2YRHA

Solution structure of the c2h2-type zinc finger domain (699-729) from zinc finger protein 473
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
GSSGSSGKKPLVCNECGKTFRQSSCLSKHQRIHSGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2-type zinc finger domain (699-729) from zinc finger protein 473
rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Zinc finger protein 473
total genus 6
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2yrhA01
2PRTA 2LO3A 1X3CA 1TF6A 2CT1A 2EOFA 2MKDA 2YTOA 2EL5A 4R2AA 4F6NA 1AAYA 2D9HA 2EPCA 2LCEA 2M9AA 2EOXA 2EN8A 2WBSA 2EMXA 2YTEA 1A1JA 2EQ3A 1A1GA 1X5WA 1Z1BA 2EOYA 2YTFA 1G2FC 4GZNC 2YTGA 2DMIA 1X6HA 2CTDA 2EL6A 2DGCA 2EMBA 2YTNA 2EM6A 2EOIA 4F2JC 1A1HA 2YRHA 1UBDC 2JPAA 4X9JA 1TF3A 1TN9A 2EMIA 2EN2A 1ZR9A 1BB8A 4R2SA 1JK2A 2EQ0A 2DLQA 2EN4A 2BB8A 2EN7A 2GHFA 1NCSA 4R2RA 1A1IA 2EP3A 2GLIA 2YTQA 2DLKA 2EPRA 2YSOA 2YTDA 1ZAAC 2EM0A 2EN3A 1X6FA 1YSAC 4M9VC 2EOOA 1KJKA 2YU5A 2JP9A 2EPPA 4R2CA 2EMFA 1DGCA 2WBUA 2WBTA 4FK5C 2EOEA 2YU8A 1G2DC 2YTPA 3VHTB 1WJPA 3EPKA 2EMZA 2EM4A 4R2EA 1LLMC 2RPCA 1JK1A 3EPLA 2EORA 3UK3C 2EOHA 1RMDA 2A25A 2EM9A 2ENCA 4R2QA 2RSIA 2EMAA 2EPAA 2EOJA 1B69A 4WSGA 2EPXA 1MEYC 1YUIA 2NABA 2EM3A 3MHHC 2J7JA 3EPJA 2HGHA 2E72A 2ENAA 2EOQA 2LV2A 2CSHA 1A1FA 2MKNA 5KL4A 4IS1C 2EOZA 1A1KA 2R1FA 2ADRA 4IJDA 4R2PA 1P47A 2EQ1A 2I13A 2YTJA 2EMGA 1BBOA 5KL2A 2VRDA 5KL6A 2YSPA 1ZU1A 4R2DA 2EMWA 1UN6B 2LVHA 2EMYA 2EOSA 2YRMA 3MHSC 2WCC3 5KL3A 2EN1A 2MDGA 2EN6A 2LT7A 4F6MA 2EMKA 2ENHA 3M99B 2EM2A 5KL7A 1YUJA 2EE8A 2EL4A 2EMHA 2EPZA 3EPHA 2ELYA 2EMCA 2EPUA 1A1LA 2YTIA 2YRKA 2DRPA 1F2IG 2EJ4A 1X6EA 2EM8A 2ELZA 2EM5A 2EOMA 2EM7A 5KL5A 2EMLA
chains in the Genus database with same CATH superfamily
