4BHCA

Crystal structure of the m. tuberculosis o6-methylguanine methyltransferase r37l variant
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
165
structure length
165
Chain Sequence
MVHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSLTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALLELEKSRAPADLTLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Studies on the M. Tuberculosis O6-Methylguanine Methyltransferase and Mutated Variants.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords METHYLATED-DNA--PROTEIN-CYSTEINE METHYLTRANSFERASE
total genus 40
structure length 165
sequence length 165
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4bhcA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4bhcA01
5D5XB 1OPCA 3K9TA 2ZJ2A 3IWFA 2P8TA 1DPRA 3VEPA 3ZMZA 4ZYEA 3FXQA 1REPC 3CDHA 1OYWA 4R79A 1E17A 2Z3YA 5L3GA 2JSCA 1SMYF 1T6SA 4GCVA 3CUOA 2HOEA 1ZG1A 2XV4S 4DNCA 3IC7A 5CJ9A 3GO5A 1ZRDA 3C1DA 2QBYA 3CJNA 2VT2A 2F5DA 5TJJA 1FX7A 4KN7X 2DW4A 4U0WA 5DCMB 3WTTC 3LQRA 3WTYC 1HBXG 1HW2A 2JT1A 3F22A 1WKMA 3F6OA 2O6GE 4OMZA 5CVRA 4IRGA 3IRQA 3ECOA 3ZMDA 2A6EF 2L3DA 3DEUA 5K5QA 1IN6A 1W5SA 3R61A 3RKWA 1WSUA 3KEQA 1QNTA 5H20A 4ESFA 3GW2A 4HOBA 4I09A 2VBYA 3R6SA 3CUQB 4KIBA 1K7AA 3DFGA 5D8KB 2EFOA 4K2EA 4O3MA 1IN5A 3F8BA 1O3TA 4O6JA 5LGUA 2XROA 2PN6A 2W25A 1DDNA 3GFLA 2LNBA 1XSVA 2V9VA 3K2ZA 4OINF 4HLXA 4EGYA 2HYGD 2Z33A 2H27A 3CUQA 4U0YA 2ETHA 3GUDA 3GVAA 2WTEA 4QLCU 2L4MA 3TO7A 1IZ1A 2OD5A 1W7PD 4WX9A 1LB2A 2P7VB 2ZXJA 4MGRA 3SXYA 2OZ6A 3KP7A 4UV9A 3V8JA 1I1SA 4KMFA 3F8NA 2F2EA 3ZN0A 3HYIA 1O3QA 1LJ9A 4KFCA 4CZZA 1W4MA 1HKSA 4RB2C 2F5FA 3SZPA 3KP3A 2VC0A 2XAHA 1D8KA 3J81K 2MLGA 3M1EA 3SFZA 3LA7A 1BI3A 4NHJA 1RIOH 1T39A 1ON1A 3DQVC 2V1UA 1TNSA 3R4KA 2ZO4A 2DQLA 2FNAA 4I02A 4EV0A 2L01A 2XKPA 5LGNA 1BC7C 4ENJA 4A12A 2QBYB 4YFXF 1G3WA 1FPQA 4KIFA 4GXOA 3KETA 3U1DA 1KU3A 1W5TA 1JGSA 2QZ8A 2HDCA 3TO9A 4FX4A 4L9VA 2YSRA 5J8CA 3T0YA 3E3VA 4LLLA 4KYWA 4IPAA 5D5WB 1JE8A 2PLYA 1ZGAA 4ENNA 4EM0B 2YX4A 1S8NA 2COMA 1IXRC 4OIRF 2DFIA 2K86A 5ILUA 2VOPA 2FE3A 3I0TA 3V7CA 4M74A 3QP5A 1YO5C 1NHAA 2XUBA 4EM1A 2ELHA 2ESNA 5LHGA 3WTXC 2PFBA 3FMSA 2D1HA 2W24A 1ONVA 4ESJA 4M73A 4L9TA 1XGOA 1STZA 1H9TA 4L9NA 3KFWX 4AVPA 4MQ9F 1Z05A 3JAMZ 2M45A 5DEQA 3KP5A 2KKOA 2LSOA 3P9IA 3MZYA 2BEOA 2MH2A 5HS9A 2LF7A 1Y0UA 1J0RA 3HOTA 1G4DA 2PQ8A 3F3XA 3D0SA 1U6GA 4CO8A 1BIBA 2BBYA 5HDKA 4OU0A 2CGPA 5ICCA 2IT0A 3P9KA 4ZYGA 2NS0A 3S2WA 4BYYA 3ABTA 3PFIA 1B9MA 4P9FA 4OIPF 4JBAA 3ZQ7A 4ZZDA 4LB6B 4WXHA 2H09A 2VC1A 2X0LA 1XSXA 1USSA 4JK1X 4MNUA 1B9NA 4MHGA 1U3EM 4Q5SF 2QQAA 2G7HA 1TQPA 5L3EA 2JTVA 2PI0A 5DYMA 1L3LA 3IWZA 3SZTA 1MJ9A 2BYVE 1FT9A 4KNYA 5BS6A 3E6MA 2ZFWA 1D3YA 3FM3A 3DXJF 2FNPA 3GEZA 2RN7A 2DBBA 4IHTA 1R36A 2VT3A 3RYRA 3NRVA 3GZ5A 3ERED 5H6QA 5BPIA 2ZMEB 1GHCA 3TQNA 4O5VA 5L3BA 1ZG3A 4UVAA 5JR3A 4RGSA 1TTYA 3LFKA 3W6JB 1ODDA 4ENKA 3GWZA 4HDVA 3I58A 3TDZC 5DD4A 3FMRA 1CF7A 3HSEA 3J7AO 1TQMA 2FA5A 3GFIA 1ON2A 3J81Z 2DAOA 2HTSA 1B4AA 1R23A 3QP6A 4UV8A 2DU9A 4CICA 4RGXA 5F6FA 3WTWC 1XDSA 3TOAA 4ON0A 2H94A 1IW7F 2PMUA 2AXLA 2YU3A 1MGTA 3KZZA 1ZGJA 2RDPA 4MQVA 3DPLC 2J5OA 4RAZA 3RIRA 2EV6A 3DF8A 1FNNA 1CF7B 5E17F 4UXNA 2GAUA 1QZZA 1U78A 3I53A 1TBXA 4GYGA 2DQRA 1T2KA 1QO0D 2KRFA 1K78A 5EEGA 4IVNA 3DV8A 4CYDA 4R8HA 2M1BA 4IXAA 4L5JA 3F8CA 1Z7UA 2LDUA 5DD8A 2V1XA 2HGCA 2E1CA 3T8TA 2J5PA 2A5YB 4RS8A 4P55A 1T98A 5FLXK 2DK5A 5J8FA 1HKQA 4HAMA 2VE9A 1FBUA 4G7HF 3JSOA 2RGVA 3GFMA 1O7FA 2O61A 3GXOA 4MEYF 2IPQX 2XKOA 5J6XA 3RTRA 3N97A 3SQNA 3WGHA 1DUXC 1B1BA 5JHUA 4LJZF 4NQWA 2DO7A 2Q2EA 2MBFA 3FX3A 3KLNA 4EM2A 1YIOA 5DV5A 1EH6A 1H9GA 3V8KA 1G6NA 1U5TC 1HQCA 5D6EA 5AONA 1YW9A 1QBJA 2K4JA 3DPTA 4UVBA 3WE2A 3GYHX 2CSOA 2QYOA 2BE5F 3F8FA 1ULYA 2ACJA 3F23A 6PAXA 1LNWA 3BZ6A 3ML6A 1XMKA 2R7FA 3ELKA 2ZMEA 2IA1A 3C7JA 3KZYA 1KA8A 5CVIA 3BDDA 2AS5F 4MTDA 1KQ8A 3E6BA 2D1VA 1UCRA 1S29A 2OA4A 1K6OA 4BQAA 1GVJA 3T1BA 1XMAA 5JVTA 5DUKA 4KN4X 2BV6A 1LQ1A 2ADUA 4HW0A 5L3CA 3RJPA 3VFZA 1LVAA 1IXSB 4EJWA 2UXNA 1MZBA 1Z6RA 2FF4A 2E1NA 3WG9A 4B8XA 3OOPA 2HS5A 1J2XA 1S3JA 5FD6A 2JRTA 4LG0B 1BBYA 3K1PA 3CO7C 3E6CC 2NAZA 4CDGA 4M71A 1D8JA 3MZHA 1T38A 3ABUA 2E7XA 3N4MA 4I0BA 2NRAC 3KCCA 3MAJA 2IA0A 3JSPA 3O2PE 3BPXA 2FMLA 1SAXA 1BIAA 1B6AA 1J9IA 3KP4A 3HRUA 1FYMA 3I5UA 2MLKA 4BNCA 1Q1HA 3WE3A 1Z6TA 4Z2YA 3EQLF 3FMQA 5FFZA 2DTRA 3E97A 3IKVA 5IT9Z 1P4AA 2HKOA 4BAYA 3ZPLA 1YW7A 3WU1B 4TV7A 1Z91A 4M6XA 1BOAA 1P4WA 4QWQA 5HLGA 3GZ6A 5ICEA 3HOSA 3AAFA 4I7HA 4Q48A 2FXAA 1MJAA 5HLHA 4G6DA 4RB3C 1FYLA 2ZKZA 3FF5A 1U5TA 1V4RA 2Z5UA 3G3ZA 4N9HA 3F8MA 2QLZA 3Q9SA 2H6CA 2FBIA 4LGWA 2R3SA 3WGGA 2JPBA 4HZFA 4M9SA 4YIIA 4XSZF 4IRHA 3TO6A 1U8RA 2A07F 2RV8A 4AWXB 3JTHA 1YG2A 1AOYA 4HQMA 3JAMK 3K1NA 2OAZA 2FMYA 5K5RA 1S7AA 1P4XA 1QPMA 2IW5A 3ECHA 2GIVA 4RB0A 1Z1DA 4LLGF 3BJAA 5CYVA 3I71A 2L54A 4HV5A 4IRIA 2BGCA 1SFUA 3ZN1A 4HDUA 1U2WA 4L9JA 4RAYA 1S7OA 4CHUA 2G7UA 2M87A 4LK0F 5E20A 5AIPA 4P9UA 2CFXA 2O03A 2CG4A 2VXZA 4KICA 2HR3A 4XBFA 1HSJA 5DUIA 4M9ZA 1J59A 3ZMTA 1XD7A 1ZYRF 2P5VA 4A0ZA 3CTAA 2UXXA 3RPUA 1BN5A 1RUOA 1I1GA 