1X6FA

Solution structures of the c2h2 type zinc finger domain of human zinc finger protein 462
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
88
structure length
88
Chain Sequence
GSSGSSGLKRDFIILGNGPRLQNSTYQCKHCDSKLQSTAELTSHLNIHNEEFQKRAKRQERRKQLLSKQKYADGAFADFKQESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 462
publication title Solution structures of the C2H2 type zinc finger domain of human Zinc finger protein 462
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 12
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1x6fA00
2LT7A 1ZR9A 2EPAA 5KL5A 2EL4A 2EL5A 2EOJA 2YTFA 1DGCA 1A1FA 2EMFA 2EM6A 2A25A 2VRDA 1X6FA 2EN8A 1TN9A 4R2RA 1NCSA 2MDGA 2YSPA 1ZU1A 2WBTA 4R2CA 1A1JA 2DRPA 2EMXA 2YTOA 2EN7A 3VHTB 4R2DA 1A1KA 2JPAA 2D9HA 2EOYA 2EJ4A 3MHHC 1JK2A 2E72A 2EMKA 1BBOA 2EQ1A 4F6NA 1ZAAC 2DGCA 1B69A 2BB8A 2YTIA 2LO3A 1A1IA 2EN6A 2DLQA 2YTDA 4R2QA 1WJPA 2ENAA 2EM3A 2YTEA 2EPCA 1G2FC 1YUJA 2RSIA 2YSOA 1A1HA 1G2DC 2WCC3 2WBSA 5KL7A 2EMBA 2ELZA 2EM7A 2LVHA 2MKNA 2YRKA 2EMWA 2EORA 2EOSA 2EM5A 1X5WA 1Z1BA 1YSAC 2EMZA 2EPXA 1JK1A 2YU5A 2EOOA 2EP3A 2EPPA 2EMAA 2NABA 2EN4A 2LV2A 2JP9A 2HGHA 4R2PA 2YRMA 1X3CA 2YTGA 2EM8A 3M99B 2YTQA 2ENHA 2EOMA 1MEYC 2EOEA 4FK5C 3EPLA 4F2JC 1TF6A 2EOHA 2YTNA 2EQ0A 2LCEA 2EQ3A 2YU8A 2ENCA 2CSHA 5KL2A 1F2IG 2EM4A 2RPCA 5KL3A 2YRHA 2EN3A 2MKDA 2J7JA 2CTDA 2EMGA 2WBUA 3EPJA 2EE8A 2GLIA 3UK3C 1AAYA 2EMHA 2EMCA 4GZNC 2EOXA 1X6EA 2DMIA 3MHSC 5KL6A 1A1LA 2EN1A 1UBDC 2EPZA 2R1FA 1LLMC 2GHFA 1X6HA 2EM9A 2EN2A 2EM0A 4WSGA 4X9JA 2EM2A 4R2SA 2EL6A 2EPUA 4R2EA 3EPKA 2EOFA 1RMDA 2M9AA 1UN6B 2EMIA 5KL4A 2I13A 1KJKA 2EMYA 2EOQA 1YUIA 1P47A 2YTJA 4IJDA 4F6MA 2ADRA 1TF3A 3EPHA 2CT1A 4M9VC 2EPRA 4IS1C 1BB8A 2EOIA 4R2AA 1A1GA 2EMLA 2ELYA 2DLKA 2PRTA 2YTPA 2EOZA
chains in the Genus database with same CATH superfamily
4BHBA 2N3HA 1ZR9A 2EPAA 2LT7A 2EPMX 2EL5A 2HJJA 1WHQA 2EMFA 3JTZA 4DUZE 2EN8A 4M0VA 4DV4E 2MDGA 2B3TB 2WBTA 4BBYA 4JI4E 2DRPA 2H36X 5AE1A 1QU6A 2EZ6A 2JPAA 2EJ4A 2E1MA 3DJWA 2E72A 1YPNA 4RHBB 4F6NA 2FGGA 1WRJA 3IWDA 3IWBA 3EQ1A 4KWYA 1T4OA 3OTOE 2JY9A 2F4VE 1RC7A 2ODRC 4WPYA 1UILA 5AE2A 5BR8E 5A6BA 5FLXC 1YUJA 2RSIA 3J80C 2M1SA 2L2MA 4LF7E 3LLHA 5TSEA 2V89A 3VK6A 2EMBA 3HTXA 1I94E 4Q35B 2VQFE 1EH8A 1HNXE 4DUYE 5F3WA 4DR3E 4DR7E 1YSAC 2EPKX 5IT9C 4BCAA 1JK1A 4LF5E 2EP3A 2EMAA 2LV2A 2RSMA 1YYKA 4J8ZA 4F54A 2V83A 1YZ9A 1X3CA 3HPZA 2MDRA 3DF6A 2YTQA 2ENHA 2EOMA 4WYQB 2NUFA 4BC7A 4FK5C 2L3CA 2EOHA 2YTNA 2EQ0A 2LCEA 4DMIA 5AASA 2N3GA 1F2IG 2ODRD 4BS9A 5LL6R 1O0WA 3C6MA 1YYWA 2V8QB 3KZZA 2WBUA 2V87A 3UK3C 4X62E 2GPIA 1FJGE 2DMIA 1T38A 1A1LA 2EN1A 3J81C 2EPZA 4I8OA 2JWOA 2EPOA 1X6HA 2JOXA 2EM9A 2DMYA 4O5GA 4X64E 2B7VA 3T1YE 4B3TE 5KL4A 4L5NC 4DV2E 1KJKA 2EOQA 3C4BA 1YUIA 3K6QA 2YTJA 4F6MA 1QNTA 4IS1C 1N34E 1XMQE 4LF6E 1N3GA 2K7IA 2DLKA 1A1JA 2RTXA 2HHHE 2YTPA 2UU9E 2YWQA 2LTRA 2EOJA 2YTFA 4JI1E 1IMUA 5A6JA 2EM6A 2WZOA 3HPSA 4O4KA 1ZBTA 4P78A 4MLVA 1GQEA 2RS7A 4JI7E 3AUZA 2EMXA 2LUQA 2YTOA 4R2DA 3VHTB 1A1KA 2EOYA 3MHHC 2JYAA 5IXMB 2KOUA 3ADGA 3L00A 2LRSA 4GKKE 2MC6A 1ZAAC 4LFAE 2DGCA 3TQMA 1A1IA 2EN6A 2DLQA 1AH5A 1EH7A 4TUIA 1IBME 4DV1E 2LUPB 4NHRA 1A1HA 2LBSB 1G2DC 4YY3E 1SR9A 2ELZA 2YRKA 2EORA 2EM5A 1X5WA 4LTYA 1IQOA 2FV4B 3BIDA 2EPXA 2YU5A 2EPPA 2EN4A 2B7TA 3C6KA 2JP9A 4DV3E 4R2PA 2YRMA 3LMLA 3M99B 2EOEA 1HNZE 3J7AG 2DSYA 2LE2A 1TF6A 1IQSA 2YU8A 2CPNA 2CSHA 2VQEE 4JI2E 2YPNA 5A6KA 2UUAE 2RPCA 2UXCE 2MKDA 5CFFE 4DR4E 1L4SA 1N32E 2EMGA 4F9AB 4DV7E 5LMUE 3J7Yp 2GLIA 4Q28A 1X6EA 4LF4E 3BF2A 5KL6A 1SFEA 1UBDC 4WXCA 2R1FA 5A6BD 4DR2E 2EN2A 2EM0A 4BHCA 4AQYE 1GTKA 4ZYHA 2I9IA 2LJHA 4R2EA 3EPKA 1EKZA 5DNYA 1J26A 2UXBE 4WX9A 2EOIA 2HC5A 5KL5A 2EL4A 4DR6E 4YHHE 4M30A 2B9DA 1A1FA 2A25A 2VRDA 4R8OA 3KWRA 1NCSA 4DV0E 1MGTA 2YSPA 4B3SE 4R2CA 1KYQA 1GZ6A 4TUGA 2RS6A 4ZYGA 1BBOA 2JXPA 2DIXA 3HXLA 4O24A 4JI5E 3VYYA 1X47A 2LMZA 1B69A 2BB8A 2LO3A 1J5EE 1ZBQA 2YTDA 1WHNA 5ADZA 5A69A 2ENAA 2EM3A 4GEQB 3OMLA 2EWLA 4DR5E 2WCC3 2WBSA 4OOGC 2N8XA 1PJQA 4WXDA 3F6HA 