2YTNA

Solution structure of the c2h2 type zinc finger (region 732-764) of human zinc finger protein 347
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGKKPYKCNECGKVFTQNSHLARHRGIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 347
publication title Solution structure of the C2H2 type zinc finger (region 732-764) of human Zinc finger protein 347
rcsb
source organism Homo sapiens
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytnA01
2YTJA 5KL4A 2WCC3 2EPCA 2YTFA 2LCEA 1A1GA 2D9HA 1X6EA 1MEYC 2EL6A 1UBDC 3EPHA 2RPCA 2LVHA 4R2EA 4X9JA 5KL7A 2EOJA 2EQ1A 2YTDA 2JP9A 3EPJA 1YSAC 2CSHA 4R2DA 4IJDA 2NABA 3EPLA 1AAYA 2ENCA 2EM3A 1A1HA 2EOSA 2GHFA 1JK2A 2YU5A 2YRMA 2LT7A 4GZNC 3UK3C 1A1LA 1RMDA 4R2PA 3MHHC 2M9AA 2YTOA 2EMBA 2EMIA 2EMZA 2DMIA 2EOHA 1X5WA 2YTQA 2EMXA 3MHSC 5KL3A 2EMHA 2EM9A 2EOOA 1ZAAC 4WSGA 1B69A 1ZU1A 1JK1A 1TN9A 2ADRA 2EQ3A 2ELZA 2EORA 2ENHA 2WBUA 2LV2A 1TF6A 2MKNA 2R1FA 2EOQA 2WBSA 2EN3A 3EPKA 2YSPA 2MKDA 2EPZA 1Z1BA 2YTGA 2ELYA 2YSOA 2EMKA 2GLIA 2EOZA 1X3CA 2EQ0A 2EOMA 2YTEA 2EL4A 1DGCA 2LO3A 2MDGA 2EPAA 2EMLA 4R2RA 4FK5C 5KL6A 1BB8A 2EJ4A 2EPPA 2EOXA 1A1FA 2EM8A 2CT1A 2EOIA 2A25A 5KL5A 2DRPA 1UN6B 2BB8A 2EN2A 2EN1A 2EN4A 2EMAA 1BBOA 2EMGA 2EM0A 1P47A 1A1KA 2EMWA 2ENAA 1G2DC 2J7JA 2RSIA 2EN8A 2PRTA 1X6FA 2DGCA 3VHTB 2EMCA 2YTNA 2VRDA 2EPXA 2EPUA 1NCSA 2EM4A 1A1JA 2WBTA 1G2FC 1ZR9A 4R2CA 1A1IA 2EOFA 1WJPA 2EM2A 2EL5A 4R2AA 2CTDA 4R2SA 1X6HA 4R2QA 1LLMC 2EMFA 1YUJA 2EOEA 2DLQA 2I13A 2EP3A 5KL2A 1F2IG 2YTPA 2EM6A 2YU8A 2DLKA 3M99B 2EN7A 1TF3A 2EPRA 2EN6A 4F6NA 4F6MA 2E72A 2EMYA 1KJKA 2EM7A 1YUIA 2JPAA 2YRKA 2EE8A 2YTIA 4F2JC 2HGHA 4M9VC 2EM5A 4IS1C 2EOYA 2YRHA
chains in the Genus database with same CATH superfamily