1TLHB 3HUGA 1W7PA 3R0AA 1YTYA 1R5HA 2RNJA 1MDMB 4L0ZB 4EJOA 3MFKA 5JFRA 1O3RA 3GF2A 1WWXA 3HSFA 2FEZA 2CW0F 2W57A 3J80K 3DP7A 1SD5A 2DPDA 4Q4ZF 4YIFA 3PQKA 2GQQA 1R00A 1YS7A 2K7LA 2RC4A 3BOQA 3MWMA 3V4GA 5E8GA 2OZUA 4EJVA 1P92A 2CO5A 1C0WA 4GO1A 1EH8A 1V3FA 4P5OA 3C3WA 2ZNYA 1OKRA 1IF1A 3BROA 2MA3A 1SD7A 2QUFA 1ZAOA 4BH9A 1F1ZA 3MCZA 4WK8F 3HHGA 3BY6A 3ZMUA 4P96A 4HQEA 2ZNZA 1R22A 2V1DA 3EUHA 2EV0A 1YW8A 1Z9CA 1R1UA 3T5XA 5HDNA 3E5QA 5D6FA 3HTUA 3K0LA 4ZYHA 4LG0A 2O3FA 5TRDA 4F7ZA 3IRRA 4KA4A 5DCMA 2L4AA 1O3SA 3HIFA 4WXCA 4EJTA 1O57A 2WWYA 2C6YA 4FHTA 2EJRA 4BHCA 1SD6A 2IJLA 4UHTA 5FFXA 3R60A 5IT9K 1OR7A 4U88A 1FWZA 2ESHA 4U7DA 4U0VA 4G8XA 1SMTA 3FXUA 1CGPA 4LB5A 4IHSA 2KJBA 5D8LB 1BI2A 4XSXF 3KLOA 1R5GA 4HLYA 4OIQF 5F1RA 3HRTA 4UVCA 1ZLJA 5LRSA 3QPHA 1XGSA 3H92A 5A2QZ 3BWGA 4YG2F 2P7CB 5E1ZB 1R58A 5EEHA 1HW5A 3LWFA 2KIUA 2EA4A 2HWVA 1TQIA 2V6CA 4I2OA 2VBXA 4CGZA 2VE8A 2W85A 5BOXA 2F5CA 5CVJA 3U2RA 1RZ4A 2XGXA 2RKHA 2YX7A 4KMUX 4M6YA 1ZRFA 1XCBA 1SFEA 3I4PA 3NQOA 4WF2A 2XRNA 1R1TA 1DPUA 2Y0MA 4HA8A 2ISYA 2A68F 3H3ZA 2PEXA 2P6TA 1QQIA 1BI1A 2PG4A 3GX4X 3OV8A 4HV6A 1X3UA 1KYZA 2X4HA 4L18B 3QAHA 2UZKA 5HVQC 2OQGA 3FWEA 5CVVA 4M9XA 4Y15A 1WI9A 1KGSA 2Z99A 2FQ3A 4YFNF 2P4WA 4JQFA 3K1MA 1WQ2A 4WXDA 1UFMA 3D5LA 3I59A 3F72A 1BI0A 3IKTA 4ENMA 3REOA 5HS7A 3QPTA 1JHFA 2VBWA 2OBPA 1UHMA 2GXGA 4LMYA 1EV7A 2IRFG 1XN7A 2DI3A 5LLQA 1HW1A 3TGNA 2P6SA 4A0YA 1BC8C 5FLXZ 1J75A 1TNTA 4N0BA 1PP8F 3U9GA 4AIJA 3J80Z 3RPQA 3WTSC 1FZPB 5A2QK 5KVRA 5FB2A 1MD0A 3RKXA 1KQ0A 3HTSB 4OMYA 5FGMA 4ETSA 5E18F 4S04A 2QQ9A 2QWWA 2GA2A 4GYIA 3CUQC 1E2XA 3DKWA 3PQJA 3LA3A 2Y75A 5LRRA 5HDGA 4LD5A 2NYXA 4G9YA 1PDNC 1FY7A 3TKYA 2P5KA 2A69F 1ZRCA 2EV5A 2A6HF 1D5VA 2PMHA 3CLOA 2EFQA 1KQ9A 3E6DA 5LEKA 5D4SA 4OIOF 1YYVA 3M7GA 1JHHA 4HF2A 2GZWA 5D5VB 3Q9VA 1XSDA 1PP7U 2V79A 2MC3A 1FBQA 1TW3A 5ICGA 2B0LA 2KJCA 4H0EA 3VOEA 4FX0A 3T8RA 3FXRA 3F6VA 2HQNA 1MDMA 4LFUA 4A6EA 4A0XA 2IVMA 1OYIA 3VODA 3L9FA 3FM5A 4HF0A 2Z9OA 1S6LA 1USTA 1DP7P 3LSTA 4HX8A 5FD5A 3V7RA 3GFJA 3KP6A 1I5ZA 1LDDA 1XDUA 2EWNA 1G3TA 3R0JA 4WWCA 1LEBA 3GLXA 3WTZA 5LBQA 4D0PA 3G73A 2VONA 2TDXA 4PGHA 1GXPA 1I27A 2IP2A 2DPUA 5DDGA 1BJAA 3P9CA 4XRFA 1KU2A 3ZMVA 2A61A 5LGTA 1LEAA 2PJPA 2VBZA 2KIMA 1UB9A 2CWEA 2W84A 3M8EA 3K69A 4AIHA 1F9NA 2HTJA 2RQPA 2Y48A 3BP8A 4OOIA 1G3YA 3JTGA 4BHBA 3ZP5A 2QM3A 5ILSA 4DQ2A 1G3SA 1BM9A 1ZREA 1FOKA 2STWA 3BJ6A 3I64A 5CVUA 4AD9A 2FOKA 4S05A 1IN4A 2XIGA 2EFPA 3MQ0A 2EB7A 2MH9A 1ZHFA 1R1VA 3FZVA 1OMIA 1XGNA 5HLIA 1UHWA 2H6BA 1IN7A 4BXUA 4GGGA 2D45A 4UUVA 4MEXF 2XAQA 2HFHA 3TDUC 5DCFA 1FSHA 3FHZA 4RB1A 2F5EA 2NNNA 3HSRA 3ULQB 3VB2A 4G7OF 4HF1A 3JW4A 2Q0OA 4ZZLA 2QVOA 4PZJA 2O0YA 5H6RA 1IUYA 4L5IA 4U7BA 1LDKB 5ICFA 3IHUA 3E5XA 5LHIA 1K79A 3M8FA 2GA1A 3B02A 2HKXA 4BHPA 5LEJA 4KT5C 2VODA 4IJAA 2E7WA 4G7ZF 1IN8A 3EDPA 5HOOA 2M5WA 3B73A 4LLNA 4Y17A 1ZN2A 1FC3A 1FSEA 4I0AA 3LQQA 4YFKF 1PUEE 4HYEA 1O7LA 2GWRA 2M30A 2YPRA 1ZG5A 1IRGA 3I54A 5BQTA 2CYYA 5KK1A 1J7KA 2QENA 1W7PB 3MEXA 5ILVA 4XLNF 4HBLA 2P5LC 2CQKA 3LAJA 3QU6A 2DT5A 3IL2A 2EK5A 2HYFA 1IAWA 5E8IA 5L3FA 2MD5A 5AIQA 3QU3A 3ZMSA 1HKTA 3E5UA 3V7SA 5F64A 4PCQA 2EFNA 2K4BA 5E1WA 1IXCA 2K02A 1L0OC 1A04A 1FBSA 4EMSA 5FO5A 4Q47A 1ZARA 4UNOA 1SFXA 3LA2A 3LAPA 4KIGA 5L3DA 2K27A 4HX7A 2UWMA 1RI7A 3C18A 4ZYDA 4KUMA 2HQRA 3BPVA 4B09A 4E70A 2XAFA 1XGMA 2JPCA 2LF8A 3EYYA 2GXBA 1F4KA 3HRMA 4ESBA 5K1YA 1B59A 1YS6A 1YQAA 3COAC 1FP2A 4IF4A 2XAJA 4Y13A 1XCVA 4N9IA 3WGIA 2KIFA 2G9WA 2JZYA 2DK8A 1RNLA 1F5TA 4NB5A 3O6BB 5JI6A 4WCGA 3SHFA 5IT3A 3HRSA 5BPDA 3QRFF 3EETA 2XASA 3RKYA 2VOOA 1AWCA 5E1XA 1RUNA 2Q8KA 1TW2A 3L09A 1H0MA 4ASNA 2WV0A 5LHHA 2LKPA 2STTA 2FSWA 2FRHA 3ROUA 2EA2A 4A6DA 3L2CA 5HS8A 4XLPF 2QQBA 5ED4A 4RGRA 2XVCA 3W6KB 3WODF 4EVIA 1HSTA 3BJOA 2FBHA 1P6RA 3RDIA 4EGZA 1VTNC 2HZTA 1EH7A 2ISZA 1R7JA 4RGUA 4G6QA 1GXQA 2RVCA 4PGGA 2EFWA 3KE2A 1KU7A 3L7WA 3WTVC 2IA2A 3I59B 1YFHA 1LDJA 3M9AA 3NEUA 2ZBKA 1SD4A 4EQQA 4HX4A 2O8XA 4LK1F 1IRFA 4I98B 1KYWA 3RYPA 3KEOA 2DLLA 1MJBA 1ZLKA 3ISPA 4A2UA 4L0YB 1JXSA 5K5OA 4CXFA 1OYYA 3O3KA 3TOBA 2NNYA 3L00A 4EJUA 2D2WA 4ZH4F 1FYKA 2FU4A 4FT8A 1HXDA 5CLSA 5ERIA 1U5TB 4KDPA 1J5YA 2PBIA 2OQRA 4A5NA 4PDKA 3F21A 1MKMA 1YLFA 1KU9A 3P7NA 1K78B 2L02A 2A3SA 5BMZA 4R1HA 4A5MA 1QGPA 3WU0A 2HEOA 3KP2A 2VN2A 4G94A 2R7DA 3CO6C 1QZYA 4AIKA 1P2FA 1FP1D 4I01A 3RI4A 2YR2A 3HHHA 2M8EA 4MTEA 3EYIA 2OU2A 3WTUC 3QOPA 3H3UA 2WC2A 5D4RA 1XB4A 3V8LA 2XAGA 5D5UB 1WRJA 3Q5FA 1T0FA 4M72A 1FLIA 1ZH5A 2ZCWA 2XHKA 1I6XA 2FBKA
chains in the Genus database with same CATH superfamily
