4BHCA

Crystal structure of the m. tuberculosis o6-methylguanine methyltransferase r37l variant
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
165
structure length
165
Chain Sequence
MVHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSLTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALLELEKSRAPADLTLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLATED-DNA--PROTEIN-CYSTEINE METHYLTRANSFERASE
publication title Biochemical and Structural Studies on the M. Tuberculosis O6-Methylguanine Methyltransferase and Mutated Variants.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 40
structure length 165
sequence length 165
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4bhcA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4bhcA01
2IRFG 2XROA 2A5YB 2COMA 1HKTA 2EA2A 2STWA 3IWZA 3FWEA 1Z1DA 3GF2A 5E1XA 3PQKA 1XSDA 1AOYA 4ESJA 5LLQA 1UFMA 3E6BA 1Q1HA 4EM0B 2L3DA 1Z9CA 3I59A 1V3FA 1UHWA 1H9TA 1F1ZA 2YU3A 5LEJA 4CXFA 2HTSA 2KIUA 3TDUC 1USTA 3JAMK 1IRGA 2LF8A 3I64A 4LJZF 4KN7X 2ZXJA 3DP7A 1DP7P 2IW5A 1XMAA 2L02A 3TGNA 2PI0A 2QYOA 3VEPA 1SD4A 3RYRA 4MTDA 5D5WB 3C1DA 4OU0A 5DEQA 3U1DA 2D1VA 2HDCA 3R4KA 5ICEA 4U88A 1F9NA 3IRQA 1BC7C 3I71A 4CYDA 3HRMA 1MZBA 2CG4A 4RGXA 2PLYA 3CUQA 3ZMDA 1OYYA 2FMLA 3DF8A 2LDUA 5CVUA 2JSCA 3WU0A 2Y0MA 1AWCA 1ZN2A 4PDKA 1YO5C 4BNCA 2QENA 1BC8C 3P7NA 3I5UA 2EFWA 3WODF 2CW0F 4UVAA 4GYIA 3LAPA 3TO7A 1LDDA 2CYYA 1MD0A 1R58A 2STTA 4I01A 4R79A 3CDHA 2HOEA 5LRSA 5L3BA 2IP2A 2E7WA 2YR2A 2DAOA 2LKPA 4ZZDA 2X4HA 5E1WA 2VE9A 1ZLKA 5K5OA 4QWQA 2QQAA 3E6MA 5FLXK 2ETHA 3JSPA 2FMYA 1YYVA 2EFNA 1JE8A 1F4KA 4G6QA 1GVJA 2DPUA 3BPVA 4IRGA 1P4XA 3ZMSA 1P2FA 5LGNA 4ENKA 3FM5A 2VOPA 4R8HA 3KETA 4RB1A 4NHJA 5FB2A 4XBFA 2BV6A 2FF4A 2O0YA 1I5ZA 2WV0A 3I53A 4CO8A 2FNAA 1K79A 1KQ8A 1WRJA 2Z99A 4OMYA 4HQEA 3B73A 2HYFA 4AIKA 5E8GA 4UNOA 4KN4X 4U0YA 4I02A 3WGIA 2XAGA 2M45A 2HKXA 4Z2YA 2M5WA 4FT8A 2O61A 2XGXA 3F22A 2QQBA 3F8FA 3L7WA 1XMKA 1K6OA 3BP8A 3T0YA 4EGYA 5FD6A 4MNUA 4RS8A 3CUOA 5HVQC 4ZYEA 3WGHA 1P6RA 2A69F 3BJOA 4XSXF 1SMTA 4EMSA 2K27A 1J9IA 2G9WA 2ZNYA 1FLIA 1XSVA 3BWGA 2P7VB 2DQRA 1REPC 1W5TA 4JQFA 3REOA 3GUDA 1R00A 5E20A 2VT2A 4KFCA 3F6OA 1TQIA 1D8KA 2W24A 1HW2A 2V79A 1O7FA 1IAWA 3VB2A 4RAYA 3WE3A 1U8RA 1R1TA 2IA1A 2MA3A 1FBQA 4MEXF 5HLHA 1UHMA 1IN7A 1D3YA 3RTRA 1HBXG 5DD8A 1U78A 2A61A 4OOIA 3F21A 2VXZA 5LBQA 4HV5A 4IRHA 2XVCA 2A07F 3BJ6A 2OQGA 3RKYA 2L54A 2IT0A 2H27A 5HLGA 2KKOA 2P5KA 2CSOA 1J0RA 4GGGA 3VFZA 3PQJA 4XSZF 2EV6A 1SD7A 3EYYA 3FXQA 4HX4A 4XRFA 1PP7U 3RKXA 4HOBA 3WTTC 4IHTA 