1PKPA 4LF9E 4DV3E 1T4LB 1WHNA 1YPNA 2CT1A 4F9AB 4JI3E 2FGGA 4R2AA 1ZBQA 4ZYGA 4LF5E 2NUEA 4WX9A 2M9AA 2EOXA 4KZSA 2WBSA 2NUFA 2EMXA 2YTEA 5A6AA 2EQ3A 2DMYA 2YT4A 4B3RE 2YTFA 1QU6A 3QG5C 4DV5E 4GZNC 2LBSB 4ZYHA 2LTRA 2CTDA 2N8XA 1T4OA 1DQ3A 1QNTA 1IMUA 2V88A 3J7AG 1A1HA 1XMOE 1UBDC 4X9JA 3BBGA 1TN9A 2EMIA 2EN2A 1ZR9A 2UUBE 2EQ0A 5LMUE 2GLIA 2EPRA 2UU9E 2EPOA 1YSAC 1UHZA 2JWOA 2JP9A 4DV2E 2EMFA 1DGCA 4YY3E 1STUA 2L2MA 2EOEA 3J81C 2GPIA 2YTPA 4DR3E 4AQYE 3VHTB 2B9DA 2EMZA 1T39A 2UXDE 1IQOA 4LF6E 1EH7A 5A2QC 4BS9A 3TQMA 2LUPB 5LL6R 2RSIA 5A6BD 1N32E 2EPAA 1FKAE 2JY9A 2VE7C 2L8TA 1YUIA 1IBLE 4M30A 2IHR1 4JI7E 2YZTA 3HQ1A 1YFHA 2RQLA 1HNZE 2LTSA 4GEQB 2NUGA 4TUIA 2ADRA 2I13A 4X66E 2V89A 5KL6A 4KWYA 2WZOA 2YSPA 4R2DA 1MGTA 2LJHA 4DV0E 2EOSA 3MHSC 2MDGA 4DMIA 1GTKA 2EMKA 2ENHA 2KHXA 5KL7A 1YUJA 2EPLX 5A6BA 1WRJA 3EPHA 2EMCA 4P78A 2MDRA 2JYAA 2V86A 2L33A 3BIDA 4B3TE 3ADIA 5AE1A 3C4BA 4B3ME 2PRTA 2LUQA 1X3CA 3J80C 2EOFA 2MKDA 2K7IA 4JI2E 4F6NA 5A69A 1AAYA 4O5GA 4JI0E 1T4NA 3ZOQB 4JV5E 2V8QB 3KZZA 2LCEA 2E1MA 3J7Yp 4LF4E 2RTXA 4B3SE 3OTOE 1X5WA 1Z1BA 4DR5E 5T6JA 4DR4E 4HEIA 1FJGE 1IBME 2ODRC 4O24A 5AE2A 2YTNA 4WFTA 2VQFE 2M7QA 2YRHA 2JPAA 1TF3A 1JK2A 4DV4E 4N4RB 3IWCA 3HXLA 1NCSA 4X64E 2MC6A 2BBGA 5AC4A 2I9IA 2KOUA 3T1YE 1ZAAC 2EM0A 2FV4B 3IWDA 2EN3A 4X65E 1BBGA 1KJKA 5AC5A 2EPPA 4R2CA 3ADLA 1RQ0A 2FTXB 1IQSA 2WBTA 1XMQE 1X47A 3IWBA 3EPKA 4GKJE 2L3JA 1EH8A 2RPCA 3L00A 1JK1A 2N3GA 1J26A 4JYAE 4JI6E 3UK3C 1PJQA 2DIXA 2ENCA 4R2QA 2UUAE 1HNWE 1B69A 3HTXA 3VYYA 3C6KA 5LMNE 2J7JA 5LLQA 2RS7A 4DKKA 3EPJA 2LE2A 2HGHA 2ENAA 4RHBB 4TUGA 4IS1C 5IWAE 1IBKE 1A1KA 2JR1A 2HHHE 1T38A 2L92A 4K0KE 4M0VA 2JXPA 1SR9A 2RS6A 2LVHA 2EMYA 4Q28A 2YRMA 3ECRA 2EN1A 2EN6A 3DF6A 4X8WA 4F6MA 4OOGC 4DUYE 2EL4A 2ELYA 2EPUA 4NXNE 2YTIA 3THNA 4KHPE 2DRPA 3JTZA 5AE3A 2E5LE 2HJJA 4F9CB 5KL5A 2LO3A 1TF6A 4R8OA 2G7HA 3MSWA 3ADJA 4LF8E 5F3WA 3H09A 2EPCA 5IV8B 2EN8A 4P7DA 1RC7A 2EPKX 2EPNA 5BR8E 4LF7E 1N33E 2EOYA 4L5NC 2DSYA 5IXMB 2MC5A 1L4SA 3F6HA 2YTGA 3ADGA 2DMIA 1X6HA 2LJUA 4F9BB 4DR2E 4DV6E 2EMBA 4I8OA 2DGCA 4F2JC 2EM6A 3JU0A 3LLHA 1GQEA 4NZVA 2EN7A 4BCAA 1A1IA 2YTQA 4DV1E 2DLKA 1KYQA 2YTDA 2UXCE 3P1XA 1X6FA 2EOOA 1N36E 1O0WA 1I94E 4HTGA 3HPSA 4F54A 