2EORA

Solution structure of the c2h2 type zinc finger (region 255-287) of human zinc finger protein 224
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYNCEECGKAFIHDSQLQEHQRIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 255-287) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 9
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eorA01
2EMKA 2LCEA 1UBDC 1X5WA 2LO3A 4IJDA 1NCSA 2EQ0A 2EN2A 4F6NA 2HGHA 2EN7A 5KL6A 2WBTA 2ENHA 2CT1A 2YTQA 1X3CA 2ENCA 2WBSA 1DGCA 2WCC3 2EMHA 2EOMA 2EOHA 2ELZA 2CSHA 2PRTA 1YUJA 1UN6B 2EPRA 2EM4A 1ZAAC 1A1GA 2EPPA 4R2SA 1TN9A 2EM7A 2CTDA 2DLKA 2NABA 2YSOA 5KL7A 2YRMA 2EOIA 2ENAA 4WSGA 1G2FC 2RSIA 1KJKA 4R2PA 2DRPA 1X6FA 2J7JA 2RPCA 2YRKA 1LLMC 2EMGA 2I13A 2EPXA 1ZR9A 1YSAC 3M99B 2JPAA 2EPZA 1Z1BA 4R2EA 2ADRA 1YUIA 2EN8A 2EM9A 2EOFA 3MHHC 2VRDA 2EMBA 2EPCA 2EMZA 2E72A 2YTGA 5KL2A 2EP3A 2EMLA 2EOQA 2EPUA 2YSPA 1A1IA 2YTEA 2YRHA 1TF6A 2EOSA 2EN6A 4IS1C 2EOOA 1A1HA 4F6MA 3VHTB 1P47A 2MDGA 2EN3A 2EPAA 2EOZA 1MEYC 5KL3A 2WBUA 3EPKA 1JK2A 1BB8A 1B69A 2EMAA 2MKNA 4F2JC 1ZU1A 2EM3A 2EOEA 2LV2A 2EM5A 1A1KA 4R2DA 2YTNA 1RMDA 3UK3C 5KL5A 2M9AA 1AAYA 1G2DC 2EM8A 1X6EA 2EL5A 2EMYA 2GHFA 3EPJA 1JK1A 2EN4A 2EM2A 2YU5A 2YTFA 4R2QA 2YTDA 2EOYA 2EOXA 1X6HA 2DMIA 2EMWA 2EJ4A 2BB8A 3EPLA 2EMCA 4GZNC 2EM0A 2YTPA 2EL4A 2YTIA 3MHSC 2YTOA 1F2IG 2YTJA 2EORA 4X9JA 2DLQA 2JP9A 1BBOA 1A1JA 2DGCA 4M9VC 2EMXA 2EE8A 2EQ1A 2ELYA 2EQ3A 4R2CA 2LT7A 2GLIA 2EMIA 2LVHA 2EOJA 2MKDA 4R2AA 4R2RA 2A25A 1TF3A 2EMFA 2EM6A 2EN1A 2YU8A 2R1FA 2D9HA 1A1FA 2EL6A 4FK5C 3EPHA 1A1LA 5KL4A 1WJPA
chains in the Genus database with same CATH superfamily
1IBME 1NCSA 2EN7A 2NUGA 2FV4B 4JYAE 2ENCA 3C6KA 1IQOA 2EPKX 2L3CA 1YUJA 4LF4E 2EM4A 3F6GA 1EKZA 2EPPA 4BS9A 2EM7A 2CTDA 2DLKA 2YRMA 3C4BA 4BHBA 2EPOA 4R2PA 3IWBA 2RPCA 2I13A 2H36X 4JI0E 2B3TB 3LLHA 1N34E 1FKAE 1YSAC 2CPNA 2JPAA 2EPZA 2L2MA 1YUIA 3J80C 5A6AA 4O5GA 2EN8A 3EQ1A 2NUEA 2JYAA 2VE7C 2EPNA 2EMZA 2E72A 2M1SA 4KZSA 