1X6FA

Solution structures of the c2h2 type zinc finger domain of human zinc finger protein 462
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
88
structure length
88
Chain Sequence
GSSGSSGLKRDFIILGNGPRLQNSTYQCKHCDSKLQSTAELTSHLNIHNEEFQKRAKRQERRKQLLSKQKYADGAFADFKQESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of the C2H2 type zinc finger domain of human Zinc finger protein 462
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Zinc finger protein 462
total genus 12
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1x6fA00
1A1IA 2EM5A 2EJ4A 2PRTA 4R2DA 1BB8A 1P47A 2EL4A 1G2DC 1F2IG 2EQ1A 1X6EA 2EMZA 2EM2A 2EOJA 1JK1A 2EN1A 2EM0A 4F6MA 2EL6A 2YRKA 3M99B 4R2PA 1ZU1A 2LO3A 2R1FA 2M9AA 4F6NA 1LLMC 2MDGA 4R2RA 2E72A 2EOMA 2MKDA 1A1KA 2EOXA 2VRDA 1JK2A 2WBSA 4F2JC 1A1HA 2YTOA 3EPHA 4R2SA 2EP3A 5KL7A 1UN6B 2YRMA 1DGCA 1TF6A 2EMAA 1A1JA 2DLKA 2EM3A 2I13A 2EOSA 1ZAAC 2EPPA 1X6FA 2ELYA 2LT7A 2EM4A 1X5WA 2EN2A 2EPUA 1AAYA 1YSAC 2EN7A 1BBOA 2ENCA 2LVHA 2EPRA 2YTFA 5KL2A 5KL6A 1TF3A 2YRHA 3MHHC 2EM7A 2EQ3A 2EOIA 2CT1A 4R2AA 2YTJA 1A1LA 2NABA 2CTDA 3EPJA 2EL5A 2EOZA 2JPAA 2EOHA 3EPKA 2EMKA 2ENAA 2EM6A 2LCEA 2YU5A 2YTNA 2CSHA 1A1GA 2EMYA 2EPZA 2YU8A 1RMDA 2YSPA 2EMCA 4IS1C 2YTDA 2EPCA 2DMIA 4WSGA 2YTEA 3EPLA 2EN3A 1G2FC 2EMLA 5KL5A 5KL3A 4M9VC 2EPAA 2EMFA 2EN8A 4X9JA 1ZR9A 3VHTB 2BB8A 2WBUA 2GHFA 2EMHA 4R2CA 2WCC3 2ELZA 2EM8A 1X6HA 2D9HA 2EMGA 5KL4A 1KJKA 2GLIA 2DRPA 2EMWA 2DLQA 4R2EA 2EOQA 2EMBA 1TN9A 2EOOA 2WBTA 2HGHA 2RPCA 2EN4A 2YTGA 1A1FA 2EPXA 2A25A 2EE8A 2EMXA 2LV2A 1MEYC 2YSOA 2RSIA 2MKNA 2EMIA 1YUJA 1UBDC 3UK3C 1X3CA 2YTPA 2JP9A 2J7JA 3MHSC 1B69A 2EOYA 1WJPA 2EM9A 1Z1BA 1NCSA 2EQ0A 2EOEA 2ADRA 2EOFA 2EORA 2EN6A 4R2QA 4GZNC 1YUIA 2ENHA 4FK5C 2YTIA 4IJDA 2DGCA 2YTQA
chains in the Genus database with same CATH superfamily
