2YTNA

Solution structure of the c2h2 type zinc finger (region 732-764) of human zinc finger protein 347
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGKKPYKCNECGKVFTQNSHLARHRGIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 732-764) of human Zinc finger protein 347
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 347
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytnA01
2YTNA 2YSOA 2EOEA 2EN1A 2EMKA 1ZAAC 2EMIA 2EOJA 2EMWA 2ADRA 2EMZA 1ZR9A 2CT1A 2PRTA 1A1HA 1X5WA 2HGHA 1ZU1A 2EOOA 2YRHA 2VRDA 2EMYA 4R2QA 2EL5A 1G2DC 1BBOA 2EJ4A 2EM2A 2DMIA 2EORA 2I13A 2EOIA 2CTDA 2EPPA 2CSHA 3MHHC 1X3CA 2DLQA 2A25A 4R2RA 2MKDA 1Z1BA 1NCSA 1MEYC 4M9VC 2D9HA 2EE8A 1JK1A 2LO3A 1KJKA 2EOZA 1WJPA 2YTQA 4F6MA 2EM4A 2EOQA 2EL4A 2EN3A 2EN2A 4FK5C 3M99B 2BB8A 2EM8A 2M9AA 2ELZA 4R2EA 2EPCA 1YUIA 1DGCA 2J7JA 4IS1C 1RMDA 2YTOA 1TF6A 2EQ3A 2ENHA 2YTGA 2EL6A 2YTDA 3EPKA 2JP9A 3EPHA 1A1IA 2YTIA 2EOMA 2LT7A 2WBSA 2ENCA 2EN6A 4R2DA 1X6HA 2WBTA 2YTJA 2LV2A 2DLKA 2EPRA 4IJDA 2YTEA 1P47A 1A1JA 2DGCA 2EMCA 2YU5A 2EMBA 4F2JC 2RSIA 2EQ1A 2MKNA 2EMAA 2EMLA 1X6FA 2YRKA 1B69A 3UK3C 2YTPA 2GHFA 1TF3A 4F6NA 2EOSA 2EOFA 2EM7A 2EM3A 1YUJA 2EP3A 1A1LA 4R2CA 2DRPA 3EPLA 5KL5A 2EMHA 2EOYA 5KL3A 2EM6A 2YRMA 1G2FC 4R2PA 2NABA 1JK2A 4X9JA 2EMFA 2EPAA 3EPJA 1YSAC 1BB8A 2EQ0A 5KL2A 2E72A 4R2AA 2EM9A 2WBUA 4R2SA 2EMXA 3MHSC 2LCEA 2MDGA 2WCC3 1A1KA 2ELYA 2EPXA 5KL6A 2EOHA 2YTFA 2EOXA 4GZNC 2EN4A 2EMGA 5KL4A 2R1FA 2YSPA 3VHTB 2EM5A 1X6EA 5KL7A 2EPZA 1TN9A 1AAYA 2YU8A 4WSGA 1F2IG 2EN8A 2JPAA 1UN6B 1LLMC 1A1FA 2RPCA 2EN7A 2EM0A 1UBDC 2ENAA 2LVHA 2GLIA 1A1GA 2EPUA
chains in the Genus database with same CATH superfamily
2F8BA 3C4BA 2YSOA 1FKAE 2ODRD 4B3RE 5ADZA 1PJQA 2V87A 5IT9C 3AUZA 1ZAAC 4YY3E 4JI8E 2E1MA 2DIXA 3IWBA 2UUBE 1ZR9A 4LF9E 1N3GA 2EOOA 4DR1E 2HJJA 4MLQA 2EJ4A 2I13A 1T4NA 2CTDA 2EOIA 1T39A 2HC5A 2DLQA 4R2RA 2E5LE 4GKJE 2DMYA 1MEYC 2D9HA 4B3ME 1QU6A 2Q8UA 2MDRA 5LL6R 4J8ZA 2EOQA 2M7QA 2EN3A 