1IMUA

Solution structure of hi0257, a ribosome binding protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
107
structure length
107
Chain Sequence
MTLNITSKQMDITPAIREHLEERLAKLGKWQTQLISPHFVLNKVPNGFSVEASIGTPLGNLLASATSDDMYKAINEVEEKLERQLNKLQHKSESRRADERLKDSFEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords HYPOTHETICAL PROTEIN HI0257
publication title Solution structure of HI0257, a bacterial ribosome binding protein.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 22
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2001-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02482 Ribosomal_S30AE Sigma 54 modulation protein / S30EA ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.100 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Ribosome hibernation promotion factor-like 1imuA00
2RQLA 2YWQA 1L4SA 3TQMA 4HEIA 1N3GA 1IMUA
chains in the Genus database with same CATH superfamily
2EOOA 2EP3A 2EM6A 2DIXA 3LMLA 1HR0E 2EM4A 2EN4A 2YT4A 4DR4E 4YHHE 2EE8A 2EM0A 2CSHA 4DV4E 2EOMA 4M0VA 1GZ6A 1RMDA 2EPPA 2UU9E 4BCAA 2UUBE 1ZBTA 3QG5C 4DV3E 4WXCA 4JI7E 2K4VA 3ECRA 2ENCA 2WBTA 2RSIA 2N3HA 1KJKA 4JI6E 4BMJA 2YZTA 2B7TA 2LJUA 5TSEA 4I8OA 1WHQA 5IWAE 4LF7E 2JOBA 2LE2A 2EPUA 2YTFA 3ADLA 5LLQA 4DR1E 1X49A 2WCC3 1T39A 4IS1C 2ELYA 2MC6A 2RPCA 1RQ0A 2YTDA 1HNZE 4AQYE 3JAMC 2EJ4A 4JI5E 1XMOE 2ADRA 2EWLA 2JWOA 2NUFA 1LLMC 2EPNA 5IXMB 2R1FA 2EN6A 4B3ME 4LU9A 4DUYE 5AC5A 1X6HA 3H09A 3M99B 4WYQB 2JP9A 1XNQE 3ADGA 2J7JA 2BBGA 3ZOQB 2MDRA 2UXCE 2EL5A 4LFCE 2EN1A 2DGCA 2EN7A 1IBKE 2F4VE 4M2ZA 2EMLA 2EMCA 4WXDA 4B3TE 4JI0E 5AE3A 3IWDA 2EOJA 2YTNA 2WBUA 2VE7C 3RMPA 2D9HA 1ZAAC 4LF8E 2EM2A 2EOIA 2LO3A 1KYQA 2EMWA 1N34E 2EM5A 1PDAA 5KL7A 4F2JC 2LV2A 1N32E 4LF5E 4LFAE 4NHRA 4O4KA 1IBLE 2DB2A 2EMKA 4R03A 1TN9A 3IWBA 4O5GA 1X6EA 4X62E 2EMBA 4BBYA 2L92A 2YTIA 2YU5A 5A6BD 4DR3E 2EN3A 5AE2A 1A1GA 2B7VA 1T4OA 2LCEA 2LMZA 2LUQA 2DLKA 2Q8UA 1YYWA 4B3SE 3VYXA 2JOXA 4L5NC 4DKKA 3KZYA 3C4BA 2I9IA 4P78A 2ELZA 3F6HA 2LTRA 4JI4E 2YWQA 3F6GA 3THNA 2YSOA 3KZZA 2L33A 1IQSA 5AE1A 1YFHA 3ADJA 4F9BB 