1IMUA

Solution structure of hi0257, a ribosome binding protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
107
structure length
107
Chain Sequence
MTLNITSKQMDITPAIREHLEERLAKLGKWQTQLISPHFVLNKVPNGFSVEASIGTPLGNLLASATSDDMYKAINEVEEKLERQLNKLQHKSESRRADERLKDSFEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN HI0257
publication title Solution structure of HI0257, a bacterial ribosome binding protein.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Rna binding protein
total genus 22
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2001-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02482 Ribosomal_S30AE Sigma 54 modulation protein / S30EA ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.100 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Ribosome hibernation promotion factor-like 1imuA00
1L4SA 4HEIA 3TQMA 2YWQA 1N3GA 2RQLA 1IMUA
chains in the Genus database with same CATH superfamily
4BMJA 3BGHA 2VQFE 1XMQE 2ADRA 3JAMC 3HTXA 2A25A 1G2FC 2EORA 2V85A 1N34E 4DR6E 1HNWE 4O43A 2YPNA 5AE2A 2LMZA 4F9CB 1HNZE 2EM0A 2E1MA 2LT7A 4J8ZA 1WXRA 2EMCA 4X65E 2WBSA 2EOYA 4R2AA 1HR0E 1AAYA 2V88A 1YYOA 3H09A 2RSIA 4LU9A 2DSYA 1ZAAC 3BIDA 2EN2A 4R2SA 1G2DC 1EH8A 2JXPA 1PKPA 3HXLA 3AV0A 2YT4A 4DMIA 1ZBTA 4BCAA 5AE3A 2B9DA 2UXBE 4HTGA 1IBLE 2L8TA 1STUA 1PJTA 2ENCA 2JY9A 1A1FA 2EM5A 2F4VE 4P7DA 1MEYC 2WBTA 1KJKA 2EQ3A 2L92A 2LV2A 2EPMX 2JR1A 3EPJA 2YU8A 2H36X 2M9AA 4YY3E 4LF8E 5T6JA 4F6MA 1GTKA 1ZBQA 1NEIA 4DV5E 2EN6A 3LLHA 1QNTA 2EMHA 1QU6A 2L2KB 4F9AB 1IQOA 1N3GA 2RQLA 2MDRA 3ZOQB 4ZYGA 2EMBA 2YSPA 4WXCA 3K6QA 4BHCA 5DNYA 3C6MA 5KL4A 2EM8A 4BS9A 1DGCA 2EL6A 3JTZA 1RC7A 3OMLA 1WRJA 2MKNA 2MKDA 2ENAA 4MLVA 2YZTA 1I94E 1JK1A 4X8WA 3DJWA 4JI8E 2YRMA 2DGCA 3C4BA 4BC7A 2LCEA 4DR4E 2EOEA 2Q8UA 2VQEE 3VHTB 1DQ3A 3DF6A 4JI7E 4DUZE 1X5WA 2EOIA 3UK3C 2N8XA 2L3CA 2EOQA 4JI2E 3EPHA 4DR3E 2BB8A 2NA2A 2JPAA 2EMIA 4TUGA 4F2JC 2EMAA 2EZ6A 4WSGA 2NUGA 3JU0A 4BC9A 2UU9E 2RSMA 2UUCE 1T4NA 3MHHC 2YWQA 4GEQB 1J5EE 4R2QA 1YUIA 1WHNA 4Q35B 4OX9E 2PRTA 2EMLA 2EN4A 1A1IA 2NUFA 2R76A 1JK2A 1BBOA 