4LFBE 4DR7E 2ZM6E 2YU8A 1ZBTA 1WJPA 3THOB 2EPMX 3DJWA 3VK6A 4OX9E 4DR6E 2N3HA 2L2KB 3KWRA 5IT9C 1WHQA 2EORA 2V83A 1RMDA 2A25A 4MLVA 3RMPA 2EOJA 3AUZA 4JI1E 4WSGA 1HNXE 2YWQA 3MHHC 3JAMC 3C4TA 2E72A 2EOQA 3BGHA 4BC7A 4ZYEA 5AASA 1A1FA 2MKNA 2YPNA 3AV0A 1PJSA 2NA2A 1N34E 2F4VE 2Q8UA 1EH6A 4IJDA 4R2PA 1P47A 2EQ1A 4M2ZA 2UXBE 1N3GA 3KZYA 2EMGA 4LU9A 4JI5E 1BBOA 5KL2A 2UUCE 3EQ1A 4NXME 1YZ9A 2EMWA 3BF2A 1UN6B 2WCC3 4BMJA 1AH5A 4WXCA 2ODRD 2LT7A 3M99B 2EM2A 2EPZA 2LMZA 1A1LA 1F2IG 2EJ4A 4R03A 1WXRA 2H36X 4YHHE 2EOMA 4L8NA 4WYQB 5TSEA 4DV7E 1X49A 4WXDA 5A6JA 2M1SA 2YTOA 2EL5A 2KONA 5A6KA 4NHRA 2D9HA 4LFAE 2B7TA 1XNQE 2EZ6A 1A1JA 1A1GA 4WSPA 4DR1E 1G2FC 1HR0E 4RH8A 2VQEE 2DB2A 3C6MA 2EL6A 2EOIA 2L2NA 4O43A 2R76A 1BB8A 2EWLA 4R2SA 1XNRE 2DLQA 2EN4A 2BB8A 2GHFA 3OMLA 4WPYA 4R2RA 2B7VA 2EP3A 1EKZA 4DUZE 2YSOA 4O4KA 4Q35B 4M9VC 2V87A 2YU5A 1PJTA 2WBUA 2L6MA 1PDAA 4FK5C 1YYOA 1YYKA 1G2DC 3LMLA 4LFCE 2K4VA 2L3CA 2EM4A 4R2EA 1LLMC 2JOXA 3EPLA 1YYWA 2JVAA 4ZYDA 2EOHA 2EM9A 3VYXA 2LRSA 4JI4E 2EMAA 2RSMA 4J8ZA 2V85A 4BHBA 5DNYA 2EPXA 2B3TB 1MEYC 2NABA 2EM3A 4GKKE 1J5EE 2CPNA 2LV2A 2CSHA 4JI8E 4LTYA 5KL4A 3K6QA 5ADZA 2EOZA 2R1FA 4BBYA 4X62E 2YTJA 2HC5A 2VF1A 3T1HE 2VRDA 1UILA 1ZU1A 1SFEA 1NEIA 2M4IA 1X48A 5KL3A 1DI2A 4MLQA 1GZ6A 5CFFE 3HPZA 2EE8A 4BHCA 2EMHA 2YRKA 1X6EA 3FIGA 2EM8A 2F8BA 2ELZA 2EM5A 3F6GA 2JOBA 2EM7A 4BC9A 5FLXC 2EMLA
chains in the Genus database with same CATH topology
2PRTA 2LO3A 1X3CA 1TF6A 2CT1A 2EOFA 2MKDA 2YTOA 2EL5A 4R2AA 4F6NA 1AAYA 2D9HA 2EPCA 2LCEA 2M9AA 2EOXA 2EN8A 2WBSA 2EMXA 2YTEA 1A1JA 2EQ3A 1A1GA 1X5WA 1Z1BA 2EOYA 2YTFA 1G2FC 4GZNC 2YTGA 2DMIA 1X6HA 2CTDA 2EL6A 2DGCA 2EMBA 2YTNA 2EM6A 2EOIA 4F2JC 1A1HA 2YRHA 1UBDC 2JPAA 4X9JA 1TF3A 1TN9A 2EMIA 2EN2A 1ZR9A 1BB8A 4R2SA 1JK2A 2EQ0A 2DLQA 2EN4A 2BB8A 2EN7A 2GHFA 1NCSA 4R2RA 1A1IA 2EP3A 2GLIA 2YTQA 2DLKA 2EPRA 2YSOA 2YTDA 1ZAAC 2EM0A 2EN3A 1X6FA 1YSAC 4M9VC 2EOOA 1KJKA 2YU5A 2JP9A 2EPPA 4R2CA 2EMFA 1DGCA 2WBUA 2WBTA 