2YRHA

Solution structure of the c2h2-type zinc finger domain (699-729) from zinc finger protein 473
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
GSSGSSGKKPLVCNECGKTFRQSSCLSKHQRIHSGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Zinc finger protein 473
publication title Solution structure of the C2H2-type zinc finger domain (699-729) from zinc finger protein 473
rcsb
source organism Homo sapiens
total genus 6
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2yrhA01
2ELYA 1G2DC 2ADRA 2RPCA 2EMYA 5KL7A 2WBUA 2EN6A 2EPAA 5KL3A 1A1GA 2EOZA 2EMCA 2EMGA 2EPXA 2EMIA 2GHFA 2LO3A 4IS1C 4F6NA 3UK3C 2YTDA 1BBOA 2EL6A 1X6EA 2DLKA 2EJ4A 2EQ0A 2EN1A 2BB8A 1BB8A 2EN7A 4R2EA 3MHSC 2EPZA 1A1FA 3M99B 2ELZA 4R2DA 4R2PA 2YRMA 2YTGA 2EN2A 2EM3A 2EPRA 2EPCA 3EPLA 2CT1A 1X6FA 2EMAA 1DGCA 4FK5C 2YTOA 1YUJA 2EMLA 4GZNC 1UBDC 2DGCA 2WCC3 2ENCA 2EMHA 2D9HA 2EL5A 2YSPA 1TF3A 1UN6B 1B69A 1A1LA 4X9JA 2JPAA 2EQ1A 2HGHA 2EM6A 2JP9A 1JK2A 1WJPA 2EMBA 1A1IA 1Z1BA 2LV2A 1ZU1A 2EOXA 1X3CA 2EOMA 2EM0A 2R1FA 4R2SA 4IJDA 3EPKA 1ZR9A 2EMWA 1A1HA 2YTJA 4R2RA 1P47A 2CSHA 2A25A 2EM7A 1A1KA 2EMXA 3EPJA 1TN9A 1F2IG 2ENAA 2RSIA 2YRKA 2YTQA 1NCSA 2EOIA 2DRPA 2EOYA 2EOOA 2MKNA 2LVHA 2YU8A 2CTDA 2J7JA 4F6MA 1ZAAC 2YTPA 2EMKA 3EPHA 2YTEA 2EOFA 2ENHA 2EN8A 2YTIA 3MHHC 2EMZA 2EQ3A 1MEYC 4M9VC 2NABA 2EM5A 1JK1A 2YU5A 4R2QA 2EN3A 1X5WA 1AAYA 1YSAC 2EOHA 2YRHA 2EPPA 2EM8A 2WBTA 4WSGA 1YUIA 2VRDA 1A1JA 5KL5A 2YSOA 2LCEA 2LT7A 2EM4A 4R2AA 2EM2A 2EPUA 4R2CA 1G2FC 1X6HA 2YTNA 2EN4A 2EE8A 2M9AA 3VHTB 2EOJA 2EOQA 2EOEA 2EORA 2YTFA 1TF6A 2GLIA 2DMIA 2E72A 5KL2A 2EMFA 5KL6A 1KJKA 2WBSA 1RMDA 2DLQA 2EP3A 2MDGA 2EOSA 5KL4A 4F2JC 2EL4A 2PRTA 2MKDA 2EM9A 2I13A 1LLMC
chains in the Genus database with same CATH superfamily