4WFTA 2YTEA 1PJQA 3RMPA 2EM9A 4WSPA 1Z1BA 2WBUA 3L00A 2IHR1 3MSWA 5A69A 3T1YE 4JI0E 2YTQA 2L6MA 5A6JA 4JI3E 4MLQA 4LFAE 2L2NA 4LTYA 1X6FA 2E72A 2EMKA 2EMWA 2EPUA 2EPKX 2HJJA 2EMXA 4O24A 4JI6E 2HGHA 1XNRE 4R2CA 1UN6B 5IXMB 2M7QA 2MC6A 1BB8A 2VE7C 3ADGA 3J81C 4M0VA 1O0WA 4DR1E 3KZYA 2YTIA 2DMIA 2YTOA 4R2RA 1LLMC 1IBKE 2DMYA 2LVHA 2EPPA 1YYWA 1T4OA 3LMLA 1SR9A 1WJPA 2LUQA 4WX9A 4N4RB 3MHSC 2YTGA 2YTJA 2EWLA 1J26A 3ECRA 1N36E 2M4IA 2L33A 2N3GA 2LBSB 2EOXA 4KZSA 2V87A 2LTRA 3OTOE 1UILA 3EPLA 4BHBA 2ZM6E 2V89A 2YTPA 2EPNA 4LFCE 2EMFA 2EP3A 1A1LA 4GZNC 1L4SA 4DV0E 5F3WA 2V8QB 2LRSA 4BBYA 1X49A 2CSHA 2RS7A 2EL5A 2NUEA 1XNQE 2DIXA 2ELYA 3TQMA 2K4VA 3EQ1A 1RMDA 3T1HE 1YYKA 2JWOA 4WPYA 4R2PA 4KHPE 3ADLA 1IQSA 3P1XA 2EPCA 1PJSA 4OOGC 5KL6A 2I9IA 2BBGA 2EQ1A 2E5LE 1A1KA 1A1JA 2JOXA 4JV5E 3J7Yp 4JYAE 4ZYEA 3ADJA 2EOFA 3IWCA 4IS1C 1ZR9A 5CFFE 4KWYA 2D9HA 1UHZA 4X64E 4F6NA 1AH5A 3THOB 1N33E 4HEIA 1MGTA 4RHBB 2FGGA 2EMYA 3VYXA 2EPOA 5KL5A 1T38A 4NXME 1N32E 2CT1A 4O5GA 4TUIA 2MDGA 1WHQA 4B3SE 2EJ4A 3VYYA 2B7VA 4JI1E 3AUZA 4DR2E 2EOOA 2YTDA 3THNA 5IWAE 4DKKA 2VF1A 2DLKA 4DR5E 1PDAA 2I13A 2NABA 1XMOE 1IMUA 2EM4A 1GZ6A 3HPZA 2JP9A 1A1HA 1YUJA 2F8BA 2EE8A 3FIGA 2LO3A 4RH8A 2M1SA 1X6EA 2ODRD 2JOBA 4R2EA 5A2QC 2KOUA 2HHHE 3C4TA 5AC5A 2FV4B 3BF2A 3KWRA 2RPCA 2DRPA 1TF3A 4B3TE 4DV1E 4ZYHA 1YFHA 2EN3A 4NXNE 2V86A 2JVAA 2UUAE 4R8OA 5A6BA 5FLXC 4IJDA 4JI5E 2VRDA 4WXDA 5ADZA 1NCSA 3BBGA 4ZYDA 4LF4E 1KYQA 4B3RE 2FTXB 2GHFA 5AC4A 2JYAA 4L5NC 2EQ0A 2HC5A 2EL4A 1BBGA 3IWBA 2GLIA 5A6AA 3VK6A 5A6BD 2ODRC 2EOHA 5KL3A 2EOZA 2EPLX 1TF6A 4O4KA 1RQ0A 2EN8A 2KHXA 4M30A 4DUYE 3ADIA 4AQYE 5LLQA 1F2IG 4NZVA 1HNXE 1UBDC 2WZOA 3F6HA 2LTSA 1YPNA 2EPZA 4DV2E 2EM3A 1EH7A 1EH6A 5LL6R 3KZZA 4X62E 2YTFA 2UUBE 2YU5A 1TN9A 1GQEA 2B3TB 1IBME 4Q28A 4M2ZA 4GKKE 2CTDA 2J7JA 4LF6E 2UXDE 2EN7A 2YSOA 1FKAE 2EN1A 4B3ME 2LE2A 1X6HA 2LUPB 2EM7A 5AE1A 2EMGA 2MC5A 5TSEA 4M9VC 2L3JA 4DV3E 2ENHA 5AASA 2G7HA 1YSAC 2CPNA 4F9BB 2KONA 1T39A 2ELZA 1X3CA 2RS6A 2EM6A 2EPAA 3IWDA 5A6KA 4FK5C 2DLQA 4NHRA 3J80C 4X9JA 2LJUA 4L8NA 5BR8E 2EPRA 1FJGE 4DV4E 