4O4KA 2YTJA 5KL4A 1N36E 2D9HA 4LF6E 1EKZA 3C4TA 2EL6A 3ADGA 1EH7A 5IXMB 4MLQA 3EPHA 2RPCA 1J26A 2LVHA 4NXME 4R2EA 3TQMA 4GEQB 2YTDA 2E5LE 2JP9A 3EPJA 4BBYA 5IV8B 2DB2A 2NABA 4JI8E 1AAYA 2EM3A 1FKAE 4DR7E 4LFCE 4WFTA 2UUBE 1DI2A 2LUPB 1XMOE 1N33E 4DV6E 3MHHC 1STUA 2L2MA 2JVAA 4F9CB 2YTOA 2I9IA 4DR3E 2EMBA 2EMZA 5CFFE 2EOHA 3L00A 2KHXA 3F6GA 3RMPA 4DV1E 3VYYA 1N32E 4B3ME 2ADRA 5A6BD 2EQ3A 2EZ6A 2ENHA 2E1MA 2LV2A 1TF6A 3KZZA 3J80C 1MGTA 5AC4A 4JI0E 2EPLX 1DQ3A 2WBSA 2EPZA 1Z1BA 4O24A 2GLIA 2NA2A 2BBGA 2EOMA 2YTEA 2NUEA 2LO3A 4WYQB 2MDGA 2EPAA 1PDAA 3KZYA 4LTYA 2EMLA 4R2RA 2EPPA 2EOXA 5LLQA 4DUZE 2DRPA 1UN6B 2EN2A 2L2KB 2EMGA 2EM0A 1A1KA 2ENAA 2LJHA 2RSIA 2JOXA 2MDRA 3BBGA 3LMLA 2LE2A 2EMCA 3T1HE 2RQLA 2K4VA 4DR2E 1HNXE 2V8QB 4DV4E 2WZOA 1AH5A 4R2CA 1A1IA 2EOFA 4JI2E 1WJPA 4DV2E 3DF6A 4MLVA 4LF8E 5AC5A 3BGHA 1X6HA 1LLMC 4WPYA 2ZM6E 2EMFA 2H36X 1WHQA 1EH8A 1GTKA 2EOEA 2JR1A 5A6AA 2EP3A 2EM6A 2YU8A 3M99B 1TF3A 2EPRA 4F6NA 3FIGA 2E72A 2GPIA 2V83A 4LF5E 3IWBA 4N4RB 2LTRA 1T38A 1IBME 4L8NA 1X49A 2HJJA 3H09A 4LU9A 4JI1E 2YT4A 2VQFE 2YTIA 2HGHA 4M9VC 4IS1C 2EOYA 4DV5E 4DR6E 3ADJA 4J8ZA 1XNRE 2LCEA 1RC7A 3BF2A 1ZBTA 2YPNA 4DV7E 4BMJA 4WXCA 4RH8A 4DKKA 5A6KA 4OOGC 2DSYA 4DR4E 2EQ1A 3ECRA 2L3JA 1QU6A 3THOB 1A1HA 2EOSA 1JK2A 2YU5A 2YRMA 2LT7A 1X47A 4GZNC 1RMDA 2UXDE 4F9BB 1O0WA 4K0KE 2FV4B 2EMIA 3JTZA 4O43A 1RQ0A 2FTXB 2HHHE 4JI6E 2EMXA 2JY9A 5KL3A 1YYWA 2EMHA 4KZSA 2EM9A 3BIDA 5LMUE 1ZU1A 1JK1A 5LL6R 2ODRD 2V87A 3IWDA 5AE1A 1YZ9A 2RS7A 1T4OA 2EPNA 2EN3A 3EPKA 4DR5E 2MKDA 4WX9A 1UHZA 4RHBB 2N3GA 2DMYA 4F9AB 2EOZA 1X3CA 2EQ0A 1YYOA 2EL4A 2RS6A 4DUYE 5A6BA 1DGCA 4ZYGA 1I94E 2M1SA 2IHR1 5KL6A 2EM8A 2CT1A 2UUCE 5A69A 1P47A 1PJSA 4B3SE 2EMWA 2Q8UA 2J7JA 2DIXA 2EN8A 4DR1E 3JU0A 1L4SA 5A6JA 2EPXA 1PJTA 2B9DA 1NCSA 2L33A 1T39A 3OMLA 4R2AA 2CTDA 3AUZA 4ZYEA 4R2QA 3C4BA 1WRJA 2I13A 4R8OA 4LFBE 2YTPA 4KWYA 2LRSA 2EN7A 3EQ1A 4JI5E 3AV0A 2LMZA 1KJKA 4BC7A 2CPNA 2JPAA 4LF9E 2RTXA 2EE8A 5ADZA 2MC5A 4P78A 2JYAA 4F2JC 1ZBQA 1XNQE 2YRHA 2M7QA 3J7AG 5A2QC 3HPSA 2F4VE 3VK6A 4GKKE 1A1GA 3QG5C 1X6EA 4YY3E 2VQEE 3HTXA 4OX9E 4X9JA 4HEIA 2UXCE 1X48A 2EOJA 4R03A 1XMQE 1YSAC 1YPNA 2V89A 4R2DA 1EH6A 4YHHE 1HR0E 4DV3E 2NUFA 4JYAE 4X65E 4LFAE 3UK3C 1A1LA 