5F3WA 2L92A 4KZSA 4BC9A 3C4TA 2EM8A 3C6KA 4ZYEA 2M9AA 4DUZE 4O4KA 1YUIA 2NUEA 2YTGA 2UU9E 4X62E 2MC6A 4DKKA 3AV0A 3QG5C 5T6JA 1X6HA 2YTJA 2LV2A 2EPRA 2YTEA 1A1JA 2DGCA 4ZYHA 1FJGE 2KONA 2VQFE 2MKNA 2LJHA 3ADGA 1X6FA 2YRKA 2F4VE 4WXCA 1TF3A 2N3HA 4F6NA 2EOFA 2EM7A 2EM3A 1YUJA 1A1LA 4R2CA 3JTZA 2EMHA 2EOYA 2YRMA 4DR5E 1JK2A 2V85A 2L8TA 3LMLA 1BB8A 2V88A 4JI1E 5A6AA 3BGHA 4M30A 2B7TA 1UHZA 3HXLA 4DMIA 1YPNA 2EWLA 5IXMB 4DV4E 2HHHE 2WCC3 2MDGA 1A1KA 2ELYA 2EPXA 3THOB 5KL6A 2YTFA 4ZYDA 2EOXA 1O0WA 2EMGA 5KL4A 2RS7A 1YFHA 4WPYA 2EM5A 1X6EA 4HTGA 5KL7A 4BMJA 1AAYA 5A6JA 1PDAA 1HR0E 1WXRA 1A1FA 1YYKA 2RPCA 2EM0A 2ENAA 4WFTA 2EPMX 1J26A 4NZVA 4O43A 3VYXA 2RTXA 2EOEA 4ZYGA 2L33A 4LTYA 4JI3E 3F6GA 1EH6A 2EN1A 5AE1A 1SR9A 2L2KB 2ADRA 3ADJA 1YYOA 2PRTA 1X5WA 2HGHA 1HNZE 3TQMA 2VRDA 2KHXA 4K0KE 4DUYE 2KOUA 2EM2A 2EORA 4R03A 2EPPA 4JI6E 3IWCA 1X3CA 2A25A 2MKDA 1Z1BA 4JYAE 3K6QA 3T1YE 4P78A 4BBYA 3BBGA 2EOZA 1WJPA 2YTQA 3HPSA 4GKKE 2EN2A 4NXNE 3M99B 4F9CB 4LFBE 2ELZA 4R2EA 1GQEA 2DSYA 5A6BA 4IS1C 2N8XA 2EQ3A 1HNWE 3J80C 2YTIA 2YZTA 3LLHA 2WBSA 4DR7E 2UXCE 2L6MA 2EQ1A 2L3JA 2JXPA 1IBKE 1B69A 3UK3C 3ECRA 5A6KA 1T4OA 3DJWA 4JI5E 3OMLA 2UXDE 3THNA 3EPLA 5AC4A 1WRJA 1G2FC 1MGTA 5AE2A 3EPJA 2EMFA 2EPAA 4WX9A 5IV8B 2EQ0A 2L2MA 2V86A 5A6BD 4Q35B 2V89A 2RSMA 4X66E 2EZ6A 3P1XA 4DV1E 2UUAE 1QNTA 4LF7E 2V8QB 2WZOA 2I9IA 3HPZA 3DF6A 3J7Yp 4BC7A 2R1FA 2LJUA 1N32E 1SFEA 3HQ1A 2JWOA 4RHBB 4JI2E 1TN9A 4JI7E 4WSGA 2LRSA 2EN8A 1WHNA 2LUPB 3FIGA 4JI4E 1UN6B 2B7VA 2EN7A 4LF5E 3KZYA 2LVHA 3EQ1A 1A1GA 2EPUA 4O24A 4DR3E 4LU9A 4DR2E 5LMNE 3IWDA 1GTKA 1IQOA 2R76A 4DV5E 5BR8E 1A1HA 4BHCA 4R2QA 2JY9A 1G2DC 2EL5A 1BBOA 4YHHE 2VE7C 1IQSA 4WYQB 2RQLA 1UILA 2CSHA 4I8OA 1WHQA 4O5GA 3KZZA 1EKZA 4HEIA 4M2ZA 4F6MA 4RH8A 4DV2E 2YT4A 2EM4A 4DR4E 4JV5E 5AASA 3HTXA 1XMOE 2EPCA 1GZ6A 1DGCA 2J7JA 3F6HA 2YTOA 2FV4B 3EPKA 2JP9A 3VK6A 4TUIA 1A1IA 3J7AG 2LUQA 2B3TB 1J5EE 2ENCA 4DR6E 1PJSA 2ZM6E 1RQ0A 1P47A 3JU0A 2DLKA 2LMZA 1IBLE 