1X6FA

Solution structures of the c2h2 type zinc finger domain of human zinc finger protein 462
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
88
structure length
88
Chain Sequence
GSSGSSGLKRDFIILGNGPRLQNSTYQCKHCDSKLQSTAELTSHLNIHNEEFQKRAKRQERRKQLLSKQKYADGAFADFKQESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Zinc finger protein 462
publication title Solution structures of the C2H2 type zinc finger domain of human Zinc finger protein 462
rcsb
source organism Homo sapiens
total genus 12
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1x6fA00
4F2JC 1A1FA 2EM2A 2YU5A 1YUIA 2YTPA 1KJKA 2EM7A 1Z1BA 3MHSC 3VHTB 4F6MA 5KL7A 2EOYA 5KL3A 4R2QA 2DLQA 1G2FC 2DLKA 2EMAA 2EPXA 1A1LA 4IJDA 2EORA 4GZNC 1X6FA 2ADRA 2EQ1A 4R2DA 2EQ3A 1AAYA 1TF6A 2YTGA 2WBUA 2EMXA 2EOZA 4R2PA 2YTQA 2CSHA 4WSGA 2EPUA 2EMHA 1UN6B 2CTDA 2DRPA 1ZR9A 2DMIA 2VRDA 2YTFA 2EJ4A 2EPCA 2YSOA 2EQ0A 1A1GA 2LVHA 1ZU1A 2EL6A 2EPZA 2A25A 2EMZA 2RSIA 1A1KA 1X6HA 2YU8A 1X6EA 2NABA 2YTOA 3MHHC 2EMIA 4F6NA 4R2AA 1P47A 2EMBA 2EN1A 2J7JA 2RPCA 2EOOA 2HGHA 4IS1C 2YTJA 2YRKA 1JK1A 4R2RA 1TF3A 2ELZA 1A1HA 1NCSA 2EMYA 2LT7A 2MKDA 3M99B 1BBOA 3EPKA 1X5WA 2EMFA 2YRMA 2EM9A 2EN8A 2EN2A 2EOEA 4R2SA 1BB8A 4M9VC 2EOQA 2LO3A 2DGCA 2EM5A 3EPLA 2D9HA 2EM4A 4R2EA 1DGCA 2EMLA 2JPAA 3UK3C 4R2CA 2EPRA 2JP9A 2CT1A 2EN4A 2MDGA 2EOXA 2EE8A 1A1IA 2EOFA 1WJPA 2ENHA 1RMDA 2ENCA 2EOJA 3EPJA 3EPHA 2EOIA 2WBSA 2WBTA 4X9JA 1JK2A 2MKNA 5KL6A 2YTNA 1YSAC 2E72A 2EM3A 2EN7A 2ENAA 2EM8A 1X3CA 2EP3A 2EM6A 1B69A 2EN3A 2I13A 2EN6A 2EOMA 1G2DC 1F2IG 2LV2A 1A1JA 1ZAAC 2EM0A 5KL4A 2R1FA 2LCEA 2EPAA 2EMKA 2EOHA 2YSPA 1TN9A 2YTIA 2BB8A 2PRTA 4FK5C 2EMCA 2EL5A 2ELYA 2EPPA 2GLIA 5KL2A 2GHFA 1LLMC 1YUJA 2EMGA 2EMWA 1UBDC 5KL5A 2YTDA 1MEYC 2M9AA 2WCC3 2EOSA 2EL4A 2YRHA 2YTEA
chains in the Genus database with same CATH superfamily