4R2PA 3VYXA 2M9AA 4BCAA 2DMIA 2YTQA 4X66E 3MHSC 4WSGA 1B69A 4ZYDA 3J81C 1HNZE 2HC5A 1IQOA 2ELZA 2WBUA 2MKNA 1NEIA 2R1FA 3C6MA 2EOQA 3F6HA 5IWAE 2YSPA 1WHNA 2JXPA 2RSMA 2NUGA 2ELYA 1N3GA 2EMKA 5TSEA 4NHRA 2K7IA 2L3CA 4ZYHA 4M30A 4BS9A 4FK5C 5T6JA 2KOUA 2EJ4A 1A1FA 4WSPA 1KYQA 2BB8A 4NZVA 1IQSA 2EN4A 2EMAA 1BBOA 2UXBE 3K6QA 2DGCA 1X6FA 2YTNA 3KWRA 2VRDA 1GZ6A 2EPUA 4BHBA 4X64E 1J5EE 4JI3E 1UILA 1WXRA 1A1JA 1ZR9A 1IBLE 2KONA 3C6KA 2EM2A 4HTGA 4R2SA 4L5NC 1F2IG 5KL2A 5AE2A 4LF7E 2DLKA 1HNWE 2L2NA 2L6MA 3T1YE 2EPMX 3DJWA 4F6MA 1YUIA 2YRKA 2UUAE 2JOBA 5F3WA 3LLHA 1YYKA 4X62E 2WCC3 2EPCA 2YTFA 1QNTA 1SR9A 1MEYC 1UBDC 4BHCA 5KL7A 4O5GA 2MC6A 1YFHA 2CSHA 4JI4E 2B7TA 4IJDA 3EPLA 2ENCA 3ADIA 4JV5E 2YWQA 2GHFA 3J7Yp 3IWCA 2YZTA 1N34E 5IT9C 2FGGA 2JWOA 4LF4E 3P1XA 4AQYE 4WXDA 1X5WA 2LJUA 1BBGA 3THNA 2EPOA 4KHPE 1T4LB 1PKPA 2G7HA 2EOOA 1ZAAC 2EWLA 1TN9A 3HPZA 3JAMC 5AE3A 2F8BA 2V86A 3HXLA 2B7VA 4DMIA 2EORA 4DV0E 2EPKX 2L92A 5FLXC 2LUQA 2YTGA 5DNYA 2YSOA 1IMUA 4NXNE 2UU9E 1FJGE 4M2ZA 2V88A 4Q28A 4F54A 5BR8E 4BC9A 2ODRC 3ZOQB 2LTSA 3ADLA 1BB8A 4B3TE 4GKJE 5KL5A 2EOIA 2A25A 2B3TB 1GQEA 2EN1A 2N8XA 2LBSB 2VE7C 1G2DC 2L8TA 2PRTA 1IBKE 3VHTB 4B3RE 3OTOE 2EM4A 5AASA 2WBTA 1G2FC 4X8WA 3MSWA 2EL5A 4Q35B 4JI7E 4P7DA 2M4IA 4TUIA 1YUJA 1SFEA 2DLQA 1PJQA 3HQ1A 2N3HA 2VF1A 2EN6A 2EMYA 2R76A 2EM7A 2V85A 4I8OA 2EM5A 4M0VA 5LMNE 1T4NA 4TUGA
chains in the Genus database with same CATH topology
2YTJA 5KL4A 2WCC3 2EPCA 2YTFA 2LCEA 1A1GA 2D9HA 1X6EA 1MEYC 2EL6A 1UBDC 3EPHA 2RPCA 2LVHA 4R2EA 4X9JA 5KL7A 2EOJA 2EQ1A 2YTDA 2JP9A 3EPJA 1YSAC 2CSHA 4R2DA 4IJDA 2NABA 3EPLA 1AAYA 2ENCA 2EM3A 1A1HA 2EOSA 2GHFA 1JK2A 2YU5A 2YRMA 2LT7A 4GZNC 3UK3C 1A1LA 1RMDA 4R2PA 3MHHC 2M9AA 2YTOA 2EMBA 2EMIA 2EMZA 2DMIA 2EOHA 1X5WA 2YTQA 2EMXA 3MHSC 5KL3A 2EMHA 2EM9A 2EOOA 1ZAAC 4WSGA 1B69A 1ZU1A 1JK1A 1TN9A 2ADRA 2EQ3A 2ELZA 2EORA 2ENHA 2WBUA 2LV2A 1TF6A 2MKNA 2R1FA 2EOQA 2WBSA 2EN3A 3EPKA 2YSPA 2MKDA 2EPZA 1Z1BA 2YTGA 2ELYA 2YSOA 