2EOSA 1EH6A 1Z1BA 1HR0E 2EOOA 2VF1A 4M2ZA 2UXDE 2Q8UA 2HGHA 3C4TA 1PJSA 2L2KB 1FKAE 4F2JC 4LU9A 2L6MA 4BMJA 2EM4A 4B3RE 5KL3A 4ZYEA 4HTGA 2YRHA 2EN3A 4KZSA 2J7JA 3JAMC 2CTDA 4LFBE 4WFTA 2FTXB 3H09A 1AAYA 2EMHA 4GZNC 2EOXA 2IHR1 5AC5A 2K4VA 3MHSC 1STUA 3QG5C 3BGHA 1LLMC 1UHZA 2L8TA 4X8WA 2L92A 1T4NA 3JU0A 4WSGA 2EPLX 4X9JA 3T1HE 4MLQA 2EL6A 2EPUA 1PDAA 2RQLA 2EMIA 2I13A 1N33E 2EMYA 5A2QC 2LTSA 4N4RB 2NUEA 4LF9E 4M9VC 4DV5E 1A1GA 2EMLA 5LLQA 2EOZA 2YT4A 5AC4A 4WSPA 1DGCA 5AE3A 1IBKE 2V86A 1DQ3A 1X6FA 2MC5A 1TN9A 4R2RA 3FIGA 2ZM6E 1ZU1A 3BBGA 5T6JA 3ZOQB 4LF8E 2EN7A 2D9HA 1X49A 4F9BB 1JK2A 3IWCA 4BC9A 2EMKA 2JR1A 2EQ1A 2VE7C 4LFCE 3ADJA 2YTIA 4RH8A 2KHXA 2V85A 4B3ME 1IBLE 2M4IA 4R2QA 1WJPA 1BBGA 4KHPE 2YTEA 3RMPA 2EPCA 1PJTA 1G2FC 2YSOA 3MSWA 3VYXA 3ECRA 5KL7A 1HNWE 4X65E 2DB2A 1T4LB 2EM7A 2LVHA 2MKNA 3HQ1A 1YYOA 2EMWA 1DI2A 4JI6E 2UUCE 2L2NA 5IV8B 2EMZA 3THNA 2JVAA 3ADLA 3P1XA 2NABA 2YTGA 2EM8A 1XMOE 1XNRE 1MEYC 3F6GA 3EPLA 2F8BA 4OX9E 4F9CB 4JV5E 1PKPA 2EQ3A 2ENCA 4GKJE 4NXME 5KL2A 4DV6E 4JYAE 1NEIA 1YFHA 4NXNE 2NUGA 2L33A 4HEIA 4O43A 4JI3E 2JOBA 3EPJA 2EE8A 4X66E 2EMCA 1T39A 5LMNE 5A6AA 3AV0A 1X48A 2LJUA 2YZTA 2E5LE 3KZYA 2GHFA 2R76A 1RQ0A 2KONA 4P7DA 4DKKA 4L8NA 1N36E 2V88A 2EM2A 4DR1E 4R2SA 2EPNA 2G7HA 2EOFA 1RMDA 2M9AA 1UN6B 4JI0E 4NZVA 1P47A 1WXRA 4IJDA 2ADRA 2L3JA 3THOB 1TF3A 3EPHA 2CT1A 2EPRA 4R03A 5IWAE 1BB8A 1XNQE 2NA2A 4R2AA 2M7QA 2BBGA 2UUBE 2ELYA 4ZYDA 4K0KE 2PRTA 3ADIA 4JI8E
chains in the Genus database with same CATH topology
2LT7A 1ZR9A 2EPAA 5KL5A 2EL4A 2EL5A 2EOJA 2YTFA 1DGCA 1A1FA 2EMFA 2EM6A 2A25A 2VRDA 1X6FA 2EN8A 1TN9A 4R2RA 1NCSA 2MDGA 2YSPA 1ZU1A 2WBTA 4R2CA 1A1JA 2DRPA 2EMXA 2YTOA 2EN7A 3VHTB 4R2DA 1A1KA 2JPAA 2D9HA 2EOYA 2EJ4A 3MHHC 1JK2A 2E72A 2EMKA 1BBOA 2EQ1A 4F6NA 1ZAAC 2DGCA 1B69A 2BB8A 2YTIA 2LO3A 1A1IA 2EN6A 2DLQA 2YTDA 4R2QA 1WJPA 2ENAA 2EM3A 2YTEA 2EPCA 1G2FC 1YUJA 2RSIA 2YSOA 1A1HA 1G2DC 2WCC3 2WBSA 5KL7A 2EMBA 2ELZA 2EM7A 2LVHA 2MKNA 2YRKA 2EMWA 2EORA 2EOSA 