3BF2A 3VYYA 4OX9E 2L8TA 2UXCE 4BCAA 3P1XA 4DR3E 4LTYA 1TF6A 4JI5E 3JAMC 2Q8UA 5FLXC 2EOOA 4NXNE 4O24A 2ODRC 3VHTB 1YYWA 2L33A 2EOZA 1MEYC 5KL3A 4WX9A 3ADGA 3T1HE 3EPKA 5DNYA 2V86A 2GPIA 1B69A 2MKNA 1UILA 2L3JA 4F2JC 2I9IA 2EOEA 2LV2A 2EM5A 3K6QA 4R2DA 4WYQB 1RMDA 3UK3C 5KL5A 4P78A 1X6EA 2F8BA 1DQ3A 1UHZA 3J7Yp 2EM2A 5IWAE 2NUFA 1IQSA 5LLQA 4DR2E 4DV2E 2NA2A 4JI7E 2EOXA 2DMIA 2B9DA 4GZNC 2EM0A 2DIXA 4I8OA 3MHSC 1EH6A 1GQEA 2YTOA 2HHHE 1SFEA 4JI2E 1O0WA 3KZZA 4HTGA 2DLQA 2JP9A 1EH7A 4DUYE 2VQEE 4DV5E 1A1JA 4B3TE 3DJWA 5CFFE 2V85A 2LT7A 3KWRA 2MKDA 3BGHA 3MSWA 1RC7A 2YU8A 3RMPA 3T1YE 3ADLA 2D9HA 4YY3E 4LF7E 5KL4A 1WJPA 2EMKA 2LCEA 1X5WA 4GEQB 2HGHA 2JWOA 2EQ0A 4DR6E 5KL6A 4L5NC 4B3ME 5AE2A 5LMNE 1IMUA 2YTQA 1X3CA 2BBGA 4NZVA 2WCC3 5LL6R 5AE1A 2VF1A 2ELZA 2UXDE 1T38A 4L8NA 5A6BD 1A1GA 1N36E 1IBLE 3HPSA 4R2SA 2YSOA 1HNXE 2ENAA 2LE2A 2EPLX 4MLQA 1G2FC 5AASA 2V87A 4O43A 1X6FA 3FIGA 2J7JA 2YRKA 2DRPA 1GTKA 4DV0E 2UXBE 4LFAE 3TQMA 1T4LB 4R2EA 2ADRA 2B7TA 3MHHC 2EPCA 2RTXA 2YTGA 2RS6A 2EOQA 4TUGA 2MDRA 1A1IA 4BHCA 2EOSA 5A6BA 4X65E 4IS1C 1A1HA 2EWLA 2MDGA 1HR0E 2UUAE 4LFBE 2LBSB 1A1KA 4DR4E 4JV5E 2DSYA 3ADJA 2LUQA 1N32E 2V8QB 4WFTA 1AH5A 2EN4A 3AV0A 4R8OA 4LF8E 3VK6A 4BBYA 4ZYDA 1XNRE 2BB8A 3EPLA 2EMCA 2RS7A 3HTXA 2DMYA 3KZYA 4BMJA 4JI4E 2YPNA 1F2IG 1N33E 1WHNA 2YTJA 1STUA 3AUZA 2EORA 2RQLA 4GKJE 4X9JA 2LUPB 4WXCA 1BBGA 4JI6E 2EQ1A 2ELYA 2EQ3A 3C4TA 1XMQE 4R2AA 2A25A 3L00A 4DV6E 1IBKE 2JVAA 4FK5C 4X64E 5AC5A 4ZYGA 3HQ1A 2LMZA 1DI2A 4IJDA 2EN2A 4HEIA 2WZOA 1X49A 2RSMA 2WBTA 4F9BB 3DF6A 1DGCA 4Q28A 5IXMB 5A2QC 2M7QA 1MGTA 2EOMA 2EOHA 3THOB 4GKKE 2PRTA 2L2KB 2EPRA 1ZBTA 4AQYE 1YPNA 1ZAAC 3ZOQB 2LJUA 1TN9A 4DV1E 2DB2A 4X8WA 3JU0A 2YWQA 5A6JA 3BIDA 1X48A 1KJKA 1XNQE 5T6JA 5IV8B 1LLMC 2EMGA 2UUBE 1T4NA 1FJGE 4Q35B 3M99B 2N3HA 3HXLA 1I94E 2LJHA 2EOFA 2ZM6E 3IWDA 2EP3A 4TUIA 2EMLA 2EPUA 2YSPA 4RHBB 1HNWE 2YRHA 2EN6A 5LMUE 4F6MA 1RQ0A 2E1MA 1P47A 2EN3A 4MLVA 2FTXB 4B3RE 4LU9A 2MC6A 