2EMKA 2GLIA 2EOZA 1X3CA 2EQ0A 2EOMA 2YTEA 2EL4A 1DGCA 2LO3A 2MDGA 2EPAA 2EMLA 4R2RA 4FK5C 5KL6A 1BB8A 2EJ4A 2EPPA 2EOXA 1A1FA 2EM8A 2CT1A 2EOIA 2A25A 5KL5A 2DRPA 1UN6B 2BB8A 2EN2A 2EN1A 2EN4A 2EMAA 1BBOA 2EMGA 2EM0A 1P47A 1A1KA 2EMWA 2ENAA 1G2DC 2J7JA 2RSIA 2EN8A 2PRTA 1X6FA 2DGCA 3VHTB 2EMCA 2YTNA 2VRDA 2EPXA 2EPUA 1NCSA 2EM4A 1A1JA 2WBTA 1G2FC 1ZR9A 4R2CA 1A1IA 2EOFA 1WJPA 2EM2A 2EL5A 4R2AA 2CTDA 4R2SA 1X6HA 4R2QA 1LLMC 2EMFA 1YUJA 2EOEA 2DLQA 2I13A 2EP3A 5KL2A 1F2IG 2YTPA 2EM6A 2YU8A 2DLKA 3M99B 2EN7A 1TF3A 2EPRA 2EN6A 4F6NA 4F6MA 2E72A 2EMYA 1KJKA 2EM7A 1YUIA 2JPAA 2YRKA 2EE8A 2YTIA 4F2JC 2HGHA 4M9VC 2EM5A 4IS1C 2EOYA 2YRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTJ A;  5KL4 A;  2WCC 3;  2EPC A;  2YTF A;  2LCE A;  1A1G A;  2D9H A;  1X6E A;  1MEY C;  2EL6 A;  1UBD C;  3EPH A;  2RPC A;  2LVH A;  4R2E A;  4X9J A;  5KL7 A;  2EOJ A;  2EQ1 A;  2YTD A;  2JP9 A;  3EPJ A;  1YSA C;  2CSH A;  4R2D A;  4IJD A;  2NAB A;  3EPL A;  1AAY A;  2ENC A;  2EM3 A;  1A1H A;  2EOS A;  2GHF A;  1JK2 A;  2YU5 A;  2YRM A;  2LT7 A;  4GZN C;  3UK3 C;  1A1L A;  1RMD A;  4R2P A;  3MHH C;  2M9A A;  2YTO A;  2EMB A;  2EMI A;  2EMZ A;  2DMI A;  2EOH A;  1X5W A;  2YTQ A;  2EMX A;  3MHS C;  5KL3 A;  2EMH A;  2EM9 A;  2EOO A;  1ZAA C;  4WSG A;  1B69 A;  1ZU1 A;  1JK1 A;  1TN9 A;  2ADR A;  2EQ3 A;  2ELZ A;  2EOR A;  2ENH A;  2WBU A;  2LV2 A;  1TF6 A;  2MKN A;  2R1F A;  2EOQ A;  2WBS A;  2EN3 A;  3EPK A;  2YSP A;  2MKD A;  2EPZ A;  1Z1B A;  2YTG A;  2ELY A;  2YSO A;  2EMK A;  2GLI A;  2EOZ A;  1X3C A;  2EQ0 A;  2EOM A;  2YTE A;  2EL4 A;  1DGC A;  2LO3 A;  2MDG A;  2EPA A;  2EML A;  4R2R A;  4FK5 C;  5KL6 A;  1BB8 A;  2EJ4 A;  2EPP A;  2EOX A;  1A1F A;  2EM8 A;  2CT1 A;  2EOI A;  2A25 A;  5KL5 A;  2DRP A;  1UN6 B;  2BB8 A;  2EN2 A;  2EN1 A;  2EN4 A;  2EMA A;  1BBO A;  2EMG A;  2EM0 A;  1P47 A;  1A1K A;  2EMW A;  2ENA A;  1G2D C;  2J7J A;  2RSI A;  2EN8 A;  2PRT A;  1X6F A;  2DGC A;  3VHT B;  2EMC A;  