2JVAA 3IWCA 5IXMB 2ADRA 4DMIA 4AQYE 4ZYDA 4B3TE 5LMNE 2EMCA 2EWLA 4IS1C 4KWYA 3UK3C 3J81C 4LF9E 1PJSA 3OMLA 1BBOA 2EL6A 2LJUA 4BS9A 1QU6A 2HC5A 2L8TA 4DV7E 3KWRA 4LF8E 4DV3E 3VK6A 4R2PA 2LTSA 5AC5A 2EPRA 3RMPA 5F3WA 1HNWE 4LF4E 2EPMX 1DGCA 4FK5C 1HNXE 1YUJA 4DR1E 3BF2A 2ENCA 2EL5A 5A2QC 4X65E 4JI0E 2YPNA 1YPNA 2EMBA 1A1IA 1X49A 2H36X 1RQ0A 3ADIA 1KYQA 2F4VE 2L2NA 2R1FA 2LTRA 5AC4A 1XNRE 1T4LB 2L3JA 5BR8E 5TSEA 1ZR9A 4LF5E 3LMLA 2ODRD 4DR2E 4BC7A 1EKZA 4NXNE 2HHHE 1XMOE 1NCSA 3J7AG 2EOOA 5A69A 2YU8A 4M30A 2J7JA 4F6MA 3EQ1A 2V85A 4WXCA 1UILA 2EMZA 2F8BA 2YU5A 4R2QA 4JI8E 2KONA 4HEIA 2UUAE 4O24A 1YUIA 2EPNA 2VRDA 1A1JA 2LE2A 4R8OA 4DR5E 2NUGA 2EM2A 4BCAA 1SR9A 1PJTA 2RQLA 2G7HA 2M4IA 2M9AA 3VHTB 5AE2A 2RS6A 1TF6A 2GLIA 1PJQA 2UXBE 2VQFE 2WBSA 2KOUA 4DKKA 2MDGA 4F2JC 1YFHA 2B3TB 3F6HA 1N36E 1LLMC 2ELYA 2RPCA 2WZOA 2EN6A 2RSMA 2GHFA 2LO3A 2V8QB 3HPSA 2L2MA 1WHNA 1UHZA 4BMJA 4JI1E 4DUYE 3AV0A 2EJ4A 2FGGA 3C6MA 4BHBA 4L5NC 2B7VA 1BB8A 4KZSA 2MDRA 3MHSC 1A1FA 4WX9A 2NUEA 2EM3A 2EPCA 2CT1A 2EMAA 2JWOA 4GKJE 2DGCA 2WCC3 2LBSB 2M1SA 2KHXA 1TF3A 1B69A 4X9JA 3JTZA 2EM6A 4R03A 1JK2A 4DR7E 1WJPA 4X64E 1Z1BA 1ZU1A 1J26A 1RC7A 4J8ZA 1YZ9A 1X47A 3EPKA 4B3SE 4ZYHA 1IMUA 5FLXC 5AE3A 5IT9C 1A1HA 2E5LE 5CFFE 2CSHA 2A25A 3OTOE 2EMXA 2EPOA 2I9IA 2RSIA 2YRKA 2YTQA 2DRPA 3J7Yp 4NHRA 2LVHA 5IV8B 2CTDA 3L00A 2EMKA 1N3GA 3TQMA 2ENHA 2YTIA 1PKPA 2VE7C 1I94E 2NABA 1IQOA 5A6BA 1JK1A 2DMYA 2EN3A 4ZYGA 2EOHA 2YRHA 2EPPA 2EM8A 4K0KE 3T1HE 1EH7A 1GTKA 4BHCA 2IHR1 4ZYEA 5AE1A 4MLVA 5DNYA 4GEQB 3THOB 2CPNA 2EE8A 4JI7E 2LRSA 2EORA 3VYYA 4JI4E 2YTFA 4DR4E 4Q28A 4X8WA 2EMFA 1KJKA 1RMDA 2EP3A 2JYAA 5KL4A 2L92A 4LFCE 2MC5A 4NXME 2MKDA 4F9CB 4DV2E 1G2DC 2N3HA 2B9DA 2V86A 2Q8UA 5KL7A 2UU9E 4X62E 5KL3A 1GQEA 1QNTA 2N3GA 2RS7A 2EMIA 2V83A 4F6NA 1N33E 1ZBTA 2YTDA 5T6JA 1WXRA 4GKKE 5LLQA 1X6EA 2EQ0A 2EN1A 3BIDA 3P1XA 1HNZE 2L33A 5AASA 3HPZA 2ELZA 3M99B 4R2DA 2YRMA 4JV5E 1O0WA 2EN2A 3EPLA 4WYQB 4O4KA 5A6AA 1YYWA 1T38A 2DIXA 2YTOA 2EMLA 4GZNC 4LFAE 1UN6B 1A1LA 3IWDA 2JPAA 4F54A 3AUZA 3ADJA 4LTYA 3DJWA 4DR6E 4WSPA 2M7QA 5A6KA 2EOMA 2B7TA 2EM0A 1FJGE 2JXPA 4LF7E 1MGTA 2EMWA 4JI5E 1XNQE 4R2RA 3H09A 1IBLE 1IBKE 1P47A 2R76A 3EPJA 1TN9A 2V87A 