2YTNA

Solution structure of the c2h2 type zinc finger (region 732-764) of human zinc finger protein 347
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGKKPYKCNECGKVFTQNSHLARHRGIHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 347
publication title Solution structure of the C2H2 type zinc finger (region 732-764) of human Zinc finger protein 347
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ytnA01
1AAYA 1X5WA 2YSOA 3VHTB 2EM4A 2YRHA 2YRMA 4X9JA 2EM0A 2EOYA 2WBSA 1A1FA 2EMIA 2CTDA 1X6FA 3MHSC 2A25A 2EN7A 2MDGA 2E72A 1BB8A 3EPLA 2EM8A 4R2PA 2EMBA 4F6MA 2DMIA 2EPPA 2YU8A 2EOHA 2R1FA 4F6NA 1JK2A 2EMWA 1B69A 1TF6A 1ZAAC 1NCSA 2EL6A 1DGCA 2EORA 2EN2A 2MKNA 2EMXA 1YSAC 2EN4A 2RPCA 2DGCA 2YTFA 5KL5A 2EMKA 2LO3A 2EPCA 2BB8A 3EPHA 2EMGA 2EOQA 2YSPA 3MHHC 2EPUA 2EJ4A 1X3CA 4R2DA 2EM3A 5KL7A 2EOSA 2YTEA 2LVHA 2YTGA 1P47A 2EN6A 1MEYC 2EL5A 4R2EA 2ENHA 1WJPA 2LCEA 2YTQA 2YRKA 2EP3A 2EM6A 2GHFA 5KL2A 4IS1C 2EOXA 4GZNC 3UK3C 5KL4A 2EPRA 2EQ3A 2I13A 2ADRA 2YU5A 1YUIA 2EOIA 2J7JA 2EMZA 2CT1A 1A1GA 2VRDA 2EMLA 2M9AA 2RSIA 1F2IG 4R2SA 4F2JC 2YTPA 2GLIA 2EOEA 2EOOA 2MKDA 5KL6A 2EQ0A 1UBDC 2EMFA 1KJKA 1UN6B 2EN8A 1A1KA 2ENCA 1Z1BA 1TF3A 2EM9A 2LT7A 2EM7A 1JK1A 1X6EA 2DRPA 2EMYA 1A1JA 3M99B 2WBTA 2DLKA 4WSGA 2YTOA 2JP9A 2YTJA 1A1HA 1G2FC 2EMHA 4FK5C 1BBOA 2WBUA 2EN3A 2EPAA 4R2QA 2EPXA 2EN1A 2ENAA 3EPKA 2D9HA 2NABA 2CSHA 2EQ1A 2YTIA 2EMAA 2EMCA 4R2CA 2LV2A 3EPJA 4R2RA 2DLQA 1TN9A 2HGHA 2EOFA 1LLMC 2EM2A 2EE8A 2JPAA 2EPZA 1YUJA 1ZU1A 2EM5A 2WCC3 2EOMA 1G2DC 2YTNA 5KL3A 2EL4A 1A1LA 2YTDA 1A1IA 1RMDA 4R2AA 4IJDA 2EOJA 2PRTA 4M9VC 2ELYA 2EOZA 1X6HA 2ELZA 1ZR9A
chains in the Genus database with same CATH superfamily