4MLVA 3ADIA 2EMBA 4M0VA 4L5NC 2EMAA 3KWRA 4JI0E 2B9DA 2LTRA 5IWAE 4LFAE 5AE3A 2YTPA 2K7IA 1N33E 3RMPA 2EP3A 4DV7E 1RC7A 2LTSA 4B3TE 5FLXC 4AQYE 2EM6A 2MC5A 4R2PA 1EH8A 1YSAC 2JYAA 4DV0E 1ZBTA 5KL2A 3ADLA 2EPNA 1IMUA 2N3GA 4R2AA 4X65E 2EM9A 4R2SA 2UXBE 1X48A 1X49A 2JR1A 4OOGC 3MHSC 1KYQA 2LCEA 4KHPE 4F9AB 3VYYA 2EN4A 5A2QC 2UUCE 2YSPA 1N36E 4B3SE 2CPNA 2EPZA 1T4LB 4L8NA 4OX9E 2YU8A 1F2IG 2JPAA 1N34E 1XNRE 1BBGA 2GLIA 2YTNA 4NXME 2V83A 1EH7A 2EMKA 2EMIA 2EOJA 2EMWA 5CFFE 1T38A 2EMZA 4BS9A 2CT1A 1ZU1A 4TUGA 3BIDA 2YRHA 4WXDA 2EMYA 3MSWA 2DMIA 4BCAA 2BBGA 2K4VA 2M1SA 3MHHC 2VQEE 4R8OA 1NCSA 2H36X 4M9VC 2EE8A 2FGGA 1JK1A 1NEIA 2LO3A 2NA2A 3J81C 1XMQE 1KJKA 4F54A 2EL4A 3ZOQB 4FK5C 2BB8A 2L2NA 5AC5A 2M4IA 1RMDA 1TF6A 5LLQA 5DNYA 2YWQA 2ENHA 2EL6A 2YTDA 3EPHA 2JVAA 2EOMA 2EPKX 2LT7A 4LFCE 4NHRA 2ODRC 2FTXB 2EN6A 4R2DA 4DV6E 5LMUE 2WBTA 1PKPA 2LBSB 4IJDA 1PJTA 1X47A 1DQ3A 2EMCA 2YPNA 2YU5A 4F2JC 2RSIA 2EPLX 4P7DA 5TSEA 1DI2A 2EMLA 4X64E 1AH5A 1L4SA 2GHFA 2EOSA 1STUA 2GPIA 2NUFA 2DRPA 3C6MA 3H09A 5KL5A 3T1HE 2JOXA 5KL3A 3JAMC 4BHBA 5A69A 3OTOE 4LF6E 2LE2A 2NABA 4X9JA 2VF1A 4LF4E 1HNXE 1YZ9A 2E72A 4GEQB 2WBUA 2L3CA 4LF8E 2JOBA 4X8WA 2EMXA 1I94E 4WSPA 2IHR1 4DV3E 2EOHA 4GZNC 4F9BB 3VHTB 3BF2A 1XNQE 2EPOA 4KWYA 4Q28A 2RS6A 2DB2A 2G7HA 1ZBQA 1LLMC 4N4RB 3L00A 1UBDC 1IBME 1YYWA 2NUGA
chains in the Genus database with same CATH topology
2YTNA 2YSOA 2EOEA 2EN1A 2EMKA 1ZAAC 2EMIA 2EOJA 2EMWA 2ADRA 2EMZA 1ZR9A 2CT1A 2PRTA 1A1HA 1X5WA 2HGHA 1ZU1A 2EOOA 2YRHA 2VRDA 2EMYA 4R2QA 2EL5A 1G2DC 1BBOA 2EJ4A 2EM2A 2DMIA 2EORA 2I13A 2EOIA 2CTDA 2EPPA 2CSHA 3MHHC 1X3CA 2DLQA 2A25A 4R2RA 2MKDA 1Z1BA 1NCSA 1MEYC 4M9VC 2D9HA 2EE8A 1JK1A 2LO3A 1KJKA 2EOZA 1WJPA 2YTQA 4F6MA 2EM4A 2EOQA 2EL4A 2EN3A 2EN2A 4FK5C 3M99B 2BB8A 2EM8A 2M9AA 2ELZA 4R2EA 2EPCA 1YUIA 1DGCA 2J7JA 4IS1C 1RMDA 2YTOA 1TF6A 2EQ3A 2ENHA 2YTGA 2EL6A 2YTDA 3EPKA 2JP9A 3EPHA 1A1IA 2YTIA 2EOMA 2LT7A 2WBSA 2ENCA 2EN6A 4R2DA 1X6HA 2WBTA 2YTJA 