2YTN A;  2VRD A;  2EPX A;  2EPU A;  1NCS A;  2EM4 A;  1A1J A;  2WBT A;  1G2F C;  1ZR9 A;  4R2C A;  1A1I A;  2EOF A;  1WJP A;  2EM2 A;  2EL5 A;  4R2A A;  2CTD A;  4R2S A;  1X6H A;  4R2Q A;  1LLM C;  2EMF A;  1YUJ A;  2EOE A;  2DLQ A;  2I13 A;  2EP3 A;  5KL2 A;  1F2I G;  2YTP A;  2EM6 A;  2YU8 A;  2DLK A;  3M99 B;  2EN7 A;  1TF3 A;  2EPR A;  2EN6 A;  4F6N A;  4F6M A;  2E72 A;  2EMY A;  1KJK A;  2EM7 A;  1YUI A;  2JPA A;  2YRK A;  2EE8 A;  2YTI A;  4F2J C;  2HGH A;  4M9V C;  2EM5 A;  4IS1 C;  2EOY A;  2YRH A; 
#chains in the Genus database with same CATH topology
 4O4K A;  2YTJ A;  5KL4 A;  1N36 E;  2D9H A;  4LF6 E;  1EKZ A;  3C4T A;  2EL6 A;  3ADG A;  1EH7 A;  5IXM B;  4MLQ A;  3EPH A;  2RPC A;  1J26 A;  2LVH A;  4NXM E;  4R2E A;  3TQM A;  4GEQ B;  2YTD A;  2E5L E;  2JP9 A;  3EPJ A;  4BBY A;  5IV8 B;  2DB2 A;  2NAB A;  4JI8 E;  1AAY A;  2EM3 A;  1FKA E;  4DR7 E;  4LFC E;  4WFT A;  2UUB E;  1DI2 A;  2LUP B;  1XMO E;  1N33 E;  4DV6 E;  3MHH C;  1STU A;  2L2M A;  2JVA A;  4F9C B;  2YTO A;  2I9I A;  4DR3 E;  2EMB A;  2EMZ A;  5CFF E;  2EOH A;  3L00 A;  2KHX A;  3F6G A;  3RMP A;  4DV1 E;  3VYY A;  1N32 E;  4B3M E;  2ADR A;  5A6B D;  2EQ3 A;  2EZ6 A;  2ENH A;  2E1M A;  2LV2 A;  1TF6 A;  3KZZ A;  3J80 C;  1MGT A;  5AC4 A;  4JI0 E;  2EPL X;  1DQ3 A;  2WBS A;  2EPZ A;  1Z1B A;  4O24 A;  2GLI A;  2NA2 A;  2BBG A;  2EOM A;  2YTE A;  2NUE A;  2LO3 A;  4WYQ B;  2MDG A;  2EPA A;  1PDA A;  3KZY A;  4LTY A;  2EML A;  4R2R A;  2EPP A;  2EOX A;  5LLQ A;  4DUZ E;  2DRP A;  1UN6 B;  2EN2 A;  2L2K B;  2EMG A;  2EM0 A;  1A1K A;  2ENA A;  2LJH A;  2RSI A;  2JOX A;  2MDR A;  3BBG A;  3LML A;  2LE2 A;  2EMC A;  3T1H E;  2RQL A;  2K4V A;  4DR2 E;  1HNX E;  2V8Q B;  4DV4 E;  2WZO A;  1AH5 A;  4R2C A;  1A1I A;  2EOF A;  4JI2 E;  1WJP A;  4DV2 E;  3DF6 A;  4MLV A;  4LF8 E;  5AC5 A;  3BGH A;  1X6H A;  1LLM C;  4WPY A;  2ZM6 E;  2EMF A;  2H36 X;  1WHQ A;  1EH8 A;  1GTK A;  2EOE A;  2JR1 A;  5A6A A;  2EP3 A;  