2AQFA 5D5XB 1BR1A 1OPCA 3K9TA 2MSYA 2ZJ2A 3IWFA 2AO9A 2P8TA 3D5SC 3FIGA 2WCC3 3PM1A 1WH7A 4XL9A 4C3HJ 1MSEC 1D5YA 1DPRA 3VEPA 3ZMZA 4ZYEA 5LD2C 3FXQA 2LRSA 3CLQA 1REPC 2BY0A 4FE4A 1EF4A 1IO2A 3CDHA 2ENHA 3ZRGA 5HNFA 1OYWA 2ZSIB 2EM9A 2CRGA 4R79A 4CCKA 2E60A 3HKZA 4DZPA 1NK3P 1E17A 3J7Yp 2EMIA 1YUJA 2CUZA 2Z3YA 3K4LA 4G12A 4D5FA 2WA0A 5C44J 5L3GA 4DIQA 5JHFA 2JSCA 2EM0A 2HVRA 2NVUB 1SMYF 1T6SA 2I10A 4GCVA 5CFFE 2XSJC 3CUOA 2HOEA 1ZG1A 1K61A 3M99B 2CFOA 3PUFA 1XPXA 2XV4S 4DNCA 3IC7A 1Z1BA 1OCZH 5CJ9A 4M3DA 3GO5A 2BHZA 2DFEA 3A0HC 1WHUA 3QYBA 1QA6A 2VKVA 1ZRDA 4CYCB 3C1DA 2QBYA 1X6EA 3HPHA 4HNTA 3CJNA 2VT2A 1IV8A 2DMNA 1FX7A 2F5DA 4KN7X 5TJJA 3TL4X 3H9JA 3L2UA 1IG7A 4HPQA 1G8XA 5IYCJ 1CQTA 4WSPA 1WH5A 2DW4A 2I8DA 4U0WA 5DCMB 2LMDA 3WTTC 3LQRA 4IS1C 2EL6A 4LF9E 3WTYC 3FKJA 3ZQGA 2YRKA 1WHNA 4GZNC 4GKKE 1HBXG 2DIXA 4BGDA 3H5NA 2H1LA 2Z1DA 4MLQA 1HW2A 2OPTA 3LMLA 2JT1A 3F22A 3VYRB 3FXKA 1WKMA 3VYUB 3F6OA 2EOZA 2R7TA 2CUJA 3A02A 2O6GE 1VQKI 3HOYJ 4OMZA 4IZZA 2VRDA 2VE7C 4FETA 5CVRA 3KX2A 4IRGA 3IRQA 3ECOA 3ZMDA 1X6FA 3GTQJ 1LLMC 4JI1E 2GHFA 3EPHA 1G2DC 2A6EF 2L3DA 4JX6A 2RSMA 3DEUA 1DP3A 2Z16A 3ZOBA 5K5QA 3SFIA 3BG6A 1IN6A 3FXMA 4PJLA 3W3CA 4BDYA 2B3TB 2E1OA 1W5SA 4W1UA 3TP3A 4YIRX 3R61A 3MD2A 1HDDC 1X2MA 3BTJA 3RKWA 1WSUA 1NTCA 3KEQA 5FLMJ 2R93J 1QNTA 5H20A 4ESFA 3JR9A 3GW2A 4HOBA 4I09A 4E7HA 2VBYA 3GLLA 3R6SA 1J5EE 3CUQB 4KIBA 1K7AA 2CU7A 2YSPA 3DFGA 1SEUA 5D8KB 1BOBA 3SZGA 3Q3SA 2EMLA 2R76A 2EFOA 4K2EA 4O3MA 1IN5A 3F8BA 1X1AA 4XK4A 5GAGJ 1O3TA 3NWTA 4XONA 3S17J 2FOWA 4O6JA 4I76A 5LGUA 1RQ0A 2XROA 2PN6A 2W25A 1DDNA 2EN6A 3GFLA 4A3KJ 4I99C 2LNBA 3GBGA 2GM4A 3ZQQA 2PRTA 2AHQA 3ERMA 4JI3E 1FTZA 3GTJJ 1JTYA 2MC6A 1XSVA 3DEWA 2LREA 4X62E 2DDBA 2DB2A 5AASA 1QU6A 5AC5A 3VYSB 2XB0X 2V9VA 3K2ZA 2KHMA 3BCBA 4OINF 2YTIA 3CC2I 4HLXA 4EGYA 2HYGD 1A31A 2EOMA 2Z33A 4K0KE 3S1NJ 3HZJA 4I6ZA 1TF6A 2H27A 1IBME 3CUQA 3UR3C 4DJAA 4U0YA 3BR2A 2ETHA 5KL2A 4XLAA 4FK5C 3GUDA 3RQ4A 3A03A 3GVAA 4DYRA 3S3OA 2WTEA 4QLCU 2L4MA 3DKYA 3TO7A 3J80C 3DWLE 2YTGA 1IZ1A 2JRMA 3BTLA 1TC3C 2LLKA 4NZVA 2OD5A 1W7PD 2MGQA 3HGYA 4WX9A 5KL7A 4GKJE 1LB2A 2DA5A 3K4CA 4J01A 2DOEA 2P7VB 1WFXA 5C4JJ 2ZXJA 1VQ5I 1BBGA 1A6IA 2MG4A 1PVEA 4MGRA 3SXYA 4F91B 2OZ6A 3KP7A 4UV9A 3V8JA 4DYQA 1ITYA 1I1SA 2LJUA 4KMFA 2ICWG 2F2EA 3F8NA 2E2IJ 1GT0C 3ZN0A 1IBKE 3HYIA 3AFHA 1O3QA 2L7ZA 1LJ9A 1NH3A 3ZQIA 1MNMC 2WBTA 3GTMJ 4XLFA 4E7IA 3HXLA 5F0FA 1MSFC 2FD5A 1B8IA 4KFCA 4CZZA 2AXTC 1W4MA 5GP9A 3S1MJ 1R9TJ 1BA5A 2R7WA 5AE3A 1HKSA 4RB2C 3S15J 2EQ1A 2F5FA 1Z67A 2JA7J 3SZPA 2DRPA 3E7LA 3KP3A 4EATA 2LC2A 1T56A 2VC0A 2XAHA 1D8KA 1ETOA 3TP0A 3J81K 2LMZA 2MLGA 2UUCE 1RESA 5EGOB 3M1EA 2DA2A 4G6TB 4XRMA 2VPLA 3SFZA 3LA7A 3AG1H 1UG0A 3AG3H 2O9LA 3VK6A 3DCFA 1FJLA 1BI3A 4NHJA 1RIOH 2FTXB 1T39A 1ON1A 3DQVC 4E7KA 2V1UA 1TNSA 4BBSJ 3R4KA 5EYRA 2ZO4A 4UUTA 2DQLA 4D5CA 2LUPB 2X1EA 5GTIC 3ZXSA 2FNAA 3KZIC 3MKYB 2GIZA 4I02A 4EV0A 4F6MA 4XLCA 2L01A 2EN2A 2XKPA 2Q2EB 4V19K 3EPJA 5LGNA 1BC7C 4ENJA 3NARA 4A12A 2PMZA 5F1JA 1Y8RB 1XS9A 2QBYB 1RETA 4JYKA 3OSGA 4YFXF 1G3WA 2K3FA 3ZOQB 1FPQA 4KIFA 4X0GA 1PDAA 4NBQA 5A6BD 4GXOA 4RM2A 3KETA 1WXRA 3U1DA 1KU3A 3AKZA 1T4LB 1W5TA 3ONQA 1JGSA 2QZ8A 2HDCA 3G1MA 3ZQHA 2DMPA 3TO9A 4FX4A 1R71A 5DM6F 1QHHD 2DXIA 4AYBN 2GLIA 4L9VA 2YSRA 4LITA 5J8CA 3Q0UA 3T0YA 1Y0NA 3E3VA 4LLLA 3SYTA 4KYWA 2IS1A 4IPAA 5D5WB 4DGWB 1JE8A 2CS3A 2PLYA 3LSRA 1B72A 1ZGAA 4ENNA 1LPQA 4EM0B 2YX4A 1Z3YA 3C6KA 1S8NA 4C2UA 4R2CA 4DBQA 3K4JA 2COMA 2DOFA 3QYEA 2N8GA 3CJQB 1SC7A 1MMGA 1IXRC 2EPNA 2NUGA 2E35A 1N33E 4OIRF 5F04A 2DFIA 4MFEA 4X1EA 4M2ZA 2K86A 3K10A 5ILUA 2K4VA 2VOPA 2LJHA 2FE3A 3I0TA 3VYXA 1X3CA 3V7CA 2CUFA 2ODRC 4DV5E 4M74A 3IWBA 5HLTA 3QP5A 2GOMA 1YO5C 1NHAA 2XUBA 1SANA 4EM1A 2ELHA 3PUBA 5AC4A 2ESNA 5LHGA 3JRCA 2UV1A 4DR2E 4IX7A 3WTXC 1MH3A 4O24A 4KT6A 4MIMA 1ETYA 2PFBA 2B9DA 1V5FA 3FMSA 2OUMA 1RR7A 2D1HA 1ZAAC 5KAFC 2OF7A 2W24A 3HBLA 2ZJPF 1ONVA 4ESJA 3K6QA 4M73A 4N4RB 2M0CA 2CW8A 4F2JC 4NXME 3HPZA 2H1KA 1TT5B 4XMYA 4L9TA 1XGOA 4LIVA 5GTHC 1STZA 1H9TA 2LOOA 2CQXA 4L9NA 3KFWX 4AVPA 4MQ9F 3MVPA 1I6HJ 4LF5E 1Z05A 3JAMZ 2M45A 2NXNB 4NXNE 5DEQA 3J81C 1Y1WJ 3FKIJ 1PUFB 5HDNA 3M07A 3PSIA 2EN4A 3BC8A 3KP5A 2EMGA 5GPAA 4Y3OA 1X2NA 1YZ9A 3CCQI 2BBGA 2KKOA 2LSOA 3P9IA 3MZYA 2BEOA 3QPSA 5EDNA 4A3LJ 2EORA 2MH2A 2ZC2A 3T1HE 5HS9A 1U8BA 1WI3A 3HOZJ 3HGGA 2LF7A 1HA8A 1Y0UA 1J0RA 2HVQA 1GV5A 2HQ5A 2KISA 4GRIA 1VNDA 3HOTA 2EMAA 4M3EA 2EM7A 1G4DA 2PQ8A 3F3XA 3K2AA 3D0SA 1U6GA 1UELB 3K70D 4CO8A 1H89C 1BIBA 2BBYA 4E6KG 5HDKA 4OU0A 5LMNE 1VQNI 5AE2A 2CGPA 3S93A 5ICCA 1VQ9I 2IT0A 3P9KA 4ZYGA 3M1CA 2NS0A 1HNZE 4CZCA 3S2WA 4BYYA 3SEQA 3ABTA 4LFAE 4BY7J 5JVGF 2R7XA 3PFIA 1B9MA 4P9FA 2EQ3A 4OIPF 4JBAA 3ZQ7A 4ZZDA 1ZBQA 2JR1A 4QPOA 4LB6B 3J7YJ 4WXHA 1MBJA 2H09A 1B69A 4XKVA 2VC1A 1OFCX 2WAFA 2X0LA 2LH9A 1XSXA 1USSA 5IYDJ 5K7HA 2X6YA 4JK1X 1A36A 1DGWY 4MNUA 1B9NA 3E1SA 2MABA 1T08B 4MHGA 1U3EM 1N75A 4RH8A 1ETWA 2ZMEC 3LL7A 4Q5SF 1ETXA 1RC9A 2QQAA 2G7HA 1MH4A 2NOGA 2JY9A 1TQPA 5L3EA 4XNFA 2QQ8A 4P1WA 5C4XJ 2E5ZA 4Q28A 4ZJZA 4DUZE 4H4KC 2JTVA 4PSXA 2PI0A 2DJIA 5DYMA 2R1FA 1L3LA 3IWZA 3SZTA 1SVLA 1MJ9A 2R7UA 2MDRA 3IWDA 4LIUA 2BYVE 1FT9A 4KNYA 5BS6A 3E6MA 3CMAI 3ADGA 1TWGJ 3BCAA 1P7IA 3O8HA 1UHSA 2ZFWA 1MBGA 1D3YA 1LFPA 3FM3A 1AHDP 1R5ID 1R4MB 3DXJF 2PX9A 2FNPA 3GEZA 3AUZA 4X8WA 1UZCA 5EEAA 2RN7A 2JUCA 2EWLA 2BVLA 1FIPA 2YPNA 3MKZA 3CMMA 3KIOA 4DV1E 1DU6A 2DBBA 4B3XA 1F2IG 4RA2A 2HOAA 2R7QA 4IHTA 3ADJA 1R36A 2VT3A 2YZTA 1Y39A 3RYRA 2F4MB 3NRVA 3GZ5A 1IDZA 2EN7A 2P0WA 2IAIA 3ERED 5H6QA 2VKHA 1TP4A 3VDXA 5BPIA 3S2HJ 2EP3A 3HQ1A 2ZMEB 3EUHC 3GCMA 1GHCA 