2VOOA 2EB7A 1ULYA 4HX8A 3F6VA 5LGUA 4CGZA 4M9ZA 1XGMA 1EH6A 4U7DA 3V8JA 1U5TA 5D4RA 1ZG1A 3ABUA 3EYIA 1IF1A 3T5XA 4L5JA 1ZGJA 1SFUA 1BIBA 1G3YA 2FBIA 4KMFA 1FT9A 2VE8A 3HRSA 2ZNZA 3WTZA 3C3WA 5IT9K 4G7ZF 2OU2A 1OPCA 1FPQA 4HF1A 1LEAA 5CYVA 2R7FA 3HTUA 4LLNA 2P8TA 1LDJA 3MQ0A 4I09A 2VC1A 1TQMA 2OD5A 1XCVA 2B0LA 1T98A 1FNNA 1USSA 3ULQB 4HX7A 5FFZA 3KE2A 4YFNF 3IRRA 2EK5A 3FXUA 4JBAA 2L4AA 1EH7A 2YX4A 2NS0A 2ZMEA 1BIAA 1R36A 4EV0A 5DYMA 3J81K 4N9IA 5HOOA 1W7PB 2NAZA 5L3FA 1RI7A 2ESHA 3K1NA 2QVOA 3SHFA 1Z6TA 5ICFA 3SZPA 2W25A 2KRFA 1GHCA 3LQRA 2K86A 5LHHA 2QQ9A 3FHZA 3NRVA 5L3CA 1HXDA 3G73A 2PMHA 2PJPA 4M9XA 1XGNA 3R0JA 3KLOA 2E1NA 4KMUX 1WSUA 1O3SA 1I1SA 3GFMA 1YW8A 1EH8A 2BBYA 2M30A 3AAFA 1DPUA 3BDDA 3FMSA 5FFXA 5FLXZ 1F5TA 2PFBA 2Q8KA 2RNJA 1WI9A 2CFXA 3PFIA 4EVIA 5ICGA 3TDZC 3GX4X 1OKRA 4A6EA 2NNYA 4EJVA 1U3EM 2Q2EA 2OAZA 2P7CB 1XGSA 3RJPA 1K78A 1ODDA 4B8XA 1ZG5A 4EJUA 1SAXA 1HW1A 4ZYDA 2Z5UA 3BPXA 4YFXF 4F7ZA 2XAJA 1IN8A 2GXGA 1R1VA 3LWFA 2EA4A 4BHCA 4P9FA 3W6KB 1R5GA 5D6FA 1XSXA 3H3UA 4IVNA 5HDNA 1L3LA 1K7AA 2Y75A 3ZMUA 1J59A 2WC2A 5CVIA 3GYHX 1YG2A 5FGMA 1GXQA 5BPIA 1TW3A 3EETA 4BHPA 1G3SA 2XV4S 3QPHA 5K5QA 5CVJA 5K1YA 2JZYA 2DK8A 5CVVA 2LSOA 4H0EA 3FXRA 1B9MA 4M73A 4ESFA 1J5YA 2EJRA 2A6HF 3KP6A 4GO1A 1P92A 1DUXC 1D8JA 4B09A 1CF7A 2PN6A 2ZO4A 1RZ4A 3F3XA 4U0VA 2AXLA 2BEOA 3MCZA 3RIRA 5HDGA 2Y48A 2GZWA 1ZGAA 3QU6A 3J80Z 4EQQA 4LG0A 2YSRA 2DPDA 3NQOA 1KQ0A 4IRIA 3LFKA 2VBZA 4ZYGA 4EJTA 2D2WA 3DV8A 2E7XA 3QAHA 4A12A 3ZMTA 5F6FA 4LB5A 2IVMA 5LHGA 3P9CA 4O6JA 2FBKA 2LNBA 1ZREA 1W5SA 5DDGA 1FZPB 1HKQA 4Y15A 2OZ6A 4R1HA 4NB5A 5HS9A 3HOSA 3RPUA 4UHTA 1MDMA 1A04A 5AIPA 4GYGA 3BJAA 3KP5A 3I59B 3ERED 3EQLF 5JR3A 1XB4A 4ETSA 5DCFA 5LEKA 3GZ6A 4FX4A 2QWWA 1MKMA 3GFIA 2HS5A 2PG4A 3ZMZA 5IT9Z 4AWXB 4Y17A 2F5DA 2F5EA 4L0YB 4KA4A 4KIBA 1W7PD 3Q9VA 2V6CA 1BI2A 3DEUA 2V1UA 3P9IA 1B9NA 1SFXA 4HV6A 4U7BA 2O3FA 3GFJA 1JHFA 3KP7A 1KU9A 4M72A 3BZ6A 2FEZA 3GXOA 2MC3A 5ED4A 3KP3A 1V4RA 5TJJA 1LEBA 3CUQB 5L3GA 3J81Z 5DD4A 3WGGA 2XUBA 3CJNA 1KU7A 5ILSA 4BHBA 1T0FA 2HFHA 5L3DA 4Y13A 5KK1A 2HKOA 1KQ9A 3T1BA 2O03A 3KLNA 3BY6A 2IJLA 1HW5A 1UB9A 2FBHA 3LQQA 3COAC 1Y0UA 4HDVA 2KJBA 3HSEA 4RB2C 4G94A 1O3TA 1U2WA 2LF7A 2DBBA 3HYIA 1FX7A 1Z7UA 1IZ1A 3TOBA 1LNWA 4ON0A 3V7SA 3F72A 2EWNA 1T38A 1PUEE 1ZHFA 2F5FA 3P9KA 1O3RA 3FZVA 1LJ9A 3LA2A 2OA4A 2MLKA 1LB2A 2XIGA 3R61A 5DCMA 2OQRA 2ISZA 1R1UA 3V4GA 1GXPA 4UV8A 3RPQA 4A0XA 2DLLA 3TKYA 4PCQA 2IA2A 4WK8F 4FHTA 4ZH4F 4WWCA 4DQ2A 1FYLA 1L0OC 4PGHA 3K1MA 1IRFA 1O57A 4YIIA 4S05A 2DK5A 1NHAA 2ZFWA 5H20A 2IA0A 