2LV2A 2DLKA 2EPRA 4IJDA 2YTEA 1P47A 1A1JA 2DGCA 2EMCA 2YU5A 2EMBA 4F2JC 2RSIA 2EQ1A 2MKNA 2EMAA 2EMLA 1X6FA 2YRKA 1B69A 3UK3C 2YTPA 2GHFA 1TF3A 4F6NA 2EOSA 2EOFA 2EM7A 2EM3A 1YUJA 2EP3A 1A1LA 4R2CA 2DRPA 3EPLA 5KL5A 2EMHA 2EOYA 5KL3A 2EM6A 2YRMA 1G2FC 4R2PA 2NABA 1JK2A 4X9JA 2EMFA 2EPAA 3EPJA 1YSAC 1BB8A 2EQ0A 5KL2A 2E72A 4R2AA 2EM9A 2WBUA 4R2SA 2EMXA 3MHSC 2LCEA 2MDGA 2WCC3 1A1KA 2ELYA 2EPXA 5KL6A 2EOHA 2YTFA 2EOXA 4GZNC 2EN4A 2EMGA 5KL4A 2R1FA 2YSPA 3VHTB 2EM5A 1X6EA 5KL7A 2EPZA 1TN9A 1AAYA 2YU8A 4WSGA 1F2IG 2EN8A 2JPAA 1UN6B 1LLMC 1A1FA 2RPCA 2EN7A 2EM0A 1UBDC 2ENAA 2LVHA 2GLIA 1A1GA 2EPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTN A;  2YSO A;  2EOE A;  2EN1 A;  2EMK A;  1ZAA C;  2EMI A;  2EOJ A;  2EMW A;  2ADR A;  2EMZ A;  1ZR9 A;  2CT1 A;  2PRT A;  1A1H A;  1X5W A;  2HGH A;  1ZU1 A;  2EOO A;  2YRH A;  2VRD A;  2EMY A;  4R2Q A;  2EL5 A;  1G2D C;  1BBO A;  2EJ4 A;  2EM2 A;  2DMI A;  2EOR A;  2I13 A;  2EOI A;  2CTD A;  2EPP A;  2CSH A;  3MHH C;  1X3C A;  2DLQ A;  2A25 A;  4R2R A;  2MKD A;  1Z1B A;  1NCS A;  1MEY C;  4M9V C;  2D9H A;  2EE8 A;  1JK1 A;  2LO3 A;  1KJK A;  2EOZ A;  1WJP A;  2YTQ A;  4F6M A;  2EM4 A;  2EOQ A;  2EL4 A;  2EN3 A;  2EN2 A;  4FK5 C;  3M99 B;  2BB8 A;  2EM8 A;  2M9A A;  2ELZ A;  4R2E A;  2EPC A;  1YUI A;  1DGC A;  2J7J A;  4IS1 C;  1RMD A;  2YTO A;  1TF6 A;  2EQ3 A;  2ENH A;  2YTG A;  2EL6 A;  2YTD A;  3EPK A;  2JP9 A;  3EPH A;  1A1I A;  2YTI A;  2EOM A;  2LT7 A;  2WBS A;  2ENC A;  2EN6 A;  4R2D A;  1X6H A;  2WBT A;  2YTJ A;  2LV2 A;  2DLK A;  2EPR A;  4IJD A;  2YTE A;  1P47 A;  1A1J A;  2DGC A;  2EMC A;  2YU5 A;  2EMB A;  4F2J C;  2RSI A;  2EQ1 A;  2MKN A;  2EMA A;  2EML A;  1X6F A;  2YRK A;  1B69 A;  3UK3 C;  2YTP A;  2GHF A;  1TF3 A;  4F6N A;  2EOS A;  2EOF A;  2EM7 A;  2EM3 A;  1YUJ A;  2EP3 A;  1A1L A;  4R2C A;  2DRP A;  3EPL A;  5KL5 A;  2EMH A;  2EOY A;  5KL3 A;  2EM6 A;  2YRM A;  1G2F C;  4R2P A;  2NAB A;  1JK2 A;  4X9J A;  