3EPJ A;  2YSO A;  4F6N A;  2MKD A;  1A1F A;  2ELY A;  2EM0 A;  2EL6 A;  4IJD A;  1LLM C;  1A1I A;  5KL6 A;  2EQ1 A;  1X3C A;  2WCC 3;  1DGC A;  1KJK A;  2EMW A;  1NCS A;  2EOY A;  2EOI A;  2EPA A; 
#chains in the Genus database with same CATH topology
 1XMQ E;  4F6M A;  3EPL A;  2IHR 1;  3HPS A;  1UIL A;  1IQO A;  4GKJ E;  1DI2 A;  2BB8 A;  1EKZ A;  2YU8 A;  4F9C B;  2GHF A;  4L5N C;  1J5E E;  1UBD C;  1T4N A;  2EQ0 A;  1N34 E;  4B3M E;  4JV5 E;  4DV4 E;  2RTX A;  3P1X A;  2EMA A;  2EM4 A;  1FKA E;  1TN9 A;  1YFH A;  1B69 A;  1N32 E;  1A1G A;  4ZYH A;  2MKN A;  2LRS A;  5IXM B;  4WPY A;  1J26 A;  2MDR A;  4ZYG A;  1GZ6 A;  2UXC E;  1X6E A;  3VYY A;  5A6B A;  2EPU A;  1WHN A;  1YYK A;  5KL4 A;  1ZU1 A;  2YTP A;  2EJ4 A;  2DLQ A;  3J80 C;  1T38 A;  2EN1 A;  2EOJ A;  2YTF A;  2VF1 A;  2WBS A;  2B3T B;  2EPL X;  1ZBT A;  2NAB A;  4TUG A;  4ZYD A;  1N36 E;  2UUA E;  4OOG C;  2ADR A;  2L2M A;  2EPR A;  2L6M A;  2CSH A;  1Z1B A;  2EMX A;  2EN4 A;  3HQ1 A;  3T1Y E;  4JI6 E;  2I13 A;  2EN3 A;  1JK1 A;  4O24 A;  4NXM E;  1YUI A;  4O43 A;  5FLX C;  3ZOQ B;  1EH8 A;  2JOX A;  2E72 A;  2LJU A;  1JK2 A;  2YTD A;  5KL3 A;  2EOH A;  4DR7 E;  2DRP A;  4LF5 E;  5A6B D;  2LT7 A;  2EOS A;  2MC6 A;  2JY9 A;  2EOQ A;  3AUZ A;  4WXC A;  2DLK A;  2JXP A;  3HPZ A;  4BMJ A;  4R2Q A;  4DUZ E;  4AQY E;  3THO B;  1YSA C;  3ADG A;  2EN8 A;  2R1F A;  1XMO E;  4K0K E;  4TUI A;  2KHX A;  2RSM A;  3KWR A;  4B3R E;  2YRH A;  1PJQ A;  3MHS C;  2MKD A;  2UXB E;  3QG5 C;  1X3C A;  4DV3 E;  4BC7 A;  2LJH A;  5A2Q C;  2L2K B;  1I94 E;  1EH6 A;  4DR1 E;  4LF8 E;  3BBG A;  4L8N A;  2LE2 A;  2EOI A;  2EPA A;  2YSO A;  4IS1 C;  5A69 A;  4JI3 E;  1HNW E;  3BGH A;  3VK6 A;  1YPN A;  2K4V A;  2EPX A;  3JAM C;  5F3W A;  4LFB E;  2MDG A;  3J81 C;  4F54 A;  1A1J A;  2L92 A;  4LF9 E;  2M1S A;  2ZM6 E;  2LTR A;  5KL2 A;  5LL6 R;  2LBS B;  4JI8 E;  5AE1 A;  2JPA A;  3RMP A;  4Q35 B;  4RH8 A;  3C4T A;  2B7V A;  2ENC A;  4DR4 E;  2HC5 A;  2YU5 A;  4N4R B;  4M9V C;  4DV7 E;  1AAY A;  4GEQ B;  5IV8 B;  1HR0 E;  4X8W A;  2YTN A;  2FGG A;  2YPN A;  5AE2 A;  1ZR9 A;  5IWA E;  4J8Z A;  3H09 A;  1UHZ A;  2WZO A;  2NUE A;  3THN A;  3DF6 A;  4NHR A;  2GPI A;  2PRT A;  1YYO A;  1P47 A;  2KON A;  1A1L A;  2UU9 E;  5A6A A;  2UUC E;  2EM3 A;  2EPP A;  4LU9 A;  1TF6 A;  2EPC A;  2EN2 A;  1HNZ E;  2UUB E;  5AE3 A;  2L3C A;  2RPC A;  2DMI A;  1G2F C;  1IMU A;  1STU A;  2FTX B;  2RSI A;  1YZ9 A;  2EPM X;  4WSP A;  2JYA A;  5TSE A;  3C6K A;  2E5L E;  1G2D C;  2EOZ A;  