4KZSA 1IMUA 2NA2A 5ADZA 4DR6E 2DMYA 1A1FA 2EMIA 2DB2A 1X6FA 4F54A 2YPNA 2MC6A 1BB8A 4DKKA 2DMIA 4M0VA 1JK2A 2ODRD 4JI1E 2L2KB 4DUYE 2V89A 1YYWA 2ELZA 5A6AA 3ADLA 3EQ1A 1XNRE 3T1YE 1YSAC 5IV8B 2DGCA 2YTFA 3ECRA 4TUGA 4R8OA 3THNA 5A69A 1ZBQA 2EPUA 2LVHA 4TUIA 4DMIA 2YTGA 1J5EE 4BS9A 2HJJA 1MEYC 2EL5A 4R2EA 2NUEA 2Q8UA 2LCEA 2YTQA 4WFTA 3IWCA 4WYQB 2EPRA 2L3JA 2V87A 2JXPA 2GPIA 2CT1A 2LE2A 4DV4E 2LMZA 2LRSA 4JI8E 1YYOA 4LF9E 2L6MA 4R03A 2GLIA 1BBGA 1YFHA 2MKDA 3HPSA 2EMFA 4L8NA 1WHQA 5AC4A 4O5GA 1YPNA 1UN6B 2EN8A 2K4VA 2KONA 2LT7A 2EM7A 1JK1A 1X6EA 1T4LB 2WBTA 4WSGA 4NHRA 3ADGA 4GKKE 2EMHA 1GZ6A 4F9CB 4R2QA 2EPXA 1HNWE 1GTKA 2LJHA 2D9HA 2FTXB 2M4IA 2EQ1A 2YTIA 4R2CA 5LMUE 5IWAE 4LF6E 2HGHA 3BBGA 2LUPB 3KZZA 2VQEE 3C6MA 1HNZE 4I8OA 2HHHE 1O0WA 2EOMA 2WCC3 2JY9A 4DV5E 4X62E 3LMLA 1A1LA 1RMDA 4M9VC 2EOZA 1X6HA 3C4TA 2FGGA 1AAYA 3OMLA 3DF6A 1NEIA 4WXDA 5LLQA 3C4BA 1SR9A 5A6KA 1T4NA 2EM0A 2EOYA 2V86A 4DV6E 4NZVA 5AE2A 2WZOA 4LF5E 2EN7A 2E72A 1T4OA 2EPNA 1X48A 3ZOQB 2EMBA 3DJWA 2R76A 2EPPA 2EOHA 1TF6A 2B7TA 2EMWA 2EL6A 5A6BD 2EN2A 3VK6A 1WXRA 4JYAE 5DNYA 2JOXA 1FKAE 4KHPE 2EMXA 2RPCA 1L4SA 4BMJA 2EMKA 2EPCA 3VYXA 4JV5E 2EPLX 4O24A 4DV2E 1X47A 4OOGC 2ENHA 3BF2A 1WJPA 3LLHA 2YRKA 2EP3A 4IS1C 2GHFA 4LTYA 1EKZA 5LL6R 2EWLA 2EQ3A 2VE7C 3KWRA 2I13A 4M2ZA 2K7IA 1J26A 2J7JA 2EMZA 1A1GA 2YWQA 4M30A 1PJSA 2KHXA 2M9AA 2RSIA 1F2IG 4F2JC 2IHR1 4F9BB 2EOOA 3P1XA 2EZ6A 1WHNA 1UBDC 2KOUA 1KJKA 2I9IA 2JVAA 2YT4A 2L92A 1HR0E 1KYQA 1PKPA 2UXCE 1IBLE 2DRPA 4ZYGA 3IWDA 4BHBA 4LF7E 4LFBE 4RH8A 4LFAE 4K0KE 1DI2A 4JI3E 1PJQA 1EH7A 2EN3A 2WBUA 2F8BA 2NABA 2E1MA 2EMAA 2EMCA 2NUGA 4R2RA 4DR3E 4N4RB 1TN9A 5BR8E 1LLMC 4BBYA 5IT9C 2FV4B 4WSPA 2EE8A 2EPZA 4DR4E 2UUBE 2EM5A 2RS7A 2V83A 4F9AB 3TQMA 4DR5E 2RTXA 5KL3A 2PRTA 1YYKA 2EOJA 1ZR9A 2JWOA 3MSWA 5IXMB 5FLXC 2JYAA 2RS6A 1X5WA 4RHBB 4GEQB 3K6QA 1N36E 2EM4A 4X9JA 4YHHE 3T1HE 1T39A 4JI6E 4DV0E 4B3RE 4NXNE 3EPLA 3THOB 1RQ0A 2EM8A 4HTGA 4F6MA 2YU8A 1ZAAC 1DGCA 2EPKX 2UUCE 2EORA 4HEIA 3AUZA 1PDAA 4P78A 2EN4A 5KL5A 1DQ3A 2LO3A 4JI4E 2B7VA 3EPHA 2YSPA 3MHHC 2EJ4A 1X3CA 4R2DA 5KL7A 2EOSA 5AASA 2JR1A 2LJUA 4JI5E 3J7Yp 4GZNC 2L3CA 4ZYHA 4JI7E 3UK3C 4BHCA 4B3SE 2ADRA 2YU5A 1YUIA 2LTRA 2L2MA 1QU6A 3HXLA 3JAMC 1RC7A 2LUQA 4LU9A 4MLQA 