2EOIA 5LL6R 2MKNA 4M2ZA 4JI6E 4B3ME 2EZ6A 3J80C 1WRJA 5ADZA 3EPHA 3MHHC 1T4OA 2K4VA 2EQ3A 1DQ3A 1YSAC 4F9BB 4DV6E 2MC6A 3MSWA 4DV0E 5KL5A 2YSOA 4B3RE 4KHPE 2EM4A 3C4BA 2EPUA 4R2CA 4O43A 1L4SA 2YTNA 3F6GA 1IBME 2EN4A 3VYXA 5IWAE 2EOQA 1STUA 2EOEA 3THNA 1J5EE 1HR0E 4N4RB 2DMIA 2E72A 2K7IA 5KL2A 1XMQE 5KL6A 2JY9A 4P7DA 3ADLA 2EOSA 2JOXA 2EL4A 3ADGA 2PRTA 4LFBE 5A6JA 2V88A 2I13A 2EMYA 3BGHA 1SFEA 2WBUA 2EPLX 2EPAA 2L2KB 3HXLA 1A1GA 2EOZA 2EMGA 2LMZA 2EPXA 3DF6A 3C6KA 2RTXA 3QG5C 2VF1A 1NEIA 2N8XA 3FIGA 2UUBE 3HTXA 2DLKA 4LF6E 1IQSA 2LUQA 4TUIA 2LJHA 4O5GA 2BB8A 2EN7A 2YZTA 4R2EA 5LMUE 2EPZA 1ZBQA 1N32E 1YYOA 2YTGA 3LLHA 4BC9A 1X6FA 4YY3E 4DR3E 2FTXB 3BBGA 1UBDC 2EMHA 2D9HA 2YSPA 2DSYA 2NUFA 4JI2E 4X66E 2YT4A 3KZYA 2EQ1A 2HGHA 4JYAE 2JP9A 3ZOQB 4P78A 1BBGA 2LV2A 2V89A 3ECRA 2EOXA 1X3CA 4WPYA 4YHHE 1AH5A 1EH6A 2ZM6E 4R2SA 4IJDA 2DB2A 1YYKA 2UUCE 2YTJA 4OX9E 2EM7A 1A1KA 4I8OA 3C4TA 1F2IG 3JU0A 2ENAA 1DI2A 2UXCE 1EH8A 1X48A 3JAMC 2EOYA 3T1YE 4NZVA 2L6MA 3HQ1A 2YTPA 1ZAAC 2YTEA 2YWQA 2EOFA 2EN8A 1MEYC 4M9VC 4WXDA 4WFTA 2EM5A 4JI3E 1AAYA 1X5WA 4RHBB 2EPKX 4DV4E 3K6QA 4WSGA 2WBTA 1FKAE 1GZ6A 4DV5E 4L8NA 4DUZE 2LCEA 2LT7A 4Q35B 4R2AA 5A6BD 2L3CA 4M0VA 1G2FC 4MLQA 1X6HA 4BBYA 2VQEE 2JR1A 2GPIA 3KZZA 4LU9A 1WHQA 2EOJA 2BBGA 4TUGA 1N34E 3IWBA 1T39A 2NA2A 2UXDE 4F9AB 2FV4B 4DV1E 2DLQA 1PDAA 4OOGC 4RH8A 2LUPB 2JOBA 2E1MA 4HTGA 1T4NA 2HJJA 2EM9A 2ODRC
chains in the Genus database with same CATH topology
2ELYA 1G2DC 2ADRA 2RPCA 2EMYA 5KL7A 2WBUA 2EN6A 2EPAA 5KL3A 1A1GA 2EOZA 2EMCA 2EMGA 2EPXA 2EMIA 2GHFA 2LO3A 4IS1C 4F6NA 3UK3C 2YTDA 1BBOA 2EL6A 1X6EA 2DLKA 2EJ4A 2EQ0A 2EN1A 2BB8A 1BB8A 2EN7A 4R2EA 3MHSC 2EPZA 1A1FA 3M99B 2ELZA 4R2DA 4R2PA 2YRMA 2YTGA 2EN2A 2EM3A 2EPRA 2EPCA 3EPLA 2CT1A 1X6FA 2EMAA 1DGCA 4FK5C 2YTOA 1YUJA 2EMLA 4GZNC 1UBDC 2DGCA 2WCC3 2ENCA 2EMHA 2D9HA 2EL5A 2YSPA 1TF3A 1UN6B 1B69A 1A1LA 4X9JA 2JPAA 2EQ1A 2HGHA 2EM6A 2JP9A 1JK2A 1WJPA 2EMBA 1A1IA 1Z1BA 2LV2A 1ZU1A 2EOXA 1X3CA 2EOMA 