4B3RE 2EM5A 2EJ4A 1BB8A 5T6JA 1P47A 1YYKA 2LTRA 2EQ1A 2IHR1 3BIDA 3FIGA 2EM2A 2EOJA 4MLVA 1T4OA 4DUYE 2EN1A 4F9AB 2DMYA 1T4LB 2CPNA 3OMLA 4YY3E 1FKAE 4R2RA 2EPKX 1YZ9A 2MKDA 4TUIA 2GPIA 1JK2A 4WFTA 5A2QC 4HEIA 4LF4E 4BHCA 1SR9A 4O24A 2B7VA 2DLKA 3EQ1A 2I13A 4BCAA 2EPPA 4WX9A 1X6FA 2ELYA 4ZYDA 1T39A 2NA2A 2EM4A 2EN2A 2EPUA 5CFFE 1BBOA 2EN7A 2L2MA 2EPRA 2YTFA 5KL6A 5AE3A 1TF3A 2RS7A 1IQSA 3ZOQB 4R2AA 2HJJA 2YTJA 1RC7A 2B3TB 3JTZA 2CTDA 3EPJA 2KONA 2B7TA 3T1YE 4LF8E 2YU5A 2YTNA 2EMYA 2RS6A 2EPZA 1RMDA 2YSPA 2YT4A 4R03A 2LMZA 2EPCA 3AV0A 3EPLA 2K7IA 2EN3A 2JY9A 5ADZA 3J80C 4RH8A 1PJSA 5KL5A 4R8OA 4JI4E 5LL6R 3KWRA 1HNZE 4LU9A 2NUGA 1DQ3A 4R2CA 2EM8A 1UILA 2D9HA 4X8WA 1KJKA 2WZOA 2DRPA 2EMWA 2LTSA 4R2EA 3THOB 3ADJA 1TN9A 2Q8UA 2YTGA 3HPZA 4DKKA 2FGGA 2LV2A 2LUQA 4BMJA 4LF5E 1DI2A 5IV8B 2LBSB 2EMIA 1FJGE 4NHRA 1UBDC 1X3CA 1HR0E 4WPYA 4TUGA 3J7AG 3MHSC 1B69A 1N32E 4I8OA 1NCSA 1YUIA 3BBGA 2ADRA 4P7DA 3JU0A 3J81C 4DR3E 2NUEA 4BC7A 4FK5C 1X47A 2YTIA 4IJDA 4F9CB 4JI7E 1A1IA 4F9BB 1IQOA 2PRTA 4X64E 2NUFA 2EWLA 5A6AA 4DV5E 3T1HE 1F2IG 2M7QA 4Q35B 2L2KB 1JK1A 1WRJA 5DNYA 2F4VE 1HNWE 4DV7E 2JXPA 1MGTA 2YRKA 3M99B 1ZU1A 1LLMC 5AC4A 2E72A 2EOMA 2G7HA 3VYYA 2VQEE 2VRDA 3F6HA 1O0WA 4KHPE 4F2JC 4KWYA 4JV5E 3EPHA 1WHNA 2ODRD 2V8QB 1TF6A 2HHHE 2JOBA 1N3GA 4LF7E 1IBKE 1YFHA 2LT7A 2KHXA 3HQ1A 1I94E 1AAYA 2V88A 4BHBA 2BBGA 3LMLA 1WXRA 2JWOA 2V83A 5A6BA 2M4IA 3MSWA 3BGHA 2CT1A 1A1LA 1QNTA 2FTXB 2KOUA 2N3HA 2EOZA 2JPAA 2R76A 4DMIA 3EPKA 2EMKA 2ENAA 2LCEA 1EKZA 4JI2E 4DV6E 2VF1A 1UHZA 4GKKE 4J8ZA 2EMLA 1PJTA 5KL3A 3ADIA 4JI6E 3VK6A 3IWBA 2WBUA 2GHFA 2EMHA 4BS9A 1YPNA 1ZBQA 3L00A 1X6HA 2UXCE 1EH8A 2LUPB 2GLIA 4B3ME 2DLQA 1YYOA 2EMBA 2EOOA 2FV4B 2WBTA 2YZTA 3DF6A 2HGHA 2EN4A 2A25A 2L2NA 4LTYA 1MEYC 1IMUA 3LLHA 2DSYA 4RHBB 2MKNA 4O43A 2V85A 4ZYHA 4N4RB 1L4SA 1J26A 3QG5C 2F8BA 2JOXA 3OTOE 2EOEA 5A6JA 2UUAE 2EORA 4NXME 2EPMX 5IXMB 2DGCA 3K6QA 2JYAA 2MDRA 4R2DA 3H09A 2EL4A 4DUZE 1G2DC 2I9IA 2EMZA 4HTGA 3HPSA 2K4VA 4L8NA 2EL6A 2B9DA 4DR7E 4R2PA 2LO3A 4F6NA 2M9AA 4GKJE 2MDGA 5A69A 4GEQB 2UUCE 2EOXA 4DV3E 2ODRC 1EH6A 2WBSA 5LMUE 2EP3A 5KL7A 2RQLA 1UN6B 2DB2A 2YRMA 2L92A 4MLQA 