1PJTA 2L2NA 4LF8E 4AQYE 2DIXA 2ODRC 4NXME 4ZYDA 2N3GA 4MLVA 4X65E 5AE1A 2EM9A 4P7DA 4WX9A 2EMYA 1YZ9A 3M99B 3BGHA 2BBGA 2DLKA 2V85A 2YTOA 2L33A 3FIGA 2JP9A 2CPNA 2YTJA 3AV0A 1A1HA 4B3TE 3QG5C 4Q35B 1GQEA 3HQ1A 4FK5C 1BBOA 1IQOA 1I94E 1N34E 1AH5A 3VYYA 4X66E 2ENAA 1N33E 2M7QA 2EPMX 3F6HA 2MDRA 4Q28A 2RQLA 5LMNE 2LV2A 4BC7A 2N8XA 2EOFA 2HC5A 2JOBA 2G7HA 1IQSA 4DR1E 2EM2A 1YUJA 5CFFE 5A2QC 3J7AG 4X8WA 2UXBE 1G2DC 4LF4E 2EL4A 3J80C 2YTDA 1A1IA 4X64E 2L8TA 4ZYEA 2VF1A 2V88A 1IBME 4GKJE 3JU0A 1MGTA 1X49A 2YSOA 2E5LE 3VHTB 3L00A 2YZTA 2YRHA 2YRMA 2LTSA 4B3ME 2WBSA 2CTDA 3F6GA 3MHSC 2A25A 4WXCA 2MDGA 4JI0E 4J8ZA 4R2PA 1EH8A 4BC9A 1QNTA 4F6NA 2R1FA 1N3GA 1IBKE 1NCSA 4DR7E 2LBSB 2NUFA 4LFCE 1SFEA 3OTOE 2MKNA 2UXDE 3HTXA 1N32E 3ADJA 2BB8A 2EMGA 1ZBTA 2EOQA 3J81C 2F4VE 2EM3A 2YTEA 4BCAA 3JTZA 2M1SA 1P47A 2EN6A 1FJGE 4DR2E 3H09A 1WRJA 2EM6A 5KL2A 1XMOE 2EOXA 5KL4A 2B9DA 3HPZA 2ZM6E 4KWYA 2EOIA 5A6JA 2EPOA 2VRDA 2N3HA 2UUAE 2V8QB 2EMLA 1EH6A 3C6KA 5AE3A 2DSYA 4WPYA 4R2SA 3KZYA 4OX9E 2YTPA 2EOEA 5KL6A 2EQ0A 3RMPA 2MC5A 4JI2E 4O43A 1A1KA 2ENCA 1Z1BA 1TF3A 2RSMA 1T38A 3ADIA 1A1JA 4DV1E 1HNXE 2UU9E 3IWBA 2H36X 2B3TB 1G2FC 2EPAA 5TSEA 2EN1A 3EPKA 5A6BA 1UILA 2VQFE 2CSHA 1XMQE 3EPJA 2DLQA 4DUZE 4O4KA 1XNQE 2JPAA 5F3WA 1ZU1A 5AC5A 5T6JA 4DV7E 1STUA 4YY3E 4R2AA 4IJDA 4DV3E 2ELYA 3BIDA 1B69A 2YTNA 4L5NC 1UHZA
chains in the Genus database with same CATH topology
1AAYA 1X5WA 2YSOA 3VHTB 2EM4A 2YRHA 2YRMA 4X9JA 2EM0A 2EOYA 2WBSA 1A1FA 2EMIA 2CTDA 1X6FA 3MHSC 2A25A 2EN7A 2MDGA 2E72A 1BB8A 3EPLA 2EM8A 4R2PA 2EMBA 4F6MA 2DMIA 2EPPA 2YU8A 2EOHA 2R1FA 4F6NA 1JK2A 2EMWA 1B69A 1TF6A 1ZAAC 1NCSA 2EL6A 1DGCA 2EORA 2EN2A 2MKNA 2EMXA 1YSAC 2EN4A 2RPCA 2DGCA 2YTFA 5KL5A 2EMKA 2LO3A 2EPCA 2BB8A 3EPHA 2EMGA 2EOQA 2YSPA 3MHHC 2EPUA 2EJ4A 1X3CA 4R2DA 2EM3A 5KL7A 2EOSA 2YTEA 2LVHA 2YTGA 1P47A 2EN6A 1MEYC 2EL5A 4R2EA 2ENHA 1WJPA 2LCEA 2YTQA 2YRKA 2EP3A 2EM6A 2GHFA 5KL2A 4IS1C 2EOXA 4GZNC 3UK3C 5KL4A 2EPRA 2EQ3A 2I13A 