2EM0A 2R1FA 4R2SA 4IJDA 3EPKA 1ZR9A 2EMWA 1A1HA 2YTJA 4R2RA 1P47A 2CSHA 2A25A 2EM7A 1A1KA 2EMXA 3EPJA 1TN9A 1F2IG 2ENAA 2RSIA 2YRKA 2YTQA 1NCSA 2EOIA 2DRPA 2EOYA 2EOOA 2MKNA 2LVHA 2YU8A 2CTDA 2J7JA 4F6MA 1ZAAC 2YTPA 2EMKA 3EPHA 2YTEA 2EOFA 2ENHA 2EN8A 2YTIA 3MHHC 2EMZA 2EQ3A 1MEYC 4M9VC 2NABA 2EM5A 1JK1A 2YU5A 4R2QA 2EN3A 1X5WA 1AAYA 1YSAC 2EOHA 2YRHA 2EPPA 2EM8A 2WBTA 4WSGA 1YUIA 2VRDA 1A1JA 5KL5A 2YSOA 2LCEA 2LT7A 2EM4A 4R2AA 2EM2A 2EPUA 4R2CA 1G2FC 1X6HA 2YTNA 2EN4A 2EE8A 2M9AA 3VHTB 2EOJA 2EOQA 2EOEA 2EORA 2YTFA 1TF6A 2GLIA 2DMIA 2E72A 5KL2A 2EMFA 5KL6A 1KJKA 2WBSA 1RMDA 2DLQA 2EP3A 2MDGA 2EOSA 5KL4A 4F2JC 2EL4A 2PRTA 2MKDA 2EM9A 2I13A 1LLMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ELY A;  1G2D C;  2ADR A;  2RPC A;  2EMY A;  5KL7 A;  2WBU A;  2EN6 A;  2EPA A;  5KL3 A;  1A1G A;  2EOZ A;  2EMC A;  2EMG A;  2EPX A;  2EMI A;  2GHF A;  2LO3 A;  4IS1 C;  4F6N A;  3UK3 C;  2YTD A;  1BBO A;  2EL6 A;  1X6E A;  2DLK A;  2EJ4 A;  2EQ0 A;  2EN1 A;  2BB8 A;  1BB8 A;  2EN7 A;  4R2E A;  3MHS C;  2EPZ A;  1A1F A;  3M99 B;  2ELZ A;  4R2D A;  4R2P A;  2YRM A;  2YTG A;  2EN2 A;  2EM3 A;  2EPR A;  2EPC A;  3EPL A;  2CT1 A;  1X6F A;  2EMA A;  1DGC A;  4FK5 C;  2YTO A;  1YUJ A;  2EML A;  4GZN C;  1UBD C;  2DGC A;  2WCC 3;  2ENC A;  2EMH A;  2D9H A;  2EL5 A;  2YSP A;  1TF3 A;  1UN6 B;  1B69 A;  1A1L A;  4X9J A;  2JPA A;  2EQ1 A;  2HGH A;  2EM6 A;  2JP9 A;  1JK2 A;  1WJP A;  2EMB A;  1A1I A;  1Z1B A;  2LV2 A;  1ZU1 A;  2EOX A;  1X3C A;  2EOM A;  2EM0 A;  2R1F A;  4R2S A;  4IJD A;  3EPK A;  1ZR9 A;  2EMW A;  1A1H A;  2YTJ A;  4R2R A;  1P47 A;  2CSH A;  2A25 A;  2EM7 A;  1A1K A;  2EMX A;  3EPJ A;  1TN9 A;  1F2I G;  2ENA A;  2RSI A;  2YRK A;  2YTQ A;  1NCS A;  2EOI A;  2DRP A;  2EOY A;  2EOO A;  2MKN A;  2LVH A;  2YU8 A;  2CTD A;  2J7J A;  4F6M A;  1ZAA C;  2YTP A;  2EMK A;  3EPH A;  2YTE A;  2EOF A;  2ENH A;  2EN8 A;  2YTI A;  3MHH C;  2EMZ A;  2EQ3 A;  1MEY C;  4M9V C;  2NAB A;  2EM5 A;  