3UK3C

Crystal structure of znf217 bound to dna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
52
structure length
52
Chain Sequence
RECSYCGKFFRSNYYLNIHLRTHTGEKPYKCEFCEYAAAQKTSLRYHLERHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna/metal binding protein
molecule keywords 5'-D(*TP*TP*TP*GP*CP*AP*GP*AP*AP*TP*CP*GP*AP*TP*TP*CP*TP*GP*
publication title Rediscovering DNA recognition by classical Zinc Fingers.
rcsb
source organism Homo sapiens
total genus 16
structure length 52
sequence length 52
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 3uk3C02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 3uk3C01
2EOZA 2ELYA 4X9JA 2GLIA 2EMIA 2EPZA 2EOOA 2CSHA 1A1HA 2DRPA 2EP3A 4FK5C 2WBSA 2NABA 2EM9A 2EMWA 2YRMA 2WBUA 1RMDA 1A1IA 4F2JC 2EE8A 1LLMC 3UK3C 1NCSA 2EMKA 2PRTA 1JK1A 1DGCA 2EM3A 2ENCA 4GZNC 5KL2A 2EORA 2EPUA 2EPXA 3EPHA 1A1FA 4WSGA 1A1GA 2EMYA 4R2AA 2LV2A 2YTDA 2DLKA 2EMHA 2YSPA 2A25A 2ENHA 2GHFA 2EN3A 2EOJA 2EMFA 2EOYA 2JP9A 2EOEA 2DLQA 4R2EA 2EPPA 4R2RA 2EN1A 2YTOA 2DMIA 2D9HA 2MKDA 1A1JA 2YTPA 2LCEA 2EM6A 2EM7A 2EMLA 3EPLA 2EOHA 2LT7A 2ADRA 2EOMA 2EOSA 2EQ1A 3EPKA 1G2DC 2EMCA 1BBOA 2VRDA 1B69A 2EPCA 3M99B 1UN6B 2ELZA 2M9AA 1YUIA 4IS1C 1X6EA 4M9VC 2YU5A 5KL4A 1KJKA 4R2PA 2RPCA 2YTJA 2EPRA 2EM4A 2CT1A 2MDGA 3VHTB 2YTIA 2EMZA 2EN7A 2JPAA 2YTEA 2EMGA 2EOFA 1Z1BA 2EMAA 1JK2A 2LVHA 1YSAC 1A1LA 2YTGA 2BB8A 2CTDA 2YTNA 2EM5A 2MKNA 2EM2A 2DGCA 1TF3A 1TF6A 3MHSC 4IJDA 3MHHC 2EOIA 2RSIA 1AAYA 1X6FA 2EPAA 2WCC3 2EJ4A 1YUJA 2EL4A 1G2FC 4R2SA 1ZU1A 4R2DA 2EMBA 1A1KA 2YTQA 2EN4A 1F2IG 5KL7A 2I13A 2EMXA 2EL6A 2R1FA 1X6HA 2WBTA 2YRKA 2YRHA 4R2CA 1P47A 2EOXA 1UBDC 1BB8A 2EN2A 2EN6A 5KL5A 4R2QA 4F6MA 2EOQA 4F6NA 1TN9A 2YU8A 2E72A 2HGHA 1ZR9A 1X3CA 2YSOA 5KL6A 3EPJA 1WJPA 2EN8A 2EM8A 2YTFA 5KL3A 1MEYC 2EL5A 2ENAA 2LO3A 1ZAAC 2EM0A 1X5WA 2J7JA 2EQ0A 2EQ3A
chains in the Genus database with same CATH superfamily