3TQNA 3UNGC 4O5VA 1N25A 5L3BA 2EMFA 1ZG3A 3K4MA 4UVAA 5JR3A 2M7BA 3IP4B 4XKBA 1VF9A 4RGSA 4IEJA 1ZQ3P 2YWQA 1TTYA 3DTKA 5FRNA 5FKNA 3CCSI 3LFKA 3W6JB 2X6WA 1ODDA 5GPCA 4NDLA 4XOTA 5IWAE 2ELJA 3GWZA 4QPQA 4HDVA 3I58A 4ENKA 1TL8A 2PJRB 2EOHA 2L6MA 2DDAA 3TDZC 2KL4A 5DD4A 3MHHC 1YUIA 2VJJA 2EIMH 3FMRA 2XAUA 4XN3A 1CF7A 2WZOA 2NABA 2Z2SB 3HSEA 2M0MA 2L9VA 3J7AO 1TQMA 2FA5A 3BG9A 1QHGA 1ON2A 3GFIA 1HC8A 5FROA 2IGNA 3J81Z 1Y1VJ 2DAOA 1MEYC 2Y31A 2HTSA 1B4AA 1R23A 3QP6A 2VJIA 3SDGA 4UV8A 2DU9A 4CICA 4RGXA 3C4TA 5F6FA 4E7ZA 1OCOH 3WTWC 3PO2J 1X1CA 1XDSA 1D0YA 1LVKA 3TOAA 4CUGA 3LSPA 4ON0A 2DMIA 2YTPA 2KONA 2H94A 1IW7F 4IHVA 2PMUA 2VQHA 2AXLA 2YU3A 2M9HA 4XQFA 1MGTA 4QIWN 2EOFA 1PUFA 3KZZA 1VQLI 1ZGJA 2RDPA 2HI3A 3DPLC 4MQVA 2N8XA 2J5OA 4AQYE 4DYCA 4UUSA 3RMPA 3BQYA 1J26A 3CP8A 4RAZA 3RIRA 2EV6A 5HNHA 3K4KA 2ADRA 3J7AG 2M7QA 3DF8A 1FNNA 2OC6A 1CF7B 5E17F 4UXNA 2EPRA 2GAUA 1QZZA 1U78A 2LTPA 3I53A 1TBXA 2FGGA 4GYGA 2DQRA 2JYAA 1T2KA 2ME0A 2L9SA 2OV7A 4XRSA 4Z6YA 1TF3A 1QO0D 2EMYA 2E36A 2KRFA 1K78A 5KL6A 5EEGA 4IVNA 1UAAA 1P9QC 2XF6A 3DV8A 4CYDA 5M3MJ 2EN8A 3TBIA 4R8OA 2MDGA 4O5GA 5LFAA 4R8HA 3A2KA 3FXLA 3E0JB 2WB1A 2PMZN 2M1BA 4IXAA 4L5JA 1AA7A 3F8CA 4BE0A 1HCRA 3GTLJ 1BW5A 4ZDLA 1Z7UA 3VPRA 4LU9A 3S1QJ 1MMSA 2LDUA 2EOIA 2CQNA 5DD8A 3W6VA 2R7SA 4ZDPA 2V1XA 2HGCA 3DBLB 5BNGA 2MFZA 4KWYA 2E1CA 3T8TA 2J5PA 4DV6E 2A5YB 4A3MJ 4RS8A 4P55A 1T98A 3IAM2 4XLEA 2CV1A 5FLXK 5C3EJ 2DK5A 2ID6A 4BUPA 5J8FA 5EGOA 1HKQA 4C2MJ 4HAMA 2VE9A 1V5GA 1FBUA 4HG2A 4G7HF 3JSOA 2YTNA 2RGVA 3GFMA 4ANJA 1O7FA 2F5VA 2XDVA 2LBFB 1OCTC 3BR5A 3GXOA 3IAS2 2IPQX 2XKOA 4MEYF 3RTRA 5J6XA 3N97A 1PJTA 2N3GA 2CMPA 1YYWA 2QSFX 4PK4A 2HPMA 3SQNA 3WGHA 3CESA 1DUXC 4BACA 2ECBA 5J3LA 4DW6A 1X48A 3QPLA 1W1WE 2VI6A 4OOGC 1B1BA 3PIOF 2LTRA 5JHUA 1A1IA 4LJZF 4NQWA 2DO7A 2Q2EA 2EQRA 1SFKA 3KWRA 2MBFA 3FX3A 3KLNA 3LOCA 2ECCA 2VQGA 2Y69H 1X19A 4EM2A 1STUA 1YIOA 3AL0C 2K5CA 3BG7A 2UUZA 1AH5A 5DV5A 2E5NA 2DMYA 1EH6A 2V85A 1H9GA 2DGCA 1D0ZA 4RMNA 3HOWJ 3V8KA 2JOBA 2F4OB 1G6NA 1LFBA 3CCLI 1U5TC 3MMYB 1HQCA 4O4KA 3VYYA 3CCUI 3CF5F 5D6EA 5AONA 3LSJA 2NA2A 1YW9A 1QBJA 2K4JA 3DPTA 4UVBA 3WE2A 2CSHA 1N3GA 4V2GA 3GYHX 2CSOA 1JKOC 1SFOJ 2QYOA 4PJ0C 3F8FA 2BE5F 2X6OA 3K4NA 4NUBA 5LL6R 1ULYA 5KNLA 3OIPA 2EIKH 1P7JA 2K85A 3I55I 4CCJA 2ACJA 1X4OA 3C2HA 5JLWA 5DM7F 3F23A 1LNWA 3BZ6A 3ML6A 6PAXA 2EOJA 1GVDA 1XMKA 4RHBB 2R7FA 3U21A 2DA6A 1JK1A 3ELKA 2V26A 2ZMEA 2R5YA 3MHSC 2IA1A 1AKHA 1XNQE 4B43A 3C7JA 1I39A 3KZYA 1KA8A 5CVIA 5TGTA 1YPNA 3BDDA 2AS5F 3HKZN 2YU8A 4MTDA 2KZGA 1W36D 2ZB9A 3E6BA 1IJWC 1KQ8A 2DTZA 2D1VA 1NEIA 5A6KA 1UCRA 1S29A 2OA4A 1K6OA 4BQAA 2HC5A 5F27A 1FJGE 3JAMC 2XRLA 1GVJA 2IGOA 4OAYA 1H88C 1K6YA 2FJ1A 2LUQA 2DOAA 4R03A 2KRCA 3T1BA 4ZTFA 4XM3A 2L2KB 3WG7H 1OISA 2O8KA 1XMAA 5JVTA 5DUKA 2EMHA 4KN4X 1RPWA 2BV6A 2KLOA 1LQ1A 4RLQA 3LSHA 2KOUA 3OMLA 2ADUA 4HW0A 1WGXA 5L3CA 3RJPA 2VLAA 4KISA 3VFZA 1LVAA 1IXSB 4EJWA 2UXNA 1MZBA 3A0BC 2B9SA 1Z6RA 4BU2A 4HEA2 2V83A 2FF4A 4AIDA 2E1NA 3WG9A 2EPUA 4B8XA 3OOPA 2DMTA 2HS5A 3IV5A 1J2XA 1S3JA 2X1CA 1V54H 5FD6A 2JRTA 3DJWA 2EPZA 4LG0B 5FLXC 2DA3A 1JGGA 5EF6A 4PFOA 1BBYA 3K1PA 3CO7C 4L8NA 2Y9YA 2LV2A 4Y4RA 2VIXA 3FBIB 3E6CC 3HDDA 4IJDA 4WYQB 2NAZA 1OCRH 4CDGA 4JI7E 2W4SA 2EZLA 3F6HA 4FE7A 4M71A 1D8JA 1MIJA 1WJFA 3MZHA 1T38A 3ABUA 2LP0A 2D5VA 4JP0A 2QSHX 2E7XA 3W2VA 5K7ZA 3N4MA 1S72I 2JUGA 3GTKJ 4I0BA 4X9JA 2NRAC 3KCCA 3MAJA 2V89A 2IA0A 3FBNB 2CQQA 2RQLA 3JSPA 3PJRA 2QGUA 3O2PE 3BPXA 4PFPA 2FMLA 1SAXA 1DU0A 2WY8Q 1S9HA 3QOEA 2LG4A 1X4PA 4XIDA 2LY9A 1BIAA 1B6AA 1VQ4I 1J9IA 3KP4A 3HRUA 1FYMA 4XN0A 3I5UA 1TWHJ 2E2HJ 2MLKA 4BNCA 2LVSA 2Y0SA 4JOMA 1Q1HA 3WE3A 1X3WB 1Z6TA 3L2VA 4Z2YA 2MW8A 3EQLF 3J7ZI 2VB6A 3W2WA 3FMQA 5FFZA 2DTRA 2RQQA 3E97A 3IKVA 3HG9A 3KEYA 4M3BA 2ELZA 3BF2A 5IT9Z 1P4AA 3HTXA 2KRHA 3M4OJ 2L2NA 2HKOA 4BAYA 3ZPLA 2M9AA 2BHYA 1YW7A 5DTDA 4B47A 3WU1B 4TV7A 4QSHA 1Z91A 2B7VA 1A1JA 2ID3A 4C2TA 4M6XA 1RR8C 1WJAA 3MZ8A 1VI0A 3FIWA 1UHZA 2JVAA 1BOAA 1P4WA 4QWQA 4E7SA 5HLGA 1I94E 2IXSA 3OR2C 3GZ6A 5ICEA 1DQUA 2JK3A 4CSWA 4E7LA 3CMYA 4CYCA 2V7FA 3PNVA 5CKTA 3G1LA 2H8WA 3HOSA 1A1KA 1DI2A 4CCOA 3O8GA 3AAFA 4I7HA 4M6VA 1LUJB 4D7NA 3OYBA 4Q48A 4ZTJA 2FXAA 1MJAA 1IV6A 1FMVA 5HLHA 3DBRB 1GQEA 1JK2A 2DYSH 4G6DA 3DU5A 3G4SI 2WAEA 2CQ7A 4RB3C 3H35A 3DLLF 3OYCA 1FYLA 2ZKZA 1YRNB 3FDYA 4DZJA 2YRHA 2CPNA 3FF5A 1U5TA 1YHQI 3DTIA 1V4RA 2Z5UA 3G3ZA 3DTEA 2XB5A 4N9HA 3JRDA 4DBRA 2ODRD 3F8MA 4PJMA 3HJEA 2QLZA 2V4JC 2VF1A 4LF7E 2NVYJ 3Q9SA 5E3NA 2H6CA 2FBIA 3CCRI 3B6CA 4LGWA 4AVZA 2R3SA 2ZFUA 3WGGA 2JPBA 4HZFA 1N32E 4M9SA 2ZXIA 3CJRB 4YIIA 4XSZF 2EM3A 2G0EA 4IRHA 2HHHE 2QKLB 3IH4A 4NNJA 3TO6A 1U8RA 2A07F 2R5ZA 4GEQB 2IGMA 2RV8A 4HNVA 5J4VA 2IHR1 1QVTA 2QKMB 1G59A 1ZBTA 3H0GJ 3MN2A 1YOVB 1EKEA 4AWXB 3OL3A 4PUSA 1Z21A 2COBA 3CZ6A 3JTHA 4A3BJ 1YG2A 1AOYA 2R92J 1AKHB 4DR3E 4HQMA 4AC0A 5KL4A 3JAMK 3GTPJ 1Y6IA 3K1NA 2OAZA 4A3DJ 2FMYA 5K5RA 1S7AA 5M5YJ 1P4XA 2GXAA 4JI6E 2BW3A 4F92B 1QPMA 2IW5A 3F0CA 1UJ8A 3ECHA 1F43A 1OCCH 2GIVA 9ANTA 4RB0A 1Z1DA 4LLGF 2VXDA 2JOXA 1V55H 1WCMJ 3BJAA 4B44A 5CYVA 2YS9A 3X2QH 