2HJJ A;  1WRJ A;  4JI0 E;  2N8X A;  4ZYE A;  3ADJ A;  2NA2 A;  4KZS A;  2V86 A;  4R2P A;  1F2I G;  4R2S A;  2EOE A;  4HEI A;  1EH7 A;  3M99 B;  3EPH A;  5AAS A;  4X65 E;  2EE8 A;  2EPZ A;  3AV0 A;  4KWY A;  1XNR E;  1PJT A;  1T4O A;  2RS7 A;  1A1F A;  4X62 E;  2DSY A;  2VQF E;  1N33 E;  5A6J A;  1KJK A;  2EMW A;  1GTK A;  4BS9 A;  2LTS A;  2EPK X;  2MC5 A;  2DIX A;  1X48 A;  1YUJ A;  2EOO A;  1DQ3 A;  1RMD A;  2EMG A;  3BF2 A;  4M0V A;  3MSW A;  3LML A;  1WHQ A;  2LVH A;  1O0W A;  2JP9 A;  4R8O A;  3FIG A;  2EWL A;  2H36 X;  3EQ1 A;  1WJP A;  3BID A;  2F4V E;  3KZZ A;  2I9I A;  4R2E A;  1ZBQ A;  1X6F A;  1ZAA C;  2FV4 B;  1BBG A;  2EL4 A;  2LCE A;  2NUF A;  3JTZ A;  2KOU A;  4JI5 E;  4O4K A;  2UXD E;  4DR2 E;  4F9A B;  2ODR D;  2V87 A;  5CFF E;  2EOM A;  2HGH A;  2EMF A;  2YTE A;  1GQE A;  2L2N A;  4DKK A;  2R76 A;  1IBK E;  2JWO A;  2YT4 A;  4GZN C;  1T39 A;  2Q8U A;  2J7J A;  2EM9 A;  2EM8 A;  4DV6 E;  2YTG A;  1IBM E;  1A1H A;  4LFC E;  2V88 A;  3OML A;  1RQ0 A;  4R2A A;  4M2Z A;  2G7H A;  4JI1 E;  4MLQ A;  4BBY A;  2EM5 A;  3LLH A;  1X47 A;  2ENH A;  2LV2 A;  4WSG A;  3KZY A;  5LMU E;  2VE7 C;  4LF6 E;  4JI4 E;  2CTD A;  4Q28 A;  3IWD A;  2EML A;  3F6G A;  4JI7 E;  4B3T E;  2L8T A;  2B7T A;  1BB8 A;  2YRK A;  1IBL E;  4OX9 E;  4HTG A;  1XNQ E;  1PJS A;  4BHB A;  2V8Q B;  3J7A G;  3IWC A;  2A25 A;  2EMC A;  3K6Q A;  3DJW A;  2L33 A;  3VHT B;  2EMI A;  2V85 A;  2EZ6 A;  1A1K A;  1NEI A;  2EM2 A;  4GKK E;  2V89 A;  4KHP E;  2EMB A;  3EPJ A;  4F6N A;  5A6K A;  1L4S A;  2RQL A;  4BCA A;  2EM0 A;  4IJD A;  5LMN E;  1LLM C;  2EQ1 A;  4DV1 E;  4P78 A;  4WYQ B;  4LTY A;  1SR9 A;  3F6H A;  1NCS A;  2EOY A;  2D9H A;  1QNT A;  3HXL A;  2DGC A;  4NXN E;  2ELZ A;  4FK5 C;  2EMY A;  1MGT A;  2M4I A;  2DMY A;  3EPK A;  2VRD A;  5AC5 A;  4X64 E;  1HNX E;  4YY3 E;  1YYW A;  2YTQ A;  2YRM A;  2EOX A;  2WBT A;  1X5W A;  3ECR A;  2WBU A;  4RHB B;  4YHH E;  4WXD A;  2DB2 A;  2EN7 A;  2LO3 A;  4NZV A;  1WXR A;  5AC4 A;  1FJG E;  2LUQ A;  2M9A A;  1T4L B;  2CPN A;  5KL5 A;  2JVA A;  4BHC A;  3L00 A;  5BR8 E;  2VQE E;  2EM6 A;  2LUP B;  4R2D A;  4R2C A;  2NUG A;  5KL7 A;  2N3H A;  1BBO A;  4LFA E;  4M30 A;  2K7I A;  2ODR C;  4DUY E;  2EN6 A;  1X6H A;  4LF7 E;  2YTJ A;  1UN6 B;  2L3J A;  3UK3 C;  1AH5 A;  2YTO A;  2YWQ A;  3OTO E;  1QU6 A;  2EL5 A;  4DV2 E;  4LF4 E;  2EPN A;  2EMZ A;  4DR6 E;  5ADZ A;  2EQ3 A;  4F2J C;  2V83 A;  2YSP A;  2F8B A;  3T1H E;  2EM7 A;  2HHH E;  4X66 E;  2EOF A;  1PDA A;  5DNY A;  1MEY