4FK5C 2EOEA 2YU8A 1G2DC 2YTPA 3VHTB 1WJPA 3EPKA 2EMZA 2EM4A 4R2EA 1LLMC 2RPCA 1JK1A 3EPLA 2EORA 3UK3C 2EOHA 1RMDA 2A25A 2EM9A 2ENCA 4R2QA 2RSIA 2EMAA 2EPAA 2EOJA 1B69A 4WSGA 2EPXA 1MEYC 1YUIA 2NABA 2EM3A 3MHHC 2J7JA 3EPJA 2HGHA 2E72A 2ENAA 2EOQA 2LV2A 2CSHA 1A1FA 2MKNA 5KL4A 4IS1C 2EOZA 1A1KA 2R1FA 2ADRA 4IJDA 4R2PA 1P47A 2EQ1A 2I13A 2YTJA 2EMGA 1BBOA 5KL2A 2VRDA 5KL6A 2YSPA 1ZU1A 4R2DA 2EMWA 1UN6B 2LVHA 2EMYA 2EOSA 2YRMA 3MHSC 2WCC3 5KL3A 2EN1A 2MDGA 2EN6A 2LT7A 4F6MA 2EMKA 2ENHA 3M99B 2EM2A 5KL7A 1YUJA 2EE8A 2EL4A 2EMHA 2EPZA 3EPHA 2ELYA 2EMCA 2EPUA 1A1LA 2YTIA 2YRKA 2DRPA 1F2IG 2EJ4A 1X6EA 2EM8A 2ELZA 2EM5A 2EOMA 2EM7A 5KL5A 2EMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PRT A;  2LO3 A;  1X3C A;  1TF6 A;  2CT1 A;  2EOF A;  2MKD A;  2YTO A;  2EL5 A;  4R2A A;  4F6N A;  1AAY A;  2D9H A;  2EPC A;  2LCE A;  2M9A A;  2EOX A;  2EN8 A;  2WBS A;  2EMX A;  2YTE A;  1A1J A;  2EQ3 A;  1A1G A;  1X5W A;  1Z1B A;  2EOY A;  2YTF A;  1G2F C;  4GZN C;  2YTG A;  2DMI A;  1X6H A;  2CTD A;  2EL6 A;  2DGC A;  2EMB A;  2YTN A;  2EM6 A;  2EOI A;  4F2J C;  1A1H A;  2YRH A;  1UBD C;  2JPA A;  4X9J A;  1TF3 A;  1TN9 A;  2EMI A;  2EN2 A;  1ZR9 A;  1BB8 A;  4R2S A;  1JK2 A;  2EQ0 A;  2DLQ A;  2EN4 A;  2BB8 A;  2EN7 A;  2GHF A;  1NCS A;  4R2R A;  1A1I A;  2EP3 A;  2GLI A;  2YTQ A;  2DLK A;  2EPR A;  2YSO A;  2YTD A;  1ZAA C;  2EM0 A;  2EN3 A;  1X6F A;  1YSA C;  4M9V C;  2EOO A;  1KJK A;  2YU5 A;  2JP9 A;  2EPP A;  4R2C A;  2EMF A;  1DGC A;  2WBU A;  2WBT A;  4FK5 C;  2EOE A;  2YU8 A;  1G2D C;  2YTP A;  3VHT B;  1WJP A;  3EPK A;  2EMZ A;  2EM4 A;  4R2E A;  1LLM C;  2RPC A;  1JK1 A;  3EPL A;  2EOR A;  3UK3 C;  2EOH A;  1RMD A;  2A25 A;  2EM9 A;  2ENC A;  4R2Q A;  2RSI A;  2EMA A;  2EPA A;  2EOJ A;  1B69 A;  4WSG A;  2EPX A;  1MEY C;  1YUI A;  2NAB A;  2EM3 A;  3MHH C;  2J7J A;  3EPJ A;  2HGH A;  2E72 A;  2ENA A;  2EOQ A;  2LV2 A;  2CSH A;  1A1F A;  2MKN A;  5KL4 A;  4IS1 C;  2EOZ A;  1A1K A;  2R1F