2EMAA 2EPLX 4O4KA 2L33A 1N36E 2EM3A 1A1JA 2JR1A 5AC5A 1PKPA 2EOSA 4BC9A 3P1XA 5IWAE 5AASA 5A6BD 5BR8E 5KL2A 2LVHA 2DIXA 2YRHA 3MHHC 2MC5A 3THNA 1BBGA 1T38A 2EM7A 1SFEA 4DV2E 2L6MA 3C6KA 2EOIA 4WSPA 2NABA 2EL5A 1ZBTA 2EOHA 4LFAE 2V87A 4B3TE 2CSHA 5IT9C 2VE7C 4OOGC 2EMCA 4LFBE 4KZSA 2E5LE 4JI3E 4DV1E 2DMIA 4WSGA 1KYQA 4M9VC 2EMFA 3C4TA 1ZR9A 2BB8A 3DJWA 2ELZA 2EMGA 4O5GA 5KL4A 4JI5E 4M0VA 2EOQA 4B3SE 1WHQA 4F54A 2L3JA 4JI1E 4DR5E 2RSIA 4K0KE 3BF2A 4BBYA 4X62E 4ZYEA 1XMQE 3HXLA 2YTPA 1XNQE 4L5NC 2E1MA 4YHHE 1YYWA 1WJPA 2L8TA 3ECRA 1GQEA 1X49A 2EQ0A 4WYQB 2EN6A 4GZNC 3F6GA 2YTQA 2H36X 2UXBE 2LJUA 3KZYA 1XMOE 2JVAA 2YWQA 1X6EA 3HTXA 3IWDA 2N8XA 4DR1E 2EM0A 4F6MA 1STUA 2R1FA 5LLQA 3IWCA 1A1KA 4JYAE 2LJHA 4DV0E 1EH7A 1A1HA 2YTOA 1AH5A 5TSEA 2ZM6E 1T4NA 4R2SA 1XNRE 4LF9E 1DGCA 4M30A 4WXCA 2UU9E 1ZAAC 2YPNA 1J5EE 3KZZA 1YSAC 1NEIA 1X5WA 3RMPA 2ENCA 3ADGA 1QU6A 2V89A 2HC5A 4DR4E 3JAMC 1IBLE 2EQ3A 2VQFE 1N33E 4LFCE 5F3WA 3AUZA 2EPOA 5LMNE 2MC6A 4NXNE 3C6MA 4JI8E 4WXDA 4X65E 4OX9E 2EM6A 4P78A 4X66E 1A1GA 2UUBE 2LE2A 2YU8A 3TQMA 4IS1C 2YTDA 2YTEA 2RTXA 4JI0E 2M1SA 1G2FC 4ZYGA 4Q28A 2UXDE 1GZ6A 2EPAA 2EN8A 4X9JA 3VHTB 4NZVA 3C4BA 2WCC3 4LF6E 1PDAA 4AQYE 3J7Yp 5AE2A 1RQ0A 2EZ6A 2RSMA 2LRSA 4DR2E 2RPCA 1X48A 1A1FA 3VYXA 2EPXA 2EE8A 2EMXA 2EPNA 4DV4E 2YSOA 2V86A 5AE1A 1YUJA 5A6KA 1GTKA 2L3CA 3UK3C 2N3GA 2JP9A 1N34E 1IBME 4DR6E 5FLXC 2J7JA 4M2ZA 2EOYA 2EM9A 1Z1BA 2EOFA 1PJQA 4R2QA 3ADLA 2ENHA 1HNXE
chains in the Genus database with same CATH topology
1A1IA 2EM5A 2EJ4A 2PRTA 4R2DA 1BB8A 1P47A 2EL4A 1G2DC 1F2IG 2EQ1A 1X6EA 2EMZA 2EM2A 2EOJA 1JK1A 2EN1A 2EM0A 4F6MA 2EL6A 2YRKA 3M99B 4R2PA 1ZU1A 2LO3A 2R1FA 2M9AA 4F6NA 1LLMC 2MDGA 4R2RA 2E72A 2EOMA 2MKDA 1A1KA 2EOXA 2VRDA 1JK2A 2WBSA 4F2JC 1A1HA 2YTOA 3EPHA 4R2SA 2EP3A 5KL7A 1UN6B 2YRMA 1DGCA 1TF6A 2EMAA 1A1JA 2DLKA 2EM3A 2I13A 2EOSA 1ZAAC 2EPPA 1X6FA 2ELYA 2LT7A 2EM4A 1X5WA 2EN2A 2EPUA 1AAYA 1YSAC 2EN7A 1BBOA 2ENCA 2LVHA 2EPRA 2YTFA 5KL2A 5KL6A 1TF3A 2YRHA 