3FM3A 5HLIA 3QP6A 4YG2F 1W4MA 3J80K 1DDNA 2XKPA 3SFZA 4IXAA 4HBLA 5A2QK 1FSHA 2CGPA 3IHUA 5ERIA 1KGSA 3HOTA 4HA8A 4AVPA 1O3QA 1OYIA 5LGTA 1VTNC 3FF5A 4HAMA 2VBXA 1E2XA 1R23A 3LAJA 2DI3A 1D5VA 2QBYB 3WTUC 2VODA 4RGUA 1O7LA 2GWRA 3FMRA 3KZZA 2CWEA 1BJAA 2QLZA 3OV8A 4CDGA 3J7AO 2XAFA 1J2XA 4KDPA 2XAHA 1QO0D 3SZTA 1IW7F 5BOXA 1ZRCA 2XAQA 5DUKA 2XRNA 1LQ1A 5JI6A 4PGGA 5AONA 3GEZA 4EGZA 3MWMA 1XD7A 2HQNA 4WXDA 1PDNC 2HGCA 4RGSA 4BQAA 4LK0F 4A5NA 2WWYA 4HLYA 4UVBA 2FXAA 2A3SA 3D5LA 1B1BA 3BROA 4UVCA 3ZP5A 4I0BA 2Q0OA 1C0WA 3MFKA 2MLGA 3IKTA 1HSJA 2GAUA 3KEOA 2H6CA 4ASNA 1XGOA 3ECOA 1YQAA 4A6DA 3RI4A 4L9TA 1QBJA 2FE3A 1IUYA 1S7AA 4ENJA 1ZAOA 2Z33A 3B02A 5DV5A 1J7KA 1STZA 1ON1A 4UV9A 1IXSB 4ZYHA 3HRTA 4QLCU 2MH2A 5DUIA 4WXHA 1S8NA 2TDXA 2ZKZA 1ON2A 4KUMA 1RUNA 2K7LA 2W85A 1XDSA 2VBWA 5D4SA 1S6LA 3IWFA 1U5TB 3EUHA 4BXUA 1ZH5A 2ESNA 4O3MA 2UXXA 5CVRA 5K5RA 4L9NA 2PQ8A 3RYPA 5E1ZB 2MH9A 2NYXA 2P5VA 3F8BA 2NRAC 3WE2A 4MEYF 1SD5A 3L9FA 2A6EF 1JXSA 5H6QA 4MQVA 4TV7A 1G4DA 2DFIA 5KVRA 1I1GA 2V1XA 1LDKB 5J8CA 1BBYA 3V7RA 5ILVA 5D8KB 4A5MA 1KYWA 1BI3A 1QGPA 4OIQF 3DKWA 5ICCA 3JTGA 3H3ZA 2FRHA 3NEUA 1YS6A 1HSTA 3HUGA 1T2KA 2ZMEB 1S7OA 1H0MA 3QRFF 5CLSA 4HLXA 2M1BA 1E17A 5J8FA 4P9UA 2C6YA 3LSTA 2H09A 4RB0A 4EM1A 2KIMA 1BI0A 4HDUA 4OIPF 5CJ9A 3QU3A 2D45A 4ZZLA 4L0ZB 3HHGA 3I58A 4AIHA 3M8FA 1KYZA 3E5UA 4EJWA 1FBUA 2HQRA 1FY7A 2DT5A 1FYKA 3EDPA 3TOAA 2G7HA 2W57A 1ONVA 2VBYA 2X0LA 1YW9A 2HTJA 6PAXA 2L4MA 2AS5F 4LMYA 2J5PA 3KFWX 4CZZA 1ZRFA 4OIOF 4L5IA 1HKSA 2EV5A 2ZJ2A 4KICA 3HSFA 4DNCA 3V8LA 1CGPA 3E5XA 2XHKA 2K02A 2M8EA 5JVTA 4XLPF 3O3KA 1G3WA 4HYEA 4LFUA 4JK1X 5HDKA 1RIOH 3ZN1A 4LLGF 1LVAA 2QUFA 1MJBA 1FSEA 4WF2A 4KYWA 5EEHA 1OMIA 5FD5A 2K4JA 2FNPA 4P5OA 4OIRF 1K78B 3C7JA 5JFRA 3K0LA 4AD9A 3T8RA 5ILUA 1EV7A 2ZBKA 2P4WA 5FO5A 3W6JB 3L2CA 2J5OA 5A2QZ 3O6BB 1FWZA 3GW2A 1S29A 1YLFA 3GLXA 4ENNA 3VODA 3F8CA 2FOKA 5J6XA 1XDUA 3JTHA 5D5XB 1X3UA 2VC0A 3V8KA 2HZTA 4RGRA 3E5QA 3U2RA 1BI1A 3GFLA 4LLLA 4MGRA 4CICA 3TO6A 1B59A 2E1CA 2JTVA 1KU2A 3CUQC 4KIGA 1Z91A 5E8IA 3VOEA 3KEQA 1RUOA 1QQIA 2ADUA 4KNYA 3ABTA 3BOQA 3TO9A 4UXNA 3V7CA 1IN5A 1J75A 3ECHA 4Q48A 3F23A 4O5VA 3ZQ7A 1CF7B 4M74A 3D0SA 3DXJF 4GXOA 1FBSA 2HR3A 3IKVA 3E6CC 1PP8F 4UUVA 1SD6A 3R60A 4P55A 3ROUA 1WKMA 2KIFA 1MJ9A 1JGSA 4BYYA 3MZYA 5LHIA 1ZLJA 5D5UB 1OYWA 4U0WA 2M87A 4MTEA 4L18B 2VONA 3RKWA 4LG0B 1TNSA 4LB6B 3CO7C 4GCVA 3MZHA 1MJAA 2G7UA 2ACJA 1FOKA 1QZZA 1WQ2A 2RKHA 3N97A 3CTAA 3LA3A 5H6RA 2GQQA 2QM3A 4RB3C 4MHGA 4FX0A 1ZYRF 2H6BA 1BN5A 5LRRA 5E18F 4E70A 3ZMVA 3ML6A 2P6TA 2UXNA 3N4MA 