2ADRA 2YU5A 1YUIA 2EOIA 2J7JA 2EMZA 2CT1A 1A1GA 2VRDA 2EMLA 2M9AA 2RSIA 1F2IG 4R2SA 4F2JC 2YTPA 2GLIA 2EOEA 2EOOA 2MKDA 5KL6A 2EQ0A 1UBDC 2EMFA 1KJKA 1UN6B 2EN8A 1A1KA 2ENCA 1Z1BA 1TF3A 2EM9A 2LT7A 2EM7A 1JK1A 1X6EA 2DRPA 2EMYA 1A1JA 3M99B 2WBTA 2DLKA 4WSGA 2YTOA 2JP9A 2YTJA 1A1HA 1G2FC 2EMHA 4FK5C 1BBOA 2WBUA 2EN3A 2EPAA 4R2QA 2EPXA 2EN1A 2ENAA 3EPKA 2D9HA 2NABA 2CSHA 2EQ1A 2YTIA 2EMAA 2EMCA 4R2CA 2LV2A 3EPJA 4R2RA 2DLQA 1TN9A 2HGHA 2EOFA 1LLMC 2EM2A 2EE8A 2JPAA 2EPZA 1YUJA 1ZU1A 2EM5A 2WCC3 2EOMA 1G2DC 2YTNA 5KL3A 2EL4A 1A1LA 2YTDA 1A1IA 1RMDA 4R2AA 4IJDA 2EOJA 2PRTA 4M9VC 2ELYA 2EOZA 1X6HA 2ELZA 1ZR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AAY A;  1X5W A;  2YSO A;  3VHT B;  2EM4 A;  2YRH A;  2YRM A;  4X9J A;  2EM0 A;  2EOY A;  2WBS A;  1A1F A;  2EMI A;  2CTD A;  1X6F A;  3MHS C;  2A25 A;  2EN7 A;  2MDG A;  2E72 A;  1BB8 A;  3EPL A;  2EM8 A;  4R2P A;  2EMB A;  4F6M A;  2DMI A;  2EPP A;  2YU8 A;  2EOH A;  2R1F A;  4F6N A;  1JK2 A;  2EMW A;  1B69 A;  1TF6 A;  1ZAA C;  1NCS A;  2EL6 A;  1DGC A;  2EOR A;  2EN2 A;  2MKN A;  2EMX A;  1YSA C;  2EN4 A;  2RPC A;  2DGC A;  2YTF A;  5KL5 A;  2EMK A;  2LO3 A;  2EPC A;  2BB8 A;  3EPH A;  2EMG A;  2EOQ A;  2YSP A;  3MHH C;  2EPU A;  2EJ4 A;  1X3C A;  4R2D A;  2EM3 A;  5KL7 A;  2EOS A;  2YTE A;  2LVH A;  2YTG A;  1P47 A;  2EN6 A;  1MEY C;  2EL5 A;  4R2E A;  2ENH A;  1WJP A;  2LCE A;  2YTQ A;  2YRK A;  2EP3 A;  2EM6 A;  2GHF A;  5KL2 A;  4IS1 C;  2EOX A;  4GZN C;  3UK3 C;  5KL4 A;  2EPR A;  2EQ3 A;  2I13 A;  2ADR A;  2YU5 A;  1YUI A;  2EOI A;  2J7J A;  2EMZ A;  2CT1 A;  1A1G A;  2VRD A;  2EML A;  2M9A A;  2RSI A;  1F2I G;  4R2S A;  4F2J C;  2YTP A;  2GLI A;  2EOE A;  2EOO A;  2MKD A;  5KL6 A;  2EQ0 A;  1UBD C;  2EMF A;  1KJK A;  1UN6 B;  2EN8 A;  1A1K A;  2ENC A;  1Z1B A;  1TF3 A;  2EM9 A;  2LT7 A;  2EM7 A;  1JK1 A;  1X6E A;  2DRP A;  2EMY A;  1A1J A;  3M99 B;  2WBT A;  2DLK A;  4WSG A;  2YTO A;  2JP9 A;  2YTJ A;  1A1H A;  