2UU9E 2HHHE 1YYKA 5LLQA 2WBSA 2NABA 2EMWA 2WBUA 1XMQE 4F9BB 4F2JC 4BMJA 4DV5E 4P7DA 1LLMC 1X47A 3DF6A 4DUYE 1DGCA 5KL2A 2EPUA 1QNTA 3EPHA 2L3JA 4WSPA 2DIXA 1N36E 4R2AA 2DLKA 2A25A 1N34E 2EOYA 5ADZA 1ZBQA 1IQSA 2H36X 4LF6E 2EWLA 4R2RA 4DR2E 1PDAA 2YTPA 2V85A 2B3TB 2EMLA 3EPLA 5A6BD 4LF9E 4GKKE 2EOMA 4RH8A 3EPKA 1G2DC 4LF7E 1IMUA 1B69A 2K7IA 1IBKE 3M99B 1EKZA 5AC5A 1KJKA 4OX9E 1RQ0A 5DNYA 2N3HA 4R2PA 5LMNE 1EH6A 4JI3E 4TUGA 4JV5E 4F9CB 2EMGA 4WXCA 4O5GA 1IBLE 4X8WA 1A1LA 2DMYA 2BB8A 2CTDA 2HC5A 2EM5A 3BF2A 1TF3A 3JAMC 4IJDA 3MHHC 2R76A 2NUFA 1T39A 4OOGC 4BC9A 1G2FC 5IV8B 4R2SA 4KZSA 1PJSA 4WFTA 5AE2A 4BC7A 2I13A 1BB8A 1UBDC 2B9DA 2EOXA 5KL5A 4F6NA 2E5LE 1YPNA 4JI7E 1ZR9A 4DMIA 2HGHA 4DR1E 2YSOA 5KL6A 1WJPA 4DV7E 2M1SA 3VK6A 2YTFA 2JY9A 3THOB 1X5WA 2J7JA 2EQ0A 3HPZA 1X49A 2EQ3A 4DR7E 2EOZA 2ELYA 2EMIA 2EPZA 2LE2A 1A1HA 2DRPA 2RSMA 2EPKX 3J81C 2YRMA 2JVAA 1J5EE 1UHZA 4ZYGA 3J80C 2RS7A 1IQOA 4B3SE 2EMKA 2PRTA 4GZNC 4LFBE 1T4LB 4TUIA 4Q35B 3P1XA 2FTXB 4DV6E 2EMHA 2V86A 4M0VA 4B3TE 4X62E 2EN3A 2EMFA 3IWCA 4LF4E 1WXRA 3BGHA 2DLQA 4R2EA 2JP9A 1YYWA 4JI0E 1L4SA 1YYOA 2DMIA 4LTYA 2N8XA 4P78A 1A1JA 2LCEA 2UUBE 2MC6A 2V88A 2V83A 2EOHA 3J7AG 4DR4E 2LUQA 4BHBA 2RQLA 2DSYA 4BCAA 2EMCA 1DI2A 2EPCA 1J26A 5IXMB 1UN6B 2M9AA 4IS1C 3EQ1A 2LTRA 2RPCA 1GZ6A 2V89A 2YTJA 2CT1A 2L92A 3VYXA 2JYAA 5A6KA 2YTIA 4R03A 2EOFA 5LL6R 1Z1BA 2EMAA 2LVHA 4JI2E 4MLVA 5CFFE 1SR9A 5A6AA 2MKNA 2EM2A 3BBGA 3JU0A 3MHSC 2EPLX 2RSIA 4DV3E 1AAYA 2EPAA 1XNRE 2LBSB 3FIGA 2B7VA 4WXDA 2NA2A 1AH5A 2MC5A 2YWQA 2JR1A 3ADJA 4L8NA 4BHCA 4X65E 2F8BA 2LMZA 2NUGA 4R2DA 4X66E 2EMBA 2I9IA 3BIDA 2R1FA 2YRKA 4F54A 3IWDA 1P47A 3HTXA 4DKKA 5AC4A 2V8QB 4YY3E 4F6MA 2EOQA 1TN9A 2UUCE 1WHNA 1X3CA 2ZM6E 3EPJA 4JYAE 3ADGA 4X64E 2EM8A 5BR8E 5KL3A 4JI4E 1MEYC 4K0KE 2ODRD 1ZAAC 2B7TA 3ZOQB 3AUZA 1WHQA 2GLIA 2L6MA 2EOOA 4NZVA 2CSHA 2L2MA 2EP3A 2YPNA 4O24A 2UXCE 2ODRC 4LU9A 2Q8UA 1RMDA 2EE8A 4LFAE 2E1MA 2LRSA 3UK3C 1JK1A 4LF5E 2EM3A 2M4IA 2G7HA 3K6QA 3KZZA 2DB2A 2EPXA 2WZOA 4O43A 2EPNA 3QG5C 4DV0E 1A1GA 3ADLA 1HNZE 1MGTA 2LV2A 1GTKA 2YSPA 3TQMA 2GHFA 