2O6GE 2D1HA 1MDMB 2DO7A 1HQCA 1KA8A 4I2OA 3LA7A 2DU9A 1BM9A 1T6SA 2W84A 4L9JA 3KP4A 2NNNA 4HZFA 1S3JA 3ELKA 2R7DA 4HF2A 2O8XA 4WCGA 5E17F 3IC7A 1QZYA 4G7OF 1U6GA 2QBYA 4I98B 2F2EA 5JHUA 5L3EA 3KCCA 2RVCA 4LGWA 5TRDA 3H92A 4M6XA 4EM2A 2GXBA 5D5VB 1R22A 2PEXA 4ESBA 3ZN0A 1YS7A 4YIFA 3MEXA 5AIQA 3Q9SA 1P4AA 1YIOA 1TQPA 5BS6A 3DQVC 3E6DA 2WTEA 3S2WA 3FMQA 2HYGD 3WTVC 3GO5A 2FQ3A 4A2UA 1IN4A 3IL2A 1ZARA 1BOAA 4Q5SF 2YPRA 4I7HA 4G6DA 2JPBA 2OBPA 3GVAA 3T8TA 4KIFA 1T39A 4N0BA 1IXCA 3WTWC 3OOPA 1XCBA 3HIFA 4PZJA 4L9VA 4M71A 4S04A 1W7PA 2FU4A 4G9YA 2DQLA 2HEOA 5F64A 2MD5A 1TLHB 3DPTA 3GZ5A 3K9TA 3HRUA 1YFHA 4IF4A 1FP1D 2DTRA 5DCMB 2PBIA 3C18A 1YTYA 1FYMA 4A0YA 4IPAA 2GA1A 4WXCA 5HS8A 3GWZA 1U5TC 2L01A 4LK1F 5EEGA 3CO6C 3M1EA 1QPMA 2R3SA 3CLOA 3K1PA 3F8MA 1RNLA 3K2ZA 4HW0A 1B4AA 1YW7A 4IHSA 2CO5A 2RQPA 4YFKF 1IN6A 3QP5A 3RDIA 1OR7A 3HTSB 3JAMZ 3QPTA 1B6AA 3I54A 1TNTA 3E97A 5HS7A 2V9VA 2Z3YA 1I6XA 4IJAA 3Q5FA 4A0ZA 3DPLC 3TQNA 1WWXA 4HF0A 2RDPA 4Q4ZF 3WTSC 3DFGA 4OMZA 2GA2A 4K2EA 3M7GA 1TTYA 1UCRA 1Z05A 1IXRC 3F8NA 1G3TA 2DW4A 2H94A 4ENMA 4I0AA 4EJOA 1QNTA 2JRTA 3JW4A 4OINF 1SFEA 2GIVA 4BAYA 1P4WA 2FA5A 3SQNA 1TBXA 2MBFA 3I0TA 3L09A 2IPQX 1R7JA 3M9AA 5BPDA 1JHHA 1ZG3A 1R5HA 5BQTA 4HQMA 3I4PA 4MQ9F 2PMUA 1FC3A 4P96A 5D8LB 1Z6RA 2EFOA 2OZUA 2EFQA 1MGTA 2F5CA 2RN7A 3HHHA 4D0PA 2UWMA 3FX3A 1G6NA 2Z9OA 1KU3A 1XN7A 3R6SA 4N9HA 2FSWA 2V1DA 4NQWA 4G8XA 5F1RA 2RGVA 2A68F 2VT3A 2UZKA 2EFPA 3KZYA 3MAJA 4BH9A 1I27A 3K69A 2VN2A 4XLNF 2CQKA 4KT5C 4G7HF 2ELHA 3QOPA 2ZCWA 1TW2A 3ISPA 2RC4A 2JT1A 1SMYF 4AIJA 2K4BA 2HWVA 4LD5A 3SXYA 2BGCA 1H9GA 2BE5F 4CHUA 5D6EA 3WG9A 1FP2A 2ISYA 2JPCA 2P6SA 1ZRDA 3WTYC 4M9SA 4RAZA 3WU1B 3G3ZA 3ZPLA 5BMZA 5IT3A 3M8EA 3U9GA 3JSOA 1DPRA 2XKOA 2YX7A 3O2PE 2P5LC 3L00A 3KP2A 4M6YA 2KJCA 3R0AA 3HSRA 4WX9A 4Q47A 3E3VA 2RV8A 2XASA 2EV0A 3WTXC 2BYVE 2QZ8A
chains in the Genus database with same CATH superfamily
4JOMA 2IRFG 2XROA 3BQYA 2A5YB 2DMUA 1GTKA 2NUGA 2COMA 1HKTA 3GMEA 1JUSA 2EA2A 2STWA 1T4LB 3J7YJ 3BZKA 3IWZA 2YPNA 1X6EA 3OYMA 3FWEA 1Z1DA 1W0UA 3GF2A 5E1XA 3PQKA 4X65E 2LUQA 2VJJA 5M5XJ 3HUGB 2MC5A 2NABA 1XSDA 3BTCA 4M9VC 2M9AA 2MYSA 3OWTA 4XLFA 1AOYA 2KLOA 1V54H 3BR0A 2A25A 2EM5A 1UBDC 4BKXA 4ESJA 1IC8A 1YPNA 2ODRC 2HI3A 2V85A 1A1GA 1MMNA 1UFMA 3E6BA 1Q1HA 5LLQA 2EOHA 2BW3A 1GZ6A 4EM0B 2EOIA 3N05A 4FCYA 4IHYA 2L3DA 2EMYA 3S8PA 2FTXB 1Z9CA 3I59A 1V3FA 3G71I 4GEQB 1UHWA 1H9TA 2EQ1A 1HA8A 4JX5A 1F1ZA 2YU3A 2JN6A 5LEJA 2WCC3 2EM7A 4CXFA 3G4SI 2HTSA 4B48A 2KIUA 3TDUC 1U9OA 3G2BA 3ZRGA 3J81C 1USTA 3JAMK 1YYKA 2HGHA 3CJQB 