4WXDA 1JK2A 4X62E 1ZU1A 2EM3A 2N8XA 2YTNA 4WPYA 4DMIA 4K0KE 2M9AA 4N4RB 1XMOE 1AAYA 2K7IA 2EL5A 2ODRD 2GHFA 1JK1A 3F6HA 2YU5A 1WXRA 2YTFA 4R2QA 4F9AB 2YTDA 2EOYA 2JOBA 1QU6A 1N3GA 5AC4A 4B3SE 1YFHA 4DR5E 1YYKA 4OOGC 1YYOA 1BBOA 3QG5C 2EMXA 4JI1E 4ZYEA 4R2CA 4DV7E 2E5LE 3H09A 2GLIA 5A69A 2F4VE 2R76A 3J7AG 4R2RA 2EOJA 4X66E 1X47A 2LTRA 5ADZA 2EMFA 1TF3A 2EN1A 1HNZE 2EL6A 3EPHA 4DUZE 3OTOE 1A1LA 1UBDC 1KYQA 2LO3A 4DKKA 4F6NA 3ECRA 2ENHA 2HC5A 5IT9C 2YZTA 2CT1A 1ZBQA 2UUCE 2WBSA 2JOXA 2JY9A 2EMHA 4M0VA 2CSHA 1UN6B 2EZ6A 2UU9E 1QNTA 3BBGA 2NABA 5KL7A 2EOIA 4WSGA 1PJQA 2LRSA 4O4KA 4LF5E 2RSIA 4JI3E 4DR7E 3IWCA 2EPXA 1ZR9A 4NHRA 4DV3E 4NXME 1Z1BA 2VQFE 2EM9A 2KHXA 2VRDA 2EMBA 2K4VA 2LTSA 5A6KA 5KL2A 4R03A 4DV4E 1PKPA 5TSEA 4ZYHA 5AE3A 1J5EE 2YTEA 2KONA 2FGGA 2YT4A 4BC9A 4RH8A 2G7HA 2IHR1 4WSPA 2EPAA 2JR1A 5BR8E 4F9CB 2V89A 4F54A 2WBUA 1BB8A 2EMAA 1T39A 4P7DA 4LFCE 3HPZA 4LF6E 2N3GA 2V88A 1T4OA 4BC7A 4J8ZA 2HJJA 1G2DC 1EH8A 2EM8A 2EMYA 3EPJA 2MC5A 3OMLA 2L6MA 1YZ9A 1PDAA 2M4IA 2L92A 2JXPA 1PJSA 1L4SA 2KOUA 1X6HA 2EMWA 3VYXA 1NEIA 1SR9A 2EJ4A 4LF9E 2YTPA 2B7VA 2EL4A 3JTZA 2YTIA 4YHHE 1WRJA 3ADIA 4KHPE 1PJTA 4DR1E 2DGCA 4M9VC 2EE8A 4KWYA 3J81C 2L2NA 2EMIA 2LVHA 2V83A 5F3WA 1J26A 2EPMX 2EM6A 3C6MA 3THNA 4M2ZA 2R1FA 4M30A 1A1FA 4JI8E 1WHQA 3LMLA 1GZ6A
chains in the Genus database with same CATH topology
2EMKA 2LCEA 1UBDC 1X5WA 2LO3A 4IJDA 1NCSA 2EQ0A 2EN2A 4F6NA 2HGHA 2EN7A 5KL6A 2WBTA 2ENHA 2CT1A 2YTQA 1X3CA 2ENCA 2WBSA 1DGCA 2WCC3 2EMHA 2EOMA 2EOHA 2ELZA 2CSHA 2PRTA 1YUJA 1UN6B 2EPRA 2EM4A 1ZAAC 1A1GA 2EPPA 4R2SA 1TN9A 2EM7A 2CTDA 2DLKA 2NABA 2YSOA 5KL7A 2YRMA 2EOIA 2ENAA 4WSGA 1G2FC 2RSIA 1KJKA 4R2PA 2DRPA 1X6FA 2J7JA 2RPCA 2YRKA 1LLMC 2EMGA 2I13A 2EPXA 1ZR9A 1YSAC 3M99B 2JPAA 2EPZA 1Z1BA 4R2EA 2ADRA 1YUIA 2EN8A 2EM9A 2EOFA 3MHHC 2VRDA 2EMBA 2EPCA 2EMZA 2E72A 2YTGA 5KL2A 2EP3A 2EMLA 2EOQA 2EPUA 2YSPA 1A1IA 2YTEA 2YRHA 1TF6A 2EOSA 2EN6A 4IS1C 2EOOA 1A1HA 4F6MA 3VHTB 1P47A 