3MHHC 2EM7A 2EQ3A 2EOIA 2CT1A 4R2AA 2YTJA 1A1LA 2NABA 2CTDA 3EPJA 2EL5A 2EOZA 2JPAA 2EOHA 3EPKA 2EMKA 2ENAA 2EM6A 2LCEA 2YU5A 2YTNA 2CSHA 1A1GA 2EMYA 2EPZA 2YU8A 1RMDA 2YSPA 2EMCA 4IS1C 2YTDA 2EPCA 2DMIA 4WSGA 2YTEA 3EPLA 2EN3A 1G2FC 2EMLA 5KL5A 5KL3A 4M9VC 2EPAA 2EMFA 2EN8A 4X9JA 1ZR9A 3VHTB 2BB8A 2WBUA 2GHFA 2EMHA 4R2CA 2WCC3 2ELZA 2EM8A 1X6HA 2D9HA 2EMGA 5KL4A 1KJKA 2GLIA 2DRPA 2EMWA 2DLQA 4R2EA 2EOQA 2EMBA 1TN9A 2EOOA 2WBTA 2HGHA 2RPCA 2EN4A 2YTGA 1A1FA 2EPXA 2A25A 2EE8A 2EMXA 2LV2A 1MEYC 2YSOA 2RSIA 2MKNA 2EMIA 1YUJA 1UBDC 3UK3C 1X3CA 2YTPA 2JP9A 2J7JA 3MHSC 1B69A 2EOYA 1WJPA 2EM9A 1Z1BA 1NCSA 2EQ0A 2EOEA 2ADRA 2EOFA 2EORA 2EN6A 4R2QA 4GZNC 1YUIA 2ENHA 4FK5C 2YTIA 4IJDA 2DGCA 2YTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A1I A;  2EM5 A;  2EJ4 A;  2PRT A;  4R2D A;  1BB8 A;  1P47 A;  2EL4 A;  1G2D C;  1F2I G;  2EQ1 A;  1X6E A;  2EMZ A;  2EM2 A;  2EOJ A;  1JK1 A;  2EN1 A;  2EM0 A;  4F6M A;  2EL6 A;  2YRK A;  3M99 B;  4R2P A;  1ZU1 A;  2LO3 A;  2R1F A;  2M9A A;  4F6N A;  1LLM C;  2MDG A;  4R2R A;  2E72 A;  2EOM A;  2MKD A;  1A1K A;  2EOX A;  2VRD A;  1JK2 A;  2WBS A;  4F2J C;  1A1H A;  2YTO A;  3EPH A;  4R2S A;  2EP3 A;  5KL7 A;  1UN6 B;  2YRM A;  1DGC A;  1TF6 A;  2EMA A;  1A1J A;  2DLK A;  2EM3 A;  2I13 A;  2EOS A;  1ZAA C;  2EPP A;  1X6F A;  2ELY A;  2LT7 A;  2EM4 A;  1X5W A;  2EN2 A;  2EPU A;  1AAY A;  1YSA C;  2EN7 A;  1BBO A;  2ENC A;  2LVH A;  2EPR A;  2YTF A;  5KL2 A;  5KL6 A;  1TF3 A;  2YRH A;  3MHH C;  2EM7 A;  2EQ3 A;  2EOI A;  2CT1 A;  4R2A A;  2YTJ A;  1A1L A;  2NAB A;  2CTD A;  3EPJ A;  2EL5 A;  2EOZ A;  2JPA A;  2EOH A;  3EPK A;  2EMK A;  2ENA A;  2EM6 A;  2LCE A;  2YU5 A;  2YTN A;  2CSH A;  1A1G A;  2EMY A;  2EPZ A;  2YU8 A;  1RMD A;  2YSP A;  2EMC A;  4IS1 C;  2YTD A;  2EPC A;  2DMI A;  4WSG A;  2YTE A;  3EPL A;  2EN3 A;  1G2F C;  2EML A;  5KL5 A;  5KL3 A;  4M9V C;  2EPA A;  2EMF A;  2EN8 A;  4X9J A;  1ZR9 A;  3VHT B;  2BB8 A;  2WBU A;  2GHF A;  2EMH A;  4R2C