2XPUA 5F27A 2LF8A 3I64A 4LJZF 1IRGA 3MSWA 2CW7A 4KN7X 2ZXJA 1X5WA 3DP7A 5FJ8J 2VASA 1DP7P 2IW5A 1Z67A 4P78A 1XMAA 2VL8A 3EPZA 1ZBTA 4JX4A 2YSOA 2L02A 1T95A 2JA5J 1H88C 5GADJ 3TGNA 4Y52J 1JGGA 2PI0A 2QYOA 3VEPA 2LTRA 1SD4A 2L5QA 5FKKA 3RYRA 5IP6A 4MTDA 5D5WB 4G12A 3C1DA 3SDBA 1VQNI 4OU0A 5DEQA 3U1DA 4N4RB 2D1VA 2HDCA 3R4KA 5ICEA 2E5ZA 1FOXA 2HXIA 4U88A 3DLAA 1YYOA 4QSHA 3OYCA 1L4SA 3M4OJ 1F9NA 1POGA 4BXFA 2GOXB 5GPAA 2P0WA 3IRQA 1RRJA 3I71A 1BC7C 4JV5E 1TWGJ 4CYDA 3HRMA 1MZBA 2CG4A 3K4NA 4RGXA 2PLYA 2ENHA 3CUQA 3ZMDA 4XLCA 2DXIA 1OYYA 5A6BA 2FMLA 2EL5A 2VE7C 2XB5A 2LDUA 3DF8A 3FIWA 1JJ8C 1ERDA 2DB2A 3QPSA 5J1YA 5CVUA 4BJ6C 1T4NA 3BQZA 2JSCA 2EBIA 1HLVA 3WU0A 2Y0MA 1AWCA 3U1KA 5KL2A 2VF1A 1FKAE 1ZN2A 4PDKA 1YO5C 4BNCA 3X2QH 2QENA 2X9DA 4PSXA 2VKVA 1BC8C 4X8WA 3P7NA 1JKQC 2YTIA 3I5UA 2EFWA 1UAAA 4D9JA 4BDZA 2DCEA 3MKZA 3WODF 1YITI 1EF4A 4FE7A 2CW0F 3E7LA 4UVAA 3GTOJ 4GYIA 3LAPA 4RLQA 1HC8A 3OYEA 1HR0E 1X3ZB 3TO7A 3DLLF 1VQ8I 5J40A 4TUIA 1LDDA 4DR4E 2CYYA 3OSFA 1MD0A 1R58A 3D5RC 2LKSA 2STTA 2K7IA 3HL2A 2LR8A 4I01A 4R79A 3DU5A 3CDHA 2HOEA 4FQGA 5F08A 5LRSA 2Y9YA 3SEZA 2B9DA 4DGWB 5L3BA 2IP2A 1SFKA 1CQTA 2E7WA 2HPMA 2YR2A 2DAOA 2UV1A 2LKPA 2EOOA 2JA8J 4ZZDA 2X4HA 1BB8A 5E1WA 2JA7J 2VE9A 2EMWA 2H36X 2MD0A 1ZLKA 5K5OA 2L2OA 2QQAA 4QWQA 2EPFA 3E6MA 5FLXK 3DCFA 2GIZA 4NC7A 4UUSB 3OYHA 2ETHA 1MEYC 2HOSA 2LYCA 1W0TA 3JSPA 2FMYA 1YYVA 2EFNA 3FXMA 1JE8A 1F4KA 3ADGA 4G6QA 5EF6A 1GVJA 3B6CA 2A6TA 3MMYB 2DPUA 3BPVA 4IRGA 2Y69H 1P4XA 2X51A 3ZMSA 2EM2A 4F3QA 1YI2I 1P2FA 5LGNA 1EA3A 2ID6A 4ENKA 3FM5A 1XMOE 4XORA 1O4XA 2VOPA 4JI1E 3H5RA 4A3MJ 4R8HA 1R6RA 2WBTA 3KETA 4RB1A 4NHJA 2R7VA 3L2RA 5FB2A 4XBFA 1D0ZA 2BV6A 3U21A 3CDIA 4IQ4A 1X3CA 2ME0A 2QSHX 1X3WB 2FF4A 2O0YA 1I5ZA 2WV0A 3FHNA 3I53A 4JI3E 4CO8A 2WV1A 2FNAA 2F6CA 1K79A 1KQ8A 1PDAA 1WRJA 2LOOA 2JY9A 2Z99A 3DBRB 4OMYA 4F9CB 4BE1A 1TWAJ 1UELB 3B73A 4HQEA 2HYFA 4AIKA 4HSRA 1TT0A 5E8GA 1Z3YA 4A69C 4UNOA 2LFBA 4BY7J 4KN4X 1WHNA 4U0YA 2W48A 3KPHA 4I02A 3WGIA 2XAGA 1OCTC 4GRIA 2EN6A 1I6HJ 4W1UA 2M45A 2LJHA 2HKXA 2H1LA 2DYSH 4CCNA 2EE8A 4Z2YA 2JK3A 4E7JA 2M5WA 1FJLA 1WH7A 4FT8A 4NZVA 2O61A 2XGXA 3F22A 2QQBA 2VQCA 3F8FA 1XPXA 5M5WJ 2KONA 3HPHA 3L7WA 4NDLA 1XMKA 2K9SA 1K6OA 3BP8A 4FTHA 2L9SA 1ZAAC 1TWFJ 3T0YA 2MW8A 1ZQ3P 4EGYA 5FD6A 3OR2C 4MNUA 2E1MC 3BR6A 4RS8A 3CUOA 4A3EJ 5HVQC 4ZYEA 4CYCA 3WGHA 3CD6I 1QVUA 5BR8E 5J1UA 2YWQA 3S16J 1P6RA 2A69F 3BJOA 4XSXF 3CCEI 1SMTA 4EMSA 1U8BA 2K27A 1J9IA 2G9WA 3ZOQB 2ZNYA 1FLIA 2EZIA 1XSVA 3BWGA 2P7VB 2DQRA 1R71A 3RQ4A 1REPC 1W5TA 4JQFA 1JTYA 3REOA 3GUDA 