2WADA 4BL0B 4HNUA 3I71A 3V42A 4A3GJ 2L54A 4HV5A 2L3CA 4B3SE 2BY1A 4XICA 4IRIA 2EOSA 1RMDA 2BGCA 3CDLA 2HOTA 1GZ6A 4LG3A 1SFUA 3RZDJ 3DLAA 1YX5A 3ZN1A 4HDUA 2JVGA 1U2WA 2UU9E 5CPRB 4L9JA 5GAHJ 3CJTB 4RAYA 3FISA 1S7OA 2BOLA 2EIJH 2GPIA 1D1AA 4R2EA 4CHUA 2G7UA 2V1NA 2M87A 4F3QA 4LK0F 5E20A 5AIPA 5TSEA 4P9UA 2CFXA 4M3GA 1NG6A 2O03A 2Y2ZA 2L3JA 4C30A 1OCPA 5EZGA 1HDPA 1TT0A 2CG4A 2M34A 3S3MA 2VXZA 4KICA 1IUFA 2HR3A 2EN1A 4BQOA 4XBFA 1HSJA 5DUIA 4M9ZA 4RAFA 1IRXA 2JMWA 2LO3A 4DR6E 1FEXA 1J59A 1BB8A 3ZMTA 2CW7A 2EPAA 2LRDA 1GV2A 4DKKA 2DA4A 4AM3A 1XD7A 1ZYRF 2P5VA 4A0ZA 3CTAA 2UXXA 3RPUA 1YYOA 4B4CA 1BN5A 1U9OA 2MYSA 4BE1A 3LSGA 4R2RA 1RUOA 1I1GA 1TLHB 1T33A 3HUGA 1W7PA 3R0AA 2EMBA 1YX3A 3CP2A 1YTYA 4B3AA 3AG4H 4J00A 4X6AJ 5IPAA 2ENCA 1YYKA 1R5HA 4JI2E 2L0KA 5AE1A 2RNJA 4B3RE 1B8IB 1T4NA 1MDMB 4NQWB 4L0ZB 2E1MB 4EJOA 3OOUA 3MFKA 2DCEA 5JFRA 1O3RA 3GF2A 4HSRA 1WWXA 3LSKA 3HSFA 2FEZA 2AQEA 4BC9A 2CW0F 2W57A 3J80K 1IQOA 3DP7A 2HPIA 1SD5A 3G71I 1NG7A 2DPDA 4Q4ZF 5A6JA 4LF8E 2X51A 4YIFA 3I4NJ 4CCNA 3PQKA 2GQQA 2V8QB 1R00A 1YS7A 2K7LA 3RKQA 2RC4A 3BOQA 3MWMA 3V4GA 3Q0VA 5E8GA 1FKAE 2OZUA 4EJVA 2VQCA 1P92A 1WVRA 2CO5A 4HEIA 4DOZA 3WHCA 1C0WA 1PYVA 4PSWA 4GO1A 2GLOA 3OYKA 1EH8A 1V3FA 4P5OA 3MSWA 1S7EA 2ZNYA 3C3WA 4JI8E 1X58A 3OWTA 4E7JA 5M3FJ 4IKFA 5EJCA 2EZ6A 1JJ6C 1HOMA 4IHWA 3OS0A 1OKRA 3DBHB 2R7ZJ 1GLNA 3LFUA 3G2BA 3UK3C 4A3IJ 2M8GX 2E19A 1IF1A 3BROA 2ME6A 4XLHA 2CV0A 2MA3A 1SD7A 4FQGA 2CUEA 4F54A 2QUFA 3J7AY 2K9NA 1ZAOA 3THOB 1HNXE 1YJNI 4BH9A 4BQQA 1F1ZA 2R7OA 1IBLE 3MCZA 2X9DA 4BMJA 4DV7E 5HODA 4WK8F 2B7EA 2LYCA 3HHGA 3BY6A 1W36C 5E3OA 1LE8A 3ZMUA 2EE8A 4P96A 4HQEA 2ZNZA 1R22A 2V1DA 1JTXA 3EUHA 2EV0A 1YW8A 2YSOA 1SVOA 4KITB 1Z9CA 1R1UA 1M1EB 2VJ5A 3T5XA 4BEHB 3RSNA 3ABLH 2JWTA 3E5QA 5D6FA 4ABZA 2HXOA 3HTUA 2NVQJ 3K0LA 4ZYHA 4LG0A 2WBSA 2Y0SN 1WJCA 2O3FA 5TRDA 5J1YA 4F7ZA 2Q1ZB 2NUFA 3IRRA 1XMXA 1Z3XA 4KA4A 5DCMA 4IQ4A 2NS8A 4XKCA 4JI4E 2L4AA 1D1BA 5B66C 1O3SA 3HIFA 1JT0A 4DMIA 4AUXA 4WXCA 2EBIA 4EJTA 2ELYA 4JX5A 2EMZA 1O57A 2WWYA 2C6YA 2I9IA 4FHTA 1BW6A 4BJ5C 4QTRA 1HF0A 2DN0A 1OR7C 1BR4A 2EJRA 1MW7A 3FK7A 4BHCA 1K4TA 2RAEA 2VJ4A 3D5RC 5EG0B 1KJKA 1SD6A 2IJLA 1S5LC 5CQEA 4UHTA 5FFXA 3R60A 4MFDA 5A6AA 5IT9K 4R2DA 1OR7A 3BG3A 4U88A 1ZR9A 4F6NA 4F9CB 1FWZA 2RNGA 4YEJA 2ESHA 4U7DA 3CCJI 2VKDA 4U0VA 2VQLA 1SMTA 3FXUA 4G8XA 1CGPA 4LB5A 2UXBE 4IHSA 3JRHA 2KJBA 3OSFA 5D8LB 1BI2A 2L5QA 4XSXF 1ACIA 2V9KA 3KLOA 1R5GA 1XC5A 2KQRA 4HLYA 4OIQF 2O61A 4UB8C 2J7JA 5F1RA 2LBSB 3HRTA 4UVCA 3PNTA 1ZLJA 5F3WA 5F08A 3M8JA 5LRSA 3I4MJ 5E3MA 3QPHA 2K9LA 4KJZA 2VQFE 1XGSA 3H92A 2BZTA 1WJEA 2BY2A 3L2QA 2E72A 4DUYE 2UUBE 5A2QZ 3CMEI 4S0HB 2K3PA 1TWFJ 3NAUA 4IO9F 2YTOA 3BWGA 2EZKA 4YG2F 2P7CB 1D0XA 3BZCA 4Y52J 5E1ZB 1QRYA 1R58A 3HL2A 1FOXA 5EEHA 1HW5A 3LWFA 2KIUA 5BR8E 2F8BA 2EMXA 4A3CJ 2EA4A 2HWVA 2BXYA 1TQIA 4X64E 2FQ4A 2V6CA 4I2OA 3KYDB 2JQ7A 2VBXA 2ENAA 3BR1A 2K9QA 2XSDC 1ETVA 3EUAA 4CGZA 2VE8A 1KYQA 1APLC 4JI5E 2W85A 5BOXA 2LY2A 2L33A 4P7DA 1SVMA 2F5CA 3BR3A 3IH2A 5CVJA 3U2RA 2YU9J 1PJSA 1RZ4A 2XGXA 2XF7A 2V88A 3OR1C 2RKHA 4CA0A 2LKSA 1YRNA 2YX7A 4KMUX 2M1SA 4M6YA 4ZDOA 1ZRFA 1XCBA 1SFEA 2KDOA 4OAZA 1ZK8A 3ZR8X 3I4PA 3G6EI 2JPAA 2LD5A 2A5WA 2O7OA 3NQOA 1Q1VA 4WF2A 2XRNA 4C9YA 1ETKA 1R1TA 2CH0A 2EPFA 2K40A 1DPUA 2Y0MA 2WAQN 3ZQCA 3Q0WA 4HA8A 5FRMA 2ISYA 2R7VA 2V9PA 2A68F 3CCEI 3EPZA 3H3ZA 3KYLA 1XMQE 4IOCF 2CTDA 5KHDA 3OYGA 1W0TA 3OS1A 3S3NA 2DMQA 2OTJI 2PEXA 2P6TA 3HPGA 4DV2E 2OCCH 3N05A 1JKRC 1ZTRA 1QQIA 1BI1A 2PG4A 1Z7LA 3RCOA 3SJMA 3EQ1A 2ZSHB 2KPMA 3GX4X 1E0EA 3OV8A 4HV6A 1X3UA 4LTYA 1KYZA 2X4HA 4L18B 3QAHA 2UZKA 2LR8A 5IYBJ 2YTDA 5HVQC 1MMDA 2OQGA 2VQEE 3FWEA 5CVVA 2RS7A 4BBYA 4A3JJ 4M9XA 1R49A 4BKXA 1IQSA 4DR4E 4Y15A 3WHBA 4BE2A 1WI9A 2HDWA 1ZKGA 2F48A 1OJLA 2HVSA 1KGSA 2L9NA 4BXFA 3H0DA 2JA8J 2Z99A 2WAQA 2FQ3A 4YFNF 2IS6A 2P4WA 1X47A 4JQFA 1ORKA 3K1MA 1WQ2A 4WXDA 1R6RA 4YELA 2EPMX 5J1RA 1UFMA 4IQJA 2K7IA 4LFCE 3AG2H 3D5LA 3I59A 4F9AB 3W2AA 4P78A 3F72A 1BI0A 4BXXJ 3IKTA 4ENMA 3REOA 1VQPI 3ABMH 5HS7A 2LFBA 3QPTA 5B1BH 1JHFA 1X49A 3OL4A 2VBWA 2OBPA 1DGRM 2M3AA 3CC4I 2YRMA 3ADLA 2A25A 5FKKA 4MLOA 1UHMA 2GXGA 2IBDA 3CDIA 4LMYA 3ESWB 1EV7A 3S16J 2R5ZB 1XN7A 2IRFG 2DI3A 4CCLA 2HQAA 2JN6A 2LBFA 4F55A 5LLQA 1BJZA 1HW1A 3TGNA 3PFYA 2P6SA 2WB1N 4BJTA 3ECRA 4A0YA 4BY1J 3PSFA 4HTGA 4A93J 5LMUE 4FTHA 1LKXA 1BC8C 5FLXZ 3DKXA 2EL4A 2WBUA 2ZXHA 4TUIA 2JA6J 1J75A 2R0QC 3S2DJ 1TNTA 2JVHA 4N0BA 2QCOA 3U9GA 5J1UA 3J80Z 3OYEA 3RPQA 3WTSC 4AIJA 1PP8F 1FZPB 5A2QK 5KVRA 1SR9A 5FB2A 2A05A 3JTZA 1MD0A 1UILA 2HOSA 1P47A 2KFDA 3OYMA 3RKXA 1MBFA 1N36E 1KQ0A 2XC7A 1NCSA 3HTSB 1I50J 2UUAE 1LFUP 4OMYA 5FGMA 4ETSA 5E18F 5GAEJ 2ZJRF 3OS2A 2QQ9A 2QWWA 4S04A 2GA2A 2YT4A 2R4GA 3CUQC 4GYIA 1E2XA 3DKWA 4IL6C 2LKXA 3UKGA 3CCVI 3PQJA 3LA3A 2Y75A 3IUOA 5LRRA 1RC7A 5HDGA 4LD5A 1XTAA 2KHXA 4MO7A 2NYXA 2B7TA 1K83J 3BZKA 1G2FC 4JYAE 4G9YA 3GZNB 1PDNC 3TQMA 2L7KA 4BQNA 1FY7A 1RRJA 3TKYA 2P5KA 2A69F 1ZRCA 2EV5A 5IOZA 2A6HF 2DODA 1D5VA 2PMHA 3CLOA 3L1PA 2WV1A 2EFQA 5CQGA 1KQ9A 5KAIC 3BTCA 3E6DA 5LEKA 2YTEA 4RDUA 2R5YB 3OIOA 2YUSA 