2EMF A;  2EPA A;  3EPJ A;  1YSA C;  1BB8 A;  2EQ0 A;  5KL2 A;  2E72 A;  4R2A A;  2EM9 A;  2WBU A;  4R2S A;  2EMX A;  3MHS C;  2LCE A;  2MDG A;  2WCC 3;  1A1K A;  2ELY A;  2EPX A;  5KL6 A;  2EOH A;  2YTF A;  2EOX A;  4GZN C;  2EN4 A;  2EMG A;  5KL4 A;  2R1F A;  2YSP A;  3VHT B;  2EM5 A;  1X6E A;  5KL7 A;  2EPZ A;  1TN9 A;  1AAY A;  2YU8 A;  4WSG A;  1F2I G;  2EN8 A;  2JPA A;  1UN6 B;  1LLM C;  1A1F A;  2RPC A;  2EN7 A;  2EM0 A;  1UBD C;  2ENA A;  2LVH A;  2GLI A;  1A1G A;  2EPU A; 
#chains in the Genus database with same CATH topology
 2F8B A;  3C4B A;  2YSO A;  1FKA E;  2ODR D;  4B3R E;  5ADZ A;  1PJQ A;  2V87 A;  5IT9 C;  3AUZ A;  1ZAA C;  4YY3 E;  4JI8 E;  2E1M A;  2DIX A;  3IWB A;  2UUB E;  1ZR9 A;  4LF9 E;  1N3G A;  2EOO A;  4DR1 E;  2HJJ A;  4MLQ A;  2EJ4 A;  2I13 A;  1T4N A;  2CTD A;  2EOI A;  1T39 A;  2HC5 A;  2DLQ A;  4R2R A;  2E5L E;  4GKJ E;  2DMY A;  1MEY C;  2D9H A;  4B3M E;  1QU6 A;  2Q8U A;  2MDR A;  5LL6 R;  4J8Z A;  2EOQ A;  2M7Q A;  2EN3 A;  5F3W A;  2L92 A;  4KZS A;  4BC9 A;  3C4T A;  2EM8 A;  3C6K A;  4ZYE A;  2M9A A;  4DUZ E;  4O4K A;  1YUI A;  2NUE A;  2YTG A;  2UU9 E;  4X62 E;  2MC6 A;  4DKK A;  3AV0 A;  3QG5 C;  5T6J A;  1X6H A;  2YTJ A;  2LV2 A;  2EPR A;  2YTE A;  1A1J A;  2DGC A;  4ZYH A;  1FJG E;  2KON A;  2VQF E;  2MKN A;  2LJH A;  3ADG A;  1X6F A;  2YRK A;  2F4V E;  4WXC A;  1TF3 A;  2N3H A;  4F6N A;  2EOF A;  2EM7 A;  2EM3 A;  1YUJ A;  1A1L A;  4R2C A;  3JTZ A;  2EMH A;  2EOY A;  2YRM A;  4DR5 E;  1JK2 A;  2V85 A;  2L8T A;  3LML A;  1BB8 A;  2V88 A;  4JI1 E;  5A6A A;  3BGH A;  4M30 A;  2B7T A;  1UHZ A;  3HXL A;  4DMI A;  1YPN A;  2EWL A;  5IXM B;  4DV4 E;  2HHH E;  2WCC 3;  2MDG A;  1A1K A;  2ELY A;  2EPX A;  3THO B;  5KL6 A;  2YTF A;  4ZYD A;  2EOX A;  1O0W A;  2EMG A;  5KL4 A;  2RS7 A;  1YFH A;  4WPY A;  2EM5 A;  1X6E A;  4HTG A;  5KL7 A;  4BMJ A;  1AAY A;  5A6J A;  1PDA A;  1HR0 E;  1WXR A;  1A1F A;  1YYK A;  2RPC A;  2EM0 A;  2ENA A;  