3UR3C 1R00A 2DA6A 5E20A 4Q28A 3K70D 3HPZA 2VT2A 2LRDA 5HNHA 4AYBA 3M07A 3G6EI 5KL3A 4KFCA 3C6MA 3F6OA 3OL4A 1TQIA 4CCOA 1D8KA 2X6YA 2NA2A 3HGYA 5IYBJ 2W24A 1HW2A 2V79A 5EG0B 1O7FA 1IAWA 3VB2A 4RAYA 1ZBQA 1NG7A 3WE3A 4CCKA 1U8RA 1I39A 2RSMA 3HOVJ 3BIDA 1MMDA 4LF5E 1Z0XA 4TUGA 3S32A 1JT0A 1R1TA 2IA1A 3H9GA 2MA3A 3EPHA 1FBQA 4MEXF 5HLHA 3HB9A 4Y3OA 1UHMA 4PJJA 2NVUB 1IN7A 3VSLA 2LMDA 1D3YA 2LY2A 4BU2A 3RTRA 2X6OA 1HBXG 5DD8A 1U78A 1VI0A 2A61A 3CJTB 5IYDJ 1IDZA 4OOIA 1X4PA 2DMTA 3F21A 3HOZJ 1YZ9A 2VXZA 3QOEA 5LBQA 4HV5A 3L2QA 4IRHA 3UKGA 2XVCA 1GUUA 1TWCJ 1TZLA 3ZQHA 1AU7A 1PJTA 3K4JA 2A07F 3VYSB 2L33A 2XPVA 4YY3E 3K10A 3BJ6A 2OQGA 3RKYA 2L54A 2IT0A 2YRMA 5KHDA 2H27A 5HLGA 2KKOA 3TW7A 1SVLA 5A6KA 5KAFC 2P5KA 2CSOA 3CCJI 4ZDPA 1X6FA 1J0RA 4GGGA 4B3TE 2K5CA 2QSFX 3HOUJ 2DJIA 4ZDOA 3VFZA 1HDPA 3PQJA 4F93B 2MC6A 4XSZF 1MMSA 2EV6A 3TW6A 1IRZA 1SD7A 3EYYA 3LOCA 1VNDA 3FXQA 4HX4A 5EGOB 1X2NA 2UXDE 4XRFA 1PP7U 2LC2A 1QZEA 3RKXA 2WY8Q 4HOBA 3WTTC 1DI2A 4IHTA 1X48A 1N75A 3KEYA 2VOOA 5K7ZA 2WB1N 2EB7A 3DEEA 3M8JA 2VJIA 1ULYA 4HX8A 4DBQA 2DTZA 3F6VA 3NAUA 5LGUA 4CGZA 4M9ZA 1P9QC 1XGMA 1EH6A 4U7DA 3V8JA 3PFYA 1U5TA 4DIQA 5D4RA 1ZG1A 2CPNA 4LFCE 3KYCB 1WPKA 4BEHA 3ABUA 5LD2C 2ZC2A 3EYIA 1IF1A 1ZELA 2ICWG 3OY9A 2IAIA 3T5XA 4F6MA 2IS1A 1ENHA 2R7RA 3IWCA 2AHQA 2OJED 4L5JA 4E7KA 2XSDC 1IG7A 1SR9A 5IWAE 3OIQA 4E7SA 1YJNI 1ZGJA 2R5ZA 1SFUA 1A6IA 1BIBA 2DMYA 4O4KA 1Z7LA 3HG9A 1G3YA 2YTOA 2FBIA 2OUMA 1K4SA 4KMFA 4CCLA 1FT9A 2VE8A 3HRSA 5IY5H 2ZNZA 3WTZA 1OJLA 3C3WA 1TP4A 2L7MP 2YS9A 5IT9K 4G7ZF 2L2MA 2OU2A 1ZKGA 3ZQCA 2GLIA 1OPCA 3FKJA 3CESA 1FPQA 1W1WE 4ZC3A 2DDAA 4HF1A 4I76A 4PUSA 3EPKA 2HNHA 2Y0SN 4E4HA 1LEAA 5CYVA 2R7FA 3HTUA 4XRMA 3FXJA 1IV8A 1EJ9A 4B43A 4LLNA 4XKCA 2BVMA 2P8TA 2EPOA 1LDJA 1TC3C 3MQ0A 1YRNA 1WFXA 4I09A 3F6HA 2VC1A 2YZTA 1TQMA 2OD5A 3ZQIA 4A3KJ 3GTLJ 1HCRA 4JI8E 4D7MA 3M3YJ 1XCVA 2B0LA 2NOGA 1T98A 2ZJQF 4LITA 4YELA 1R49A 2DODA 2FOWA 3MKLA 1FNNA 1USSA 3ULQB 4A3CJ 4HX7A 5FFZA 3KE2A 4CA0A 1IQSA 4YFNF 3IRRA 2FGGA 3A1YA 5EDNA 1TF3A 2W82A 3OMLA 2EK5A 3CP2A 3FXUA 5HODA 2CTDA 4BBRJ 2NVYJ 4JBAA 2L4AA 1EH7A 2YX4A 2NS0A 2ZMEA 1BIAA 1AKHB 1GVDA 5EZHA 1R36A 2ECCA 2VQFE 1V5GA 3RSNA 4EV0A 5DYMA 1J26A 3J81K 1HDDC 2OCEA 4N9IA 5B1AH 5HOOA 2ZMEC 1DQUA 5CPRB 1B8IA 2EMBA 1W7PB 2NAZA 5L3FA 4MFDA 1RI7A 1N34E 2ESHA 3H3VK 3BBGA 3CJRB 3K1NA 2QVOA 3AL0C 3SHFA 1Z6TA 4O5GA 2E35A 5ICFA 1XNRE 3SZPA 3S1NJ 2TRTA 3D1NI 2W25A 2KRFA 3EUAA 4Y4RA 4XIDA 1GHCA 3LQRA 3P5JA 2K86A 2OTLI 3T1HE 3CMYA 4CCMA 5LHHA 1RMDA 1Z21A 5A6JA 3ADJA 2QQ9A 1A1FA 5FKOA 3FHZA 4KJZA 