4LF8E 2V85A 4DR1E 4JV5E 2YTPA 2K4VA 3KZZA 1X48A 5AC4A 4LFBE 1KJKA 4O43A 1X47A 3MHSC 4F6MA 2DMYA 4BC7A 2DLQA 3LLHA 1X6FA 1NEIA 5BR8E 2DSYA 1TF6A 4LF9E 2EMXA 2EOZA 3BBGA 3HTXA 2YWQA 1ZR9A 5AE3A 2YTFA 4WXCA 2UXBE 2B7VA 3F6HA 1A1GA 4F9BB 2KONA 1ZU1A 2B3TB 1T4LB 1X6HA 4BBYA 4GEQB 1X6EA 4JI7E 1O0WA 2YTOA 2N3HA 3MHHC 3AUZA 2M7QA 4R2AA 1QU6A 1T38A 3JTZA 2FTXB 4R2RA 1TF3A 1NCSA 2LT7A 2MKDA 1FKAE 2N8XA 1EH8A 1X5WA 2EMFA 4RHBB 4WFTA 2EOEA 2RTXA 4R2SA 4TUIA 1BBGA 1YFHA 2DGCA 2EM5A 2EM4A 2JXPA 4NZVA 1IMUA 1DQ3A 1WXRA 4AQYE 5T6JA 1HNXE 4Q35B 4DR5E 3BIDA 3HQ1A 2JP9A 5A2QC 2E1MA 2UUCE 4TUGA 1A1IA 1PJTA 2IHR1 5A69A 1WJPA 4K0KE 2JOBA 5A6BD 3OMLA 1GQEA 2HHHE 3EPJA 3JAMC 3JU0A 1YSAC 2EN7A 3P1XA 4DV1E 2EM6A 4F54A 1B69A 5CFFE 1F2IG 2LV2A 1A1JA 1ZAAC 2EM0A 4LFCE 1YYKA 3AV0A 4LF4E 5KL4A 2EPAA 2EMKA 4GKJE 4X64E 2YTIA 5ADZA 4O5GA 5AE1A 4HEIA 2EMCA 2EL5A 1N32E 3HPSA 2ELYA 2GLIA 4DV6E 2GHFA 1LLMC 4B3ME 1YUJA 1YZ9A 5KL5A 3T1YE 4GKKE 4WSPA 5LL6R 2EOSA 4M2ZA 3ADIA 2EPLX 3J7AG 4JI5E 2EM2A 2YU5A 4JI4E 1ZBQA 4O4KA 2I9IA 4JYAE 4BC9A 2G7HA 2EPXA 5F3WA 4IJDA 4GZNC 3LMLA 1L4SA 2EQ1A 2DB2A 2EQ3A 1AAYA 1KYQA 1WHQA 3KZYA 1UHZA 3C4TA 1YYWA 5LLQA 4BCAA 4ZYGA 4O24A 1T4NA 2EQ0A 2HC5A 2ZM6E 3FIGA 2M1SA 4ZYHA 4DR4E 2EPZA 2L33A 2RS7A 4DR3E 2RSIA 1A1KA 2YU8A 4DUZE 3ZOQB 2JWOA 2EMIA 4ZYDA 4OX9E 2EMBA 2EN1A 2J7JA 2M4IA 4IS1C 1JK1A 1STUA 2EMYA 1BBOA 2DIXA 1HNWE 4L8NA 2YRMA 4P78A 2LUQA 2EN2A 4X8WA 4LF6E 4ZYEA 4M9VC 2BBGA 3J80C 4LTYA 2D9HA 4DR6E 3ADGA 4R2EA 1DGCA 3UK3C 4R2CA 2EPRA 2MDGA 4Q28A 2EWLA 1RMDA 2ENCA 2EOJA 4LF5E 2EOIA 2WBTA 2H36X 4X9JA 2MKNA 1EH6A 1WHNA 2V8QB 5LMUE 3J7Yp 2LTRA 1PDAA 2RS6A 4J8ZA 4F9CB 2EOMA 1YPNA 2YT4A 3DF6A 4JI3E 1IQOA 2KOUA 2R1FA 2EOHA 2MDRA 1MGTA 1RQ0A 5KL2A 2EMGA 1HNZE 2LJUA 2B7TA 4OOGC 4P7DA 2LJHA 1Z1BA 1A1FA 1YUIA 2VQEE 5A6JA 1SFEA 3VHTB 2L3JA 5AC5A 2NUEA 4HTGA 1GZ6A 5KL3A 4R2QA 4JI2E 1G2FC 2EMAA 1PKPA 4B3TE 1J26A 3BF2A 2EORA 1ZBTA 3HPZA 1XMOE 4DV0E 1PJSA 5IWAE 4DR7E 2ADRA 4R2DA 4YHHE 4RH8A 2YTGA 1QNTA 2WBUA 1IBKE 2YTQA 2CSHA 1IQSA 4WSGA 2EPUA 4WX9A 2EMHA 1UN6B 2UXDE 3T1HE 2B9DA 4LFAE 4BHBA 2EJ4A 2EPCA 3DJWA 2YSOA 2JYAA 3EQ1A 2LVHA 2FGGA 4KWYA 2NUGA 