4WFT A;  2EPM X;  1J26 A;  4NZV A;  4O43 A;  3VYX A;  2RTX A;  2EOE A;  4ZYG A;  2L33 A;  4LTY A;  4JI3 E;  3F6G A;  1EH6 A;  2EN1 A;  5AE1 A;  1SR9 A;  2L2K B;  2ADR A;  3ADJ A;  1YYO A;  2PRT A;  1X5W A;  2HGH A;  1HNZ E;  3TQM A;  2VRD A;  2KHX A;  4K0K E;  4DUY E;  2KOU A;  2EM2 A;  2EOR A;  4R03 A;  2EPP A;  4JI6 E;  3IWC A;  1X3C A;  2A25 A;  2MKD A;  1Z1B A;  4JYA E;  3K6Q A;  3T1Y E;  4P78 A;  4BBY A;  3BBG A;  2EOZ A;  1WJP A;  2YTQ A;  3HPS A;  4GKK E;  2EN2 A;  4NXN E;  3M99 B;  4F9C B;  4LFB E;  2ELZ A;  4R2E A;  1GQE A;  2DSY A;  5A6B A;  4IS1 C;  2N8X A;  2EQ3 A;  1HNW E;  3J80 C;  2YTI A;  2YZT A;  3LLH A;  2WBS A;  4DR7 E;  2UXC E;  2L6M A;  2EQ1 A;  2L3J A;  2JXP A;  1IBK E;  1B69 A;  3UK3 C;  3ECR A;  5A6K A;  1T4O A;  3DJW A;  4JI5 E;  3OML A;  2UXD E;  3THN A;  3EPL A;  5AC4 A;  1WRJ A;  1G2F C;  1MGT A;  5AE2 A;  3EPJ A;  2EMF A;  2EPA A;  4WX9 A;  5IV8 B;  2EQ0 A;  2L2M A;  2V86 A;  5A6B D;  4Q35 B;  2V89 A;  2RSM A;  4X66 E;  2EZ6 A;  3P1X A;  4DV1 E;  2UUA E;  1QNT A;  4LF7 E;  2V8Q B;  2WZO A;  2I9I A;  3HPZ A;  3DF6 A;  3J7Y p;  4BC7 A;  2R1F A;  2LJU A;  1N32 E;  1SFE A;  3HQ1 A;  2JWO A;  4RHB B;  4JI2 E;  1TN9 A;  4JI7 E;  4WSG A;  2LRS A;  2EN8 A;  1WHN A;  2LUP B;  3FIG A;  4JI4 E;  1UN6 B;  2B7V A;  2EN7 A;  4LF5 E;  3KZY A;  2LVH A;  3EQ1 A;  1A1G A;  2EPU A;  4O24 A;  4DR3 E;  4LU9 A;  4DR2 E;  5LMN E;  3IWD A;  1GTK A;  1IQO A;  2R76 A;  4DV5 E;  5BR8 E;  1A1H A;  4BHC A;  4R2Q A;  2JY9 A;  1G2D C;  2EL5 A;  1BBO A;  4YHH E;  2VE7 C;  1IQS A;  4WYQ B;  2RQL A;  1UIL A;  2CSH A;  4I8O A;  1WHQ A;  4O5G A;  3KZZ A;  1EKZ A;  4HEI A;  4M2Z A;  4F6M A;  4RH8 A;  4DV2 E;  2YT4 A;  2EM4 A;  4DR4 E;  4JV5 E;  5AAS A;  3HTX A;  1XMO E;  2EPC A;  1GZ6 A;  1DGC A;  2J7J A;  3F6H A;  2YTO A;  2FV4 B;  3EPK A;  2JP9 A;  3VK6 A;  4TUI A;  1A1I A;  3J7A G;  2LUQ A;  2B3T B;  1J5E E;  2ENC A;  4DR6 E;  1PJS A;  2ZM6 E;  1RQ0 A;  1P47 A;  3JU0 A;  2DLK