2EM5A 1X5WA 1Z1BA 1YSAC 2EMZA 2EPXA 1JK1A 2YU5A 2EOOA 2EP3A 2EPPA 2EMAA 2NABA 2EN4A 2LV2A 2JP9A 2HGHA 4R2PA 2YRMA 1X3CA 2YTGA 2EM8A 3M99B 2YTQA 2ENHA 2EOMA 1MEYC 2EOEA 4FK5C 3EPLA 4F2JC 1TF6A 2EOHA 2YTNA 2EQ0A 2LCEA 2EQ3A 2YU8A 2ENCA 2CSHA 5KL2A 1F2IG 2EM4A 2RPCA 5KL3A 2YRHA 2EN3A 2MKDA 2J7JA 2CTDA 2EMGA 2WBUA 3EPJA 2EE8A 2GLIA 3UK3C 1AAYA 2EMHA 2EMCA 4GZNC 2EOXA 1X6EA 2DMIA 3MHSC 5KL6A 1A1LA 2EN1A 1UBDC 2EPZA 2R1FA 1LLMC 2GHFA 1X6HA 2EM9A 2EN2A 2EM0A 4WSGA 4X9JA 2EM2A 4R2SA 2EL6A 2EPUA 4R2EA 3EPKA 2EOFA 1RMDA 2M9AA 1UN6B 2EMIA 5KL4A 2I13A 1KJKA 2EMYA 2EOQA 1YUIA 1P47A 2YTJA 4IJDA 4F6MA 2ADRA 1TF3A 3EPHA 2CT1A 4M9VC 2EPRA 4IS1C 1BB8A 2EOIA 4R2AA 1A1GA 2EMLA 2ELYA 2DLKA 2PRTA 2YTPA 2EOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LT7 A;  1ZR9 A;  2EPA A;  5KL5 A;  2EL4 A;  2EL5 A;  2EOJ A;  2YTF A;  1DGC A;  1A1F A;  2EMF A;  2EM6 A;  2A25 A;  2VRD A;  1X6F A;  2EN8 A;  1TN9 A;  4R2R A;  1NCS A;  2MDG A;  2YSP A;  1ZU1 A;  2WBT A;  4R2C A;  1A1J A;  2DRP A;  2EMX A;  2YTO A;  2EN7 A;  3VHT B;  4R2D A;  1A1K A;  2JPA A;  2D9H A;  2EOY A;  2EJ4 A;  3MHH C;  1JK2 A;  2E72 A;  2EMK A;  1BBO A;  2EQ1 A;  4F6N A;  1ZAA C;  2DGC A;  1B69 A;  2BB8 A;  2YTI A;  2LO3 A;  1A1I A;  2EN6 A;  2DLQ A;  2YTD A;  4R2Q A;  1WJP A;  2ENA A;  2EM3 A;  2YTE A;  2EPC A;  1G2F C;  1YUJ A;  2RSI A;  2YSO A;  1A1H A;  1G2D C;  2WCC 3;  2WBS A;  5KL7 A;  2EMB A;  2ELZ A;  2EM7 A;  2LVH A;  2MKN A;  2YRK A;  2EMW A;  2EOR A;  2EOS A;  2EM5 A;  1X5W A;  1Z1B A;  1YSA C;  2EMZ A;  2EPX A;  1JK1 A;  2YU5 A;  2EOO A;  2EP3 A;  2EPP A;  2EMA A;  2NAB A;  2EN4 A;  2LV2 A;  2JP9 A;  2HGH A;  4R2P A;  2YRM A;  1X3C A;  2YTG A;  2EM8 A;  3M99 B;  2YTQ A;  2ENH A;  2EOM A;  1MEY C;  2EOE A;  4FK5 C;  3EPL A;  4F2J C;  1TF6 A;  2EOH A;  2YTN A;  2EQ0 A;  2LCE A;  2EQ3 A;  2YU8 A;  2ENC A;  2CSH A;  5KL2 A;  1F2I G;  2EM4 A;  2RPC A;  5KL3 A;  2YRH A;  2EN3 A;  2MKD A;  2J7J A;  2CTD A;  2EMG A;  2WBU A;  3EPJ A;  2EE8 A;  2GLI A;  3UK3 C;  1AAY A;  2EMH A;  2EMC A;  4GZN C;  2EOX A;  1X6E A;  2DMI A;  3MHS C;  5KL6 A;  1A1L A;  2EN1 A;  1UBD C;  2EPZ A;  2R1F A;  1LLM C;  2GHF A;  1X6H A;  2EM9 A;  2EN2 A;  2EM0 A;  4WSG A;  4X9J A;  2EM2 A;  4R2S A;  2EL6 A;  2EPU A;  4R2E A;  3EPK A;  2EOF A;  1RMD A;  2M9A A;  1UN6 B;  2EMI A;  5KL4 A;  2I13 A;  1KJK A;  2EMY A;  2EOQ A;  1YUI A;  1P47 A;  2YTJ A;  4IJD A;  4F6M A;  2ADR A;  1TF3 A;  3EPH A;  2CT1 A;  4M9V C;  2EPR A;  4IS1 C;  1BB8 A;  2EOI A;  4R2A A;  1A1G A;  2EML A;  2ELY A;  2DLK A;  2PRT A;  2YTP A;  2EOZ A; 
#chains in the Genus database with same CATH topology
 4BHB A;  2N3H A;  1ZR9 A;  2EPA A;  2LT7 A;  2EPM X;  2EL5 A;  2HJJ A;  1WHQ A;  2EMF A;  3JTZ A;  4DUZ E;  2EN8 A;  4M0V A;  4DV4 E;  2MDG A;  2B3T B;  2WBT A;  4BBY A;  4JI4 E;  2DRP A;  2H36 X;  5AE1 A;  1QU6 A;  2EZ6 A;  2JPA A;  2EJ4 A;  2E1M A;  3DJW A;  2E72 A;  1YPN A;  4RHB B;  4F6N A;  2FGG A;  1WRJ A;  3IWD A;  3IWB A;  3EQ1 A;  4KWY A;  1T4O A;  3OTO E;  2JY9 A;  2F4V E;  1RC7 A;  2ODR C;  4WPY A;  1UIL A;  5AE2 A;  5BR8 E;  5A6B A;  5FLX C;  1YUJ A;  2RSI A;  3J80 C;  2M1S A;  2L2M A;  4LF7 E;  3LLH A;  5TSE A;  2V89 A;  3VK6 A;  2EMB A;  3HTX A;  1I94 E;  4Q35 B;  2VQF E;  1EH8 A;  1HNX E;  4DUY E;  5F3W A;  4DR3 E;  4DR7 E;  1YSA C;  2EPK X;  5IT9 C;  4BCA A;  1JK1 A;  4LF5 E;  2EP3 A;  2EMA A;  2LV2 A;  2RSM A;  1YYK A;  4J8Z A;  4F54 A;  2V83 A;  1YZ9 A;  1X3C A;  3HPZ A;  2MDR A;  3DF6 A;  2YTQ A;  2ENH A;  2EOM A;  4WYQ B;  2NUF A;  4BC7 A;  4FK5 C;  2L3C A;  2EOH A;  2YTN A;  2EQ0 A;  2LCE A;  4DMI A;  5AAS A;  2N3G A;  1F2I G;  2ODR D;  4BS9 A;  5LL6 R;  1O0W A;  3C6M A;  1YYW A;  2V8Q B;  3KZZ A;  2WBU A;  2V87 A;  3UK3 C;  4X62 E;  2GPI A;  1FJG E;  2DMI A;  1T38 A;  1A1L A;  2EN1 A;  3J81 C;  2EPZ A;  4I8O A;  2JWO A;  2EPO A;  1X6H A;  2JOX A;  2EM9 A;  2DMY A;  4O5G A;  4X64 E;  2B7V A;  3T1Y E;  4B3T E;  5KL4 A;  4L5N C;  4DV2 E;  1KJK A;  2EOQ A;  3C4B