1JK1 A;  2YU5 A;  4R2Q A;  2EN3 A;  1X5W A;  1AAY A;  1YSA C;  2EOH A;  2YRH A;  2EPP A;  2EM8 A;  2WBT A;  4WSG A;  1YUI A;  2VRD A;  1A1J A;  5KL5 A;  2YSO A;  2LCE A;  2LT7 A;  2EM4 A;  4R2A A;  2EM2 A;  2EPU A;  4R2C A;  1G2F C;  1X6H A;  2YTN A;  2EN4 A;  2EE8 A;  2M9A A;  3VHT B;  2EOJ A;  2EOQ A;  2EOE A;  2EOR A;  2YTF A;  1TF6 A;  2GLI A;  2DMI A;  2E72 A;  5KL2 A;  2EMF A;  5KL6 A;  1KJK A;  2WBS A;  1RMD A;  2DLQ A;  2EP3 A;  2MDG A;  2EOS A;  5KL4 A;  4F2J C;  2EL4 A;  2PRT A;  2MKD A;  2EM9 A;  2I13 A;  1LLM C; 
#chains in the Genus database with same CATH topology
 2JVA A;  3IWC A;  5IXM B;  2ADR A;  4DMI A;  4AQY E;  4ZYD A;  4B3T E;  5LMN E;  2EMC A;  2EWL A;  4IS1 C;  4KWY A;  3UK3 C;  3J81 C;  4LF9 E;  1PJS A;  3OML A;  1BBO A;  2EL6 A;  2LJU A;  4BS9 A;  1QU6 A;  2HC5 A;  2L8T A;  4DV7 E;  3KWR A;  4LF8 E;  4DV3 E;  3VK6 A;  4R2P A;  2LTS A;  5AC5 A;  2EPR A;  3RMP A;  5F3W A;  1HNW E;  4LF4 E;  2EPM X;  1DGC A;  4FK5 C;  1HNX E;  1YUJ A;  4DR1 E;  3BF2 A;  2ENC A;  2EL5 A;  5A2Q C;  4X65 E;  4JI0 E;  2YPN A;  1YPN A;  2EMB A;  1A1I A;  1X49 A;  2H36 X;  1RQ0 A;  3ADI A;  1KYQ A;  2F4V E;  2L2N A;  2R1F A;  2LTR A;  5AC4 A;  1XNR E;  1T4L B;  2L3J A;  5BR8 E;  5TSE A;  1ZR9 A;  4LF5 E;  3LML A;  2ODR D;  4DR2 E;  4BC7 A;  1EKZ A;  4NXN E;  2HHH E;  1XMO E;  1NCS A;  3J7A G;  2EOO A;  5A69 A;  2YU8 A;  4M30 A;  2J7J A;  4F6M A;  3EQ1 A;  2V85 A;  4WXC A;  1UIL A;  2EMZ A;  2F8B A;  2YU5 A;  4R2Q A;  4JI8 E;  2KON A;  4HEI A;  2UUA E;  4O24 A;  1YUI A;  2EPN A;  2VRD A;  1A1J A;  2LE2 A;  4R8O A;  4DR5 E;  2NUG A;  2EM2 A;  4BCA A;  1SR9 A;  1PJT A;  2RQL A;  2G7H A;  2M4I A;  2M9A A;  3VHT B;  5AE2 A;  2RS6 A;  1TF6 A;  2GLI A;  1PJQ A;  2UXB E;  2VQF E;  2WBS A;  2KOU A;  4DKK A;  2MDG A;  4F2J C;  1YFH A;  2B3T B;  3F6H A;  1N36 E;  1LLM C;  2ELY A;  2RPC A;  2WZO A;  2EN6 A;  2RSM A;  2GHF A;  2LO3 A;  2V8Q B;  3HPS A;  2L2M A;  1WHN A;  1UHZ A;  4BMJ A;  4JI1 