4K0KE 2YTNA 1P47A 1B69A 4R03A 1T4LB 3C6KA 1DI2A 2WCC3 1A1GA 2N3HA 4DV7E 4F54A 5IT9C 1X48A 5IV8B 2RTXA 2LJHA 4I8OA 2EOSA 3F6GA 3HPSA 4GKJE 2GPIA 2K7IA 2YRHA 2UXCE 1YZ9A 4WYQB 3EPKA 3QG5C 4R2DA 4DR7E 5KL2A 1SFEA 5LMUE 1EKZA 4LF9E 2B7TA 2EOJA 2L2MA 2R1FA 3HQ1A 2EM2A 5KL7A 2EOMA 4LF7E 2DB2A 1ZU1A 4JI4E 4X66E 3M99B 3J7AG 2YRKA 4P78A 4YHHE 5LMNE 4LFBE 2V83A 1X47A 2EMZA 4DV6E 2EPXA 4LF5E
chains in the Genus database with same CATH topology
1L4SA 4HEIA 3TQMA 2YWQA 1N3GA 2RQLA 1IMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L4S A;  4HEI A;  3TQM A;  2YWQ A;  1N3G A;  2RQL A;  1IMU A; 
#chains in the Genus database with same CATH topology
 4BMJ A;  3BGH A;  2VQF E;  1XMQ E;  2ADR A;  3JAM C;  3HTX A;  2A25 A;  1G2F C;  2EOR A;  2V85 A;  1N34 E;  4DR6 E;  1HNW E;  4O43 A;  2YPN A;  5AE2 A;  2LMZ A;  4F9C B;  1HNZ E;  2EM0 A;  2E1M A;  2LT7 A;  4J8Z A;  1WXR A;  2EMC A;  4X65 E;  2WBS A;  2EOY A;  4R2A A;  1HR0 E;  1AAY A;  2V88 A;  1YYO A;  3H09 A;  2RSI A;  4LU9 A;  2DSY A;  1ZAA C;  3BID A;  2EN2 A;  4R2S A;  1G2D C;  1EH8 A;  2JXP A;  1PKP A;  3HXL A;  3AV0 A;  2YT4 A;  4DMI A;  1ZBT A;  4BCA A;  5AE3 A;  2B9D A;  2UXB E;  4HTG A;  1IBL E;  2L8T A;  1STU A;  1PJT A;  2ENC A;  2JY9 A;  1A1F A;  2EM5 A;  2F4V E;  4P7D A;  1MEY C;  2WBT A;  1KJK A;  2EQ3 A;  2L92 A;  2LV2 A;  2EPM X;  2JR1 A;  3EPJ A;  2YU8 A;  2H36 X;  2M9A A;  4YY3 E;  4LF8 E;  5T6J A;  4F6M A;  1GTK A;  1ZBQ A;  1NEI A;  4DV5 E;  2EN6 A;  3LLH A;  1QNT A;  2EMH A;  1QU6 A;  2L2K B;  4F9A B;  1IQO A;  1N3G A;  2RQL A;  2MDR A;  3ZOQ B;  4ZYG A;  2EMB A;  2YSP A;  4WXC A;  3K6Q A;  4BHC A;  5DNY A;  3C6M A;  5KL4 A;  2EM8 A;  4BS9 A;  1DGC A;  2EL6 A;  3JTZ A;  1RC7 A;  3OML A;  1WRJ A;  2MKN A;  2MKD A;  2ENA A;  4MLV A;  2YZT A;  1I94 E;  1JK1 A;  4X8W A;  3DJW A;  4JI8 E;  2YRM A;  2DGC A;  3C4B A;  4BC7 A;  2LCE A;  4DR4 E;  2EOE A;  2Q8U A;  2VQE E;  3VHT B;  1DQ3 A;  3DF6 A;  4JI7 E;  4DUZ E;  1X5W A;  2EOI A;  3UK3 C;  2N8X A;  2L3C A;  2EOQ A;  4JI2 E;  3EPH A;  4DR3 E;  2BB8 A;  2NA2 A;  2JPA A;  2EMI A;  