4C2MJ 3NRVA 4DV2E 5H2FC 2DA5A 2BB8A 3EUHC 5L3CA 1HXDA 1PYVA 3G73A 3FXOA 2EPXA 2XF6A 4R2CA 2PMHA 3L1PA 4M9XA 3JR9A 2PJPA 1XGNA 1HOMA 3R0JA 3BT9A 3KLOA 3ZXSA 4P7DA 2E1NA 4KMUX 4PJMA 1WSUA 2EOFA 3K70C 1O3SA 4E7IA 3S2DJ 1I1SA 2EQ0A 3GFMA 3G1MA 1YW8A 2BZTA 4X0GA 1EH8A 4DYRA 3HPSA 2BBYA 2M30A 2EZHA 3AAFA 2EL6A 2NUFA 1BR4A 1DPUA 2HZDA 2DA7A 1VQOI 5GAHJ 5EEAA 2Y30A 2UUZA 3ZQQA 2E2IJ 2EMXA 3BDDA 1JKOC 3FMSA 3OYIA 2JR1A 5FFXA 4XOPA 5FLXZ 2EJ4A 1F5TA 2PFBA 2DA1A 2QKLB 2X48A 2RNJA 1WI9A 3AFHA 2Q8KA 1TN9A 4IO9F 2VKEA 2GM4A 1MMAA 2CQQA 1A1IA 1A36A 2CFXA 1EKZA 4IS1C 1ZR4A 3ABLH 3J80C 2R5YB 3QYEA 3B6AA 2EM6A 2ZM6E 3PFIA 5A2QC 2F4MB 4RM3A 1S72I 4EVIA 1WVRA 4XOTA 5JLWA 3VYTB 4LFAE 1Z77A 4RDUA 2LP0A 5ICGA 1K6YA 2WZOA 3TDZC 3GX4X 3HBLA 1OKRA 1QHHD 3MZ8A 4A6EA 1SVMA 5HNFA 2R7ZJ 2NNYA 2K9MA 4EJVA 1R4MB 3BG3A 1U3EM 2EPAA 4R2EA 2KP6A 2Q2EA 2OAZA 2R7XA 2R93J 2EOMA 2DOEA 4IQJA 2P7CB 4AC0A 3TBIA 1XGSA 2D5VA 3RJPA 3SEQA 1XMQE 2VKHA 1X1DA 2K3FA 3LMLA 1K78A 1WCMJ 1ODDA 1WJEA 4B8XA 1ZG5A 2E72A 2JOXA 4EJUA 4FISA 3OYGA 4A93J 1SAXA 3DKYA 2EMAA 3V42A 1HW1A 2EN7A 2R92J 1Y8RB 4DUZE 4ZYDA 4DMIA 2Z5UA 3BPXA 4YFXF 4F7ZA 3ADIA 2XAJA 1IN8A 3BR2A 5KCMA 4B3AA 4XNFA 5IP9J 2ENAA 3JU0A 2GXGA 2L7KA 3MN2A 4A3BJ 1G8XA 5IT9C 1B69A 3BLYA 1I3AA 1R1VA 1WXRA 3LWFA 2EA4A 3A0BC 4BHCA 3DEWA 3THOB 2EMFA 2MC4A 4P9FA 3ZR8X 4J8ZA 2KHMA 2DDBA 3W6KB 1R5GA 2KRCA 1ETYA 4OAYA 5D6FA 1XSXA 5J4YA 3H3UA 3LSGA 4IVNA 5HDNA 1L3LA 1K7AA 2Y75A 3LSRA 3ZMUA 4ZTFA 1J59A 2MGQA 2WC2A 5CVIA 4R03A 1KJKA 3GYHX 3PM1A 1XMXA 1LE8B 2CV1A 1YG2A 4DV1E 5GP9A 5FGMA 3D5SC 1MNMC 1GXQA 4NQWB 5BPIA 2EMIA 1TW3A 3EETA 5LMNE 3KYLA 2RS7A 4BHPA 3KX2A 1RETA 2LY9A 2VQGA 3S14J 1G3SA 2XV4S 2UUAE 5GAGJ 3VYUB 2UUBE 2VKDA 1D0YA 3TP0A 2V83A 2DMNA 3QPHA 2UXBE 3UK3C 2DA3A 3BG5A 2H8WA 5K5QA 4LF4E 2CSHA 5CVJA 2LJUA 5K1YA 1YYWA 2JZYA 3HKZN 2WA0A 3KYDB 1UHZA 2DK8A 5CVVA 2LSOA 4H0EA 1VQKI 3FK6A 3FXRA 4DV6E 2IGOA 5F0CA 1B9MA 4M73A 4RA2A 2ELJA 1STUA 2CW8A 4ESFA 1J5YA 1P7JA 2EJRA 2LVHA 1BR2A 4FETA 4N4NB 1RKTA 5M3FJ 4JI5E 2A6HF 1JKPC 3KP6A 4GO1A 4XLHA 2JA6J 1P92A 1DUXC 1D8JA 4B09A 2JMWA 1CF7A 2PN6A 2ZO4A 4IHXA 2EOEA 1RZ4A 1N36E 3F3XA 1PKPA 4U0VA 3OYBA 2BY3A 2R4GA 1MBEA 2AXLA 1OFCX 2BEOA 3MCZA 3RIRA 4YIRX 5HDGA 2HYJA 2EMKA 1SFOJ 5GAEJ 2Y48A 3I56I 4IOCF 1ZR9A 2GZWA 1ZGAA 4UUSA 3QU6A 3GLLA 4PJLA 2HQAA 3MKWB 2L7ZA 3J80Z 1VFCA 4DR3E 4EQQA 3VYXA 2M2EA 1IQOA 2G0EA 4LG0A 3WHBA 2YSRA 2DPDA 3NQOA 4HNVA 1KQ0A 4IRIA 1SANA 3LFKA 4R2AA 2VBZA 3ZQFA 3A01A 3A2KA 4ZYGA 4EJTA 2ECBA 2D2WA 4WSGA 3AG2H 3AG4H 3DV8A 2RPCA 2E7XA 2OCCH 3QAHA 4C3HJ 5K7HA 4A12A 