5IWAE 3HQ1A 4NHRA 4WPYA 2VE7C 5TSEA 4N4RB 4DV2E 2EPPA 2EN1A 2YTOA 2D9HA 2JOXA 5T6JA 2EM6A 2RTXA 2FGGA 3L00A 2YT4A 2KOUA 3AV0A 1EH7A 2ELZA 2EPOA 1YUIA 4M30A 2NUEA 4M9VC 2YU5A 4F9AB 4NXNE 2L8TA 2EPRA 1HR0E 5A2QC 3VHTB 5IT9C 2EMZA 2EN7A 2IHR1 2JXPA 2GPIA 1PKPA 3C4TA 1YSAC 2YTGA 2KHXA 3LMLA 1N32E 1ZBTA 4O4KA 1GQEA 5AASA 2EOIA 1X6FA 2UUAE 4R8OA 2EJ4A 5A6JA 4DV1E 4GEQB 1DQ3A 2VQFE 1KYQA 1ZU1A 2UXDE 2LTSA 1EH8A 3KZYA 2YTQA 4ZYDA 5KL7A 5LMUE 5F3WA 4AQYE 1X6HA 2UXBE 4WYQB 4R2QA 2V87A 2E72A 3F6GA 2L2KB 3ADIA 1FJGE 2EL5A 4YHHE 3C6KA 2LO3A 2EM0A 4J8ZA 2F4VE 4X9JA 3ECRA 2VF1A 3IWBA 1BBGA 2LJHA 1YZ9A 1SFEA 4FK5C 2EM9A 2M7QA 3HPSA 1A1IA 5AE1A 1T38A 2MDRA 1FKAE 1NCSA 2ENCA 1YFHA 2KONA 4GKJE 2EORA 5FLXC 2BBGA 2YZTA 2VQEE 4DR3E 1RC7A 1A1FA 4WSGA 1QU6A 1STUA 2EMYA 2FV4B 2RS6A 2YTDA 2ENHA 2EOJA 2JOBA 4DR5E 4KWYA 1XMOE 1HNWE 2EOEA 1IBME 2CPNA 4B3RE 2MKDA 2LUPB 3J7Yp 2EM7A 1T4NA 2EPMX 2EZ6A 2LT7A 2ADRA 3F6HA 4KHPE 2EOSA 2EQ1A 3HXLA 1BBOA 3KWRA 2VRDA 3LLHA 3C6MA 4L5NC 4ZYHA 1X48A 3VYYA 1X6EA 4ZYEA 3JTZA 4I8OA 5KL4A 4WX9A 4NXME 2EM4A 4BS9A 3T1YE 1WRJA 3OMLA 2MDGA 5AE3A 4DUZE 4JI8E 2JPAA 2YTEA 1XNQE 1JK2A 1HNXE 5A69A 3OTOE 4B3ME 2YTNA 1PJTA 3T1HE 2K4VA 2DGCA 4RHBB 2N3GA 1TF6A 4BBYA 1N33E 1O0WA 1I94E 2L2NA 2JWOA 2WCC3 1YUJA 3H09A 4Q28A 3THNA 2EL4A 4HTGA 4JI1E 1NEIA 1N3GA 1T4OA 3C4BA 3DJWA 1PJQA 1A1KA 2L33A 2EN4A 1F2IG 2LJUA 2EMXA 2EL6A 2L3CA 4R2CA 2WBTA 2YRHA 2HJJA 2EN2A 4M2ZA 2EN6A 4JI5E 2YU8A 4JI6E 4DR6E 1UILA 4LF8E 3MSWA 2EN8A 4LFCE 4MLQA 4DV4E 2ENAA 3RMPA 5A6BA 4HEIA
chains in the Genus database with same CATH topology
2EOZA 2ELYA 4X9JA 2GLIA 2EMIA 2EPZA 2EOOA 2CSHA 1A1HA 2DRPA 2EP3A 4FK5C 2WBSA 2NABA 2EM9A 2EMWA 2YRMA 2WBUA 1RMDA 1A1IA 4F2JC 2EE8A 1LLMC 3UK3C 1NCSA 2EMKA 2PRTA 1JK1A 1DGCA 2EM3A 2ENCA 4GZNC 5KL2A 2EORA 2EPUA 2EPXA 3EPHA 1A1FA 4WSGA 1A1GA 2EMYA 4R2AA 2LV2A 2YTDA 2DLKA 2EMHA 2YSPA 2A25A 2ENHA 2GHFA 2EN3A 2EOJA 2EMFA 2EOYA 2JP9A 2EOEA 2DLQA 4R2EA 2EPPA 4R2RA 2EN1A 2YTOA 2DMIA 2D9HA 2MKDA 1A1JA 2YTPA 2LCEA 