2MDGA 2EN3A 2EPAA 2EOZA 1MEYC 5KL3A 2WBUA 3EPKA 1JK2A 1BB8A 1B69A 2EMAA 2MKNA 4F2JC 1ZU1A 2EM3A 2EOEA 2LV2A 2EM5A 1A1KA 4R2DA 2YTNA 1RMDA 3UK3C 5KL5A 2M9AA 1AAYA 1G2DC 2EM8A 1X6EA 2EL5A 2EMYA 2GHFA 3EPJA 1JK1A 2EN4A 2EM2A 2YU5A 2YTFA 4R2QA 2YTDA 2EOYA 2EOXA 1X6HA 2DMIA 2EMWA 2EJ4A 2BB8A 3EPLA 2EMCA 4GZNC 2EM0A 2YTPA 2EL4A 2YTIA 3MHSC 2YTOA 1F2IG 2YTJA 2EORA 4X9JA 2DLQA 2JP9A 1BBOA 1A1JA 2DGCA 4M9VC 2EMXA 2EE8A 2EQ1A 2ELYA 2EQ3A 4R2CA 2LT7A 2GLIA 2EMIA 2LVHA 2EOJA 2MKDA 4R2AA 4R2RA 2A25A 1TF3A 2EMFA 2EM6A 2EN1A 2YU8A 2R1FA 2D9HA 1A1FA 2EL6A 4FK5C 3EPHA 1A1LA 5KL4A 1WJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMK A;  2LCE A;  1UBD C;  1X5W A;  2LO3 A;  4IJD A;  1NCS A;  2EQ0 A;  2EN2 A;  4F6N A;  2HGH A;  2EN7 A;  5KL6 A;  2WBT A;  2ENH A;  2CT1 A;  2YTQ A;  1X3C A;  2ENC A;  2WBS A;  1DGC A;  2WCC 3;  2EMH A;  2EOM A;  2EOH A;  2ELZ A;  2CSH A;  2PRT A;  1YUJ A;  1UN6 B;  2EPR A;  2EM4 A;  1ZAA C;  1A1G A;  2EPP A;  4R2S A;  1TN9 A;  2EM7 A;  2CTD A;  2DLK A;  2NAB A;  2YSO A;  5KL7 A;  2YRM A;  2EOI A;  2ENA A;  4WSG A;  1G2F C;  2RSI A;  1KJK A;  4R2P A;  2DRP A;  1X6F A;  2J7J A;  2RPC A;  2YRK A;  1LLM C;  2EMG A;  2I13 A;  2EPX A;  1ZR9 A;  1YSA C;  3M99 B;  2JPA A;  2EPZ A;  1Z1B A;  4R2E A;  2ADR A;  1YUI A;  2EN8 A;  2EM9 A;  2EOF A;  3MHH C;  2VRD A;  2EMB A;  2EPC A;  2EMZ A;  2E72 A;  2YTG A;  5KL2 A;  2EP3 A;  2EML A;  2EOQ A;  2EPU A;  2YSP A;  1A1I A;  2YTE A;  2YRH A;  1TF6 A;  2EOS A;  2EN6 A;  4IS1 C;  2EOO A;  1A1H A;  4F6M A;  3VHT B;  1P47 A;  2MDG A;  2EN3 A;  2EPA A;  2EOZ A;  1MEY C;  5KL3 A;  2WBU A;  3EPK A;  1JK2 A;  1BB8 A;  1B69 A;  2EMA A;  2MKN A;  4F2J C;  1ZU1 A;  2EM3 A;  2EOE A;  2LV2 A;  2EM5 A;  1A1K A;  4R2D A;  2YTN A;  1RMD A;  3UK3 C;  5KL5 A;  2M9A A;  1AAY A;  1G2D C;  2EM8 A;  1X6E A;  2EL5 A;  2EMY A;  2GHF A;  3EPJ A;  1JK1 A;  2EN4 A;  2EM2 A;  2YU5 A;  2YTF A;  4R2Q A;  2YTD A;  2EOY A;  2EOX A;  1X6H A;  