1G2F C;  2EMH A;  4FK5 C;  1BBO A;  2WBU A;  2EN3 A;  2EPA A;  4R2Q A;  2EPX A;  2EN1 A;  2ENA A;  3EPK A;  2D9H A;  2NAB A;  2CSH A;  2EQ1 A;  2YTI A;  2EMA A;  2EMC A;  4R2C A;  2LV2 A;  3EPJ A;  4R2R A;  2DLQ A;  1TN9 A;  2HGH A;  2EOF A;  1LLM C;  2EM2 A;  2EE8 A;  2JPA A;  2EPZ A;  1YUJ A;  1ZU1 A;  2EM5 A;  2WCC 3;  2EOM A;  1G2D C;  2YTN A;  5KL3 A;  2EL4 A;  1A1L A;  2YTD A;  1A1I A;  1RMD A;  4R2A A;  4IJD A;  2EOJ A;  2PRT A;  4M9V C;  2ELY A;  2EOZ A;  1X6H A;  2ELZ A;  1ZR9 A; 
#chains in the Genus database with same CATH topology
 4KZS A;  1IMU A;  2NA2 A;  5ADZ A;  4DR6 E;  2DMY A;  1A1F A;  2EMI A;  2DB2 A;  1X6F A;  4F54 A;  2YPN A;  2MC6 A;  1BB8 A;  4DKK A;  2DMI A;  4M0V A;  1JK2 A;  2ODR D;  4JI1 E;  2L2K B;  4DUY E;  2V89 A;  1YYW A;  2ELZ A;  5A6A A;  3ADL A;  3EQ1 A;  1XNR E;  3T1Y E;  1YSA C;  5IV8 B;  2DGC A;  2YTF A;  3ECR A;  4TUG A;  4R8O A;  3THN A;  5A69 A;  1ZBQ A;  2EPU A;  2LVH A;  4TUI A;  4DMI A;  2YTG A;  1J5E E;  4BS9 A;  2HJJ A;  1MEY C;  2EL5 A;  4R2E A;  2NUE A;  2Q8U A;  2LCE A;  2YTQ A;  4WFT A;  3IWC A;  4WYQ B;  2EPR A;  2L3J A;  2V87 A;  2JXP A;  2GPI A;  2CT1 A;  2LE2 A;  4DV4 E;  2LMZ A;  2LRS A;  4JI8 E;  1YYO A;  4LF9 E;  2L6M A;  4R03 A;  2GLI A;  1BBG A;  1YFH A;  2MKD A;  3HPS A;  2EMF A;  4L8N A;  1WHQ A;  5AC4 A;  4O5G A;  1YPN A;  1UN6 B;  2EN8 A;  2K4V A;  2KON A;  2LT7 A;  2EM7 A;  1JK1 A;  1X6E A;  1T4L B;  2WBT A;  4WSG A;  4NHR A;  3ADG A;  4GKK E;  2EMH A;  1GZ6 A;  4F9C B;  4R2Q A;  2EPX A;  1HNW E;  1GTK A;  2LJH A;  2D9H A;  2FTX B;  2M4I A;  2EQ1 A;  2YTI A;  4R2C A;  5LMU E;  5IWA E;  4LF6 E;  2HGH A;  3BBG A;  2LUP B;  3KZZ A;  2VQE E;  3C6M A;  1HNZ E;  4I8O A;  2HHH E;  1O0W A;  2EOM A;  2WCC 3;  2JY9 A;  4DV5 E;  4X62 E;  3LML A;  1A1L A;  1RMD A;  4M9V C;  2EOZ A;  1X6H A;  3C4T A;  2FGG A;  1AAY A;  3OML A;  3DF6 A;  1NEI A;  4WXD A;  5LLQ A;  3C4B A;  1SR9 A;  5A6K A;  1T4N A;  2EM0 A;  2EOY A;  