A;  2LMZ A;  1IBL E;  4MLV A;  3ADI A;  2EMB A;  4M0V A;  4L5N C;  2EMA A;  3KWR A;  4JI0 E;  2B9D A;  2LTR A;  5IWA E;  4LFA E;  5AE3 A;  2YTP A;  2K7I A;  1N33 E;  3RMP A;  2EP3 A;  4DV7 E;  1RC7 A;  2LTS A;  4B3T E;  5FLX C;  4AQY E;  2EM6 A;  2MC5 A;  4R2P A;  1EH8 A;  1YSA C;  2JYA A;  4DV0 E;  1ZBT A;  5KL2 A;  3ADL A;  2EPN A;  1IMU A;  2N3G A;  4R2A A;  4X65 E;  2EM9 A;  4R2S A;  2UXB E;  1X48 A;  1X49 A;  2JR1 A;  4OOG C;  3MHS C;  1KYQ A;  2LCE A;  4KHP E;  4F9A B;  3VYY A;  2EN4 A;  5A2Q C;  2UUC E;  2YSP A;  1N36 E;  4B3S E;  2CPN A;  2EPZ A;  1T4L B;  4L8N A;  4OX9 E;  2YU8 A;  1F2I G;  2JPA A;  1N34 E;  1XNR E;  1BBG A;  2GLI A;  2YTN A;  4NXM E;  2V83 A;  1EH7 A;  2EMK A;  2EMI A;  2EOJ A;  2EMW A;  5CFF E;  1T38 A;  2EMZ A;  4BS9 A;  2CT1 A;  1ZU1 A;  4TUG A;  3BID A;  2YRH A;  4WXD A;  2EMY A;  3MSW A;  2DMI A;  4BCA A;  2BBG A;  2K4V A;  2M1S A;  3MHH C;  2VQE E;  4R8O A;  1NCS A;  2H36 X;  4M9V C;  2EE8 A;  2FGG A;  1JK1 A;  1NEI A;  2LO3 A;  2NA2 A;  3J81 C;  1XMQ E;  1KJK A;  4F54 A;  2EL4 A;  3ZOQ B;  4FK5 C;  2BB8 A;  2L2N A;  5AC5 A;  2M4I A;  1RMD A;  1TF6 A;  5LLQ A;  5DNY A;  2YWQ A;  2ENH A;  2EL6 A;  2YTD A;  3EPH A;  2JVA A;  2EOM A;  2EPK X;  2LT7 A;  4LFC E;  4NHR A;  2ODR C;  2FTX B;  2EN6 A;  4R2D A;  4DV6 E;  5LMU E;  2WBT A;  1PKP A;  2LBS B;  4IJD A;  1PJT A;  1X47 A;  1DQ3 A;  2EMC A;  2YPN A;  2YU5 A;  4F2J C;  2RSI A;  2EPL X;  4P7D A;  5TSE A;  1DI2 A;  2EML A;  4X64 E;  1AH5 A;  1L4S A;  2GHF A;  2EOS A;  1STU A;  2GPI A;  2NUF A;  2DRP A;  3C6M A;  3H09 A;  5KL5 A;  3T1H E;  2JOX A;  5KL3 A;  3JAM C;  4BHB A;  5A69 A;  3OTO E;  4LF6 E;  2LE2 A;  2NAB A;  4X9J A;  2VF1 A;  4LF4 E;  1HNX E;  1YZ9 A;  2E72 A;  4GEQ B;  2WBU A;  2L3C A;  4LF8 E;  2JOB A;  4X8W A;  2EMX A;  1I94 E;  4WSP A;  2IHR 1;  4DV3 E;  2EOH A;  4GZN C;  4F9B B;  3VHT B;  3BF2 A;  1XNQ E;  2EPO A;  4KWY A;  4Q28 A;  2RS6 A;  2DB2 A;  2G7H A;  1ZBQ A;  1LLM C;  4N4R B;  3L00 A;  1UBD C;  1IBM E;  1YYW A;  2NUG A; 