A;  2WCC 3;  2ELZ A;  2EM8 A;  1X6H A;  2D9H A;  2EMG A;  5KL4 A;  1KJK A;  2GLI A;  2DRP A;  2EMW A;  2DLQ A;  4R2E A;  2EOQ A;  2EMB A;  1TN9 A;  2EOO A;  2WBT A;  2HGH A;  2RPC A;  2EN4 A;  2YTG A;  1A1F A;  2EPX A;  2A25 A;  2EE8 A;  2EMX A;  2LV2 A;  1MEY C;  2YSO A;  2RSI A;  2MKN A;  2EMI A;  1YUJ A;  1UBD C;  3UK3 C;  1X3C A;  2YTP A;  2JP9 A;  2J7J A;  3MHS C;  1B69 A;  2EOY A;  1WJP A;  2EM9 A;  1Z1B A;  1NCS A;  2EQ0 A;  2EOE A;  2ADR A;  2EOF A;  2EOR A;  2EN6 A;  4R2Q A;  4GZN C;  1YUI A;  2ENH A;  4FK5 C;  2YTI A;  4IJD A;  2DGC A;  2YTQ A; 
#chains in the Genus database with same CATH topology
 4B3R E;  2EM5 A;  2EJ4 A;  1BB8 A;  5T6J A;  1P47 A;  1YYK A;  2LTR A;  2EQ1 A;  2IHR 1;  3BID A;  3FIG A;  2EM2 A;  2EOJ A;  4MLV A;  1T4O A;  4DUY E;  2EN1 A;  4F9A B;  2DMY A;  1T4L B;  2CPN A;  3OML A;  4YY3 E;  1FKA E;  4R2R A;  2EPK X;  1YZ9 A;  2MKD A;  4TUI A;  2GPI A;  1JK2 A;  4WFT A;  5A2Q C;  4HEI A;  4LF4 E;  4BHC A;  1SR9 A;  4O24 A;  2B7V A;  2DLK A;  3EQ1 A;  2I13 A;  4BCA A;  2EPP A;  4WX9 A;  1X6F A;  2ELY A;  4ZYD A;  1T39 A;  2NA2 A;  2EM4 A;  2EN2 A;  2EPU A;  5CFF E;  1BBO A;  2EN7 A;  2L2M A;  2EPR A;  2YTF A;  5KL6 A;  5AE3 A;  1TF3 A;  2RS7 A;  1IQS A;  3ZOQ B;  4R2A A;  2HJJ A;  2YTJ A;  1RC7 A;  2B3T B;  3JTZ A;  2CTD A;  3EPJ A;  2KON A;  2B7T A;  3T1Y E;  4LF8 E;  2YU5 A;  2YTN A;  2EMY A;  2RS6 A;  2EPZ A;  1RMD A;  2YSP A;  2YT4 A;  4R03 A;  2LMZ A;  2EPC A;  3AV0 A;  3EPL A;  2K7I A;  2EN3 A;  2JY9 A;  5ADZ A;  3J80 C;  4RH8 A;  1PJS A;  5KL5 A;  4R8O A;  4JI4 E;  5LL6 R;  3KWR A;  1HNZ E;  4LU9 A;  2NUG A;  1DQ3 A;  4R2C A;  2EM8 A;  1UIL A;  2D9H A;  4X8W A;  1KJK A;  2WZO A;  2DRP A;  2EMW A;  2LTS A;  4R2E A;  3THO B;  3ADJ A;  1TN9 A;  2Q8U A;  2YTG A;  3HPZ A;  4DKK A;  2FGG A;  2LV2 A;  2LUQ A;  4BMJ A;  4LF5 E;  1DI2 A;  5IV8 B;  2LBS B;  2EMI A;  1FJG E;  4NHR A;  1UBD C;  1X3C A;  1HR0 E;  4WPY A;  4TUG A;  3J7A G;  3MHS C;  1B69 A;  1N32 E;  