2UUBE 2L3CA 1XNRE 3BGHA 1GTKA 4R03A 2HGHA 2ELZA 5IV8B 2VQFE 3THNA 3IWCA 3K6QA 2EOQA 4DR2E 2LO3A 3VYYA 2LE2A 3ECRA 2UU9E 2UUAE 2L92A 2JPAA 2EN4A 3ADLA 2EOXA 2YZTA 4KZSA 2V88A 3QG5C 2WZOA 1T39A 2ENHA 4LU9A 2NUFA 2CPNA 2JOXA 3KWRA 1XMQE 2WBSA 1EKZA 3H09A 1JK2A 4DKKA 4BS9A 4X65E 4JI6E 2YTNA 2V83A 5A6KA 2ENAA 1X3CA 4R8OA 2EP3A 1RC7A 4L5NC 1T4OA 4NHRA 2EZ6A 2EN6A 2UXCE 3HXLA 2GPIA 4MLVA 4DV4E 2LCEA 1N36E 2YSPA 2JR1A 2R76A 3VYXA 1TN9A 4MLQA 1YYOA 2BB8A 4BMJA 2K7IA 2PRTA 5IT9C 5AE2A 2EPPA 3C6MA 2L2MA 4DUYE 1UBDC 2M9AA 1J5EE 1IBLE 4BHCA 2ODRC 4NXNE 4WPYA 2LRSA 3THOB 4F2JC 4DV2E 2EM7A 2LMZA 3L00A 2L2KB 5KL7A 2VF1A 2EOYA 2EPMX 2FV4B 2DLKA 2L2NA 1DI2A 1A1LA 1N33E 3IWDA 2EPNA 1WRJA 4R2PA 4B3RE 1X49A 2NA2A 2VE7C 2MC6A 2CTDA 2MC5A 2DRPA 2DMIA 4X66E 2VRDA 3F6GA 1EH7A 2E5LE 2V89A 2F4VE 2EL6A 2A25A 2EMZA 4JI8E 4JI1E 4DV5E 2NABA 1HR0E 3RMPA 3TQMA 4WXDA 5A6AA 4F6NA 1P47A 2RPCA 2EOOA 2JVAA 2YRKA 2YTJA 3C6KA 2YPNA 3VK6A 1A1HA 4JI0E 3IWBA 3M99B 4I8OA 3EPKA 4X62E 4F9AB 2KHXA 5FLXC 2EM9A 2EN8A 2RQLA 1BB8A 1I94E 3EPLA 4M0VA 4KHPE 1N34E 2EMLA 2LTSA 2CT1A 4NXME 4B3SE 2LUPB 2EE8A 2EOFA 1XNQE 5AASA 4WYQB 3J81C 2LBSB 2HJJA 3EPHA 5DNYA 4M30A 4LF7E 2JY9A 5KL6A 3OTOE 4DV7E 2E72A 4N4RB 1FJGE 2EM3A 1UILA 3ADJA 2EM8A 2V86A 2EN3A 2I13A 1SR9A 1AH5A 2V87A 2RSMA 1G2DC 2L6MA 3C4BA 2L8TA 5LMNE 5TSEA 1N3GA 4DV3E 4FK5C 4DMIA 4YY3E 2F8BA 3MSWA 2EMWA 2EPOA 2N3GA 5A6BA 2ODRD 5IXMB 1PJQA 2EPKX 2YTDA 2WCC3 1MEYC 2Q8UA 1IBME 2YRHA 2EL4A 2YTEA
chains in the Genus database with same CATH topology
4F2JC 1A1FA 2EM2A 2YU5A 1YUIA 2YTPA 1KJKA 2EM7A 1Z1BA 3MHSC 3VHTB 4F6MA 5KL7A 2EOYA 5KL3A 4R2QA 2DLQA 1G2FC 2DLKA 2EMAA 2EPXA 1A1LA 4IJDA 2EORA 4GZNC 1X6FA 2ADRA 2EQ1A 4R2DA 2EQ3A 1AAYA 1TF6A 2YTGA 2WBUA 2EMXA 2EOZA 4R2PA 2YTQA 2CSHA 4WSGA 2EPUA 2EMHA 1UN6B 2CTDA 2DRPA 1ZR9A 2DMIA 2VRDA 2YTFA 2EJ4A 2EPCA 2YSOA 2EQ0A 1A1GA 2LVHA 1ZU1A 2EL6A 2EPZA 2A25A 2EMZA 2RSIA 1A1KA 1X6HA 2YU8A 1X6EA 2NABA 2YTOA 3MHHC 2EMIA 4F6NA 4R2AA 1P47A 2EMBA 2EN1A 2J7JA 