#chains in the Genus database with same CATH homology
 2YTN A;  2YSO A;  2EOE A;  2EN1 A;  2EMK A;  1ZAA C;  2EMI A;  2EOJ A;  2EMW A;  2ADR A;  2EMZ A;  1ZR9 A;  2CT1 A;  2PRT A;  1A1H A;  1X5W A;  2HGH A;  1ZU1 A;  2EOO A;  2YRH A;  2VRD A;  2EMY A;  4R2Q A;  2EL5 A;  1G2D C;  1BBO A;  2EJ4 A;  2EM2 A;  2DMI A;  2EOR A;  2I13 A;  2EOI A;  2CTD A;  2EPP A;  2CSH A;  3MHH C;  1X3C A;  2DLQ A;  2A25 A;  4R2R A;  2MKD A;  1Z1B A;  1NCS A;  1MEY C;  4M9V C;  2D9H A;  2EE8 A;  1JK1 A;  2LO3 A;  1KJK A;  2EOZ A;  1WJP A;  2YTQ A;  4F6M A;  2EM4 A;  2EOQ A;  2EL4 A;  2EN3 A;  2EN2 A;  4FK5 C;  3M99 B;  2BB8 A;  2EM8 A;  2M9A A;  2ELZ A;  4R2E A;  2EPC A;  1YUI A;  1DGC A;  2J7J A;  4IS1 C;  1RMD A;  2YTO A;  1TF6 A;  2EQ3 A;  2ENH A;  2YTG A;  2EL6 A;  2YTD A;  3EPK A;  2JP9 A;  3EPH A;  1A1I A;  2YTI A;  2EOM A;  2LT7 A;  2WBS A;  2ENC A;  2EN6 A;  4R2D A;  1X6H A;  2WBT A;  2YTJ A;  2LV2 A;  2DLK A;  2EPR A;  4IJD A;  2YTE A;  1P47 A;  1A1J A;  2DGC A;  2EMC A;  2YU5 A;  2EMB A;  4F2J C;  2RSI A;  2EQ1 A;  2MKN A;  2EMA A;  2EML A;  1X6F A;  2YRK A;  1B69 A;  3UK3 C;  2YTP A;  2GHF A;  1TF3 A;  4F6N A;  2EOS A;  2EOF A;  2EM7 A;  2EM3 A;  1YUJ A;  2EP3 A;  1A1L A;  4R2C A;  2DRP A;  3EPL A;  5KL5 A;  2EMH A;  2EOY A;  5KL3 A;  2EM6 A;  2YRM A;  1G2F C;  4R2P A;  2NAB A;  1JK2 A;  4X9J A;  2EMF A;  2EPA A;  3EPJ A;  1YSA C;  1BB8 A;  2EQ0 A;  5KL2 A;  2E72 A;  4R2A A;  2EM9 A;  2WBU A;  4R2S A;  2EMX A;  3MHS C;  2LCE A;  2MDG A;  2WCC 3;  1A1K A;  2ELY A;  2EPX A;  5KL6 A;  2EOH A;  2YTF A;  2EOX A;  4GZN C;  2EN4 A;  2EMG A;  5KL4 A;  2R1F A;  2YSP A;  3VHT B;  2EM5 A;  1X6E A;  5KL7 A;  2EPZ A;  1TN9 A;  1AAY A;  2YU8 A;  4WSG A;  1F2I G;  2EN8 A;  2JPA A;  1UN6 B;  1LLM C;  1A1F A;  2RPC A;  2EN7 A;  2EM0 A;  1UBD C;  2ENA A;  2LVH A;  2GLI A;  1A1G A;  2EPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...