2V86 A;  4DV6 E;  4NZV A;  5AE2 A;  2WZO A;  4LF5 E;  2EN7 A;  2E72 A;  1T4O A;  2EPN A;  1X48 A;  3ZOQ B;  2EMB A;  3DJW A;  2R76 A;  2EPP A;  2EOH A;  1TF6 A;  2B7T A;  2EMW A;  2EL6 A;  5A6B D;  2EN2 A;  3VK6 A;  1WXR A;  4JYA E;  5DNY A;  2JOX A;  1FKA E;  4KHP E;  2EMX A;  2RPC A;  1L4S A;  4BMJ A;  2EMK A;  2EPC A;  3VYX A;  4JV5 E;  2EPL X;  4O24 A;  4DV2 E;  1X47 A;  4OOG C;  2ENH A;  3BF2 A;  1WJP A;  3LLH A;  2YRK A;  2EP3 A;  4IS1 C;  2GHF A;  4LTY A;  1EKZ A;  5LL6 R;  2EWL A;  2EQ3 A;  2VE7 C;  3KWR A;  2I13 A;  4M2Z A;  2K7I A;  1J26 A;  2J7J A;  2EMZ A;  1A1G A;  2YWQ A;  4M30 A;  1PJS A;  2KHX A;  2M9A A;  2RSI A;  1F2I G;  4F2J C;  2IHR 1;  4F9B B;  2EOO A;  3P1X A;  2EZ6 A;  1WHN A;  1UBD C;  2KOU A;  1KJK A;  2I9I A;  2JVA A;  2YT4 A;  2L92 A;  1HR0 E;  1KYQ A;  1PKP A;  2UXC E;  1IBL E;  2DRP A;  4ZYG A;  3IWD A;  4BHB A;  4LF7 E;  4LFB E;  4RH8 A;  4LFA E;  4K0K E;  1DI2 A;  4JI3 E;  1PJQ A;  1EH7 A;  2EN3 A;  2WBU A;  2F8B A;  2NAB A;  2E1M A;  2EMA A;  2EMC A;  2NUG A;  4R2R A;  4DR3 E;  4N4R B;  1TN9 A;  5BR8 E;  1LLM C;  4BBY A;  5IT9 C;  2FV4 B;  4WSP A;  2EE8 A;  2EPZ A;  4DR4 E;  2UUB E;  2EM5 A;  2RS7 A;  2V83 A;  4F9A B;  3TQM A;  4DR5 E;  2RTX A;  5KL3 A;  2PRT A;  1YYK A;  2EOJ A;  1ZR9 A;  2JWO A;  3MSW A;  5IXM B;  5FLX C;  2JYA A;  2RS6 A;  1X5W A;  4RHB B;  4GEQ B;  3K6Q A;  1N36 E;  2EM4 A;  4X9J A;  4YHH E;  3T1H E;  1T39 A;  4JI6 E;  4DV0 E;  4B3R E;  4NXN E;  3EPL A;  3THO B;  1RQ0 A;  2EM8 A;  4HTG A;  4F6M A;  2YU8 A;  1ZAA C;  1DGC A;  2EPK X;  2UUC E;  2EOR A;  4HEI A;  3AUZ A;  1PDA A;  4P78 A;  2EN4 A;  5KL5 A;  1DQ3 A;  2LO3 A;  4JI4 E;  2B7V A;  3EPH A;  2YSP A;  3MHH C;  2EJ4 A;  1X3C A;  4R2D A;  5KL7 A;  2EOS A;  5AAS A;  2JR1 A;  2LJU A;  4JI5 E;  3J7Y p;  4GZN C;  2L3C A;  4ZYH A;  4JI7 E;  3UK3 C;  4BHC A;  4B3S E;  2ADR A;  2YU5 A;  1YUI A;  2LTR A;  2L2M A;  1QU6 A;  3HXL A;  3JAM C;  1RC7 A;  2LUQ A;  4LU9 A;  4MLQ A;  1PJT A;  2L2N A;  4LF8 E;  4AQY E;  2DIX A;  2ODR C;  4NXM E;  4ZYD A;  2N3G A;  4MLV A;  4X65 E;  5AE1 A;  2EM9 A;  4P7D A;  4WX9 A;  2EMY A;  1YZ9 A;  3M99 B;  3BGH A;  2BBG A;  2DLK A;  2V85 A;  2YTO A;  2L33 A;  3FIG A;  2JP9 A;  2CPN A;  2YTJ A;  3AV0 A;  1A1H A;  4B3T E;  3QG5 C;  4Q35 B;  1GQE A;  3HQ1 A;  4FK5 C;  1BBO A;  1IQO A;  1I94 E;  1N34 E;  1AH5 A;  3VYY A;  4X66 E;  2ENA A;  1N33 E;  2M7Q A;  2EPM X;  3F6H A;  2MDR A;  4Q28 A;  2RQL A;  5LMN E;  2LV2 A;  4BC7 A;  2N8X A;  2EOF A;  2HC5 A;  2JOB A;  2G7H A;  1IQS A;  4DR1 E;  2EM2 A;  1YUJ A;  5CFF E;  5A2Q C;  3J7A G;  4X8W A;  2UXB E;  1G2D C;  4LF4 E;  2EL4 A;  3J80 C;  2YTD A;  1A1I A;  4X64 E;  2L8T A;  4ZYE A;  2VF1 A;  2V88 A;  1IBM E;  4GKJ E;  3JU0 A;  1MGT A;  1X49 A;  2YSO A;  2E5L E;  3VHT B;  3L00 A;  2YZT A;  2YRH A;  2YRM A;  2LTS A;  4B3M E;  2WBS A;  2CTD A;  3F6G A;  3MHS C;  2A25 A;  4WXC A;  2MDG A;  4JI0 E;  4J8Z A;  4R2P A;  1EH8 A;  4BC9 A;  1QNT A;  4F6N A;  2R1F A;  1N3G A;  1IBK E;  1NCS A;  4DR7 E;  2LBS B;  2NUF A;  4LFC E;  1SFE A;  3OTO E;  2MKN A;  2UXD E;  3HTX A;  1N32 E;  3ADJ A;  2BB8 A;  2EMG A;  1ZBT A;  2EOQ A;  3J81 C;  2F4V E;  2EM3 A;  2YTE A;  4BCA A;  3JTZ A;  2M1S A;  1P47 A;  2EN6 A;  1FJG E;  4DR2 E;  3H09 A;  1WRJ A;  2EM6 A;  5KL2 A;  1XMO E;  2EOX A;  5KL4 A;  2B9D A;  3HPZ A;  2ZM6 E;  4KWY A;  2EOI A;  5A6J A;  2EPO A;  2VRD A;  2N3H A;  2UUA E;  2V8Q B;  2EML A;  1EH6 A;  3C6K A;  5AE3 A;  2DSY A;  4WPY A;  4R2S A;  3KZY A;  4OX9 E;  2YTP A;  2EOE A;  5KL6 A;  2EQ0 A;  3RMP A;  2MC5 A;  4JI2 E;  4O43 A;  1A1K A;  2ENC A;  1Z1B A;  1TF3 A;  2RSM A;  1T38 A;  3ADI A;  1A1J A;  4DV1 E;  1HNX E;  2UU9 E;  3IWB A;  2H36 X;  2B3T B;  1G2F C;  2EPA A;  5TSE A;  2EN1 A;  3EPK A;  5A6B A;  1UIL A;  2VQF E;  2CSH A;  1XMQ E;  3EPJ A;  2DLQ A;  4DUZ E;  4O4K A;  1XNQ E;  2JPA A;  5F3W A;  1ZU1 A;  5AC5 A;  5T6J A;  4DV7 E;  1STU A;  4YY3 E;  4R2A A;  4IJD A;  4DV3 E;  2ELY A;  3BID A;  1B69 A;  2YTN A;  4L5N C;  1UHZ A; 