2DMI A;  2EMW A;  2EJ4 A;  2BB8 A;  3EPL A;  2EMC A;  4GZN C;  2EM0 A;  2YTP A;  2EL4 A;  2YTI A;  3MHS C;  2YTO A;  1F2I G;  2YTJ A;  2EOR A;  4X9J A;  2DLQ A;  2JP9 A;  1BBO A;  1A1J A;  2DGC A;  4M9V C;  2EMX A;  2EE8 A;  2EQ1 A;  2ELY A;  2EQ3 A;  4R2C A;  2LT7 A;  2GLI A;  2EMI A;  2LVH A;  2EOJ A;  2MKD A;  4R2A A;  4R2R A;  2A25 A;  1TF3 A;  2EMF A;  2EM6 A;  2EN1 A;  2YU8 A;  2R1F A;  2D9H A;  1A1F A;  2EL6 A;  4FK5 C;  3EPH A;  1A1L A;  5KL4 A;  1WJP A; 
#chains in the Genus database with same CATH topology
 1IBM E;  1NCS A;  2EN7 A;  2NUG A;  2FV4 B;  4JYA E;  2ENC A;  3C6K A;  1IQO A;  2EPK X;  2L3C A;  1YUJ A;  4LF4 E;  2EM4 A;  3F6G A;  1EKZ A;  2EPP A;  4BS9 A;  2EM7 A;  2CTD A;  2DLK A;  2YRM A;  3C4B A;  4BHB A;  2EPO A;  4R2P A;  3IWB A;  2RPC A;  2I13 A;  2H36 X;  4JI0 E;  2B3T B;  3LLH A;  1N34 E;  1FKA E;  1YSA C;  2CPN A;  2JPA A;  2EPZ A;  2L2M A;  1YUI A;  3J80 C;  5A6A A;  4O5G A;  2EN8 A;  3EQ1 A;  2NUE A;  2JYA A;  2VE7 C;  2EPN A;  2EMZ A;  2E72 A;  2M1S A;  4KZS A;  3BF2 A;  3VYY A;  4OX9 E;  2L8T A;  2UXC E;  4BCA A;  3P1X A;  4DR3 E;  4LTY A;  1TF6 A;  4JI5 E;  3JAM C;  2Q8U A;  5FLX C;  2EOO A;  4NXN E;  4O24 A;  2ODR C;  3VHT B;  1YYW A;  2L33 A;  2EOZ A;  1MEY C;  5KL3 A;  4WX9 A;  3ADG A;  3T1H E;  3EPK A;  5DNY A;  2V86 A;  2GPI A;  1B69 A;  2MKN A;  1UIL A;  2L3J A;  4F2J C;  2I9I A;  2EOE A;  2LV2 A;  2EM5 A;  3K6Q A;  4R2D A;  4WYQ B;  1RMD A;  3UK3 C;  5KL5 A;  4P78 A;  1X6E A;  2F8B A;  1DQ3 A;  1UHZ A;  3J7Y p;  2EM2 A;  5IWA E;  2NUF A;  1IQS A;  5LLQ A;  4DR2 E;  4DV2 E;  2NA2 A;  4JI7 E;  2EOX A;  2DMI A;  2B9D A;  4GZN C;  2EM0 A;  2DIX A;  4I8O A;  3MHS C;  1EH6 A;  1GQE A;  2YTO A;  2HHH E;  1SFE A;  4JI2 E;  1O0W A;  3KZZ A;  4HTG A;  2DLQ A;  2JP9 A;  1EH7 A;  4DUY E;  2VQE E;  4DV5 E;  1A1J A;  4B3T E;  3DJW A;  5CFF E;  2V85 A;  2LT7 A;  3KWR A;  2MKD A;  3BGH A;  3MSW A;  1RC7 A;  2YU8 A;  3RMP A;  3T1Y E;  3ADL A;  