4I8O A;  1NCS A;  1YUI A;  3BBG A;  2ADR A;  4P7D A;  3JU0 A;  3J81 C;  4DR3 E;  2NUE A;  4BC7 A;  4FK5 C;  1X47 A;  2YTI A;  4IJD A;  4F9C B;  4JI7 E;  1A1I A;  4F9B B;  1IQO A;  2PRT A;  4X64 E;  2NUF A;  2EWL A;  5A6A A;  4DV5 E;  3T1H E;  1F2I G;  2M7Q A;  4Q35 B;  2L2K B;  1JK1 A;  1WRJ A;  5DNY A;  2F4V E;  1HNW E;  4DV7 E;  2JXP A;  1MGT A;  2YRK A;  3M99 B;  1ZU1 A;  1LLM C;  5AC4 A;  2E72 A;  2EOM A;  2G7H A;  3VYY A;  2VQE E;  2VRD A;  3F6H A;  1O0W A;  4KHP E;  4F2J C;  4KWY A;  4JV5 E;  3EPH A;  1WHN A;  2ODR D;  2V8Q B;  1TF6 A;  2HHH E;  2JOB A;  1N3G A;  4LF7 E;  1IBK E;  1YFH A;  2LT7 A;  2KHX A;  3HQ1 A;  1I94 E;  1AAY A;  2V88 A;  4BHB A;  2BBG A;  3LML A;  1WXR A;  2JWO A;  2V83 A;  5A6B A;  2M4I A;  3MSW A;  3BGH A;  2CT1 A;  1A1L A;  1QNT A;  2FTX B;  2KOU A;  2N3H A;  2EOZ A;  2JPA A;  2R76 A;  4DMI A;  3EPK A;  2EMK A;  2ENA A;  2LCE A;  1EKZ A;  4JI2 E;  4DV6 E;  2VF1 A;  1UHZ A;  4GKK E;  4J8Z A;  2EML A;  1PJT A;  5KL3 A;  3ADI A;  4JI6 E;  3VK6 A;  3IWB A;  2WBU A;  2GHF A;  2EMH A;  4BS9 A;  1YPN A;  1ZBQ A;  3L00 A;  1X6H A;  2UXC E;  1EH8 A;  2LUP B;  2GLI A;  4B3M E;  2DLQ A;  1YYO A;  2EMB A;  2EOO A;  2FV4 B;  2WBT A;  2YZT A;  3DF6 A;  2HGH A;  2EN4 A;  2A25 A;  2L2N A;  4LTY A;  1MEY C;  1IMU A;  3LLH A;  2DSY A;  4RHB B;  2MKN A;  4O43 A;  2V85 A;  4ZYH A;  4N4R B;  1L4S A;  1J26 A;  3QG5 C;  2F8B A;  2JOX A;  3OTO E;  2EOE A;  5A6J A;  2UUA E;  2EOR A;  4NXM E;  2EPM X;  5IXM B;  2DGC A;  3K6Q A;  2JYA A;  2MDR A;  4R2D A;  3H09 A;  2EL4 A;  4DUZ E;  1G2D C;  2I9I A;  2EMZ A;  4HTG A;  3HPS A;  2K4V A;  4L8N A;  2EL6 A;  2B9D A;  4DR7 E;  4R2P A;  2LO3 A;  4F6N A;  2M9A A;  4GKJ E;  2MDG A;  5A69 A;  4GEQ B;  2UUC E;  2EOX A;  4DV3 E;  2ODR C;  1EH6 A;  2WBS A;  5LMU E;  2EP3 A;  5KL7 A;  2RQL A;  1UN6 B;  2DB2 A;  2YRM A;  2L92 A;  4MLQ A;  2EMA A;  2EPL X;  4O4K A;  2L33 A;  1N36 E;  2EM3 A;  1A1J A;  2JR1 A;  5AC5 A;  1PKP A;  2EOS A;  4BC9 A;  