A;  2ADR A;  4IJD A;  4R2P A;  1P47 A;  2EQ1 A;  2I13 A;  2YTJ A;  2EMG A;  1BBO A;  5KL2 A;  2VRD A;  5KL6 A;  2YSP A;  1ZU1 A;  4R2D A;  2EMW A;  1UN6 B;  2LVH A;  2EMY A;  2EOS A;  2YRM A;  3MHS C;  2WCC 3;  5KL3 A;  2EN1 A;  2MDG A;  2EN6 A;  2LT7 A;  4F6M A;  2EMK A;  2ENH A;  3M99 B;  2EM2 A;  5KL7 A;  1YUJ A;  2EE8 A;  2EL4 A;  2EMH A;  2EPZ A;  3EPH A;  2ELY A;  2EMC A;  2EPU A;  1A1L A;  2YTI A;  2YRK A;  2DRP A;  1F2I G;  2EJ4 A;  1X6E A;  2EM8 A;  2ELZ A;  2EM5 A;  2EOM A;  2EM7 A;  5KL5 A;  2EML A; 
#chains in the Genus database with same CATH topology
 1PKP A;  4LF9 E;  4DV3 E;  1T4L B;  1WHN A;  1YPN A;  2CT1 A;  4F9A B;  4JI3 E;  2FGG A;  4R2A A;  1ZBQ A;  4ZYG A;  4LF5 E;  2NUE A;  4WX9 A;  2M9A A;  2EOX A;  4KZS A;  2WBS A;  2NUF A;  2EMX A;  2YTE A;  5A6A A;  2EQ3 A;  2DMY A;  2YT4 A;  4B3R E;  2YTF A;  1QU6 A;  3QG5 C;  4DV5 E;  4GZN C;  2LBS B;  4ZYH A;  2LTR A;  2CTD A;  2N8X A;  1T4O A;  1DQ3 A;  1QNT A;  1IMU A;  2V88 A;  3J7A G;  1A1H A;  1XMO E;  1UBD C;  4X9J A;  3BBG A;  1TN9 A;  2EMI A;  2EN2 A;  1ZR9 A;  2UUB E;  2EQ0 A;  5LMU E;  2GLI A;  2EPR A;  2UU9 E;  2EPO A;  1YSA C;  1UHZ A;  2JWO A;  2JP9 A;  4DV2 E;  2EMF A;  1DGC A;  4YY3 E;  1STU A;  2L2M A;  2EOE A;  3J81 C;  2GPI A;  2YTP A;  4DR3 E;  4AQY E;  3VHT B;  2B9D A;  2EMZ A;  1T39 A;  2UXD E;  1IQO A;  4LF6 E;  1EH7 A;  5A2Q C;  4BS9 A;  3TQM A;  2LUP B;  5LL6 R;  2RSI A;  5A6B D;  1N32 E;  2EPA A;  1FKA E;  2JY9 A;  2VE7 C;  2L8T A;  1YUI A;  1IBL E;  4M30 A;  2IHR 1;  4JI7 E;  2YZT A;  3HQ1 A;  1YFH A;  2RQL A;  1HNZ E;  2LTS A;  4GEQ B;  2NUG A;  4TUI A;  2ADR A;  2I13 A;  4X66 E;  2V89 A;  5KL6 A;  4KWY A;  2WZO A;  2YSP A;  4R2D A;  1MGT A;  2LJH A;  4DV0 E;  2EOS A;  3MHS C;  2MDG A;  4DMI A;  1GTK A;  2EMK A;  2ENH A;  2KHX A;  5KL7 A;  1YUJ A;  2EPL X;  5A6B A;  1WRJ A;  3EPH A;  2EMC A;  4P78 A;  2MDR A;  2JYA A;  2V86 A;  2L33 A;  3BID A;  4B3T E;  3ADI A;  5AE1 A;  3C4B A;  4B3M