A;  1YUI A;  3K6Q A;  2YTJ A;  4F6M A;  1QNT A;  4IS1 C;  1N34 E;  1XMQ E;  4LF6 E;  1N3G A;  2K7I A;  2DLK A;  1A1J A;  2RTX A;  2HHH E;  2YTP A;  2UU9 E;  2YWQ A;  2LTR A;  2EOJ A;  2YTF A;  4JI1 E;  1IMU A;  5A6J A;  2EM6 A;  2WZO A;  3HPS A;  4O4K A;  1ZBT A;  4P78 A;  4MLV A;  1GQE A;  2RS7 A;  4JI7 E;  3AUZ A;  2EMX A;  2LUQ A;  2YTO A;  4R2D A;  3VHT B;  1A1K A;  2EOY A;  3MHH C;  2JYA A;  5IXM B;  2KOU A;  3ADG A;  3L00 A;  2LRS A;  4GKK E;  2MC6 A;  1ZAA C;  4LFA E;  2DGC A;  3TQM A;  1A1I A;  2EN6 A;  2DLQ A;  1AH5 A;  1EH7 A;  4TUI A;  1IBM E;  4DV1 E;  2LUP B;  4NHR A;  1A1H A;  2LBS B;  1G2D C;  4YY3 E;  1SR9 A;  2ELZ A;  2YRK A;  2EOR A;  2EM5 A;  1X5W A;  4LTY A;  1IQO A;  2FV4 B;  3BID A;  2EPX A;  2YU5 A;  2EPP A;  2EN4 A;  2B7T A;  3C6K A;  2JP9 A;  4DV3 E;  4R2P A;  2YRM A;  3LML A;  3M99 B;  2EOE A;  1HNZ E;  3J7A G;  2DSY A;  2LE2 A;  1TF6 A;  1IQS A;  2YU8 A;  2CPN A;  2CSH A;  2VQE E;  4JI2 E;  2YPN A;  5A6K A;  2UUA E;  2RPC A;  2UXC E;  2MKD A;  5CFF E;  4DR4 E;  1L4S A;  1N32 E;  2EMG A;  4F9A B;  4DV7 E;  5LMU E;  3J7Y p;  2GLI A;  4Q28 A;  1X6E A;  4LF4 E;  3BF2 A;  5KL6 A;  1SFE A;  1UBD C;  4WXC A;  2R1F A;  5A6B D;  4DR2 E;  2EN2 A;  2EM0 A;  4BHC A;  4AQY E;  1GTK A;  4ZYH A;  2I9I A;  2LJH A;  4R2E A;  3EPK A;  1EKZ A;  5DNY A;  1J26 A;  2UXB E;  4WX9 A;  2EOI A;  2HC5 A;  5KL5 A;  2EL4 A;  4DR6 E;  4YHH E;  4M30 A;  2B9D A;  1A1F A;  2A25 A;  2VRD A;  4R8O A;  3KWR A;  1NCS A;  4DV0 E;  1MGT A;  2YSP A;  4B3S E;  4R2C A;  1KYQ A;  1GZ6 A;  4TUG A;  2RS6 A;  4ZYG A;  1BBO A;  2JXP A;  2DIX A;  3HXL A;  4O24 A;  4JI5 E;  3VYY A;  1X47 A;  2LMZ A;  1B69 A;  2BB8 A;  2LO3 A;  1J5E E;  1ZBQ A;  2YTD A;  1WHN A;  5ADZ A;  5A69 A;  2ENA A;  2EM3 A;  4GEQ B;  3OML A;  2EWL A;  4DR5 E;  2WCC 3;  2WBS A;  4OOG C;  2N8X A;  1PJQ A;  4WXD A;  3F6H A;  2EOS A;  1EH6 A;  1Z1B A;  1HR0 E;  2EOO A;  2VF1 A;  4M2Z A;  2UXD E;  2Q8U A;  2HGH A;  3C4T A;  1PJS A;  2L2K B;  