E;  4DUY E;  3AV0 A;  2EJ4 A;  2FGG A;  3C6M A;  4BHB A;  4L5N C;  2B7V A;  1BB8 A;  4KZS A;  2MDR A;  3MHS C;  1A1F A;  4WX9 A;  2NUE A;  2EM3 A;  2EPC A;  2CT1 A;  2EMA A;  2JWO A;  4GKJ E;  2DGC A;  2WCC 3;  2LBS B;  2M1S A;  2KHX A;  1TF3 A;  1B69 A;  4X9J A;  3JTZ A;  2EM6 A;  4R03 A;  1JK2 A;  4DR7 E;  1WJP A;  4X64 E;  1Z1B A;  1ZU1 A;  1J26 A;  1RC7 A;  4J8Z A;  1YZ9 A;  1X47 A;  3EPK A;  4B3S E;  4ZYH A;  1IMU A;  5FLX C;  5AE3 A;  5IT9 C;  1A1H A;  2E5L E;  5CFF E;  2CSH A;  2A25 A;  3OTO E;  2EMX A;  2EPO A;  2I9I A;  2RSI A;  2YRK A;  2YTQ A;  2DRP A;  3J7Y p;  4NHR A;  2LVH A;  5IV8 B;  2CTD A;  3L00 A;  2EMK A;  1N3G A;  3TQM A;  2ENH A;  2YTI A;  1PKP A;  2VE7 C;  1I94 E;  2NAB A;  1IQO A;  5A6B A;  1JK1 A;  2DMY A;  2EN3 A;  4ZYG A;  2EOH A;  2YRH A;  2EPP A;  2EM8 A;  4K0K E;  3T1H E;  1EH7 A;  1GTK A;  4BHC A;  2IHR 1;  4ZYE A;  5AE1 A;  4MLV A;  5DNY A;  4GEQ B;  3THO B;  2CPN A;  2EE8 A;  4JI7 E;  2LRS A;  2EOR A;  3VYY A;  4JI4 E;  2YTF A;  4DR4 E;  4Q28 A;  4X8W A;  2EMF A;  1KJK A;  1RMD A;  2EP3 A;  2JYA A;  5KL4 A;  2L92 A;  4LFC E;  2MC5 A;  4NXM E;  2MKD A;  4F9C B;  4DV2 E;  1G2D C;  2N3H A;  2B9D A;  2V86 A;  2Q8U A;  5KL7 A;  2UU9 E;  4X62 E;  5KL3 A;  1GQE A;  1QNT A;  2N3G A;  2RS7 A;  2EMI A;  2V83 A;  4F6N A;  1N33 E;  1ZBT A;  2YTD A;  5T6J A;  1WXR A;  4GKK E;  5LLQ A;  1X6E A;  2EQ0 A;  2EN1 A;  3BID A;  3P1X A;  1HNZ E;  2L33 A;  5AAS A;  3HPZ A;  2ELZ A;  3M99 B;  4R2D A;  2YRM A;  4JV5 E;  1O0W A;  2EN2 A;  3EPL A;  4WYQ B;  4O4K A;  5A6A A;  1YYW A;  1T38 A;  2DIX A;  2YTO A;  2EML A;  4GZN C;  4LFA E;  1UN6 B;  1A1L A;  3IWD A;  2JPA A;  4F54 A;  3AUZ A;  3ADJ A;  4LTY A;  3DJW A;  4DR6 E;  4WSP A;  2M7Q A;  5A6K A;  2EOM A;  2B7T A;  2EM0 A;  1FJG E;  2JXP A;  4LF7 E;  1MGT A;  2EMW A;  4JI5 E;  1XNQ E;  4R2R A;  3H09 A;  1IBL E;  1IBK E;  1P47 A;  2R76 A;  3EPJ A;  1TN9 A;  2V87 A;  2EOI A;  5LL6 R;  2MKN A;  4M2Z A;  4JI6 E;  4B3M E;  