4TUG A;  4F2J C;  2EMA A;  2EZ6 A;  4WSG A;  2NUG A;  3JU0 A;  4BC9 A;  2UU9 E;  2RSM A;  2UUC E;  1T4N A;  3MHH C;  2YWQ A;  4GEQ B;  1J5E E;  4R2Q A;  1YUI A;  1WHN A;  4Q35 B;  4OX9 E;  2PRT A;  2EML A;  2EN4 A;  1A1I A;  2NUF A;  2R76 A;  1JK2 A;  1BBO A;  4WFT A;  2YTE A;  1PJQ A;  3RMP A;  2EM9 A;  4WSP A;  1Z1B A;  2WBU A;  3L00 A;  2IHR 1;  3MSW A;  5A69 A;  3T1Y E;  4JI0 E;  2YTQ A;  2L6M A;  5A6J A;  4JI3 E;  4MLQ A;  4LFA E;  2L2N A;  4LTY A;  1X6F A;  2E72 A;  2EMK A;  2EMW A;  2EPU A;  2EPK X;  2HJJ A;  2EMX A;  4O24 A;  4JI6 E;  2HGH A;  1XNR E;  4R2C A;  1UN6 B;  5IXM B;  2M7Q A;  2MC6 A;  1BB8 A;  2VE7 C;  3ADG A;  3J81 C;  4M0V A;  1O0W A;  4DR1 E;  3KZY A;  2YTI A;  2DMI A;  2YTO A;  4R2R A;  1LLM C;  1IBK E;  2DMY A;  2LVH A;  2EPP A;  1YYW A;  1T4O A;  3LML A;  1SR9 A;  1WJP A;  2LUQ A;  4WX9 A;  4N4R B;  3MHS C;  2YTG A;  2YTJ A;  2EWL A;  1J26 A;  3ECR A;  1N36 E;  2M4I A;  2L33 A;  2N3G A;  2LBS B;  2EOX A;  4KZS A;  2V87 A;  2LTR A;  3OTO E;  1UIL A;  3EPL A;  4BHB A;  2ZM6 E;  2V89 A;  2YTP A;  2EPN A;  4LFC E;  2EMF A;  2EP3 A;  1A1L A;  4GZN C;  1L4S A;  4DV0 E;  5F3W A;  2V8Q B;  2LRS A;  4BBY A;  1X49 A;  2CSH A;  2RS7 A;  2EL5 A;  2NUE A;  1XNQ E;  2DIX A;  2ELY A;  3TQM A;  2K4V A;  3EQ1 A;  1RMD A;  3T1H E;  1YYK A;  2JWO A;  4WPY A;  4R2P A;  4KHP E;  3ADL A;  1IQS A;  3P1X A;  2EPC A;  1PJS A;  4OOG C;  5KL6 A;  2I9I A;  2BBG A;  2EQ1 A;  2E5L E;  1A1K A;  1A1J A;  2JOX A;  4JV5 E;  3J7Y p;  4JYA E;  4ZYE A;  3ADJ A;  2EOF A;  3IWC A;  4IS1 C;  1ZR9 A;  5CFF E;  4KWY A;  2D9H A;  1UHZ A;  4X64 E;  4F6N A;  1AH5 A;  3THO B;  1N33 E;  4HEI A;  1MGT A;  4RHB B;  2FGG A;  2EMY A;  3VYX A;  2EPO A;  5KL5 A;  1T38 A;  4NXM E;  1N32 E;  2CT1 A;  4O5G A;  4TUI A;  2MDG A;  1WHQ A;  4B3S E;  2EJ4 A;  3VYY A;  2B7V A;  4JI1 E;  3AUZ A;  4DR2 E;  2EOO A;  2YTD A;  3THN A;  5IWA E;  4DKK A;  2VF1 A;  2DLK A;  4DR5 E;  1PDA A;  2I13 A;  2NAB A;  1XMO E;  1IMU A;  2EM4 A;  1GZ6 A;  3HPZ A;  2JP9 A;  1A1H A;  1YUJ A;  2F8B A;  2EE8 A;  3FIG A;  2LO3 A;  