2EM6A 2EM7A 2EMLA 3EPLA 2EOHA 2LT7A 2ADRA 2EOMA 2EOSA 2EQ1A 3EPKA 1G2DC 2EMCA 1BBOA 2VRDA 1B69A 2EPCA 3M99B 1UN6B 2ELZA 2M9AA 1YUIA 4IS1C 1X6EA 4M9VC 2YU5A 5KL4A 1KJKA 4R2PA 2RPCA 2YTJA 2EPRA 2EM4A 2CT1A 2MDGA 3VHTB 2YTIA 2EMZA 2EN7A 2JPAA 2YTEA 2EMGA 2EOFA 1Z1BA 2EMAA 1JK2A 2LVHA 1YSAC 1A1LA 2YTGA 2BB8A 2CTDA 2YTNA 2EM5A 2MKNA 2EM2A 2DGCA 1TF3A 1TF6A 3MHSC 4IJDA 3MHHC 2EOIA 2RSIA 1AAYA 1X6FA 2EPAA 2WCC3 2EJ4A 1YUJA 2EL4A 1G2FC 4R2SA 1ZU1A 4R2DA 2EMBA 1A1KA 2YTQA 2EN4A 1F2IG 5KL7A 2I13A 2EMXA 2EL6A 2R1FA 1X6HA 2WBTA 2YRKA 2YRHA 4R2CA 1P47A 2EOXA 1UBDC 1BB8A 2EN2A 2EN6A 5KL5A 4R2QA 4F6MA 2EOQA 4F6NA 1TN9A 2YU8A 2E72A 2HGHA 1ZR9A 1X3CA 2YSOA 5KL6A 3EPJA 1WJPA 2EN8A 2EM8A 2YTFA 5KL3A 1MEYC 2EL5A 2ENAA 2LO3A 1ZAAC 2EM0A 1X5WA 2J7JA 2EQ0A 2EQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOZ A;  2ELY A;  4X9J A;  2GLI A;  2EMI A;  2EPZ A;  2EOO A;  2CSH A;  1A1H A;  2DRP A;  2EP3 A;  4FK5 C;  2WBS A;  2NAB A;  2EM9 A;  2EMW A;  2YRM A;  2WBU A;  1RMD A;  1A1I A;  4F2J C;  2EE8 A;  1LLM C;  3UK3 C;  1NCS A;  2EMK A;  2PRT A;  1JK1 A;  1DGC A;  2EM3 A;  2ENC A;  4GZN C;  5KL2 A;  2EOR A;  2EPU A;  2EPX A;  3EPH A;  1A1F A;  4WSG A;  1A1G A;  2EMY A;  4R2A A;  2LV2 A;  2YTD A;  2DLK A;  2EMH A;  2YSP A;  2A25 A;  2ENH A;  2GHF A;  2EN3 A;  2EOJ A;  2EMF A;  2EOY A;  2JP9 A;  2EOE A;  2DLQ A;  4R2E A;  2EPP A;  4R2R A;  2EN1 A;  2YTO A;  2DMI A;  2D9H A;  2MKD A;  1A1J A;  2YTP A;  2LCE A;  2EM6 A;  2EM7 A;  2EML A;  3EPL A;  2EOH A;  2LT7 A;  2ADR A;  2EOM A;  2EOS A;  2EQ1 A;  3EPK A;  1G2D C;  2EMC A;  1BBO A;  2VRD A;  1B69 A;  2EPC A;  3M99 B;  1UN6 B;  2ELZ A;  2M9A A;  1YUI A;  4IS1 C;  1X6E A;  4M9V C;  2YU5 A;  5KL4 A;  1KJK A;  4R2P A;  2RPC A;  2YTJ A;  2EPR A;  2EM4 A;  2CT1 A;  2MDG A;  3VHT B;  2YTI A;  2EMZ A;  2EN7 A;  2JPA A;  2YTE A;  2EMG A;  2EOF A;  1Z1B A;  2EMA A;  1JK2 A;  2LVH A;  1YSA C;  1A1L A;  2YTG A;  2BB8 A;  2CTD A;  2YTN A;  2EM5 A;  2MKN A;  2EM2 A;  2DGC A;  1TF3 A;  