2YRHA 3UK3C 4JV5E 1EH8A 5LMUE 2EQ1A 2RS7A 4MLQA 3J7Yp 1FKAE 2DMIA 2N8XA 1TF3A 1AAYA 1I94E 3BF2A 4R2QA 2JVAA 3DJWA 2A25A 2EOQA 3AV0A 3IWCA 3HQ1A 2L6MA 4YY3E 1J26A 4GEQB 2NABA 5A6BA 1AH5A 1STUA 4JYAE 2V89A 4R2DA 5A6AA 1NEIA 3THOB 4Q28A 3OMLA 3P1XA 4KHPE 2EOXA 1YUIA 5KL2A 2GLIA 1B69A 3LLHA 1IMUA 5AC4A 3MHHC 3ADIA 1IBME 1TF6A 2EMHA 2YPNA 4LF9E 2RSMA 2BB8A 2IHR1 1JK2A 4B3RE 4DR7E 2EPLX 4ZYGA 4RHBB 4TUIA 4DR2E 2JYAA 2EPXA 4R2EA 2YRMA 1ZU1A 2EMZA 4O24A 2EPMX 4HEIA 2L2KB 1UBDC 4WPYA 1L4SA 2M4IA 2PRTA 2EOEA 2K7IA 3T1YE 2EOFA 3EPJA 4DV0E 1GQEA 2KOUA 3OTOE 2CPNA 4DV5E 2EQ0A 2VQFE 3HTXA 4ZYHA 3DF6A 3HPZA 1BBOA 1F2IG 2ODRC 1WXRA 2N3GA 4F9CB 2LT7A 4R2SA 1A1FA 2RS6A 4WSPA 4GKJE 1BBGA 1X48A 2EMXA 3EPHA 2V86A 4WSGA 2FGGA 5DNYA 4FK5C 4R2AA 4M30A 4F6NA 2LBSB 2MKDA 2RQLA 2EOHA 3EPKA 3EPLA 2UXDE 2YRKA 1BB8A 1T38A 1FJGE 2F8BA 4J8ZA 2MC5A 1Z1BA 2NUEA 1A1HA 5ADZA 1QU6A 4R2RA 4X8WA 4NXME 1G2DC 2M1SA 4IJDA 4N4RB 1YUJA 1JK1A 1EH7A 2EMAA 2EL4A 4DMIA 4KWYA 2RTXA 2G7HA 4F9AB 3VYYA 4R2CA 2EPZA 2EM9A 5KL3A 3HXLA 1N3GA 1MGTA 2YTPA 5LL6R 5IV8B 4ZYEA 2WBSA 4MLVA 1YSAC 2M7QA 2EORA 1A1KA 2EN8A 2EPAA 1T4LB 1A1IA 4OX9E 2LTSA 3HPSA 2NA2A 2V83A 4DV6E 3C4TA 5A69A 1A1JA 4WX9A 1SR9A 4NZVA 2EPRA 2ENAA 2I13A 2H36X 5IT9C 2EMYA 4X65E 2E72A 4JI8E 2V88A 1GTKA 2DLQA 3BGHA 3JU0A 3C6MA 3MHSC 2MDGA 1J5EE 4X9JA 1YZ9A 1T4NA 2EQ3A 1DGCA 2JXPA 5A6JA 4TUGA 3K6QA 4LFBE 2EM3A 4X66E 2L2NA 2MKNA 2YTJA 2NUGA 1PJSA 2R76A 1O0WA 2B9DA 4L8NA 2LRSA 2M9AA 2YU8A 1WHNA 4M9VC 3J80C 2EOSA 4F6MA 2EPOA 1PKPA 2UUAE 2UXBE 3KWRA 3J81C 2L3CA 2EMIA 3BIDA 3TQMA 1HNWE 4K0KE 4RH8A 5KL6A 1YYKA 5A2QC 4NXNE 1QNTA 4DR5E 1MEYC 4ZYDA 2B3TB 2CTDA 4DV7E 2JPAA 4HTGA 1WRJA 4JI1E 4BS9A 2DRPA 2JY9A 4JI2E 4KZSA 1YPNA 2E5LE 2EMFA 3FIGA 2YTEA 2V85A 3C6KA 4R2PA 2YSPA 4DUZE 3MSWA 1X5WA 4LF6E 2ODRD 3T1HE 1X3CA 2EM7A 2ZM6E 5T6JA 1UN6B 2FV4B 2YTOA 4BC7A 2YTQA 1P47A 1UHZA 4Q35B 1X47A 3BBGA 1X6FA 2KONA 3VK6A 1YYOA 4O43A 4JI3E 2VRDA 3L00A 5A6KA 1N33E 2EMGA 2DMYA 2GHFA 1DQ3A 2KHXA 1EH6A 4GZNC 1UILA 4DV1E 1IQOA 4F54A 2EM8A 5BR8E 1WJPA 2L2MA 2EN2A 4DR6E 2HJJA 2DSYA 4BC9A 2UUCE 2VF1A 