4RH8 A;  2M1S A;  1X6E A;  2ODR D;  2JOB A;  4R2E A;  5A2Q C;  2KOU A;  2HHH E;  3C4T A;  5AC5 A;  2FV4 B;  3BF2 A;  3KWR A;  2RPC A;  2DRP A;  1TF3 A;  4B3T E;  4DV1 E;  4ZYH A;  1YFH A;  2EN3 A;  4NXN E;  2V86 A;  2JVA A;  2UUA E;  4R8O A;  5A6B A;  5FLX C;  4IJD A;  4JI5 E;  2VRD A;  4WXD A;  5ADZ A;  1NCS A;  3BBG A;  4ZYD A;  4LF4 E;  1KYQ A;  4B3R E;  2FTX B;  2GHF A;  5AC4 A;  2JYA A;  4L5N C;  2EQ0 A;  2HC5 A;  2EL4 A;  1BBG A;  3IWB A;  2GLI A;  5A6A A;  3VK6 A;  5A6B D;  2ODR C;  2EOH A;  5KL3 A;  2EOZ A;  2EPL X;  1TF6 A;  4O4K A;  1RQ0 A;  2EN8 A;  2KHX A;  4M30 A;  4DUY E;  3ADI A;  4AQY E;  5LLQ A;  1F2I G;  4NZV A;  1HNX E;  1UBD C;  2WZO A;  3F6H A;  2LTS A;  1YPN A;  2EPZ A;  4DV2 E;  2EM3 A;  1EH7 A;  1EH6 A;  5LL6 R;  3KZZ A;  4X62 E;  2YTF A;  2UUB E;  2YU5 A;  1TN9 A;  1GQE A;  2B3T B;  1IBM E;  4Q28 A;  4M2Z A;  4GKK E;  2CTD A;  2J7J A;  4LF6 E;  2UXD E;  2EN7 A;  2YSO A;  1FKA E;  2EN1 A;  4B3M E;  2LE2 A;  1X6H A;  2LUP B;  2EM7 A;  5AE1 A;  2EMG A;  2MC5 A;  5TSE A;  4M9V C;  2L3J A;  4DV3 E;  2ENH A;  5AAS A;  2G7H A;  1YSA C;  2CPN A;  4F9B B;  2KON A;  1T39 A;  2ELZ A;  1X3C A;  2RS6 A;  2EM6 A;  2EPA A;  3IWD A;  5A6K A;  4FK5 C;  2DLQ A;  4NHR A;  3J80 C;  4X9J A;  2LJU A;  4L8N A;  5BR8 E;  2EPR A;  1FJG E;  4DV4 E;  4K0K E;  2YTN A;  1P47 A;  1B69 A;  4R03 A;  1T4L B;  3C6K A;  1DI2 A;  2WCC 3;  1A1G A;  2N3H A;  4DV7 E;  4F54 A;  5IT9 C;  1X48 A;  5IV8 B;  2RTX A;  2LJH A;  4I8O A;  2EOS A;  3F6G A;  3HPS A;  4GKJ E;  2GPI A;  2K7I A;  2YRH A;  2UXC E;  1YZ9 A;  4WYQ B;  3EPK A;  3QG5 C;  4R2D A;  4DR7 E;  5KL2 A;  1SFE A;  5LMU E;  1EKZ A;  4LF9 E;  2B7T A;  2EOJ A;  2L2M A;  2R1F A;  3HQ1 A;  2EM2 A;  5KL7 A;  2EOM A;  4LF7 E;  2DB2 A;  1ZU1 A;  4JI4 E;  4X66 E;  3M99 B;  3J7A G;  2YRK A;  4P78 A;  4YHH E;  5LMN E;  4LFB E;  2V83 A;  1X47 A;  2EMZ A;  4DV6 E;  2EPX A;  4LF5 E; 
#chains in the Genus database with same CATH homology
 1L4S A;  4HEI A;  3TQM A;  2YWQ A;  1N3G A;  2RQL A;  1IMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...