1FKA E;  4F2J C;  4LU9 A;  2L6M A;  4BMJ A;  2EM4 A;  4B3R E;  5KL3 A;  4ZYE A;  4HTG A;  2YRH A;  2EN3 A;  4KZS A;  2J7J A;  3JAM C;  2CTD A;  4LFB E;  4WFT A;  2FTX B;  3H09 A;  1AAY A;  2EMH A;  4GZN C;  2EOX A;  2IHR 1;  5AC5 A;  2K4V A;  3MHS C;  1STU A;  3QG5 C;  3BGH A;  1LLM C;  1UHZ A;  2L8T A;  4X8W A;  2L92 A;  1T4N A;  3JU0 A;  4WSG A;  2EPL X;  4X9J A;  3T1H E;  4MLQ A;  2EL6 A;  2EPU A;  1PDA A;  2RQL A;  2EMI A;  2I13 A;  1N33 E;  2EMY A;  5A2Q C;  2LTS A;  4N4R B;  2NUE A;  4LF9 E;  4M9V C;  4DV5 E;  1A1G A;  2EML A;  5LLQ A;  2EOZ A;  2YT4 A;  5AC4 A;  4WSP A;  1DGC A;  5AE3 A;  1IBK E;  2V86 A;  1DQ3 A;  1X6F A;  2MC5 A;  1TN9 A;  4R2R A;  3FIG A;  2ZM6 E;  1ZU1 A;  3BBG A;  5T6J A;  3ZOQ B;  4LF8 E;  2EN7 A;  2D9H A;  1X49 A;  4F9B B;  1JK2 A;  3IWC A;  4BC9 A;  2EMK A;  2JR1 A;  2EQ1 A;  2VE7 C;  4LFC E;  3ADJ A;  2YTI A;  4RH8 A;  2KHX A;  2V85 A;  4B3M E;  1IBL E;  2M4I A;  4R2Q A;  1WJP A;  1BBG A;  4KHP E;  2YTE A;  3RMP A;  2EPC A;  1PJT A;  1G2F C;  2YSO A;  3MSW A;  3VYX A;  3ECR A;  5KL7 A;  1HNW E;  4X65 E;  2DB2 A;  1T4L B;  2EM7 A;  2LVH A;  2MKN A;  3HQ1 A;  1YYO A;  2EMW A;  1DI2 A;  4JI6 E;  2UUC E;  2L2N A;  5IV8 B;  2EMZ A;  3THN A;  2JVA A;  3ADL A;  3P1X A;  2NAB A;  2YTG A;  2EM8 A;  1XMO E;  1XNR E;  1MEY C;  3F6G A;  3EPL A;  2F8B A;  4OX9 E;  4F9C B;  4JV5 E;  1PKP A;  2EQ3 A;  2ENC A;  4GKJ E;  4NXM E;  5KL2 A;  4DV6 E;  4JYA E;  1NEI A;  1YFH A;  4NXN E;  2NUG A;  2L33 A;  4HEI A;  4O43 A;  4JI3 E;  2JOB A;  3EPJ A;  2EE8 A;  4X66 E;  2EMC A;  1T39 A;  5LMN E;  5A6A A;  3AV0 A;  1X48 A;  2LJU A;  2YZT A;  2E5L E;  3KZY A;  2GHF A;  2R76 A;  1RQ0 A;  2KON A;  4P7D A;  4DKK A;  4L8N A;  1N36 E;  2V88 A;  2EM2 A;  4DR1 E;  4R2S A;  2EPN A;  2G7H A;  2EOF A;  1RMD A;  2M9A A;  1UN6 B;  4JI0 E;  4NZV A;  1P47 A;  1WXR A;  4IJD A;  2ADR A;  2L3J A;  3THO B;  1TF3 A;  3EPH A;  2CT1 A;  2EPR A;  4R03 A;  5IWA E;  1BB8 A;  1XNQ E;  2NA2 A;  4R2A A;  2M7Q A;  2BBG A;  2UUB E;  2ELY A;  4ZYD A;  4K0K E;  2PRT A;  3ADI A;  4JI8 E; 