E;  2PRT A;  2LUQ A;  1X3C A;  3J80 C;  2EOF A;  2MKD A;  2K7I A;  4JI2 E;  4F6N A;  5A69 A;  1AAY A;  4O5G A;  4JI0 E;  1T4N A;  3ZOQ B;  4JV5 E;  2V8Q B;  3KZZ A;  2LCE A;  2E1M A;  3J7Y p;  4LF4 E;  2RTX A;  4B3S E;  3OTO E;  1X5W A;  1Z1B A;  4DR5 E;  5T6J A;  4DR4 E;  4HEI A;  1FJG E;  1IBM E;  2ODR C;  4O24 A;  5AE2 A;  2YTN A;  4WFT A;  2VQF E;  2M7Q A;  2YRH A;  2JPA A;  1TF3 A;  1JK2 A;  4DV4 E;  4N4R B;  3IWC A;  3HXL A;  1NCS A;  4X64 E;  2MC6 A;  2BBG A;  5AC4 A;  2I9I A;  2KOU A;  3T1Y E;  1ZAA C;  2EM0 A;  2FV4 B;  3IWD A;  2EN3 A;  4X65 E;  1BBG A;  1KJK A;  5AC5 A;  2EPP A;  4R2C A;  3ADL A;  1RQ0 A;  2FTX B;  1IQS A;  2WBT A;  1XMQ E;  1X47 A;  3IWB A;  3EPK A;  4GKJ E;  2L3J A;  1EH8 A;  2RPC A;  3L00 A;  1JK1 A;  2N3G A;  1J26 A;  4JYA E;  4JI6 E;  3UK3 C;  1PJQ A;  2DIX A;  2ENC A;  4R2Q A;  2UUA E;  1HNW E;  1B69 A;  3HTX A;  3VYY A;  3C6K A;  5LMN E;  2J7J A;  5LLQ A;  2RS7 A;  4DKK A;  3EPJ A;  2LE2 A;  2HGH A;  2ENA A;  4RHB B;  4TUG A;  4IS1 C;  5IWA E;  1IBK E;  1A1K A;  2JR1 A;  2HHH E;  1T38 A;  2L92 A;  4K0K E;  4M0V A;  2JXP A;  1SR9 A;  2RS6 A;  2LVH A;  2EMY A;  4Q28 A;  2YRM A;  3ECR A;  2EN1 A;  2EN6 A;  3DF6 A;  4X8W A;  4F6M A;  4OOG C;  4DUY E;  2EL4 A;  2ELY A;  2EPU A;  4NXN E;  2YTI A;  3THN A;  4KHP E;  2DRP A;  3JTZ A;  5AE3 A;  2E5L E;  2HJJ A;  4F9C B;  5KL5 A;  2LO3 A;  1TF6 A;  4R8O A;  2G7H A;  3MSW A;  3ADJ A;  4LF8 E;  5F3W A;  3H09 A;  2EPC A;  5IV8 B;  2EN8 A;  4P7D A;  1RC7 A;  2EPK X;  2EPN A;  5BR8 E;  4LF7 E;  1N33 E;  2EOY A;  4L5N C;  2DSY A;  5IXM B;  2MC5 A;  1L4S A;  3F6H A;  2YTG A;  3ADG A;  2DMI A;  1X6H A;  2LJU A;  4F9B B;  4DR2 E;  4DV6 E;  2EMB A;  4I8O A;  2DGC A;  4F2J C;  2EM6 A;  3JU0 A;  3LLH A;  1GQE A;  4NZV A;  2EN7 A;  4BCA A;  1A1I A;  2YTQ A;  4DV1 E;  2DLK A;  1KYQ A;  2YTD A;  2UXC E;  3P1X A;  1X6F A;  2EOO A;  1N36 E;  1O0W A;  1I94 E;  4HTG A;  3HPS A;  4F54 A;  4LFB E;  4DR7 E;  2ZM6 E;  2YU8 