#chains in the Genus database with same CATH homology
 1AAY A;  1X5W A;  2YSO A;  3VHT B;  2EM4 A;  2YRH A;  2YRM A;  4X9J A;  2EM0 A;  2EOY A;  2WBS A;  1A1F A;  2EMI A;  2CTD A;  1X6F A;  3MHS C;  2A25 A;  2EN7 A;  2MDG A;  2E72 A;  1BB8 A;  3EPL A;  2EM8 A;  4R2P A;  2EMB A;  4F6M A;  2DMI A;  2EPP A;  2YU8 A;  2EOH A;  2R1F A;  4F6N A;  1JK2 A;  2EMW A;  1B69 A;  1TF6 A;  1ZAA C;  1NCS A;  2EL6 A;  1DGC A;  2EOR A;  2EN2 A;  2MKN A;  2EMX A;  1YSA C;  2EN4 A;  2RPC A;  2DGC A;  2YTF A;  5KL5 A;  2EMK A;  2LO3 A;  2EPC A;  2BB8 A;  3EPH A;  2EMG A;  2EOQ A;  2YSP A;  3MHH C;  2EPU A;  2EJ4 A;  1X3C A;  4R2D A;  2EM3 A;  5KL7 A;  2EOS A;  2YTE A;  2LVH A;  2YTG A;  1P47 A;  2EN6 A;  1MEY C;  2EL5 A;  4R2E A;  2ENH A;  1WJP A;  2LCE A;  2YTQ A;  2YRK A;  2EP3 A;  2EM6 A;  2GHF A;  5KL2 A;  4IS1 C;  2EOX A;  4GZN C;  3UK3 C;  5KL4 A;  2EPR A;  2EQ3 A;  2I13 A;  2ADR A;  2YU5 A;  1YUI A;  2EOI A;  2J7J A;  2EMZ A;  2CT1 A;  1A1G A;  2VRD A;  2EML A;  2M9A A;  2RSI A;  1F2I G;  4R2S A;  4F2J C;  2YTP A;  2GLI A;  2EOE A;  2EOO A;  2MKD A;  5KL6 A;  2EQ0 A;  1UBD C;  2EMF A;  1KJK A;  1UN6 B;  2EN8 A;  1A1K A;  2ENC A;  1Z1B A;  1TF3 A;  2EM9 A;  2LT7 A;  2EM7 A;  1JK1 A;  1X6E A;  2DRP A;  2EMY A;  1A1J A;  3M99 B;  2WBT A;  2DLK A;  4WSG A;  2YTO A;  2JP9 A;  2YTJ A;  1A1H A;  1G2F C;  2EMH A;  4FK5 C;  1BBO A;  2WBU A;  2EN3 A;  2EPA A;  4R2Q A;  2EPX A;  2EN1 A;  2ENA A;  3EPK A;  2D9H A;  2NAB A;  2CSH A;  2EQ1 A;  2YTI A;  2EMA A;  2EMC A;  4R2C A;  2LV2 A;  3EPJ A;  4R2R A;  2DLQ A;  1TN9 A;  2HGH A;  2EOF A;  1LLM C;  2EM2 A;  2EE8 A;  2JPA A;  2EPZ A;  1YUJ A;  1ZU1 A;  2EM5 A;  2WCC 3;  2EOM A;  1G2D C;  2YTN A;  5KL3 A;  2EL4 A;  1A1L A;  2YTD A;  1A1I A;  1RMD A;  4R2A A;  4IJD A;  2EOJ A;  2PRT A;  4M9V C;  2ELY A;  2EOZ A;  1X6H A;  2ELZ A;  1ZR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...