3VHTB 3J7AG 2FTXB 5LMNE 2LJHA 1ZR9A 2GPIA 2E1MA 2EOZA 1SFEA 4DV2E 1XNRE 4OOGC 5KL4A 2WZOA 2EPCA 1HNXE 2YTGA 5F3WA 2LUPB 5CFFE 2JR1A 2EZ6A 5FLXC 1RC7A 1PJQA 2L3JA 1PJTA 2EPKX 1ZBQA 3EQ1A 2EL6A 1XMQE 4WFTA 2HHHE 2LVHA 2V87A 5KL5A 4GKKE 4BHBA 5AASA 2VQEE 4R8OA 3JTZA 4P7DA 3AUZA 1DI2A 2EOYA 2HC5A 4LF4E 1A1LA 1N36E 2ENHA 2CT1A 1EKZA 4X64E 4LTYA 4BHCA 2HGHA 2V8QB 1NCSA 2L8TA 1G2FC
chains in the Genus database with same CATH topology
2RQLA 2YWQA 1L4SA 3TQMA 4HEIA 1N3GA 1IMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQL A;  2YWQ A;  1L4S A;  3TQM A;  4HEI A;  1N3G A;  1IMU A; 
#chains in the Genus database with same CATH topology
 2EOO A;  2EP3 A;  2EM6 A;  2DIX A;  3LML A;  1HR0 E;  2EM4 A;  2EN4 A;  2YT4 A;  4DR4 E;  4YHH E;  2EE8 A;  2EM0 A;  2CSH A;  4DV4 E;  2EOM A;  4M0V A;  1GZ6 A;  1RMD A;  2EPP A;  2UU9 E;  4BCA A;  2UUB E;  1ZBT A;  3QG5 C;  4DV3 E;  4WXC A;  4JI7 E;  2K4V A;  3ECR A;  2ENC A;  2WBT A;  2RSI A;  2N3H A;  1KJK A;  4JI6 E;  4BMJ A;  2YZT A;  2B7T A;  2LJU A;  5TSE A;  4I8O A;  1WHQ A;  5IWA E;  4LF7 E;  2JOB A;  2LE2 A;  2EPU A;  2YTF A;  3ADL A;  5LLQ A;  4DR1 E;  1X49 A;  2WCC 3;  1T39 A;  4IS1 C;  2ELY A;  2MC6 A;  2RPC A;  1RQ0 A;  2YTD A;  1HNZ E;  4AQY E;  3JAM C;  2EJ4 A;  4JI5 E;  1XMO E;  2ADR A;  2EWL A;  2JWO A;  2NUF A;  1LLM C;  2EPN A;  5IXM B;  2R1F A;  2EN6 A;  4B3M E;  4LU9 A;  4DUY E;  5AC5 A;  1X6H A;  3H09 A;  3M99 B;  4WYQ B;  2JP9 A;  1XNQ E;  3ADG A;  2J7J A;  2BBG A;  3ZOQ B;  2MDR A;  2UXC E;  2EL5 A;  4LFC E;  2EN1 A;  2DGC A;  2EN7 A;  1IBK E;  2F4V E;  4M2Z A;  2EML A;  2EMC A;  4WXD A;  4B3T E;  4JI0 E;  5AE3 A;  3IWD A;  2EOJ A;  2YTN A;  2WBU A;  2VE7 C;  3RMP A;  2D9H A;  1ZAA C;  4LF8 E;  2EM2 A;  2EOI A;  2LO3 A;  1KYQ A;  2EMW A;  1N34 E;  2EM5 A;  1PDA A;  5KL7 A;  4F2J C;  2LV2 A;  1N32 E;  4LF5 E;  4LFA E;  4NHR A;  4O4K A;  1IBL E;  2DB2 A;  2EMK A;  4R03 A;  1TN9 A;  3IWB A;  4O5G A;  1X6E A;  4X62 E;  2EMB A;  4BBY A;  2L92 A;  2YTI A;  2YU5 A;  5A6B D;  4DR3 E;  2EN3 A;  5AE2 A;  1A1G A;  2B7V A;  1T4O A;  