2D9H A;  4YY3 E;  4LF7 E;  5KL4 A;  1WJP A;  2EMK A;  2LCE A;  1X5W A;  4GEQ B;  2HGH A;  2JWO A;  2EQ0 A;  4DR6 E;  5KL6 A;  4L5N C;  4B3M E;  5AE2 A;  5LMN E;  1IMU A;  2YTQ A;  1X3C A;  2BBG A;  4NZV A;  2WCC 3;  5LL6 R;  5AE1 A;  2VF1 A;  2ELZ A;  2UXD E;  1T38 A;  4L8N A;  5A6B D;  1A1G A;  1N36 E;  1IBL E;  3HPS A;  4R2S A;  2YSO A;  1HNX E;  2ENA A;  2LE2 A;  2EPL X;  4MLQ A;  1G2F C;  5AAS A;  2V87 A;  4O43 A;  1X6F A;  3FIG A;  2J7J A;  2YRK A;  2DRP A;  1GTK A;  4DV0 E;  2UXB E;  4LFA E;  3TQM A;  1T4L B;  4R2E A;  2ADR A;  2B7T A;  3MHH C;  2EPC A;  2RTX A;  2YTG A;  2RS6 A;  2EOQ A;  4TUG A;  2MDR A;  1A1I A;  4BHC A;  2EOS A;  5A6B A;  4X65 E;  4IS1 C;  1A1H A;  2EWL A;  2MDG A;  1HR0 E;  2UUA E;  4LFB E;  2LBS B;  1A1K A;  4DR4 E;  4JV5 E;  2DSY A;  3ADJ A;  2LUQ A;  1N32 E;  2V8Q B;  4WFT A;  1AH5 A;  2EN4 A;  3AV0 A;  4R8O A;  4LF8 E;  3VK6 A;  4BBY A;  4ZYD A;  1XNR E;  2BB8 A;  3EPL A;  2EMC A;  2RS7 A;  3HTX A;  2DMY A;  3KZY A;  4BMJ A;  4JI4 E;  2YPN A;  1F2I G;  1N33 E;  1WHN A;  2YTJ A;  1STU A;  3AUZ A;  2EOR A;  2RQL A;  4GKJ E;  4X9J A;  2LUP B;  4WXC A;  1BBG A;  4JI6 E;  2EQ1 A;  2ELY A;  2EQ3 A;  3C4T A;  1XMQ E;  4R2A A;  2A25 A;  3L00 A;  4DV6 E;  1IBK E;  2JVA A;  4FK5 C;  4X64 E;  5AC5 A;  4ZYG A;  3HQ1 A;  2LMZ A;  1DI2 A;  4IJD A;  2EN2 A;  4HEI A;  2WZO A;  1X49 A;  2RSM A;  2WBT A;  4F9B B;  3DF6 A;  1DGC A;  4Q28 A;  5IXM B;  5A2Q C;  2M7Q A;  1MGT A;  2EOM A;  2EOH A;  3THO B;  4GKK E;  2PRT A;  2L2K B;  2EPR A;  1ZBT A;  4AQY E;  1YPN A;  1ZAA C;  3ZOQ B;  2LJU A;  1TN9 A;  4DV1 E;  2DB2 A;  4X8W A;  3JU0 A;  2YWQ A;  5A6J A;  3BID A;  1X48 A;  1KJK A;  1XNQ E;  5T6J A;  5IV8 B;  1LLM C;  2EMG A;  2UUB E;  1T4N A;  1FJG E;  4Q35 B;  3M99 B;  2N3H A;  3HXL A;  1I94 E;  2LJH A;  2EOF A;  2ZM6 E;  3IWD A;  2EP3 A;  4TUI A;  2EML A;  2EPU A;  2YSP A;  4RHB B;  1HNW E;  2YRH A;  2EN6 A;  5LMU E;  4F6M A;  1RQ0 A;  2E1M A;  1P47 