C;  4DV0 E;  3J7Y p;  4DR3 E;  2YZT A;  4DV5 E;  1X49 A;  3C6M A;  4DMI A;  2EMH A;  3ADL A;  2RS6 A;  3C4B A;  1N3G A;  4WX9 A;  3JU0 A;  2EOR A;  1KYQ A;  2BBG A;  2M7Q A;  4JI2 E;  4MLV A;  2EPO A;  1PKP A;  3ADI A;  5T6J A;  4R2R A;  3IWB A;  2ENA A;  5LLQ A;  1IQS A;  2JOB A;  2LMZ A;  2E1M A;  4O5G A;  4I8O A;  1TF3 A;  4R03 A;  2GLI A;  3HTX A;  4P7D A;  4DR5 E;  1RC7 A;  1SFE A;  2EMK A;  3VYX A;  4JYA E;  2B9D A;  4X9J A;  2CT1 A;  4F9B B;  4BC9 A;  2EP3 A;  2YTI A;  3MHH C;  4B3S E;  3TQM A;  2ELY A;  2EL6 A;  1A1I A;  1DGC A;  5KL6 A;  2WCC 3;  2N3G A;  5IT9 C;  2JR1 A;  4WFT A; 
#chains in the Genus database with same CATH homology
 4IS1 C;  4F6M A;  2DGC A;  3EPL A;  2ELZ A;  4FK5 C;  1YUJ A;  2EMY A;  2BB8 A;  3EPK A;  2VRD A;  2YU8 A;  2GHF A;  1UBD C;  2D9H A;  2EOO A;  2EPX A;  1RMD A;  2EMG A;  2EOX A;  2EQ0 A;  1X5W A;  2MDG A;  2WBT A;  2YTQ A;  2YRM A;  2WBU A;  1A1J A;  2LVH A;  2JP9 A;  2EN7 A;  2LO3 A;  2EMA A;  1WJP A;  5KL2 A;  2EM4 A;  2M9A A;  1TN9 A;  2JPA A;  1B69 A;  5KL5 A;  4R2E A;  1A1G A;  2MKN A;  1X6F A;  1ZAA C;  2EM6 A;  4R2D A;  2ENC A;  4R2C A;  2EL4 A;  2LCE A;  5KL7 A;  2YU5 A;  4M9V C;  1BBO A;  1AAY A;  1X6E A;  2EN6 A;  1X6H A;  2EPU A;  2YTJ A;  5KL4 A;  1ZU1 A;  3UK3 C;  1UN6 B;  2YTP A;  2YTO A;  2EJ4 A;  2YTN A;  2DLQ A;  2EN1 A;  2EL5 A;  2EOJ A;  1ZR9 A;  2YTF A;  2EOM A;  2WBS A;  2HGH A;  2EMZ A;  2NAB A;  2EQ3 A;  2EMF A;  4F2J C;  2YSP A;  2YTE A;  2EM7 A;  2EOF A;  2ADR A;  4GZN C;  2EPR A;  2J7J A;  2CSH A;  1Z1B A;  2EMX A;  2EN4 A;  2PRT A;  2I13 A;  2EN3 A;  1P47 A;  1A1L A;  2EM9 A;  2EM8 A;  1JK1 A;  1MEY C;  1YUI A;  2EM3 A;  2EPP A;  2YTG A;  1TF6 A;  1JK2 A;  2E72 A;  1A1H A;  2EMH A;  2EPC A;  2EN2 A;  2YTD A;  5KL3 A;  4R2A A;  2EOH A;  2EM5 A;  2EOR A;  2DRP A;  2RPC A;  2ENH A;  2DMI A;  2LV2 A;  4WSG A;  1G2F C;  2LT7 A;  2EOS A;  2RSI A;  2CTD A;  4R2R A;  2EML A;  1G2D C;  2EOZ A;  2ENA A;  2EOQ A;  1BB8 A;  2YRK A;  2DLK A;  4R2Q A;  1YSA C;  2EN8 A;  4R2P A;  1F2I G;  4R2S A;  1TF3 A;  2R1F A;  2EOE A;  2GLI A;  2A25 A;  3M99 B;  3EPH A;  2EMK A;  2EMC A;  3VHT B;  2EE8 A;  2EMI A;  2EPZ A;  4X9J A;  1A1K A;  2EM2 A;  2YRH A;  2CT1 A;  3MHS C;  2EP3 A;  2YTI A;  2EMB A;  3MHH C;  3EPJ A;  2YSO A;  4F6N A;  2MKD A;  1A1F A;  2ELY A;  2EM0 A;  2EL6 A;  4IJD A;  1LLM C;  1A1I A;  5KL6 A;  2EQ1 A;  1X3C A;  2WCC 3;  1DGC A;  1KJK A;  2EMW A;  1NCS A;  2EOY A;  2EOI A;  2EPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...