2LCE A;  2LMZ A;  2LUQ A;  2DLK A;  2Q8U A;  1YYW A;  4B3S E;  3VYX A;  2JOX A;  4L5N C;  4DKK A;  3KZY A;  3C4B A;  2I9I A;  4P78 A;  2ELZ A;  3F6H A;  2LTR A;  4JI4 E;  2YWQ A;  3F6G A;  3THN A;  2YSO A;  3KZZ A;  2L33 A;  1IQS A;  5AE1 A;  1YFH A;  3ADJ A;  4F9B B;  2YRH A;  3UK3 C;  4JV5 E;  1EH8 A;  5LMU E;  2EQ1 A;  2RS7 A;  4MLQ A;  3J7Y p;  1FKA E;  2DMI A;  2N8X A;  1TF3 A;  1AAY A;  1I94 E;  3BF2 A;  4R2Q A;  2JVA A;  3DJW A;  2A25 A;  2EOQ A;  3AV0 A;  3IWC A;  3HQ1 A;  2L6M A;  4YY3 E;  1J26 A;  4GEQ B;  2NAB A;  5A6B A;  1AH5 A;  1STU A;  4JYA E;  2V89 A;  4R2D A;  5A6A A;  1NEI A;  3THO B;  4Q28 A;  3OML A;  3P1X A;  4KHP E;  2EOX A;  1YUI A;  5KL2 A;  2GLI A;  1B69 A;  3LLH A;  1IMU A;  5AC4 A;  3MHH C;  3ADI A;  1IBM E;  1TF6 A;  2EMH A;  2YPN A;  4LF9 E;  2RSM A;  2BB8 A;  2IHR 1;  1JK2 A;  4B3R E;  4DR7 E;  2EPL X;  4ZYG A;  4RHB B;  4TUI A;  4DR2 E;  2JYA A;  2EPX A;  4R2E A;  2YRM A;  1ZU1 A;  2EMZ A;  4O24 A;  2EPM X;  4HEI A;  2L2K B;  1UBD C;  4WPY A;  1L4S A;  2M4I A;  2PRT A;  2EOE A;  2K7I A;  3T1Y E;  2EOF A;  3EPJ A;  4DV0 E;  1GQE A;  2KOU A;  3OTO E;  2CPN A;  4DV5 E;  2EQ0 A;  2VQF E;  3HTX A;  4ZYH A;  3DF6 A;  3HPZ A;  1BBO A;  1F2I G;  2ODR C;  1WXR A;  2N3G A;  4F9C B;  2LT7 A;  4R2S A;  1A1F A;  2RS6 A;  4WSP A;  4GKJ E;  1BBG A;  1X48 A;  2EMX A;  3EPH A;  2V86 A;  4WSG A;  2FGG A;  5DNY A;  4FK5 C;  4R2A A;  4M30 A;  4F6N A;  2LBS B;  2MKD A;  2RQL A;  2EOH A;  3EPK A;  3EPL A;  2UXD E;  2YRK A;  1BB8 A;  1T38 A;  1FJG E;  2F8B A;  4J8Z A;  2MC5 A;  1Z1B A;  2NUE A;  1A1H A;  5ADZ A;  1QU6 A;  4R2R A;  4X8W A;  4NXM E;  1G2D C;  2M1S A;  4IJD A;  4N4R B;  1YUJ A;  1JK1 A;  1EH7 A;  2EMA A;  2EL4 A;  4DMI A;  4KWY A;  2RTX A;  2G7H A;  4F9A B;  3VYY A;  4R2C A;  2EPZ A;  2EM9 A;  5KL3 A;  3HXL A;  1N3G A;  1MGT A;  2YTP A;  5LL6 R;  5IV8 B;  4ZYE A;  2WBS A;  4MLV A;  1YSA C;  2M7Q A;  2EOR A;  1A1K A;  2EN8 A;  2EPA A;  1T4L B;  1A1I A;  4OX9 E;  2LTS A;  3HPS A;  2NA2 A;  2V83 A;  4DV6 E;  3C4T A;  5A69 A;  1A1J A;  4WX9 A;  1SR9 A;  4NZV