3P1X A;  5IWA E;  5AAS A;  5A6B D;  5BR8 E;  5KL2 A;  2LVH A;  2DIX A;  2YRH A;  3MHH C;  2MC5 A;  3THN A;  1BBG A;  1T38 A;  2EM7 A;  1SFE A;  4DV2 E;  2L6M A;  3C6K A;  2EOI A;  4WSP A;  2NAB A;  2EL5 A;  1ZBT A;  2EOH A;  4LFA E;  2V87 A;  4B3T E;  2CSH A;  5IT9 C;  2VE7 C;  4OOG C;  2EMC A;  4LFB E;  4KZS A;  2E5L E;  4JI3 E;  4DV1 E;  2DMI A;  4WSG A;  1KYQ A;  4M9V C;  2EMF A;  3C4T A;  1ZR9 A;  2BB8 A;  3DJW A;  2ELZ A;  2EMG A;  4O5G A;  5KL4 A;  4JI5 E;  4M0V A;  2EOQ A;  4B3S E;  1WHQ A;  4F54 A;  2L3J A;  4JI1 E;  4DR5 E;  2RSI A;  4K0K E;  3BF2 A;  4BBY A;  4X62 E;  4ZYE A;  1XMQ E;  3HXL A;  2YTP A;  1XNQ E;  4L5N C;  2E1M A;  4YHH E;  1YYW A;  1WJP A;  2L8T A;  3ECR A;  1GQE A;  1X49 A;  2EQ0 A;  4WYQ B;  2EN6 A;  4GZN C;  3F6G A;  2YTQ A;  2H36 X;  2UXB E;  2LJU A;  3KZY A;  1XMO E;  2JVA A;  2YWQ A;  1X6E A;  3HTX A;  3IWD A;  2N8X A;  4DR1 E;  2EM0 A;  4F6M A;  1STU A;  2R1F A;  5LLQ A;  3IWC A;  1A1K A;  4JYA E;  2LJH A;  4DV0 E;  1EH7 A;  1A1H A;  2YTO A;  1AH5 A;  5TSE A;  2ZM6 E;  1T4N A;  4R2S A;  1XNR E;  4LF9 E;  1DGC A;  4M30 A;  4WXC A;  2UU9 E;  1ZAA C;  2YPN A;  1J5E E;  3KZZ A;  1YSA C;  1NEI A;  1X5W A;  3RMP A;  2ENC A;  3ADG A;  1QU6 A;  2V89 A;  2HC5 A;  4DR4 E;  3JAM C;  1IBL E;  2EQ3 A;  2VQF E;  1N33 E;  4LFC E;  5F3W A;  3AUZ A;  2EPO A;  5LMN E;  2MC6 A;  4NXN E;  3C6M A;  4JI8 E;  4WXD A;  4X65 E;  4OX9 E;  2EM6 A;  4P78 A;  4X66 E;  1A1G A;  2UUB E;  2LE2 A;  2YU8 A;  3TQM A;  4IS1 C;  2YTD A;  2YTE A;  2RTX A;  4JI0 E;  2M1S A;  1G2F C;  4ZYG A;  4Q28 A;  2UXD E;  1GZ6 A;  2EPA A;  2EN8 A;  4X9J A;  3VHT B;  4NZV A;  3C4B A;  2WCC 3;  4LF6 E;  1PDA A;  4AQY E;  3J7Y p;  5AE2 A;  1RQ0 A;  2EZ6 A;  2RSM A;  2LRS A;  4DR2 E;  2RPC A;  1X48 A;  1A1F A;  3VYX A;  2EPX A;  2EE8 A;  2EMX A;  2EPN A;  4DV4 E;  2YSO A;  2V86 A;  5AE1 A;  1YUJ A;  5A6K A;  1GTK A;  2L3C A;  3UK3 C;  2N3G A;  2JP9 A;  1N34 E;  1IBM E;  4DR6 E;  5FLX C;  2J7J A;  4M2Z A;  2EOY A;  2EM9 A;  1Z1B A;  2EOF A;  1PJQ A;  4R2Q A;  3ADL A;  2ENH A;  1HNX E; 