5D4SA 2TRTA 2KMUA 5F0CA 2NS7A 1YITI 4OIOF 1YYVA 3QODA 2DMUA 3M7GA 3CCMI 1ZU1A 2EL5A 1ZGWA 2DJNA 2ZXWH 1JHHA 1T0FC 5J4YA 2EINH 4HF2A 2EM6A 2EMCA 2GZWA 1ZR2A 5D5VB 1WJBA 2K9MA 1J09A 3S1RJ 1U9NA 3Q9VA 1YIJI 3VWBA 1XSDA 2JP9A 1A1LA 1HNWE 1Z77A 1PP7U 2L9RA 1ENHA 2QA4I 2V79A 4ZYAA 1IGNA 1YE9A 2LCEA 2M4KA 5H2FC 1N78A 2JWOA 2MC3A 1FBQA 3WU2C 1TW3A 5ICGA 3ZQLA 2B0LA 2KJCA 3D1NI 3CF2A 3OYHA 3S14J 4H0EA 2HXIA 4IHXA 1E3HA 3VOEA 3VSKA 4FX0A 3T8RA 1A1GA 3H5AA 2P81A 3FXRA 4A3FJ 3F6VA 2HQNA 4A6EA 4LFUA 1BR2A 3P5JA 1KZHA 4A0XA 2KDZA 5B3SH 1MDMA 5J47A 1ZELA 2EOOA 2IVMA 2OTLI 1VQ6I 1W0UA 1OYIA 3VODA 4BBRJ 3L9FA 3FM5A 1MBKA 2FUG2 4HF0A 4C3JJ 2Z9OA 3JU0A 1S6LA 1USTA 3TW6A 1DP7P 1DQ3A 4X66E 1LE8B 3LSTA 3F6GA 4HX8A 4XR6A 5FD5A 1XMOE 2UXDE 2M7AA 1QZEA 2KZVA 4FASD 2O5RA 3GFJA 3QQAA 3V7RA 2EZHA 4IHYA 1EJ9A 3KP6A 1QU3A 1I5ZA 4BCAA 3RZOJ 3FXOA 1LDDA 1XDUA 3BLYA 2FV4B 2EWNA 3IWCA 1G3TA 3R0JA 2EOQA 2L7FP 4WWCA 1LEBA 4MLVA 3GLXA 3WTZA 3TW7A 3THNA 2DA1A 5LBQA 3QWLA 4D0PA 3ZCOA 4DV3E 4BJ6C 3G73A 2VONA 3EPKA 2TDXA 3DF6A 3A1YA 4PGHA 4A3EJ 1BBOA 3LNQA 1GXPA 1I27A 5IY5H 3FK6A 3S8PA 4UY8I 3OYFA 5IV8B 2IP2A 2DPUA 5DDGA 3BG5A 1K4SA 1BJAA 1X3ZB 3P9CA 3OYDA 4XRFA 1KU2A 3K6GA 3ZMVA 2EJ4A 2A61A 1PJRA 1Z0XA 5LGTA 1LEAA 5T6JA 2PJPA 2VBZA 2E5LE 2X6XA 4XORA 2KIMA 1UB9A 1UBDC 1X6HA 1Y56A 2CWEA 2W84A 3GTGJ 5A2QC 3M8EA 2ZM6E 2L2MA 2W82A 3K69A 2K9SA 4AIHA 2M4IA 3VSLA 1F9NA 5EZHA 2HTJA 1X1PA 2RQPA 1TWCJ 2Y48A 1DGCA 2RREA 3BP8A 4OOIA 3OTOE 1MNDA 1G3YA 3JTGA 2EPOA 1RKTA 1YJ9I 2YTQA 4BHBA 5IT9C 3ZP5A 2QM3A 2FX0A 4BEHA 4DV4E 2V87A 5ILSA 4DQ2A 1G3SA 1JUMA 1BM9A 1ZREA 1FOKA 3AL0B 2YU5A 2V86A 5K7FA 2STWA 4O43A 4R2QA 1VQ8I 3BJ6A 3I64A 4UUSB 5CVUA 4AD9A 2FOKA 4S05A 1IN4A 2W7NA 2XIGA 2BXZA 5E79C 2Y9ZA 3PO3J 2EFPA 3MQ0A 1T4OA 2EB7A 2MH9A 1JJ8C 2JJ7A 1ZHFA 1JKPC 1VQ7I 2EN3A 1R1VA 3FZVA 4RBOA 2DFFA 1OMIA 1XGNA 4J19A 1TWAJ 5HLIA 1WHQA 1UHWA 4DV0E 3EPLA 2H6BA 3KPHA 2E2JJ 1IN7A 4M0VA 4BXUA 4GGGA 2DLKA 2D45A 3MKWB 3BR6A 4UUVA 4MEXF 2XAQA 1YJWI 2HFHA 4EEFG 4NC8A 3L2RA 3TDUC 5DCFA 4NC6A 1FSHA 3CQZJ 3FHZA 2NVXJ 3VHTB 4RB1A 2F5EA 2NNNA 3HSRA 3CC7I 3C6MA 4YRVA 3ULQB 1MMAA 2IEKA 5B5EC 3H5RA 3OYAA 3C2GA 2XPUA 3VB2A 1VQMI 2NOJB 4G7OF 4R2AA 1EKZA 3CD6I 4HF1A 3JW4A 3GTOJ 2Q0OA 4ZZLA 1XX5A 2MC4A 2QVOA 2O0YA 4PZJA 3H9QA 1UMQA 2HZDA 2NUEA 5H6RA 1IUYA 2TCTA 4L5IA 2JA5J 3DEEA 1HLVA 4U7BA 1LDKB 5ICFA 2BW3B 4M30A 3OMYA 2F4VE 4V2FA 5IP9J 2EM4A 2EPCA 3IHUA 2EH3A 3E5XA 5LHIA 1K79A 1WJPA 3M8FA 1VFCA 2GA1A 3B02A 2HKXA 4BHPA 5LEJA 3KYCB 4KT5C 2VODA 1OQYA 3BQZA 4IJAA 1X1BA 2E7WA 2BB8A 4G7ZF 1IN8A 3EDPA 2IS4A 5HOOA 4B3ME 3H36A 3LLHA 2M5WA 4NHRA 1N77A 1WJDA 3OIQA 3JRIA 1T8IA 5A69A 4ZC3A 3B73A 4LLNA 4J8ZA 3LSIA 4Y17A 1ZN2A 1FC3A 1FSEA 2VKEA 4I0AA 5IP6A 2X48A 3DU6A 4R2SA 1GTKA 3LQQA 4DR5E 4YFKF 2LE2A 1GUUA 5ADZA 1PUEE 4X65E 1MBEA 2VASA 4HYEA 3GMEA 4ITVA 2EQ0A 1O7LA 2GWRA 2M30A 1OLTA 2WBMA 3RPUD 2ZJQF 2W48A 4AYBA 2YPRA 2MKNA 2F6CA 4D1QA 3TMOA 3JRGA 2R7RA 3H09A 1PKPA 2HNHA 4II2A 1ZG5A 1BL0A 1IRGA 2XPVA 1Y8QB 3S32A 3OYIA 1A1FA 3K70C 2DT6A 1VQOI 3I54A 5BQTA 4YY3E 1AAYA 5FKMA 1QVUA 4HSTA 4II3A 1FTTA 2CYYA 4L5NC 1FIAA 3PNYA 2HYJA 5KK1A 1J7KA 2QENA 2XPWA 1W7PB 3HEFA 3JRFA 3MEXA 3PL8A 4I8OA 3OYLA 3TEDA 4GDFA 2DA7A 5ILVA 4XLNF 4HBLA 2M2EA 2P5LC 2BVMA 1R4NB 1V5EA 3ASOH 4C3IJ 2CQKA 3BBGA 4JI0E 2Q8UA 3LAJA 2JXPA 1ERDA 5IOYA 2L92A 1G2HA 4WPYA 5FKOA 2EPLX 3QU6A 3H1CA 2I5UA 4DR1E 2KP6A 5F0HA 5B1AH 3JREA 2DT5A 3IL2A 1SAUA 2EK5A 3P1XA 3A4CA 2HYFA 1IAWA 3RQIA 5E8IA 2B63J 2EOXA 4Y33A 5L3FA 3OYNA 2EOEA 2MD5A 5AIQA 3QU3A 3ZMSA 2L7MP 1HKTA 3E5UA 3V7SA 3ABKH 1POGA 4WSGA 5F64A 1A6QA 4A69C 2DLQA 2QSGX 2LK2A 4UB6C 4PCQA 1A5JA 2E71A 2EFNA 4L5EA 2K4BA 3K4BA 2IS2A 5E1WA 1IXCA 2K02A 1MNEA 4N4NB 4NC7A 1L0OC 3HM5A 1A04A 1ZR4A 1FBSA 1IDYA 4EMSA 2XGCA 5FO5A 1X5WA 1N34E 4Q47A 2HGHA 3MKLA 1ZARA 2EMWA 2L2OA 1GDTA 4UNOA 4RAGA 3OY9A 1SFXA 5E3LA 3LA2A 3LAPA 2HDDA 4KIGA 5L3DA 2RTXA 2K27A 2PJRA 4HX7A 3C2BA 2DYRH 2UWMA 1RI7A 4FISA 1FOWA 3C18A 1E3OC 4PJNA 3FXJA 4ZYDA 4R2PA 5IP7J 4KUMA 2HQRA 3BPVA 1JKQC 2EM5A 4B09A 4E70A 2XAFA 2RSIA 3SEZA 3BIDA 4OX9E 2VL8A 1XG1A 1XGMA 2JPCA 2W1OA 2LF8A 3EYYA 1AU7A 1YSAC 3VYTB 2GXBA 3HPSA 2M4GA 2VUMJ 2HU9A 2JA2A 1F4KA 3B6AA 1WPKA 4N4OB 3HRMA 3OYJA 4ESBA 2UXCE 5K1YA 3A01B 4LOCA 1B59A 2XGDA 1IRZA 2F4IA 1YS6A 3PIPF 5A6BA 1YQAA 2DFHA 1X1DA 1WJ5A 3COAC 3F9KA 1FP2A 4RM3A 1W5CC 1F36A 3ASNH 1QPIA 4IF4A 2XAJA 4Y13A 1XCVA 2E1MC 4N9IA 3WGIA 2HJJA 2KIFA 3H9GA 2G9WA 2JZYA 2DK8A 3EUKL 5KL5A 4M9VC 1RNLA 3LMMA 1F5TA 4NB5A 3O6BB 1EA3A 2Y30A 2OCEA 2V6EA 3BT9A 5JI6A 4WCGA 3SHFA 5IT3A 3HRSA 3K7AJ 1IMUA 4XRSG 5EG0A 1O0WA 5BPDA 3QRFF 3HUGB 3EETA 2XASA 2WY7Q 3RKYA 4YHHE 3G1OA 2VOOA 4FCYA 1AWCA 5E1XA 2CJJA 1JI8A 1HR0E 5TISC 1RUNA 2Q8KA 1TW2A 3L09A 1H0MA 1FMWA 1NK2P 2NVTJ 4JV5E 2KT0A 2QF7A 4ASNA 3A01A 5KCMA 2WV0A 1JUSA 3IH3A 5LHHA 5GADJ 4CH7A 2LKPA 3QYFA 2STTA 2FSWA 5FJ8J 3QG5C 2FRHA 2DSYA 3ROUA 5KL3A 2EA2A 3I3LA 4A6DA 2X85A 4B48A 3L2CA 2EOYA 1UG2A 5HS8A 1JUPA 4XLPF 3H3VK 2QQBA 3LSMA 4JX4A 2E34A 2LT7A 4M3FA 5ED4A 4RGRA 2GOXB 4OWRB 2XVCA 3W6KB 4F93B 3WODF 4EVIA 4BDZA 5DNYA 5JLXA 1HSTA 