2EZ6 A;  3J80 C;  1WRJ A;  5ADZ A;  3EPH A;  3MHH C;  1T4O A;  2K4V A;  2EQ3 A;  1DQ3 A;  1YSA C;  4F9B B;  4DV6 E;  2MC6 A;  3MSW A;  4DV0 E;  5KL5 A;  2YSO A;  4B3R E;  4KHP E;  2EM4 A;  3C4B A;  2EPU A;  4R2C A;  4O43 A;  1L4S A;  2YTN A;  3F6G A;  1IBM E;  2EN4 A;  3VYX A;  5IWA E;  2EOQ A;  1STU A;  2EOE A;  3THN A;  1J5E E;  1HR0 E;  4N4R B;  2DMI A;  2E72 A;  2K7I A;  5KL2 A;  1XMQ E;  5KL6 A;  2JY9 A;  4P7D A;  3ADL A;  2EOS A;  2JOX A;  2EL4 A;  3ADG A;  2PRT A;  4LFB E;  5A6J A;  2V88 A;  2I13 A;  2EMY A;  3BGH A;  1SFE A;  2WBU A;  2EPL X;  2EPA A;  2L2K B;  3HXL A;  1A1G A;  2EOZ A;  2EMG A;  2LMZ A;  2EPX A;  3DF6 A;  3C6K A;  2RTX A;  3QG5 C;  2VF1 A;  1NEI A;  2N8X A;  3FIG A;  2UUB E;  3HTX A;  2DLK A;  4LF6 E;  1IQS A;  2LUQ A;  4TUI A;  2LJH A;  4O5G A;  2BB8 A;  2EN7 A;  2YZT A;  4R2E A;  5LMU E;  2EPZ A;  1ZBQ A;  1N32 E;  1YYO A;  2YTG A;  3LLH A;  4BC9 A;  1X6F A;  4YY3 E;  4DR3 E;  2FTX B;  3BBG A;  1UBD C;  2EMH A;  2D9H A;  2YSP A;  2DSY A;  2NUF A;  4JI2 E;  4X66 E;  2YT4 A;  3KZY A;  2EQ1 A;  2HGH A;  4JYA E;  2JP9 A;  3ZOQ B;  4P78 A;  1BBG A;  2LV2 A;  2V89 A;  3ECR A;  2EOX A;  1X3C A;  4WPY A;  4YHH E;  1AH5 A;  1EH6 A;  2ZM6 E;  4R2S A;  4IJD A;  2DB2 A;  1YYK A;  2UUC E;  2YTJ A;  4OX9 E;  2EM7 A;  1A1K A;  4I8O A;  3C4T A;  1F2I G;  3JU0 A;  2ENA A;  1DI2 A;  2UXC E;  1EH8 A;  1X48 A;  3JAM C;  2EOY A;  3T1Y E;  4NZV A;  2L6M A;  3HQ1 A;  2YTP A;  1ZAA C;  2YTE A;  2YWQ A;  2EOF A;  2EN8 A;  1MEY C;  4M9V C;  4WXD A;  4WFT A;  2EM5 A;  4JI3 E;  1AAY A;  1X5W A;  4RHB B;  2EPK X;  4DV4 E;  3K6Q A;  4WSG A;  2WBT A;  1FKA E;  1GZ6 A;  4DV5 E;  4L8N A;  4DUZ E;  2LCE A;  2LT7 A;  4Q35 B;  4R2A A;  5A6B D;  2L3C A;  4M0V A;  1G2F C;  4MLQ A;  1X6H A;  4BBY A;  2VQE E;  2JR1 A;  2GPI A;  3KZZ A;  4LU9 A;  1WHQ A;  2EOJ A;  2BBG A;  4TUG A;  1N34 E;  3IWB A;  1T39 A;  2NA2 A;  2UXD E;  4F9A B;  2FV4 B;  4DV1 E;  2DLQ A;  1PDA A;  4OOG C;  4RH8 A;  2LUP B;  2JOB A;  2E1M A;  4HTG A;  1T4N A;  2HJJ A;  2EM9 A;  2ODR C; 
#chains in the Genus database with same CATH homology
 2ELY A;  1G2D C;  2ADR A;  2RPC A;  2EMY A;  5KL7 A;  2WBU A;  2EN6 A;  2EPA A;  5KL3 A;  1A1G A;  2EOZ A;  2EMC A;  2EMG A;  2EPX A;  2EMI A;  2GHF A;  2LO3 A;  4IS1 C;  4F6N A;  3UK3 C;  2YTD A;  1BBO A;  2EL6 A;  1X6E A;  2DLK A;  2EJ4 A;  2EQ0 A;  2EN1 A;  2BB8 A;  1BB8 A;  2EN7 A;  4R2E A;  3MHS C;  2EPZ A;  1A1F A;  3M99 B;  2ELZ A;  4R2D A;  4R2P A;  2YRM A;  2YTG A;  2EN2 A;  2EM3 A;  2EPR A;  2EPC A;  3EPL A;  2CT1 A;  1X6F A;  2EMA A;  1DGC A;  4FK5 C;  2YTO A;  1YUJ A;  2EML A;  4GZN C;  1UBD C;  2DGC A;  2WCC 3;  2ENC A;  2EMH A;  2D9H A;  2EL5 A;  2YSP A;  1TF3 A;  1UN6 B;  1B69 A;  1A1L A;  4X9J A;  2JPA A;  2EQ1 A;  2HGH A;  2EM6 A;  2JP9 A;  1JK2 A;  1WJP A;  2EMB A;  1A1I A;  1Z1B A;  2LV2 A;  1ZU1 A;  2EOX A;  1X3C A;  2EOM A;  2EM0 A;  2R1F A;  4R2S A;  4IJD A;  3EPK A;  1ZR9 A;  2EMW A;  1A1H A;  2YTJ A;  4R2R A;  1P47 A;  2CSH A;  2A25 A;  2EM7 A;  1A1K A;  2EMX A;  3EPJ A;  1TN9 A;  1F2I G;  2ENA A;  2RSI A;  2YRK A;  2YTQ A;  1NCS A;  2EOI A;  2DRP A;  2EOY A;  2EOO A;  2MKN A;  2LVH A;  2YU8 A;  2CTD A;  2J7J A;  4F6M A;  1ZAA C;  2YTP A;  2EMK A;  3EPH A;  2YTE A;  2EOF A;  2ENH A;  2EN8 A;  2YTI A;  3MHH C;  2EMZ A;  2EQ3 A;  1MEY C;  4M9V C;  2NAB A;  2EM5 A;  1JK1 A;  2YU5 A;  4R2Q A;  2EN3 A;  1X5W A;  1AAY A;  1YSA C;  2EOH A;  2YRH A;  2EPP A;  2EM8 A;  2WBT A;  4WSG A;  1YUI A;  2VRD A;  1A1J A;  5KL5 A;  2YSO A;  2LCE A;  2LT7 A;  2EM4 A;  4R2A A;  2EM2 A;  2EPU A;  4R2C A;  1G2F C;  1X6H A;  2YTN A;  2EN4 A;  2EE8 A;  2M9A A;  3VHT B;  2EOJ A;  2EOQ A;  2EOE A;  2EOR A;  2YTF A;  1TF6 A;  2GLI A;  2DMI A;  2E72 A;  5KL2 A;  2EMF A;  5KL6 A;  1KJK A;  2WBS A;  1RMD A;  2DLQ A;  2EP3 A;  2MDG A;  2EOS A;  5KL4 A;  4F2J C;  2EL4 A;  2PRT A;  2MKD A;  2EM9 A;  2I13 A;  1LLM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...