2EM6 A;  2YU8 A;  3M99 B;  1TF3 A;  2EPR A;  4F6N A;  3FIG A;  2E72 A;  2GPI A;  2V83 A;  4LF5 E;  3IWB A;  4N4R B;  2LTR A;  1T38 A;  1IBM E;  4L8N A;  1X49 A;  2HJJ A;  3H09 A;  4LU9 A;  4JI1 E;  2YT4 A;  2VQF E;  2YTI A;  2HGH A;  4M9V C;  4IS1 C;  2EOY A;  4DV5 E;  4DR6 E;  3ADJ A;  4J8Z A;  1XNR E;  2LCE A;  1RC7 A;  3BF2 A;  1ZBT A;  2YPN A;  4DV7 E;  4BMJ A;  4WXC A;  4RH8 A;  4DKK A;  5A6K A;  4OOG C;  2DSY A;  4DR4 E;  2EQ1 A;  3ECR A;  2L3J A;  1QU6 A;  3THO B;  1A1H A;  2EOS A;  1JK2 A;  2YU5 A;  2YRM A;  2LT7 A;  1X47 A;  4GZN C;  1RMD A;  2UXD E;  4F9B B;  1O0W A;  4K0K E;  2FV4 B;  2EMI A;  3JTZ A;  4O43 A;  1RQ0 A;  2FTX B;  2HHH E;  4JI6 E;  2EMX A;  2JY9 A;  5KL3 A;  1YYW A;  2EMH A;  4KZS A;  2EM9 A;  3BID A;  5LMU E;  1ZU1 A;  1JK1 A;  5LL6 R;  2ODR D;  2V87 A;  3IWD A;  5AE1 A;  1YZ9 A;  2RS7 A;  1T4O A;  2EPN A;  2EN3 A;  3EPK A;  4DR5 E;  2MKD A;  4WX9 A;  1UHZ A;  4RHB B;  2N3G A;  2DMY A;  4F9A B;  2EOZ A;  1X3C A;  2EQ0 A;  1YYO A;  2EL4 A;  2RS6 A;  4DUY E;  5A6B A;  1DGC A;  4ZYG A;  1I94 E;  2M1S A;  2IHR 1;  5KL6 A;  2EM8 A;  2CT1 A;  2UUC E;  5A69 A;  1P47 A;  1PJS A;  4B3S E;  2EMW A;  2Q8U A;  2J7J A;  2DIX A;  2EN8 A;  4DR1 E;  3JU0 A;  1L4S A;  5A6J A;  2EPX A;  1PJT A;  2B9D A;  1NCS A;  2L33 A;  1T39 A;  3OML A;  4R2A A;  2CTD A;  3AUZ A;  4ZYE A;  4R2Q A;  3C4B A;  1WRJ A;  2I13 A;  4R8O A;  4LFB E;  2YTP A;  4KWY A;  2LRS A;  2EN7 A;  3EQ1 A;  4JI5 E;  3AV0 A;  2LMZ A;  1KJK A;  4BC7 A;  2CPN A;  2JPA A;  4LF9 E;  2RTX A;  2EE8 A;  5ADZ A;  2MC5 A;  4P78 A;  2JYA A;  4F2J C;  1ZBQ A;  1XNQ E;  2YRH A;  2M7Q A;  3J7A G;  5A2Q C;  3HPS A;  2F4V E;  3VK6 A;  4GKK E;  1A1G A;  3QG5 C;  1X6E A;  4YY3 E;  2VQE E;  3HTX A;  4OX9 E;  4X9J A;  4HEI A;  2UXC E;  1X48 A;  2EOJ A;  4R03 A;  1XMQ E;  1YSA C;  1YPN A;  2V89 A;  4R2D A;  1EH6 A;  4YHH E;  1HR0 E;  4DV3 E;  2NUF A;  4JYA E;  4X65 E;  4LFA E;  3UK3 C;  1A1L A;  4R2P A;  3VYX A;  2M9A A;  