3BJOA 2EILH 4IOAF 2FBHA 1P6RA 3I56I 3RDIA 4EGZA 2JSPA 1VTNC 2HZTA 1EH7A 3L2WA 3C4BA 4RLFA 2ISZA 2YTJA 1R7JA 4CCMA 2YTFA 2EPXA 3HOUJ 4RGUA 4B3TE 4G6QA 1GXQA 2RVCA 4PGGA 4U87A 2EFWA 3ZGKA 3HB9A 3KE2A 4AU7A 2DT7B 4E4HA 1KU7A 3L7WA 4D9JA 2H8RA 4LFBE 2IA2A 3I59B 3WTVC 1WZ2A 1YFHA 1I3AA 1LDJA 3M9AA 3NEUA 4W97A 2ZBKA 3SDBA 2LTSA 2LVHA 2GBYA 4DR7E 4GFBA 1SD4A 2MD0A 3DPUA 4EQQA 1IC8A 4HX4A 4D7MA 2O8XA 2EM2A 4LK1F 1IRFA 4BC7A 1O4XA 3FHNA 2XGEA 4I98B 2EPPA 1RKWA 1KYWA 3RYPA 3KEOA 2DLLA 1MJBA 5J40A 1ZLKA 3ISPA 3HC7A 3JCUC 4A2UA 4HRIA 3HOVJ 4F52A 4L0YB 1JXSA 1FOYA 5K5OA 4Y7NJ 1TN9A 4CXFA 4PJJA 1OYYA 3O3KA 3TOBA 2NNYA 4LF4E 3L00A 5IXMB 4EJUA 2D2WA 4ZH4F 1FYKA 2FU4A 4FT8A 2OJED 1HXDA 1PJQA 2EZIA 2QEXI 3M3YJ 3CCYA 3NWSA 5DS9A 1U0JA 5CLSA 2ELKA 5ERIA 1U5TB 4LF6E 1MBHA 5M5WJ 4KDPA 1J5YA 4KHPE 2XF5A 2PBIA 2I13A 2OQRA 4A5NA 4B1RA 1YI2I 2BY3A 5FLVA 2VPRA 4PDKA 3F21A 1MKMA 1YLFA 1KU9A 3P7NA 4XKWA 1K78B 2L02A 4KZSA 3HOXJ 2L8TA 2X1DA 1H8AC 1XNRE 2A3SA 1D1CA 5BMZA 4R1HA 2KIQA 4A5MA 2RS6A 5FKLA 2LY1A 2CT1A 1A35A 1KONA 1MMNA 1QGPA 3JRAA 3WU0A 2HEOA 3AV0A 3KP2A 3BR0A 2VN2A 3T1YE 4G94A 2R7DA 4TUGA 1UN6B 1B72B 3CO6C 3ZQFA 4F9BB 1QZYA 4BS9A 4AIKA 4XOPA 1P2FA 1A1HA 3I9V2 1I3QJ 2CV2A 1FP1D 2E1MA 2EMKA 4I01A 3RI4A 2YR2A 1T95A 2RPCA 3HHHA 3U1KA 5M5XJ 2M8EA 4MTEA 3BTIA 1VZ0A 3EYIA 2OU2A 3WTUC 3QOPA 3H3UA 4Q35B 2WC2A 2N3HA 3BGHA 2EM8A 2A6TA 5D4RA 1XB4A 4WFTA 3V8LA 3ADIA 1TZLA 1L4SA 2MKDA 2XAGA 3JRBA 1ETQA 2W00A 5D5UB 1WRJA 1E3PA 1JT6A 3Q5FA 1T0FA 2D9HA 2H36X 4M72A 1FLIA 2MC5A 2EPKX 1ZH5A 2ZCWA 2XHKA 1I6XA 2FBKA 2IGKA
chains in the Genus database with same CATH topology
5D5XB 1OPCA 3K9TA 2ZJ2A 3IWFA 2P8TA 1DPRA 3VEPA 3ZMZA 4ZYEA 3FXQA 1REPC 3CDHA 1OYWA 4R79A 1E17A 2Z3YA 5L3GA 2JSCA 1SMYF 1T6SA 4GCVA 3CUOA 2HOEA 1ZG1A 2XV4S 4DNCA 3IC7A 5CJ9A 3GO5A 1ZRDA 3C1DA 2QBYA 3CJNA 2VT2A 2F5DA 5TJJA 1FX7A 4KN7X 2DW4A 4U0WA 5DCMB 3WTTC 3LQRA 3WTYC 1HBXG 1HW2A 2JT1A 3F22A 1WKMA 3F6OA 2O6GE 4OMZA 5CVRA 4IRGA 3IRQA 3ECOA 3ZMDA 2A6EF 2L3DA 3DEUA 5K5QA 1IN6A 1W5SA 3R61A 3RKWA 1WSUA 3KEQA 1QNTA 5H20A 4ESFA 3GW2A 4HOBA 4I09A 2VBYA 3R6SA 3CUQB 4KIBA 1K7AA 3DFGA 5D8KB 2EFOA 4K2EA 4O3MA 1IN5A 3F8BA 1O3TA 4O6JA 5LGUA 2XROA 2PN6A 2W25A 1DDNA 3GFLA 2LNBA 1XSVA 2V9VA 3K2ZA 4OINF 4HLXA 4EGYA 2HYGD 2Z33A 2H27A 3CUQA 4U0YA 2ETHA 3GUDA 3GVAA 2WTEA 4QLCU 2L4MA 3TO7A 1IZ1A 2OD5A 1W7PD 4WX9A 1LB2A 2P7VB 2ZXJA 4MGRA 3SXYA 2OZ6A 3KP7A 4UV9A 3V8JA 1I1SA 4KMFA 3F8NA 2F2EA 3ZN0A 3HYIA 1O3QA 1LJ9A 4KFCA 4CZZA 1W4MA 1HKSA 4RB2C 2F5FA 3SZPA 3KP3A 2VC0A 2XAHA 1D8KA 3J81K 2MLGA 3M1EA 3SFZA 3LA7A 1BI3A 4NHJA 1RIOH 1T39A 1ON1A 3DQVC 2V1UA 1TNSA 3R4KA 2ZO4A 2DQLA 2FNAA 4I02A 4EV0A 2L01A 2XKPA 5LGNA 1BC7C 4ENJA 4A12A 2QBYB 4YFXF 1G3WA 1FPQA 4KIFA 4GXOA 3KETA 3U1DA 1KU3A 1W5TA 1JGSA 2QZ8A 2HDCA 3TO9A 4FX4A 4L9VA 2YSRA 5J8CA 3T0YA 3E3VA 4LLLA 4KYWA 4IPAA 5D5WB 1JE8A 2PLYA 1ZGAA 4ENNA 4EM0B 2YX4A 1S8NA 2COMA 1IXRC 4OIRF 2DFIA 2K86A 5ILUA 2VOPA 2FE3A 3I0TA 3V7CA 4M74A 3QP5A 1YO5C 1NHAA 2XUBA 4EM1A 2ELHA 2ESNA 5LHGA 3WTXC 2PFBA 3FMSA 2D1HA 2W24A 1ONVA 4ESJA 4M73A 4L9TA 1XGOA 1STZA 1H9TA 4L9NA 3KFWX 4AVPA 4MQ9F 1Z05A 3JAMZ 2M45A 5DEQA 3KP5A 2KKOA 2LSOA 3P9IA 3MZYA 2BEOA 2MH2A 5HS9A 2LF7A 1Y0UA 1J0RA 3HOTA 1G4DA 2PQ8A 3F3XA 3D0SA 1U6GA 4CO8A 1BIBA 2BBYA 5HDKA 4OU0A 2CGPA 5ICCA 2IT0A 3P9KA 4ZYGA 2NS0A 3S2WA 4BYYA 3ABTA 3PFIA 1B9MA 4P9FA 4OIPF 4JBAA 3ZQ7A 4ZZDA 4LB6B 4WXHA 2H09A 2VC1A 2X0LA 1XSXA 1USSA 4JK1X 4MNUA 1B9NA 4MHGA 1U3EM 4Q5SF 2QQAA 2G7HA 1TQPA 5L3EA 2JTVA 2PI0A 5DYMA 1L3LA 3IWZA 3SZTA 1MJ9A 2BYVE 1FT9A 4KNYA 5BS6A 3E6MA 2ZFWA 1D3YA 3FM3A 3DXJF 2FNPA 3GEZA 2RN7A 2DBBA 4IHTA 1R36A 2VT3A 3RYRA 3NRVA 3GZ5A 3ERED 5H6QA 5BPIA 2ZMEB 1GHCA 3TQNA 4O5VA 5L3BA 1ZG3A 4UVAA 5JR3A 4RGSA 1TTYA 3LFKA 3W6JB 1ODDA 4ENKA 3GWZA 4HDVA 3I58A 3TDZC 5DD4A 3FMRA 1CF7A 3HSEA 3J7AO 1TQMA 2FA5A 3GFIA 1ON2A 3J81Z 2DAOA 2HTSA 1B4AA 1R23A 3QP6A 4UV8A 2DU9A 4CICA 4RGXA 5F6FA 3WTWC 1XDSA 3TOAA 4ON0A 2H94A 1IW7F 2PMUA 2AXLA 2YU3A 1MGTA 3KZZA 1ZGJA 2RDPA 4MQVA 3DPLC 2J5OA 4RAZA 3RIRA 2EV6A 3DF8A 1FNNA 1CF7B 5E17F 4UXNA 2GAUA 1QZZA 1U78A 3I53A 1TBXA 4GYGA 2DQRA 1T2KA 1QO0D 2KRFA 1K78A 5EEGA 4IVNA 3DV8A 4CYDA 4R8HA 2M1BA 4IXAA 4L5JA 3F8CA 1Z7UA 2LDUA 5DD8A 2V1XA 2HGCA 2E1CA 3T8TA 2J5PA 2A5YB 4RS8A 4P55A 1T98A 5FLXK 2DK5A 5J8FA 1HKQA 4HAMA 2VE9A 1FBUA 4G7HF 3JSOA 2RGVA 3GFMA 1O7FA 2O61A 3GXOA 4MEYF 2IPQX 2XKOA 5J6XA 3RTRA 3N97A 3SQNA 3WGHA 1DUXC 1B1BA 5JHUA 4LJZF 4NQWA 2DO7A 2Q2EA 2MBFA 3FX3A 3KLNA 4EM2A 1YIOA 5DV5A 1EH6A 1H9GA 3V8KA 1G6NA 1U5TC 1HQCA 5D6EA 5AONA 1YW9A 1QBJA 2K4JA 3DPTA 4UVBA 3WE2A 3GYHX 2CSOA 2QYOA 2BE5F 3F8FA 1ULYA 2ACJA 3F23A 6PAXA 1LNWA 3BZ6A 3ML6A 1XMKA 2R7FA 3ELKA 2ZMEA 2IA1A 3C7JA 3KZYA 1KA8A 5CVIA 3BDDA 2AS5F 4MTDA 1KQ8A 3E6BA 2D1VA 1UCRA 1S29A 2OA4A 1K6OA 4BQAA 1GVJA 3T1BA 1XMAA 5JVTA 5DUKA 4KN4X 2BV6A 1LQ1A 2ADUA 4HW0A 5L3CA 3RJPA 3VFZA 1LVAA 1IXSB 4EJWA 2UXNA 1MZBA 1Z6RA 2FF4A 2E1NA 3WG9A 4B8XA 3OOPA 2HS5A 1J2XA 1S3JA 5FD6A 2JRTA 4LG0B 1BBYA 3K1PA 3CO7C 3E6CC 2NAZA 4CDGA 4M71A 1D8JA 3MZHA 1T38A 3ABUA 2E7XA 3N4MA 4I0BA 2NRAC 3KCCA 3MAJA 2IA0A 