1TF6 A;  3MHS C;  4IJD A;  3MHH C;  2EOI A;  2RSI A;  1AAY A;  1X6F A;  2EPA A;  2WCC 3;  2EJ4 A;  1YUJ A;  2EL4 A;  1G2F C;  4R2S A;  1ZU1 A;  4R2D A;  2EMB A;  1A1K A;  2YTQ A;  2EN4 A;  1F2I G;  5KL7 A;  2I13 A;  2EMX A;  2EL6 A;  2R1F A;  1X6H A;  2WBT A;  2YRK A;  2YRH A;  4R2C A;  1P47 A;  2EOX A;  1UBD C;  1BB8 A;  2EN2 A;  2EN6 A;  5KL5 A;  4R2Q A;  4F6M A;  2EOQ A;  4F6N A;  1TN9 A;  2YU8 A;  2E72 A;  2HGH A;  1ZR9 A;  1X3C A;  2YSO A;  5KL6 A;  3EPJ A;  1WJP A;  2EN8 A;  2EM8 A;  2YTF A;  5KL3 A;  1MEY C;  2EL5 A;  2ENA A;  2LO3 A;  1ZAA C;  2EM0 A;  1X5W A;  2J7J A;  2EQ0 A;  2EQ3 A; 
#chains in the Genus database with same CATH topology
 2UU9 E;  2HHH E;  1YYK A;  5LLQ A;  2WBS A;  2NAB A;  2EMW A;  2WBU A;  1XMQ E;  4F9B B;  4F2J C;  4BMJ A;  4DV5 E;  4P7D A;  1LLM C;  1X47 A;  3DF6 A;  4DUY E;  1DGC A;  5KL2 A;  2EPU A;  1QNT A;  3EPH A;  2L3J A;  4WSP A;  2DIX A;  1N36 E;  4R2A A;  2DLK A;  2A25 A;  1N34 E;  2EOY A;  5ADZ A;  1ZBQ A;  1IQS A;  2H36 X;  4LF6 E;  2EWL A;  4R2R A;  4DR2 E;  1PDA A;  2YTP A;  2V85 A;  2B3T B;  2EML A;  3EPL A;  5A6B D;  4LF9 E;  4GKK E;  2EOM A;  4RH8 A;  3EPK A;  1G2D C;  4LF7 E;  1IMU A;  1B69 A;  2K7I A;  1IBK E;  3M99 B;  1EKZ A;  5AC5 A;  1KJK A;  4OX9 E;  1RQ0 A;  5DNY A;  2N3H A;  4R2P A;  5LMN E;  1EH6 A;  4JI3 E;  4TUG A;  4JV5 E;  4F9C B;  2EMG A;  4WXC A;  4O5G A;  1IBL E;  4X8W A;  1A1L A;  2DMY A;  2BB8 A;  2CTD A;  2HC5 A;  2EM5 A;  3BF2 A;  1TF3 A;  3JAM C;  4IJD A;  3MHH C;  2R76 A;  2NUF A;  1T39 A;  4OOG C;  4BC9 A;  1G2F C;  5IV8 B;  4R2S A;  4KZS A;  1PJS A;  4WFT A;  5AE2 A;  4BC7 A;  2I13 A;  1BB8 A;  1UBD C;  2B9D A;  2EOX A;  5KL5 A;  4F6N A;  2E5L E;  1YPN A;  4JI7 E;  1ZR9 A;  4DMI A;  2HGH A;  4DR1 E;  2YSO A;  5KL6 A;  1WJP A;  4DV7 E;  2M1S A;  3VK6 A;  2YTF A;  2JY9 A;  3THO B;  1X5W A;  2J7J A;  2EQ0 A;  3HPZ A;  1X49 A;  2EQ3 A;  4DR7 E;  2EOZ A;  2ELY A;  2EMI A;  2EPZ A;  2LE2 A;  1A1H A;  2DRP A;  2RSM A;  2EPK X;  3J81 