2RPCA 2EOOA 2HGHA 4IS1C 2YTJA 2YRKA 1JK1A 4R2RA 1TF3A 2ELZA 1A1HA 1NCSA 2EMYA 2LT7A 2MKDA 3M99B 1BBOA 3EPKA 1X5WA 2EMFA 2YRMA 2EM9A 2EN8A 2EN2A 2EOEA 4R2SA 1BB8A 4M9VC 2EOQA 2LO3A 2DGCA 2EM5A 3EPLA 2D9HA 2EM4A 4R2EA 1DGCA 2EMLA 2JPAA 3UK3C 4R2CA 2EPRA 2JP9A 2CT1A 2EN4A 2MDGA 2EOXA 2EE8A 1A1IA 2EOFA 1WJPA 2ENHA 1RMDA 2ENCA 2EOJA 3EPJA 3EPHA 2EOIA 2WBSA 2WBTA 4X9JA 1JK2A 2MKNA 5KL6A 2YTNA 1YSAC 2E72A 2EM3A 2EN7A 2ENAA 2EM8A 1X3CA 2EP3A 2EM6A 1B69A 2EN3A 2I13A 2EN6A 2EOMA 1G2DC 1F2IG 2LV2A 1A1JA 1ZAAC 2EM0A 5KL4A 2R1FA 2LCEA 2EPAA 2EMKA 2EOHA 2YSPA 1TN9A 2YTIA 2BB8A 2PRTA 4FK5C 2EMCA 2EL5A 2ELYA 2EPPA 2GLIA 5KL2A 2GHFA 1LLMC 1YUJA 2EMGA 2EMWA 1UBDC 5KL5A 2YTDA 1MEYC 2M9AA 2WCC3 2EOSA 2EL4A 2YRHA 2YTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F2J C;  1A1F A;  2EM2 A;  2YU5 A;  1YUI A;  2YTP A;  1KJK A;  2EM7 A;  1Z1B A;  3MHS C;  3VHT B;  4F6M A;  5KL7 A;  2EOY A;  5KL3 A;  4R2Q A;  2DLQ A;  1G2F C;  2DLK A;  2EMA A;  2EPX A;  1A1L A;  4IJD A;  2EOR A;  4GZN C;  1X6F A;  2ADR A;  2EQ1 A;  4R2D A;  2EQ3 A;  1AAY A;  1TF6 A;  2YTG A;  2WBU A;  2EMX A;  2EOZ A;  4R2P A;  2YTQ A;  2CSH A;  4WSG A;  2EPU A;  2EMH A;  1UN6 B;  2CTD A;  2DRP A;  1ZR9 A;  2DMI A;  2VRD A;  2YTF A;  2EJ4 A;  2EPC A;  2YSO A;  2EQ0 A;  1A1G A;  2LVH A;  1ZU1 A;  2EL6 A;  2EPZ A;  2A25 A;  2EMZ A;  2RSI A;  1A1K A;  1X6H A;  2YU8 A;  1X6E A;  2NAB A;  2YTO A;  3MHH C;  2EMI A;  4F6N A;  4R2A A;  1P47 A;  2EMB A;  2EN1 A;  2J7J A;  2RPC A;  2EOO A;  2HGH A;  4IS1 C;  2YTJ A;  2YRK A;  1JK1 A;  4R2R A;  1TF3 A;  2ELZ A;  1A1H A;  1NCS A;  2EMY A;  2LT7 A;  2MKD A;  3M99 B;  1BBO A;  3EPK A;  1X5W A;  2EMF A;  2YRM A;  2EM9 A;  2EN8 A;  2EN2 A;  2EOE A;  4R2S A;  1BB8 A;  4M9V C;  2EOQ A;  2LO3 A;  2DGC A;  2EM5 A;  3EPL A;  2D9H A;  2EM4 A;  4R2E A;  1DGC A;  2EML A;  2JPA A;  3UK3 C;  4R2C A;  2EPR A;  2JP9 A;  2CT1 A;  2EN4 A;  2MDG A;  2EOX A;  2EE8 A;  1A1I A;  2EOF A;  1WJP A;  2ENH A;  1RMD A;  2ENC A;  2EOJ A;  3EPJ A;  3EPH A;  2EOI A;  2WBS A;  2WBT A;  4X9J A;  1JK2 A;  2MKN A;  5KL6 A;  2YTN A;  1YSA C;  2E72 A;  2EM3 A;  2EN7 A;  2ENA A;  2EM8 A;  1X3C A;  2EP3 A;  2EM6 A;  1B69 A;  2EN3 A;  2I13 A;  2EN6 A;  2EOM A;  1G2D C;  1F2I G;  2LV2 A;  1A1J A;  1ZAA C;  2EM0 A;  5KL4 A;  2R1F A;  2LCE A;  2EPA A;  2EMK A;  2EOH A;  2YSP A;  1TN9 A;  2YTI A;  2BB8 A;  2PRT A;  4FK5 C;  2EMC A;  2EL5 A;  2ELY A;  2EPP A;  2GLI A;  5KL2 A;  2GHF A;  1LLM C;  1YUJ A;  2EMG A;  2EMW A;  1UBD C;  5KL5 A;  2YTD A;  1MEY C;  2M9A A;  2WCC 3;  2EOS A;  2EL4 A;  2YRH A;  2YTE A; 
#chains in the Genus database with same CATH topology
 4LF8 E;  2V85 A;  4DR1 E;  4JV5 E;  2YTP A;  2K4V A;  3KZZ A;  1X48 A;  5AC4 A;  4LFB E;  1KJK A;  4O43 A;  1X47 A;  3MHS C;  4F6M A;  2DMY A;  4BC7 A;  2DLQ A;  3LLH A;  1X6F A;  1NEI A;  5BR8 E;  2DSY A;  1TF6 A;  4LF9 E;  2EMX A;  2EOZ A;  3BBG A;  3HTX A;  2YWQ A;  1ZR9 A;  5AE3 A;  2YTF A;  4WXC A;  2UXB E;  2B7V A;  3F6H A;  1A1G A;  4F9B B;  2KON A;  1ZU1 A;  2B3T B;  1T4L B;  1X6H A;  4BBY A;  4GEQ B;  1X6E A;  4JI7 E;  1O0W A;  2YTO A;  2N3H A;  3MHH C;  3AUZ A;  2M7Q A;  4R2A A;  1QU6 A;  1T38 A;  3JTZ A;  2FTX B;  4R2R A;  1TF3 A;  1NCS A;  2LT7 A;  2MKD A;  1FKA E;  2N8X A;  1EH8 A;  1X5W A;  2EMF A;  4RHB B;  4WFT A;  2EOE A;  2RTX A;  4R2S A;  4TUI A;  1BBG A;  1YFH A;  2DGC A;  2EM5 A;  2EM4 A;  2JXP A;  4NZV A;  1IMU A;  1DQ3 A;  1WXR A;  4AQY E;  5T6J A;  1HNX E;  4Q35 B;  4DR5 E;  3BID A;  3HQ1 A;  2JP9 A;  5A2Q C;  2E1M A;  2UUC E;  4TUG A;  1A1I A;  1PJT A;  2IHR 1;  5A69 A;  1WJP A;  4K0K E;  2JOB A;  5A6B D;  3OML A;  1GQE A;  2HHH E;  3EPJ A;  3JAM C;  3JU0 A;  1YSA C;  2EN7 A;  3P1X A;  4DV1 E;  2EM6 A;  4F54 A;  1B69 A;  5CFF E;  1F2I G;  2LV2 A;  1A1J A;  1ZAA C;  2EM0 A;  4LFC E;  1YYK A;  3AV0 A;  4LF4 E;  5KL4 A;  2EPA A;  2EMK A;  4GKJ E;  4X64 E;  2YTI A;  5ADZ A;  4O5G A;  5AE1 A;  4HEI A;  2EMC A;  2EL5 A;  1N32 E;  3HPS A;  2ELY A;  2GLI A;  