3JSPA 3O2PE 3BPXA 2FMLA 1SAXA 1BIAA 1B6AA 1J9IA 3KP4A 3HRUA 1FYMA 3I5UA 2MLKA 4BNCA 1Q1HA 3WE3A 1Z6TA 4Z2YA 3EQLF 3FMQA 5FFZA 2DTRA 3E97A 3IKVA 5IT9Z 1P4AA 2HKOA 4BAYA 3ZPLA 1YW7A 3WU1B 4TV7A 1Z91A 4M6XA 1BOAA 1P4WA 4QWQA 5HLGA 3GZ6A 5ICEA 3HOSA 3AAFA 4I7HA 4Q48A 2FXAA 1MJAA 5HLHA 4G6DA 4RB3C 1FYLA 2ZKZA 3FF5A 1U5TA 1V4RA 2Z5UA 3G3ZA 4N9HA 3F8MA 2QLZA 3Q9SA 2H6CA 2FBIA 4LGWA 2R3SA 3WGGA 2JPBA 4HZFA 4M9SA 4YIIA 4XSZF 4IRHA 3TO6A 1U8RA 2A07F 2RV8A 4AWXB 3JTHA 1YG2A 1AOYA 4HQMA 3JAMK 3K1NA 2OAZA 2FMYA 5K5RA 1S7AA 1P4XA 1QPMA 2IW5A 3ECHA 2GIVA 4RB0A 1Z1DA 4LLGF 3BJAA 5CYVA 3I71A 2L54A 4HV5A 4IRIA 2BGCA 1SFUA 3ZN1A 4HDUA 1U2WA 4L9JA 4RAYA 1S7OA 4CHUA 2G7UA 2M87A 4LK0F 5E20A 5AIPA 4P9UA 2CFXA 2O03A 2CG4A 2VXZA 4KICA 2HR3A 4XBFA 1HSJA 5DUIA 4M9ZA 1J59A 3ZMTA 1XD7A 1ZYRF 2P5VA 4A0ZA 3CTAA 2UXXA 3RPUA 1BN5A 1RUOA 1I1GA 1TLHB 3HUGA 1W7PA 3R0AA 1YTYA 1R5HA 2RNJA 1MDMB 4L0ZB 4EJOA 3MFKA 5JFRA 1O3RA 3GF2A 1WWXA 3HSFA 2FEZA 2CW0F 2W57A 3J80K 3DP7A 1SD5A 2DPDA 4Q4ZF 4YIFA 3PQKA 2GQQA 1R00A 1YS7A 2K7LA 2RC4A 3BOQA 3MWMA 3V4GA 5E8GA 2OZUA 4EJVA 1P92A 2CO5A 1C0WA 4GO1A 1EH8A 1V3FA 4P5OA 3C3WA 2ZNYA 1OKRA 1IF1A 3BROA 2MA3A 1SD7A 2QUFA 1ZAOA 4BH9A 1F1ZA 3MCZA 4WK8F 3HHGA 3BY6A 3ZMUA 4P96A 4HQEA 2ZNZA 1R22A 2V1DA 3EUHA 2EV0A 1YW8A 1Z9CA 1R1UA 3T5XA 5HDNA 3E5QA 5D6FA 3HTUA 3K0LA 4ZYHA 4LG0A 2O3FA 5TRDA 4F7ZA 3IRRA 4KA4A 5DCMA 2L4AA 1O3SA 3HIFA 4WXCA 4EJTA 1O57A 2WWYA 2C6YA 4FHTA 2EJRA 4BHCA 1SD6A 2IJLA 4UHTA 5FFXA 3R60A 5IT9K 1OR7A 4U88A 1FWZA 2ESHA 4U7DA 4U0VA 4G8XA 1SMTA 3FXUA 1CGPA 4LB5A 4IHSA 2KJBA 5D8LB 1BI2A 4XSXF 3KLOA 1R5GA 4HLYA 4OIQF 5F1RA 3HRTA 4UVCA 1ZLJA 5LRSA 3QPHA 1XGSA 3H92A 5A2QZ 3BWGA 4YG2F 2P7CB 5E1ZB 1R58A 5EEHA 1HW5A 3LWFA 2KIUA 2EA4A 2HWVA 1TQIA 2V6CA 4I2OA 2VBXA 4CGZA 2VE8A 2W85A 5BOXA 2F5CA 5CVJA 3U2RA 1RZ4A 2XGXA 2RKHA 2YX7A 4KMUX 4M6YA 1ZRFA 1XCBA 1SFEA 3I4PA 3NQOA 4WF2A 2XRNA 1R1TA 1DPUA 2Y0MA 4HA8A 2ISYA 2A68F 3H3ZA 2PEXA 2P6TA 1QQIA 1BI1A 2PG4A 3GX4X 3OV8A 4HV6A 1X3UA 1KYZA 2X4HA 4L18B 3QAHA 2UZKA 5HVQC 2OQGA 3FWEA 5CVVA 4M9XA 4Y15A 1WI9A 1KGSA 2Z99A 2FQ3A 4YFNF 2P4WA 4JQFA 3K1MA 1WQ2A 4WXDA 1UFMA 3D5LA 3I59A 3F72A 1BI0A 3IKTA 4ENMA 3REOA 5HS7A 3QPTA 1JHFA 2VBWA 2OBPA 1UHMA 2GXGA 4LMYA 1EV7A 2IRFG 1XN7A 2DI3A 5LLQA 1HW1A 3TGNA 2P6SA 4A0YA 1BC8C 5FLXZ 1J75A 1TNTA 4N0BA 1PP8F 3U9GA 4AIJA 3J80Z 3RPQA 3WTSC 1FZPB 5A2QK 5KVRA 5FB2A 1MD0A 3RKXA 1KQ0A 3HTSB 4OMYA 5FGMA 4ETSA 5E18F 4S04A 2QQ9A 2QWWA 2GA2A 4GYIA 3CUQC 1E2XA 3DKWA 3PQJA 3LA3A 2Y75A 5LRRA 5HDGA 4LD5A 2NYXA 4G9YA 1PDNC 1FY7A 3TKYA 2P5KA 2A69F 1ZRCA 2EV5A 2A6HF 1D5VA 2PMHA 3CLOA 2EFQA 1KQ9A 3E6DA 5LEKA 5D4SA 4OIOF 1YYVA 3M7GA 1JHHA 4HF2A 2GZWA 5D5VB 3Q9VA 1XSDA 1PP7U 2V79A 2MC3A 1FBQA 1TW3A 5ICGA 2B0LA 2KJCA 4H0EA 3VOEA 4FX0A 3T8RA 3FXRA 3F6VA 2HQNA 1MDMA 4LFUA 4A6EA 4A0XA 2IVMA 1OYIA 3VODA 3L9FA 3FM5A 4HF0A 2Z9OA 1S6LA 1USTA 1DP7P 3LSTA 4HX8A 5FD5A 3V7RA 3GFJA 3KP6A 1I5ZA 1LDDA 1XDUA 2EWNA 1G3TA 3R0JA 4WWCA 1LEBA 3GLXA 3WTZA 5LBQA 4D0PA 3G73A 2VONA 2TDXA 4PGHA 1GXPA 1I27A 2IP2A 2DPUA 5DDGA 1BJAA 3P9CA 4XRFA 1KU2A 3ZMVA 2A61A 5LGTA 1LEAA 2PJPA 2VBZA 2KIMA 1UB9A 2CWEA 2W84A 3M8EA 3K69A 4AIHA 1F9NA 2HTJA 2RQPA 2Y48A 3BP8A 4OOIA 1G3YA 3JTGA 4BHBA 3ZP5A 2QM3A 5ILSA 4DQ2A 1G3SA 1BM9A 1ZREA 1FOKA 2STWA 3BJ6A 3I64A 5CVUA 4AD9A 2FOKA 4S05A 1IN4A 2XIGA 2EFPA 3MQ0A 2EB7A 2MH9A 1ZHFA 1R1VA 3FZVA 1OMIA 1XGNA 5HLIA 1UHWA 2H6BA 1IN7A 4BXUA 4GGGA 2D45A 4UUVA 4MEXF 2XAQA 2HFHA 3TDUC 5DCFA 1FSHA 3FHZA 4RB1A 2F5EA 2NNNA 3HSRA 3ULQB 3VB2A 4G7OF 4HF1A 3JW4A 2Q0OA 4ZZLA 2QVOA 4PZJA 2O0YA 5H6RA 1IUYA 4L5IA 4U7BA 1LDKB 5ICFA 3IHUA 3E5XA 5LHIA 1K79A 3M8FA 2GA1A 3B02A 2HKXA 4BHPA 5LEJA 4KT5C 2VODA 4IJAA 2E7WA 4G7ZF 1IN8A 3EDPA 5HOOA 2M5WA 3B73A 4LLNA 4Y17A 1ZN2A 1FC3A 1FSEA 4I0AA 3LQQA 4YFKF 1PUEE 4HYEA 1O7LA 2GWRA 2M30A 2YPRA 1ZG5A 1IRGA 3I54A 5BQTA 2CYYA 5KK1A 1J7KA 2QENA 1W7PB 3MEXA 5ILVA 4XLNF 4HBLA 2P5LC 2CQKA 3LAJA 3QU6A 2DT5A 3IL2A 2EK5A 2HYFA 1IAWA 5E8IA 5L3FA 2MD5A 5AIQA 3QU3A 3ZMSA 1HKTA 3E5UA 3V7SA 5F64A 4PCQA 2EFNA 2K4BA 5E1WA 1IXCA 2K02A 1L0OC 1A04A 1FBSA 4EMSA 5FO5A 4Q47A 1ZARA 4UNOA 1SFXA 3LA2A 3LAPA 4KIGA 5L3DA 2K27A 4HX7A 2UWMA 1RI7A 3C18A 4ZYDA 4KUMA 2HQRA 3BPVA 4B09A 4E70A 2XAFA 1XGMA 2JPCA 2LF8A 3EYYA 2GXBA 1F4KA 3HRMA 4ESBA 5K1YA 1B59A 1YS6A 1YQAA 3COAC 1FP2A 4IF4A 2XAJA 4Y13A 1XCVA 4N9IA 3WGIA 2KIFA 2G9WA 2JZYA 2DK8A 1RNLA 1F5TA 4NB5A 3O6BB 5JI6A 4WCGA 3SHFA 5IT3A 3HRSA 5BPDA 3QRFF 3EETA 2XASA 3RKYA 2VOOA 1AWCA 5E1XA 1RUNA 2Q8KA 1TW2A 3L09A 1H0MA 4ASNA 2WV0A 5LHHA 2LKPA 2STTA 2FSWA 2FRHA 3ROUA 2EA2A 4A6DA 3L2CA 5HS8A 4XLPF 2QQBA 5ED4A 4RGRA 2XVCA 3W6KB 3WODF 4EVIA 1HSTA 3BJOA 2FBHA 1P6RA 3RDIA 4EGZA 1VTNC 2HZTA 1EH7A 2ISZA 1R7JA 4RGUA 4G6QA 1GXQA 2RVCA 4PGGA 2EFWA 3KE2A 1KU7A 3L7WA 3WTVC 2IA2A 3I59B 1YFHA 1LDJA 3M9AA 3NEUA 2ZBKA 1SD4A 4EQQA 4HX4A 2O8XA 4LK1F 1IRFA 4I98B 1KYWA 3RYPA 3KEOA 2DLLA 1MJBA 1ZLKA 3ISPA 4A2UA 4L0YB 1JXSA 5K5OA 4CXFA 1OYYA 3O3KA 3TOBA 2NNYA 3L00A 4EJUA 2D2WA 4ZH4F 1FYKA 2FU4A 4FT8A 1HXDA 5CLSA 5ERIA 1U5TB 4KDPA 1J5YA 2PBIA 2OQRA 4A5NA 4PDKA 3F21A 1MKMA 1YLFA 1KU9A 3P7NA 1K78B