#chains in the Genus database with same CATH homology
 1A1I A;  2EM5 A;  2EJ4 A;  2PRT A;  4R2D A;  1BB8 A;  1P47 A;  2EL4 A;  1G2D C;  1F2I G;  2EQ1 A;  1X6E A;  2EMZ A;  2EM2 A;  2EOJ A;  1JK1 A;  2EN1 A;  2EM0 A;  4F6M A;  2EL6 A;  2YRK A;  3M99 B;  4R2P A;  1ZU1 A;  2LO3 A;  2R1F A;  2M9A A;  4F6N A;  1LLM C;  2MDG A;  4R2R A;  2E72 A;  2EOM A;  2MKD A;  1A1K A;  2EOX A;  2VRD A;  1JK2 A;  2WBS A;  4F2J C;  1A1H A;  2YTO A;  3EPH A;  4R2S A;  2EP3 A;  5KL7 A;  1UN6 B;  2YRM A;  1DGC A;  1TF6 A;  2EMA A;  1A1J A;  2DLK A;  2EM3 A;  2I13 A;  2EOS A;  1ZAA C;  2EPP A;  1X6F A;  2ELY A;  2LT7 A;  2EM4 A;  1X5W A;  2EN2 A;  2EPU A;  1AAY A;  1YSA C;  2EN7 A;  1BBO A;  2ENC A;  2LVH A;  2EPR A;  2YTF A;  5KL2 A;  5KL6 A;  1TF3 A;  2YRH A;  3MHH C;  2EM7 A;  2EQ3 A;  2EOI A;  2CT1 A;  4R2A A;  2YTJ A;  1A1L A;  2NAB A;  2CTD A;  3EPJ A;  2EL5 A;  2EOZ A;  2JPA A;  2EOH A;  3EPK A;  2EMK A;  2ENA A;  2EM6 A;  2LCE A;  2YU5 A;  2YTN A;  2CSH A;  1A1G A;  2EMY A;  2EPZ A;  2YU8 A;  1RMD A;  2YSP A;  2EMC A;  4IS1 C;  2YTD A;  2EPC A;  2DMI A;  4WSG A;  2YTE A;  3EPL A;  2EN3 A;  1G2F C;  2EML A;  5KL5 A;  5KL3 A;  4M9V C;  2EPA A;  2EMF A;  2EN8 A;  4X9J A;  1ZR9 A;  3VHT B;  2BB8 A;  2WBU A;  2GHF A;  2EMH A;  4R2C A;  2WCC 3;  2ELZ A;  2EM8 A;  1X6H A;  2D9H A;  2EMG A;  5KL4 A;  1KJK A;  2GLI A;  2DRP A;  2EMW A;  2DLQ A;  4R2E A;  2EOQ A;  2EMB A;  1TN9 A;  2EOO A;  2WBT A;  2HGH A;  2RPC A;  2EN4 A;  2YTG A;  1A1F A;  2EPX A;  2A25 A;  2EE8 A;  2EMX A;  2LV2 A;  1MEY C;  2YSO A;  2RSI A;  2MKN A;  2EMI A;  1YUJ A;  1UBD C;  3UK3 C;  1X3C A;  2YTP A;  2JP9 A;  2J7J A;  3MHS C;  1B69 A;  2EOY A;  1WJP A;  2EM9 A;  1Z1B A;  1NCS A;  2EQ0 A;  2EOE A;  2ADR A;  2EOF A;  2EOR A;  2EN6 A;  4R2Q A;  4GZN C;  1YUI A;  2ENH A;  4FK5 C;  2YTI A;  4IJD A;  2DGC A;  2YTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...