4BCA A;  2DMI A;  2YTQ A;  4X66 E;  3MHS C;  4WSG A;  1B69 A;  4ZYD A;  3J81 C;  1HNZ E;  2HC5 A;  1IQO A;  2ELZ A;  2WBU A;  2MKN A;  1NEI A;  2R1F A;  3C6M A;  2EOQ A;  3F6H A;  5IWA E;  2YSP A;  1WHN A;  2JXP A;  2RSM A;  2NUG A;  2ELY A;  1N3G A;  2EMK A;  5TSE A;  4NHR A;  2K7I A;  2L3C A;  4ZYH A;  4M30 A;  4BS9 A;  4FK5 C;  5T6J A;  2KOU A;  2EJ4 A;  1A1F A;  4WSP A;  1KYQ A;  2BB8 A;  4NZV A;  1IQS A;  2EN4 A;  2EMA A;  1BBO A;  2UXB E;  3K6Q A;  2DGC A;  1X6F A;  2YTN A;  3KWR A;  2VRD A;  1GZ6 A;  2EPU A;  4BHB A;  4X64 E;  1J5E E;  4JI3 E;  1UIL A;  1WXR A;  1A1J A;  1ZR9 A;  1IBL E;  2KON A;  3C6K A;  2EM2 A;  4HTG A;  4R2S A;  4L5N C;  1F2I G;  5KL2 A;  5AE2 A;  4LF7 E;  2DLK A;  1HNW E;  2L2N A;  2L6M A;  3T1Y E;  2EPM X;  3DJW A;  4F6M A;  1YUI A;  2YRK A;  2UUA E;  2JOB A;  5F3W A;  3LLH A;  1YYK A;  4X62 E;  2WCC 3;  2EPC A;  2YTF A;  1QNT A;  1SR9 A;  1MEY C;  1UBD C;  4BHC A;  5KL7 A;  4O5G A;  2MC6 A;  1YFH A;  2CSH A;  4JI4 E;  2B7T A;  4IJD A;  3EPL A;  2ENC A;  3ADI A;  4JV5 E;  2YWQ A;  2GHF A;  3J7Y p;  3IWC A;  2YZT A;  1N34 E;  5IT9 C;  2FGG A;  2JWO A;  4LF4 E;  3P1X A;  4AQY E;  4WXD A;  1X5W A;  2LJU A;  1BBG A;  3THN A;  2EPO A;  4KHP E;  1T4L B;  1PKP A;  2G7H A;  2EOO A;  1ZAA C;  2EWL A;  1TN9 A;  3HPZ A;  3JAM C;  5AE3 A;  2F8B A;  2V86 A;  3HXL A;  2B7V A;  4DMI A;  2EOR A;  4DV0 E;  2EPK X;  2L92 A;  5FLX C;  2LUQ A;  2YTG A;  5DNY A;  2YSO A;  1IMU A;  4NXN E;  2UU9 E;  1FJG E;  4M2Z A;  2V88 A;  4Q28 A;  4F54 A;  5BR8 E;  4BC9 A;  2ODR C;  3ZOQ B;  2LTS A;  3ADL A;  1BB8 A;  4B3T E;  4GKJ E;  5KL5 A;  2EOI A;  2A25 A;  2B3T B;  1GQE A;  2EN1 A;  2N8X A;  2LBS B;  2VE7 C;  1G2D C;  2L8T A;  2PRT A;  1IBK E;  3VHT B;  4B3R E;  3OTO E;  2EM4 A;  5AAS A;  2WBT A;  1G2F C;  4X8W A;  3MSW A;  2EL5 A;  4Q35 B;  4JI7 E;  4P7D A;  2M4I A;  4TUI A;  1YUJ A;  1SFE A;  2DLQ A;  1PJQ A;  3HQ1 A;  2N3H A;  2VF1 A;  2EN6 A;  2EMY A;  2R76 A;  2EM7 A;  2V85 A;  4I8O A;  2EM5 A;  4M0V A;  5LMN E;  1T4N A;  4TUG A; 