#chains in the Genus database with same CATH homology
 2LT7 A;  1ZR9 A;  2EPA A;  5KL5 A;  2EL4 A;  2EL5 A;  2EOJ A;  2YTF A;  1DGC A;  1A1F A;  2EMF A;  2EM6 A;  2A25 A;  2VRD A;  1X6F A;  2EN8 A;  1TN9 A;  4R2R A;  1NCS A;  2MDG A;  2YSP A;  1ZU1 A;  2WBT A;  4R2C A;  1A1J A;  2DRP A;  2EMX A;  2YTO A;  2EN7 A;  3VHT B;  4R2D A;  1A1K A;  2JPA A;  2D9H A;  2EOY A;  2EJ4 A;  3MHH C;  1JK2 A;  2E72 A;  2EMK A;  1BBO A;  2EQ1 A;  4F6N A;  1ZAA C;  2DGC A;  1B69 A;  2BB8 A;  2YTI A;  2LO3 A;  1A1I A;  2EN6 A;  2DLQ A;  2YTD A;  4R2Q A;  1WJP A;  2ENA A;  2EM3 A;  2YTE A;  2EPC A;  1G2F C;  1YUJ A;  2RSI A;  2YSO A;  1A1H A;  1G2D C;  2WCC 3;  2WBS A;  5KL7 A;  2EMB A;  2ELZ A;  2EM7 A;  2LVH A;  2MKN A;  2YRK A;  2EMW A;  2EOR A;  2EOS A;  2EM5 A;  1X5W A;  1Z1B A;  1YSA C;  2EMZ A;  2EPX A;  1JK1 A;  2YU5 A;  2EOO A;  2EP3 A;  2EPP A;  2EMA A;  2NAB A;  2EN4 A;  2LV2 A;  2JP9 A;  2HGH A;  4R2P A;  2YRM A;  1X3C A;  2YTG A;  2EM8 A;  3M99 B;  2YTQ A;  2ENH A;  2EOM A;  1MEY C;  2EOE A;  4FK5 C;  3EPL A;  4F2J C;  1TF6 A;  2EOH A;  2YTN A;  2EQ0 A;  2LCE A;  2EQ3 A;  2YU8 A;  2ENC A;  2CSH A;  5KL2 A;  1F2I G;  2EM4 A;  2RPC A;  5KL3 A;  2YRH A;  2EN3 A;  2MKD A;  2J7J A;  2CTD A;  2EMG A;  2WBU A;  3EPJ A;  2EE8 A;  2GLI A;  3UK3 C;  1AAY A;  2EMH A;  2EMC A;  4GZN C;  2EOX A;  1X6E A;  2DMI A;  3MHS C;  5KL6 A;  1A1L A;  2EN1 A;  1UBD C;  2EPZ A;  2R1F A;  1LLM C;  2GHF A;  1X6H A;  2EM9 A;  2EN2 A;  2EM0 A;  4WSG A;  4X9J A;  2EM2 A;  4R2S A;  2EL6 A;  2EPU A;  4R2E A;  3EPK A;  2EOF A;  1RMD A;  2M9A A;  1UN6 B;  2EMI A;  5KL4 A;  2I13 A;  1KJK A;  2EMY A;  2EOQ A;  1YUI A;  1P47 A;  2YTJ A;  4IJD A;  4F6M A;  2ADR A;  1TF3 A;  3EPH A;  2CT1 A;  4M9V C;  2EPR A;  4IS1 C;  1BB8 A;  2EOI A;  4R2A A;  1A1G A;  2EML A;  2ELY A;  2DLK A;  2PRT A;  2YTP A;  2EOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...