A;  1ZBT A;  1WJP A;  3THO B;  2EPM X;  3DJW A;  3VK6 A;  4OX9 E;  4DR6 E;  2N3H A;  2L2K B;  3KWR A;  5IT9 C;  1WHQ A;  2EOR A;  2V83 A;  1RMD A;  2A25 A;  4MLV A;  3RMP A;  2EOJ A;  3AUZ A;  4JI1 E;  4WSG A;  1HNX E;  2YWQ A;  3MHH C;  3JAM C;  3C4T A;  2E72 A;  2EOQ A;  3BGH A;  4BC7 A;  4ZYE A;  5AAS A;  1A1F A;  2MKN A;  2YPN A;  3AV0 A;  1PJS A;  2NA2 A;  1N34 E;  2F4V E;  2Q8U A;  1EH6 A;  4IJD A;  4R2P A;  1P47 A;  2EQ1 A;  4M2Z A;  2UXB E;  1N3G A;  3KZY A;  2EMG A;  4LU9 A;  4JI5 E;  1BBO A;  5KL2 A;  2UUC E;  3EQ1 A;  4NXM E;  1YZ9 A;  2EMW A;  3BF2 A;  1UN6 B;  2WCC 3;  4BMJ A;  1AH5 A;  4WXC A;  2ODR D;  2LT7 A;  3M99 B;  2EM2 A;  2EPZ A;  2LMZ A;  1A1L A;  1F2I G;  2EJ4 A;  4R03 A;  1WXR A;  2H36 X;  4YHH E;  2EOM A;  4L8N A;  4WYQ B;  5TSE A;  4DV7 E;  1X49 A;  4WXD A;  5A6J A;  2M1S A;  2YTO A;  2EL5 A;  2KON A;  5A6K A;  4NHR A;  2D9H A;  4LFA E;  2B7T A;  1XNQ E;  2EZ6 A;  1A1J A;  1A1G A;  4WSP A;  4DR1 E;  1G2F C;  1HR0 E;  4RH8 A;  2VQE E;  2DB2 A;  3C6M A;  2EL6 A;  2EOI A;  2L2N A;  4O43 A;  2R76 A;  1BB8 A;  2EWL A;  4R2S A;  1XNR E;  2DLQ A;  2EN4 A;  2BB8 A;  2GHF A;  3OML A;  4WPY A;  4R2R A;  2B7V A;  2EP3 A;  1EKZ A;  4DUZ E;  2YSO A;  4O4K A;  4Q35 B;  4M9V C;  2V87 A;  2YU5 A;  1PJT A;  2WBU A;  2L6M A;  1PDA A;  4FK5 C;  1YYO A;  1YYK A;  1G2D C;  3LML A;  4LFC E;  2K4V A;  2L3C A;  2EM4 A;  4R2E A;  1LLM C;  2JOX A;  3EPL A;  1YYW A;  2JVA A;  4ZYD A;  2EOH A;  2EM9 A;  3VYX A;  2LRS A;  4JI4 E;  2EMA A;  2RSM A;  4J8Z A;  2V85 A;  4BHB A;  5DNY A;  2EPX A;  2B3T B;  1MEY C;  2NAB A;  2EM3 A;  4GKK E;  1J5E E;  2CPN A;  2LV2 A;  2CSH A;  4JI8 E;  4LTY A;  5KL4 A;  3K6Q A;  5ADZ A;  2EOZ A;  2R1F A;  4BBY A;  4X62 E;  2YTJ A;  2HC5 A;  2VF1 A;  3T1H E;  2VRD A;  1UIL A;  1ZU1 A;  1SFE A;  1NEI A;  2M4I A;  1X48 A;  5KL3 A;  1DI2 A;  4MLQ A;  1GZ6 A;  5CFF E;  3HPZ A;  2EE8 A;  4BHC A;  2EMH A;  2YRK A;  1X6E A;  3FIG A;  2EM8 A;  2F8B A;  2ELZ A;  2EM5 A;  3F6G A;  2JOB A;  2EM7 A;  4BC9 A;  5FLX C;  2EML A; 