4DV6 E;  2GHF A;  1LLM C;  4B3M E;  1YUJ A;  1YZ9 A;  5KL5 A;  3T1Y E;  4GKK E;  4WSP A;  5LL6 R;  2EOS A;  4M2Z A;  3ADI A;  2EPL X;  3J7A G;  4JI5 E;  2EM2 A;  2YU5 A;  4JI4 E;  1ZBQ A;  4O4K A;  2I9I A;  4JYA E;  4BC9 A;  2G7H A;  2EPX A;  5F3W A;  4IJD A;  4GZN C;  3LML A;  1L4S A;  2EQ1 A;  2DB2 A;  2EQ3 A;  1AAY A;  1KYQ A;  1WHQ A;  3KZY A;  1UHZ A;  3C4T A;  1YYW A;  5LLQ A;  4BCA A;  4ZYG A;  4O24 A;  1T4N A;  2EQ0 A;  2HC5 A;  2ZM6 E;  3FIG A;  2M1S A;  4ZYH A;  4DR4 E;  2EPZ A;  2L33 A;  2RS7 A;  4DR3 E;  2RSI A;  1A1K A;  2YU8 A;  4DUZ E;  3ZOQ B;  2JWO A;  2EMI A;  4ZYD A;  4OX9 E;  2EMB A;  2EN1 A;  2J7J A;  2M4I A;  4IS1 C;  1JK1 A;  1STU A;  2EMY A;  1BBO A;  2DIX A;  1HNW E;  4L8N A;  2YRM A;  4P78 A;  2LUQ A;  2EN2 A;  4X8W A;  4LF6 E;  4ZYE A;  4M9V C;  2BBG A;  3J80 C;  4LTY A;  2D9H A;  4DR6 E;  3ADG A;  4R2E A;  1DGC A;  3UK3 C;  4R2C A;  2EPR A;  2MDG A;  4Q28 A;  2EWL A;  1RMD A;  2ENC A;  2EOJ A;  4LF5 E;  2EOI A;  2WBT A;  2H36 X;  4X9J A;  2MKN A;  1EH6 A;  1WHN A;  2V8Q B;  5LMU E;  3J7Y p;  2LTR A;  1PDA A;  2RS6 A;  4J8Z A;  4F9C B;  2EOM A;  1YPN A;  2YT4 A;  3DF6 A;  4JI3 E;  1IQO A;  2KOU A;  2R1F A;  2EOH A;  2MDR A;  1MGT A;  1RQ0 A;  5KL2 A;  2EMG A;  1HNZ E;  2LJU A;  2B7T A;  4OOG C;  4P7D A;  2LJH A;  1Z1B A;  1A1F A;  1YUI A;  2VQE E;  5A6J A;  1SFE A;  3VHT B;  2L3J A;  5AC5 A;  2NUE A;  4HTG A;  1GZ6 A;  5KL3 A;  4R2Q A;  4JI2 E;  1G2F C;  2EMA A;  1PKP A;  4B3T E;  1J26 A;  3BF2 A;  2EOR A;  1ZBT A;  3HPZ A;  1XMO E;  4DV0 E;  1PJS A;  5IWA E;  4DR7 E;  2ADR A;  4R2D A;  4YHH E;  4RH8 A;  2YTG A;  1QNT A;  2WBU A;  1IBK E;  2YTQ A;  2CSH A;  1IQS A;  4WSG A;  2EPU A;  4WX9 A;  2EMH A;  1UN6 B;  2UXD E;  3T1H E;  2B9D A;  4LFA E;  4BHB A;  2EJ4 A;  2EPC A;  3DJW A;  2YSO A;  2JYA A;  3EQ1 A;  2LVH A;  2FGG A;  4KWY A;  2NUG A;  2UUB E;  2L3C A;  1XNR E;  3BGH A;  1GTK A;  4R03 A;  2HGH A;  2ELZ A;  5IV8 B;  2VQF E;  3THN A;  3IWC A;  3K6Q A;  2EOQ A;  4DR2 E;  2LO3 A;  3VYY A;  2LE2 A;  3ECR A;  2UU9 E;  2UUA E;  2L92 A;  2JPA A;  2EN4 A;  3ADL A;  2EOX A;  2YZT A;  4KZS A;  2V88 A;  3QG5 C;  2WZO A;  1T39 A;  2ENH A;  4LU9 A;  2NUF A;  2CPN A;  2JOX A;  3KWR A;  1XMQ E;  2WBS A;  1EKZ A;  3H09 A;  1JK2 A;  4DKK A;  4BS9 A;  4X65 E;  4JI6 E;  2YTN A;  2V83 A;  5A6K A;  2ENA A;  1X3C A;  4R8O A;  2EP3 A;  1RC7 A;  4L5N C;  1T4O A;  4NHR A;  2EZ6 A;  2EN6 A;  2UXC E;  3HXL A;  2GPI A;  4MLV A;  4DV4 E;  2LCE A;  1N36 E;  2YSP A;  2JR1 A;  2R76 A;  3VYX A;  1TN9 A;  4MLQ A;  1YYO A;  2BB8 A;  4BMJ A;  2K7I A;  2PRT A;  5IT9 C;  5AE2 A;  2EPP A;  3C6M A;  2L2M A;  4DUY E;  1UBD C;  2M9A A;  1J5E E;  1IBL E;  4BHC A;  2ODR C;  4NXN E;  4WPY A;  2LRS A;  3THO B;  4F2J C;  4DV2 E;  2EM7 A;  2LMZ A;  3L00 A;  2L2K B;  5KL7 A;  2VF1 A;  2EOY A;  2EPM X;  2FV4 B;  2DLK A;  2L2N A;  1DI2 A;  1A1L A;  1N33 E;  3IWD A;  2EPN A;  1WRJ A;  4R2P A;  4B3R E;  1X49 A;  2NA2 A;  2VE7 C;  2MC6 A;  2CTD A;  2MC5 A;  2DRP A;  2DMI A;  4X66 E;  2VRD A;  3F6G A;  1EH7 A;  2E5L E;  2V89 A;  2F4V E;  2EL6 A;  2A25 A;  2EMZ A;  4JI8 E;  4JI1 E;  4DV5 E;  2NAB A;  1HR0 E;  3RMP A;  3TQM A;  4WXD A;  5A6A A;  4F6N A;  1P47 A;  2RPC A;  2EOO A;  2JVA A;  2YRK A;  2YTJ A;  3C6K A;  2YPN A;  3VK6 A;  1A1H A;  4JI0 E;  3IWB A;  3M99 B;  4I8O A;  3EPK A;  4X62 E;  4F9A B;  2KHX A;  5FLX C;  2EM9 A;  2EN8 A;  2RQL A;  1BB8 A;  1I94 E;  3EPL A;  4M0V A;  4KHP E;  1N34 E;  2EML A;  2LTS A;  2CT1 A;  4NXM E;  4B3S E;  2LUP B;  2EE8 A;  2EOF A;  1XNQ E;  5AAS A;  4WYQ B;  3J81 C;  2LBS B;  2HJJ A;  3EPH A;  5DNY A;  4M30 A;  4LF7 E;  2JY9 A;  5KL6 A;  3OTO E;  4DV7 E;  2E72 A;  4N4R B;  1FJG E;  2EM3 A;  1UIL A;  3ADJ A;  2EM8 A;  2V86 A;  2EN3 A;  2I13 A;  1SR9 A;  1AH5 A;  2V87 A;  2RSM A;  1G2D C;  2L6M A;  3C4B A;  2L8T A;  5LMN E;  5TSE A;  1N3G A;  4DV3 E;  4FK5 C;  4DMI A;  4YY3 E;  2F8B A;  3MSW A;  2EMW A;  2EPO A;  2N3G A;  5A6B A;  2ODR D;  5IXM B;  1PJQ A;  2EPK X;  2YTD A;  2WCC 3;  1MEY C;  2Q8U A;  1IBM E;  2YRH A;  2EL4 A;  2YTE A; 