C;  2YRM A;  2JVA A;  1J5E E;  1UHZ A;  4ZYG A;  3J80 C;  2RS7 A;  1IQO A;  4B3S E;  2EMK A;  2PRT A;  4GZN C;  4LFB E;  1T4L B;  4TUI A;  4Q35 B;  3P1X A;  2FTX B;  4DV6 E;  2EMH A;  2V86 A;  4M0V A;  4B3T E;  4X62 E;  2EN3 A;  2EMF A;  3IWC A;  4LF4 E;  1WXR A;  3BGH A;  2DLQ A;  4R2E A;  2JP9 A;  1YYW A;  4JI0 E;  1L4S A;  1YYO A;  2DMI A;  4LTY A;  2N8X A;  4P78 A;  1A1J A;  2LCE A;  2UUB E;  2MC6 A;  2V88 A;  2V83 A;  2EOH A;  3J7A G;  4DR4 E;  2LUQ A;  4BHB A;  2RQL A;  2DSY A;  4BCA A;  2EMC A;  1DI2 A;  2EPC A;  1J26 A;  5IXM B;  1UN6 B;  2M9A A;  4IS1 C;  3EQ1 A;  2LTR A;  2RPC A;  1GZ6 A;  2V89 A;  2YTJ A;  2CT1 A;  2L92 A;  3VYX A;  2JYA A;  5A6K A;  2YTI A;  4R03 A;  2EOF A;  5LL6 R;  1Z1B A;  2EMA A;  2LVH A;  4JI2 E;  4MLV A;  5CFF E;  1SR9 A;  5A6A A;  2MKN A;  2EM2 A;  3BBG A;  3JU0 A;  3MHS C;  2EPL X;  2RSI A;  4DV3 E;  1AAY A;  2EPA A;  1XNR E;  2LBS B;  3FIG A;  2B7V A;  4WXD A;  2NA2 A;  1AH5 A;  2MC5 A;  2YWQ A;  2JR1 A;  3ADJ A;  4L8N A;  4BHC A;  4X65 E;  2F8B A;  2LMZ A;  2NUG A;  4R2D A;  4X66 E;  2EMB A;  2I9I A;  3BID A;  2R1F A;  2YRK A;  4F54 A;  3IWD A;  1P47 A;  3HTX A;  4DKK A;  5AC4 A;  2V8Q B;  4YY3 E;  4F6M A;  2EOQ A;  1TN9 A;  2UUC E;  1WHN A;  1X3C A;  2ZM6 E;  3EPJ A;  4JYA E;  3ADG A;  4X64 E;  2EM8 A;  5BR8 E;  5KL3 A;  4JI4 E;  1MEY C;  4K0K E;  2ODR D;  1ZAA C;  2B7T A;  3ZOQ B;  3AUZ A;  1WHQ A;  2GLI A;  2L6M A;  2EOO A;  4NZV A;  2CSH A;  2L2M A;  2EP3 A;  2YPN A;  4O24 A;  2UXC E;  2ODR C;  4LU9 A;  2Q8U A;  1RMD A;  2EE8 A;  4LFA E;  2E1M A;  2LRS A;  3UK3 C;  1JK1 A;  4LF5 E;  2EM3 A;  2M4I A;  2G7H A;  3K6Q A;  3KZZ A;  2DB2 A;  2EPX A;  2WZO A;  4O43 A;  2EPN A;  3QG5 C;  4DV0 E;  1A1G A;  3ADL A;  1HNZ E;  1MGT A;  2LV2 A;  1GTK A;  2YSP A;  3TQM A;  2GHF A;  5IWA E;  3HQ1 A;  4NHR A;  4WPY A;  2VE7 C;  5TSE A;  4N4R B;  4DV2 E;  2EPP A;  2EN1 A;  2YTO A;  2D9H A;  2JOX A;  5T6J A;  2EM6 A;  2RTX A;  2FGG A;  3L00 A;  2YT4 A;  2KOU A;  3AV0 