#chains in the Genus database with same CATH homology
 2YTJ A;  5KL4 A;  2WCC 3;  2EPC A;  2YTF A;  2LCE A;  1A1G A;  2D9H A;  1X6E A;  1MEY C;  2EL6 A;  1UBD C;  3EPH A;  2RPC A;  2LVH A;  4R2E A;  4X9J A;  5KL7 A;  2EOJ A;  2EQ1 A;  2YTD A;  2JP9 A;  3EPJ A;  1YSA C;  2CSH A;  4R2D A;  4IJD A;  2NAB A;  3EPL A;  1AAY A;  2ENC A;  2EM3 A;  1A1H A;  2EOS A;  2GHF A;  1JK2 A;  2YU5 A;  2YRM A;  2LT7 A;  4GZN C;  3UK3 C;  1A1L A;  1RMD A;  4R2P A;  3MHH C;  2M9A A;  2YTO A;  2EMB A;  2EMI A;  2EMZ A;  2DMI A;  2EOH A;  1X5W A;  2YTQ A;  2EMX A;  3MHS C;  5KL3 A;  2EMH A;  2EM9 A;  2EOO A;  1ZAA C;  4WSG A;  1B69 A;  1ZU1 A;  1JK1 A;  1TN9 A;  2ADR A;  2EQ3 A;  2ELZ A;  2EOR A;  2ENH A;  2WBU A;  2LV2 A;  1TF6 A;  2MKN A;  2R1F A;  2EOQ A;  2WBS A;  2EN3 A;  3EPK A;  2YSP A;  2MKD A;  2EPZ A;  1Z1B A;  2YTG A;  2ELY A;  2YSO A;  2EMK A;  2GLI A;  2EOZ A;  1X3C A;  2EQ0 A;  2EOM A;  2YTE A;  2EL4 A;  1DGC A;  2LO3 A;  2MDG A;  2EPA A;  2EML A;  4R2R A;  4FK5 C;  5KL6 A;  1BB8 A;  2EJ4 A;  2EPP A;  2EOX A;  1A1F A;  2EM8 A;  2CT1 A;  2EOI A;  2A25 A;  5KL5 A;  2DRP A;  1UN6 B;  2BB8 A;  2EN2 A;  2EN1 A;  2EN4 A;  2EMA A;  1BBO A;  2EMG A;  2EM0 A;  1P47 A;  1A1K A;  2EMW A;  2ENA A;  1G2D C;  2J7J A;  2RSI A;  2EN8 A;  2PRT A;  1X6F A;  2DGC A;  3VHT B;  2EMC A;  2YTN A;  2VRD A;  2EPX A;  2EPU A;  1NCS A;  2EM4 A;  1A1J A;  2WBT A;  1G2F C;  1ZR9 A;  4R2C A;  1A1I A;  2EOF A;  1WJP A;  2EM2 A;  2EL5 A;  4R2A A;  2CTD A;  4R2S A;  1X6H A;  4R2Q A;  1LLM C;  2EMF A;  1YUJ A;  2EOE A;  2DLQ A;  2I13 A;  2EP3 A;  5KL2 A;  1F2I G;  2YTP A;  2EM6 A;  2YU8 A;  2DLK A;  3M99 B;  2EN7 A;  1TF3 A;  2EPR A;  2EN6 A;  4F6N A;  4F6M A;  2E72 A;  2EMY A;  1KJK A;  2EM7 A;  1YUI A;  2JPA A;  2YRK A;  2EE8 A;  2YTI A;  4F2J C;  2HGH A;  4M9V C;  2EM5 A;  4IS1 C;  2EOY A;  2YRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...