#chains in the Genus database with same CATH homology
 4F2J C;  1A1F A;  2EM2 A;  2YU5 A;  1YUI A;  2YTP A;  1KJK A;  2EM7 A;  1Z1B A;  3MHS C;  3VHT B;  4F6M A;  5KL7 A;  2EOY A;  5KL3 A;  4R2Q A;  2DLQ A;  1G2F C;  2DLK A;  2EMA A;  2EPX A;  1A1L A;  4IJD A;  2EOR A;  4GZN C;  1X6F A;  2ADR A;  2EQ1 A;  4R2D A;  2EQ3 A;  1AAY A;  1TF6 A;  2YTG A;  2WBU A;  2EMX A;  2EOZ A;  4R2P A;  2YTQ A;  2CSH A;  4WSG A;  2EPU A;  2EMH A;  1UN6 B;  2CTD A;  2DRP A;  1ZR9 A;  2DMI A;  2VRD A;  2YTF A;  2EJ4 A;  2EPC A;  2YSO A;  2EQ0 A;  1A1G A;  2LVH A;  1ZU1 A;  2EL6 A;  2EPZ A;  2A25 A;  2EMZ A;  2RSI A;  1A1K A;  1X6H A;  2YU8 A;  1X6E A;  2NAB A;  2YTO A;  3MHH C;  2EMI A;  4F6N A;  4R2A A;  1P47 A;  2EMB A;  2EN1 A;  2J7J A;  2RPC A;  2EOO A;  2HGH A;  4IS1 C;  2YTJ A;  2YRK A;  1JK1 A;  4R2R A;  1TF3 A;  2ELZ A;  1A1H A;  1NCS A;  2EMY A;  2LT7 A;  2MKD A;  3M99 B;  1BBO A;  3EPK A;  1X5W A;  2EMF A;  2YRM A;  2EM9 A;  2EN8 A;  2EN2 A;  2EOE A;  4R2S A;  1BB8 A;  4M9V C;  2EOQ A;  2LO3 A;  2DGC A;  2EM5 A;  3EPL A;  2D9H A;  2EM4 A;  4R2E A;  1DGC A;  2EML A;  2JPA A;  3UK3 C;  4R2C A;  2EPR A;  2JP9 A;  2CT1 A;  2EN4 A;  2MDG A;  2EOX A;  2EE8 A;  1A1I A;  2EOF A;  1WJP A;  2ENH A;  1RMD A;  2ENC A;  2EOJ A;  3EPJ A;  3EPH A;  2EOI A;  2WBS A;  2WBT A;  4X9J A;  1JK2 A;  2MKN A;  5KL6 A;  2YTN A;  1YSA C;  2E72 A;  2EM3 A;  2EN7 A;  2ENA A;  2EM8 A;  1X3C A;  2EP3 A;  2EM6 A;  1B69 A;  2EN3 A;  2I13 A;  2EN6 A;  2EOM A;  1G2D C;  1F2I G;  2LV2 A;  1A1J A;  1ZAA C;  2EM0 A;  5KL4 A;  2R1F A;  2LCE A;  2EPA A;  2EMK A;  2EOH A;  2YSP A;  1TN9 A;  2YTI A;  2BB8 A;  2PRT A;  4FK5 C;  2EMC A;  2EL5 A;  2ELY A;  2EPP A;  2GLI A;  5KL2 A;  2GHF A;  1LLM C;  1YUJ A;  2EMG A;  2EMW A;  1UBD C;  5KL5 A;  2YTD A;  1MEY C;  2M9A A;  2WCC 3;  2EOS A;  2EL4 A;  2YRH A;  2YTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...