A;  2EPR A;  2ENA A;  2I13 A;  2H36 X;  5IT9 C;  2EMY A;  4X65 E;  2E72 A;  4JI8 E;  2V88 A;  1GTK A;  2DLQ A;  3BGH A;  3JU0 A;  3C6M A;  3MHS C;  2MDG A;  1J5E E;  4X9J A;  1YZ9 A;  1T4N A;  2EQ3 A;  1DGC A;  2JXP A;  5A6J A;  4TUG A;  3K6Q A;  4LFB E;  2EM3 A;  4X66 E;  2L2N A;  2MKN A;  2YTJ A;  2NUG A;  1PJS A;  2R76 A;  1O0W A;  2B9D A;  4L8N A;  2LRS A;  2M9A A;  2YU8 A;  1WHN A;  4M9V C;  3J80 C;  2EOS A;  4F6M A;  2EPO A;  1PKP A;  2UUA E;  2UXB E;  3KWR A;  3J81 C;  2L3C A;  2EMI A;  3BID A;  3TQM A;  1HNW E;  4K0K E;  4RH8 A;  5KL6 A;  1YYK A;  5A2Q C;  4NXN E;  1QNT A;  4DR5 E;  1MEY C;  4ZYD A;  2B3T B;  2CTD A;  4DV7 E;  2JPA A;  4HTG A;  1WRJ A;  4JI1 E;  4BS9 A;  2DRP A;  2JY9 A;  4JI2 E;  4KZS A;  1YPN A;  2E5L E;  2EMF A;  3FIG A;  2YTE A;  2V85 A;  3C6K A;  4R2P A;  2YSP A;  4DUZ E;  3MSW A;  1X5W A;  4LF6 E;  2ODR D;  3T1H E;  1X3C A;  2EM7 A;  2ZM6 E;  5T6J A;  1UN6 B;  2FV4 B;  2YTO A;  4BC7 A;  2YTQ A;  1P47 A;  1UHZ A;  4Q35 B;  1X47 A;  3BBG A;  1X6F A;  2KON A;  3VK6 A;  1YYO A;  4O43 A;  4JI3 E;  2VRD A;  3L00 A;  5A6K A;  1N33 E;  2EMG A;  2DMY A;  2GHF A;  1DQ3 A;  2KHX A;  1EH6 A;  4GZN C;  1UIL A;  4DV1 E;  1IQO A;  4F54 A;  2EM8 A;  5BR8 E;  1WJP A;  2L2M A;  2EN2 A;  4DR6 E;  2HJJ A;  2DSY A;  4BC9 A;  2UUC E;  2VF1 A;  3VHT B;  3J7A G;  2FTX B;  5LMN E;  2LJH A;  1ZR9 A;  2GPI A;  2E1M A;  2EOZ A;  1SFE A;  4DV2 E;  1XNR E;  4OOG C;  5KL4 A;  2WZO A;  2EPC A;  1HNX E;  2YTG A;  5F3W A;  2LUP B;  5CFF E;  2JR1 A;  2EZ6 A;  5FLX C;  1RC7 A;  1PJQ A;  2L3J A;  1PJT A;  2EPK X;  1ZBQ A;  3EQ1 A;  2EL6 A;  1XMQ E;  4WFT A;  2HHH E;  2LVH A;  2V87 A;  5KL5 A;  4GKK E;  4BHB A;  5AAS A;  2VQE E;  4R8O A;  3JTZ A;  4P7D A;  3AUZ A;  1DI2 A;  2EOY A;  2HC5 A;  4LF4 E;  1A1L A;  1N36 E;  2ENH A;  2CT1 A;  1EKZ A;  4X64 E;  4LTY A;  4BHC A;  2HGH A;  2V8Q B;  1NCS A;  2L8T A;  1G2F C; 
#chains in the Genus database with same CATH homology
 2RQL A;  2YWQ A;  1L4S A;  3TQM A;  4HEI A;  1N3G A;  1IMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...