A;  2EN3 A;  4MLV A;  2FTX B;  4B3R E;  4LU9 A;  2MC6 A;  4WXD A;  1JK2 A;  4X62 E;  1ZU1 A;  2EM3 A;  2N8X A;  2YTN A;  4WPY A;  4DMI A;  4K0K E;  2M9A A;  4N4R B;  1XMO E;  1AAY A;  2K7I A;  2EL5 A;  2ODR D;  2GHF A;  1JK1 A;  3F6H A;  2YU5 A;  1WXR A;  2YTF A;  4R2Q A;  4F9A B;  2YTD A;  2EOY A;  2JOB A;  1QU6 A;  1N3G A;  5AC4 A;  4B3S E;  1YFH A;  4DR5 E;  1YYK A;  4OOG C;  1YYO A;  1BBO A;  3QG5 C;  2EMX A;  4JI1 E;  4ZYE A;  4R2C A;  4DV7 E;  2E5L E;  3H09 A;  2GLI A;  5A69 A;  2F4V E;  2R76 A;  3J7A G;  4R2R A;  2EOJ A;  4X66 E;  1X47 A;  2LTR A;  5ADZ A;  2EMF A;  1TF3 A;  2EN1 A;  1HNZ E;  2EL6 A;  3EPH A;  4DUZ E;  3OTO E;  1A1L A;  1UBD C;  1KYQ A;  2LO3 A;  4DKK A;  4F6N A;  3ECR A;  2ENH A;  2HC5 A;  5IT9 C;  2YZT A;  2CT1 A;  1ZBQ A;  2UUC E;  2WBS A;  2JOX A;  2JY9 A;  2EMH A;  4M0V A;  2CSH A;  1UN6 B;  2EZ6 A;  2UU9 E;  1QNT A;  3BBG A;  2NAB A;  5KL7 A;  2EOI A;  4WSG A;  1PJQ A;  2LRS A;  4O4K A;  4LF5 E;  2RSI A;  4JI3 E;  4DR7 E;  3IWC A;  2EPX A;  1ZR9 A;  4NHR A;  4DV3 E;  4NXM E;  1Z1B A;  2VQF E;  2EM9 A;  2KHX A;  2VRD A;  2EMB A;  2K4V A;  2LTS A;  5A6K A;  5KL2 A;  4R03 A;  4DV4 E;  1PKP A;  5TSE A;  4ZYH A;  5AE3 A;  1J5E E;  2YTE A;  2KON A;  2FGG A;  2YT4 A;  4BC9 A;  4RH8 A;  2G7H A;  2IHR 1;  4WSP A;  2EPA A;  2JR1 A;  5BR8 E;  4F9C B;  2V89 A;  4F54 A;  2WBU A;  1BB8 A;  2EMA A;  1T39 A;  4P7D A;  4LFC E;  3HPZ A;  4LF6 E;  2N3G A;  2V88 A;  1T4O A;  4BC7 A;  4J8Z A;  2HJJ A;  1G2D C;  1EH8 A;  2EM8 A;  2EMY A;  3EPJ A;  2MC5 A;  3OML A;  2L6M A;  1YZ9 A;  1PDA A;  2M4I A;  2L92 A;  2JXP A;  1PJS A;  1L4S A;  2KOU A;  1X6H A;  2EMW A;  3VYX A;  1NEI A;  1SR9 A;  2EJ4 A;  4LF9 E;  2YTP A;  2B7V A;  2EL4 A;  3JTZ A;  2YTI A;  4YHH E;  1WRJ A;  3ADI A;  4KHP E;  1PJT A;  4DR1 E;  2DGC A;  4M9V C;  2EE8 A;  4KWY A;  3J81 C;  2L2N A;  2EMI A;  2LVH A;  2V83 A;  5F3W A;  1J26 A;  2EPM X;  2EM6 A;  3C6M A;  3THN A;  4M2Z A;  2R1F A;  4M30 A;  1A1F A;  4JI8 E;  1WHQ A;  3LML A;  1GZ6 A; 