A;  1EH7 A;  2ELZ A;  2EPO A;  1YUI A;  4M30 A;  2NUE A;  4M9V C;  2YU5 A;  4F9A B;  4NXN E;  2L8T A;  2EPR A;  1HR0 E;  5A2Q C;  3VHT B;  5IT9 C;  2EMZ A;  2EN7 A;  2IHR 1;  2JXP A;  2GPI A;  1PKP A;  3C4T A;  1YSA C;  2YTG A;  2KHX A;  3LML A;  1N32 E;  1ZBT A;  4O4K A;  1GQE A;  5AAS A;  2EOI A;  1X6F A;  2UUA E;  4R8O A;  2EJ4 A;  5A6J A;  4DV1 E;  4GEQ B;  1DQ3 A;  2VQF E;  1KYQ A;  1ZU1 A;  2UXD E;  2LTS A;  1EH8 A;  3KZY A;  2YTQ A;  4ZYD A;  5KL7 A;  5LMU E;  5F3W A;  4AQY E;  1X6H A;  2UXB E;  4WYQ B;  4R2Q A;  2V87 A;  2E72 A;  3F6G A;  2L2K B;  3ADI A;  1FJG E;  2EL5 A;  4YHH E;  3C6K A;  2LO3 A;  2EM0 A;  4J8Z A;  2F4V E;  4X9J A;  3ECR A;  2VF1 A;  3IWB A;  1BBG A;  2LJH A;  1YZ9 A;  1SFE A;  4FK5 C;  2EM9 A;  2M7Q A;  3HPS A;  1A1I A;  5AE1 A;  1T38 A;  2MDR A;  1FKA E;  1NCS A;  2ENC A;  1YFH A;  2KON A;  4GKJ E;  2EOR A;  5FLX C;  2BBG A;  2YZT A;  2VQE E;  4DR3 E;  1RC7 A;  1A1F A;  4WSG A;  1QU6 A;  1STU A;  2EMY A;  2FV4 B;  2RS6 A;  2YTD A;  2ENH A;  2EOJ A;  2JOB A;  4DR5 E;  4KWY A;  1XMO E;  1HNW E;  2EOE A;  1IBM E;  2CPN A;  4B3R E;  2MKD A;  2LUP B;  3J7Y p;  2EM7 A;  1T4N A;  2EPM X;  2EZ6 A;  2LT7 A;  2ADR A;  3F6H A;  4KHP E;  2EOS A;  2EQ1 A;  3HXL A;  1BBO A;  3KWR A;  2VRD A;  3LLH A;  3C6M A;  4L5N C;  4ZYH A;  1X48 A;  3VYY A;  1X6E A;  4ZYE A;  3JTZ A;  4I8O A;  5KL4 A;  4WX9 A;  4NXM E;  2EM4 A;  4BS9 A;  3T1Y E;  1WRJ A;  3OML A;  2MDG A;  5AE3 A;  4DUZ E;  4JI8 E;  2JPA A;  2YTE A;  1XNQ E;  1JK2 A;  1HNX E;  5A69 A;  3OTO E;  4B3M E;  2YTN A;  1PJT A;  3T1H E;  2K4V A;  2DGC A;  4RHB B;  2N3G A;  1TF6 A;  4BBY A;  1N33 E;  1O0W A;  1I94 E;  2L2N A;  2JWO A;  2WCC 3;  1YUJ A;  3H09 A;  4Q28 A;  3THN A;  2EL4 A;  4HTG A;  4JI1 E;  1NEI A;  1N3G A;  1T4O A;  3C4B A;  3DJW A;  1PJQ A;  1A1K A;  2L33 A;  2EN4 A;  1F2I G;  2LJU A;  2EMX A;  2EL6 A;  2L3C A;  4R2C A;  2WBT A;  2YRH A;  2HJJ A;  2EN2 A;  4M2Z A;  2EN6 A;  4JI5 E;  2YU8 A;  4JI6 E;  4DR6 E;  1UIL A;  4LF8 E;  3MSW A;  2EN8 A;  4LFC E;  4MLQ A;  4DV4 E;  2ENA A;  3RMP A;  5A6B A;  4HEI A; 