#chains in the Genus database with same CATH homology
 2PRT A;  2LO3 A;  1X3C A;  1TF6 A;  2CT1 A;  2EOF A;  2MKD A;  2YTO A;  2EL5 A;  4R2A A;  4F6N A;  1AAY A;  2D9H A;  2EPC A;  2LCE A;  2M9A A;  2EOX A;  2EN8 A;  2WBS A;  2EMX A;  2YTE A;  1A1J A;  2EQ3 A;  1A1G A;  1X5W A;  1Z1B A;  2EOY A;  2YTF A;  1G2F C;  4GZN C;  2YTG A;  2DMI A;  1X6H A;  2CTD A;  2EL6 A;  2DGC A;  2EMB A;  2YTN A;  2EM6 A;  2EOI A;  4F2J C;  1A1H A;  2YRH A;  1UBD C;  2JPA A;  4X9J A;  1TF3 A;  1TN9 A;  2EMI A;  2EN2 A;  1ZR9 A;  1BB8 A;  4R2S A;  1JK2 A;  2EQ0 A;  2DLQ A;  2EN4 A;  2BB8 A;  2EN7 A;  2GHF A;  1NCS A;  4R2R A;  1A1I A;  2EP3 A;  2GLI A;  2YTQ A;  2DLK A;  2EPR A;  2YSO A;  2YTD A;  1ZAA C;  2EM0 A;  2EN3 A;  1X6F A;  1YSA C;  4M9V C;  2EOO A;  1KJK A;  2YU5 A;  2JP9 A;  2EPP A;  4R2C A;  2EMF A;  1DGC A;  2WBU A;  2WBT A;  4FK5 C;  2EOE A;  2YU8 A;  1G2D C;  2YTP A;  3VHT B;  1WJP A;  3EPK A;  2EMZ A;  2EM4 A;  4R2E A;  1LLM C;  2RPC A;  1JK1 A;  3EPL A;  2EOR A;  3UK3 C;  2EOH A;  1RMD A;  2A25 A;  2EM9 A;  2ENC A;  4R2Q A;  2RSI A;  2EMA A;  2EPA A;  2EOJ A;  1B69 A;  4WSG A;  2EPX A;  1MEY C;  1YUI A;  2NAB A;  2EM3 A;  3MHH C;  2J7J A;  3EPJ A;  2HGH A;  2E72 A;  2ENA A;  2EOQ A;  2LV2 A;  2CSH A;  1A1F A;  2MKN A;  5KL4 A;  4IS1 C;  2EOZ A;  1A1K A;  2R1F A;  2ADR A;  4IJD A;  4R2P A;  1P47 A;  2EQ1 A;  2I13 A;  2YTJ A;  2EMG A;  1BBO A;  5KL2 A;  2VRD A;  5KL6 A;  2YSP A;  1ZU1 A;  4R2D A;  2EMW A;  1UN6 B;  2LVH A;  2EMY A;  2EOS A;  2YRM A;  3MHS C;  2WCC 3;  5KL3 A;  2EN1 A;  2MDG A;  2EN6 A;  2LT7 A;  4F6M A;  2EMK A;  2ENH A;  3M99 B;  2EM2 A;  5KL7 A;  1YUJ A;  2EE8 A;  2EL4 A;  2EMH A;  2EPZ A;  3EPH A;  2ELY A;  2EMC A;  2EPU A;  1A1L A;  2YTI A;  2YRK A;  2DRP A;  1F2I G;  2EJ4 A;  1X6E A;  2EM8 A;  2ELZ A;  2EM5 A;  2EOM A;  2EM7 A;  5KL5 A;  2EML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...