#chains in the Genus database with same CATH homology
 2EMK A;  2LCE A;  1UBD C;  1X5W A;  2LO3 A;  4IJD A;  1NCS A;  2EQ0 A;  2EN2 A;  4F6N A;  2HGH A;  2EN7 A;  5KL6 A;  2WBT A;  2ENH A;  2CT1 A;  2YTQ A;  1X3C A;  2ENC A;  2WBS A;  1DGC A;  2WCC 3;  2EMH A;  2EOM A;  2EOH A;  2ELZ A;  2CSH A;  2PRT A;  1YUJ A;  1UN6 B;  2EPR A;  2EM4 A;  1ZAA C;  1A1G A;  2EPP A;  4R2S A;  1TN9 A;  2EM7 A;  2CTD A;  2DLK A;  2NAB A;  2YSO A;  5KL7 A;  2YRM A;  2EOI A;  2ENA A;  4WSG A;  1G2F C;  2RSI A;  1KJK A;  4R2P A;  2DRP A;  1X6F A;  2J7J A;  2RPC A;  2YRK A;  1LLM C;  2EMG A;  2I13 A;  2EPX A;  1ZR9 A;  1YSA C;  3M99 B;  2JPA A;  2EPZ A;  1Z1B A;  4R2E A;  2ADR A;  1YUI A;  2EN8 A;  2EM9 A;  2EOF A;  3MHH C;  2VRD A;  2EMB A;  2EPC A;  2EMZ A;  2E72 A;  2YTG A;  5KL2 A;  2EP3 A;  2EML A;  2EOQ A;  2EPU A;  2YSP A;  1A1I A;  2YTE A;  2YRH A;  1TF6 A;  2EOS A;  2EN6 A;  4IS1 C;  2EOO A;  1A1H A;  4F6M A;  3VHT B;  1P47 A;  2MDG A;  2EN3 A;  2EPA A;  2EOZ A;  1MEY C;  5KL3 A;  2WBU A;  3EPK A;  1JK2 A;  1BB8 A;  1B69 A;  2EMA A;  2MKN A;  4F2J C;  1ZU1 A;  2EM3 A;  2EOE A;  2LV2 A;  2EM5 A;  1A1K A;  4R2D A;  2YTN A;  1RMD A;  3UK3 C;  5KL5 A;  2M9A A;  1AAY A;  1G2D C;  2EM8 A;  1X6E A;  2EL5 A;  2EMY A;  2GHF A;  3EPJ A;  1JK1 A;  2EN4 A;  2EM2 A;  2YU5 A;  2YTF A;  4R2Q A;  2YTD A;  2EOY A;  2EOX A;  1X6H A;  2DMI A;  2EMW A;  2EJ4 A;  2BB8 A;  3EPL A;  2EMC A;  4GZN C;  2EM0 A;  2YTP A;  2EL4 A;  2YTI A;  3MHS C;  2YTO A;  1F2I G;  2YTJ A;  2EOR A;  4X9J A;  2DLQ A;  2JP9 A;  1BBO A;  1A1J A;  2DGC A;  4M9V C;  2EMX A;  2EE8 A;  2EQ1 A;  2ELY A;  2EQ3 A;  4R2C A;  2LT7 A;  2GLI A;  2EMI A;  2LVH A;  2EOJ A;  2MKD A;  4R2A A;  4R2R A;  2A25 A;  1TF3 A;  2EMF A;  2EM6 A;  2EN1 A;  2YU8 A;  2R1F A;  2D9H A;  1A1F A;  2EL6 A;  4FK5 C;  3EPH A;  1A1L A;  5KL4 A;  1WJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...