#chains in the Genus database with same CATH homology
 2EOZ A;  2ELY A;  4X9J A;  2GLI A;  2EMI A;  2EPZ A;  2EOO A;  2CSH A;  1A1H A;  2DRP A;  2EP3 A;  4FK5 C;  2WBS A;  2NAB A;  2EM9 A;  2EMW A;  2YRM A;  2WBU A;  1RMD A;  1A1I A;  4F2J C;  2EE8 A;  1LLM C;  3UK3 C;  1NCS A;  2EMK A;  2PRT A;  1JK1 A;  1DGC A;  2EM3 A;  2ENC A;  4GZN C;  5KL2 A;  2EOR A;  2EPU A;  2EPX A;  3EPH A;  1A1F A;  4WSG A;  1A1G A;  2EMY A;  4R2A A;  2LV2 A;  2YTD A;  2DLK A;  2EMH A;  2YSP A;  2A25 A;  2ENH A;  2GHF A;  2EN3 A;  2EOJ A;  2EMF A;  2EOY A;  2JP9 A;  2EOE A;  2DLQ A;  4R2E A;  2EPP A;  4R2R A;  2EN1 A;  2YTO A;  2DMI A;  2D9H A;  2MKD A;  1A1J A;  2YTP A;  2LCE A;  2EM6 A;  2EM7 A;  2EML A;  3EPL A;  2EOH A;  2LT7 A;  2ADR A;  2EOM A;  2EOS A;  2EQ1 A;  3EPK A;  1G2D C;  2EMC A;  1BBO A;  2VRD A;  1B69 A;  2EPC A;  3M99 B;  1UN6 B;  2ELZ A;  2M9A A;  1YUI A;  4IS1 C;  1X6E A;  4M9V C;  2YU5 A;  5KL4 A;  1KJK A;  4R2P A;  2RPC A;  2YTJ A;  2EPR A;  2EM4 A;  2CT1 A;  2MDG A;  3VHT B;  2YTI A;  2EMZ A;  2EN7 A;  2JPA A;  2YTE A;  2EMG A;  2EOF A;  1Z1B A;  2EMA A;  1JK2 A;  2LVH A;  1YSA C;  1A1L A;  2YTG A;  2BB8 A;  2CTD A;  2YTN A;  2EM5 A;  2MKN A;  2EM2 A;  2DGC A;  1TF3 A;  1TF6 A;  3MHS C;  4IJD A;  3MHH C;  2EOI A;  2RSI A;  1AAY A;  1X6F A;  2EPA A;  2WCC 3;  2EJ4 A;  1YUJ A;  2EL4 A;  1G2F C;  4R2S A;  1ZU1 A;  4R2D A;  2EMB A;  1A1K A;  2YTQ A;  2EN4 A;  1F2I G;  5KL7 A;  2I13 A;  2EMX A;  2EL6 A;  2R1F A;  1X6H A;  2WBT A;  2YRK A;  2YRH A;  4R2C A;  1P47 A;  2EOX A;  1UBD C;  1BB8 A;  2EN2 A;  2EN6 A;  5KL5 A;  4R2Q A;  4F6M A;  2EOQ A;  4F6N A;  1TN9 A;  2YU8 A;  2E72 A;  2HGH A;  1ZR9 A;  1X3C A;  2YSO A;  5KL6 A;  3EPJ A;  1WJP A;  2EN8 A;  2EM8 A;  2YTF A;  5KL3 A;  1MEY C;  2EL5 A;  2ENA A;  2LO3 A;  1ZAA C;  2EM0 A;  1X5W A;  2J7J A;  2EQ0 A;  2EQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...