3OTOE 3ZMTA 5F6FA 1HNZE 4LB5A 2M34A 1A31A 1VQPI 2IVMA 4QIWN 1VZ0A 5LHGA 3P9CA 2I9IA 2AXTC 3QYBA 2VJ4A 4O6JA 1MSEC 1NTCA 2LUPB 2EN2A 3OYJA 2FBKA 3Q0VA 1WGXA 3HQ1A 5F3WA 2NVXJ 2LNBA 4XK4A 2LBFB 1ZREA 1WJCA 1W5SA 5DDGA 1FZPB 1HKQA 3DF6A 4N4OB 4Y15A 2OZ6A 2TCTA 3CC4I 4R1HA 1OCZH 4NB5A 5HS9A 2VQHA 4YEJA 3HOSA 3CLQA 3RPUA 3CCSI 2KMUA 4UHTA 1FMWA 2HVQA 3CC7I 2ELYA 1MDMA 1UG2A 3CCYA 5EZGA 4Q35B 1A04A 2ZXIA 5AIPA 2XF7A 5FRNA 2CQXA 2BW3B 3GCMA 4GYGA 3BJAA 2X6WA 1J5EE 4NC8A 3KP5A 4XM3A 4BE0A 4GKKE 3CF5F 3I59B 3QODA 3ERED 3EQLF 4UY8I 2JRMA 5JR3A 2LCEA 1XB4A 4XKVA 5DCFA 4ETSA 5LEKA 3GZ6A 3DBHB 4FX4A 3CC2I 2QWWA 1MKMA 3GFIA 4WYQB 2HS5A 2PG4A 2IEKA 3ZMZA 1M1EB 2DYRH 1MSFC 5IT9Z 4LF6E 4AWXB 4Y17A 3K2AA 1K4TA 2F5DA 2F5EA 4L0YB 3IP4B 2HDDA 4KA4A 1WJAA 4KIBA 1BBGA 4YHHE 1W7PD 2XPWA 1T8IA 3PJRA 5B66C 3S3OA 2X1EA 3Q9VA 4M3DA 1A5JA 4O43A 4LIVA 5GTHC 3H36A 2V6CA 4XRSA 1BW5A 2EIJH 1BI2A 1X4OA 3DEUA 2BBGA 2V1UA 2JUCA 3P9IA 1B9NA 1SFXA 4HV6A 4U7BA 1RKWA 2O3FA 1XX5A 3GFJA 3OR1C 1QVTA 3RCOA 4UB8C 3LSJA 1XTAA 1JHFA 2EPNA 2Q1ZB 3KP7A 4DV5E 2BXZA 1MNEA 3HTXA 1KU9A 4M72A 3SFIA 2NVTJ 1TWHJ 3BZ6A 2FEZA 3CCRI 2QA4I 3GXOA 2MC3A 5ED4A 1Y1WJ 4HRIA 3KP3A 2KRHA 2MDGA 1V4RA 5TJJA 1LEBA 2DMPA 3CUQB 5EG0A 1JKRC 2N3GA 3IAM2 5L3GA 3J81Z 5DD4A 3WGGA 2XUBA 3A03A 3CJNA 1KU7A 1OLTA 5ILSA 2JA2A 4BHBA 2EP3A 3L2WA 4L5EA 1T0FA 2WB1A 2HFHA 2I10A 5L3DA 2FUG2 2UXCE 2P81A 3DPUA 4C3IJ 4NUBA 5KK1A 1FIPA 4Y13A 1NK2P 1A1KA 2HKOA 4RMNA 2YSPA 1KQ9A 2QGUA 2R7QA 2EWLA 1ITYA 1T0FC 3T1BA 4DR2E 4DR7E 2O03A 2EM0A 2WAQN 3KLNA 3BY6A 2IJLA 5FKMA 1HW5A 1RC9A 1UB9A 2FBHA 3OL3A 2NXNB 4JYAE 3LQQA 1LVKA 3COAC 1IBLE 2GBYA 1Y0UA 4A3DJ 3VK6A 4DYCA 4KHPE 2QEXI 4HDVA 2KJBA 3HSEA 3DTEA 2DA4A 4RB2C 4G94A 2EMHA 2EQRA 1G2FC 2L3CA 1O3TA 2E1MA 1U2WA 2LF7A 2M7AA 4K0KE 1VQ5I 2DBBA 3W3CA 3HYIA 2L2NA 3FIGA 1FX7A 1Z7UA 2KISA 1IZ1A 5E3OA 1YSAC 3TOBA 3IUOA 1U0JA 1LNWA 4F54A 4CH7A 2JPAA 1S5LC 4ON0A 3I4NJ 3BCAA 3CCUI 3V7SA 4C2TA 3F72A 2EWNA 2XGEA 1T38A 2RTXA 3MVPA 1PUEE 1ZHFA 2UUCE 4AQYE 2F5FA 2Y0SA 3PSIA 4RM2A 3GTPJ 4II2A 2R0QC 3P9KA 3H5AA 3BG9A 1N33E 4L8NA 2M7BA 1O3RA 4DJAA 1VQ7I 3FZVA 1LJ9A 2COBA 3LA2A 3PIPF 2OA4A 2VUMJ 2MLKA 1LB2A 1T08B 4X6AJ 5IYCJ 4LTYA 2XIGA 3R61A 3CCMI 5DCMA 4IJDA 2OQRA 2ISZA 2HPIA 2BHYA 4DR1E 1OCOH 1R1UA 3V4GA 2V8QB 1GXPA 4UV8A 3RPQA 3I4MJ 4BACA 4BBYA 3H9QA 1UMQA 4A0XA 2DLLA 2WADA 5DM6F 3JRBA 3TKYA 4PCQA 5IXMB 2IA2A 4WK8F 1K83J 3JRGA 2E36A 4FHTA 5FROA 4ZH4F 4B44A 3CZ6A 4WWCA 4DQ2A 1FYLA 1QA6A 1L0OC 2JSPA 1ETKA 1KONA 2GOMA 2DSYA 1VQ6I 2JWTA 4PGHA 5IOYA 1VQMI 3K1MA 2V88A 1IRFA 3J7ZI 1O57A 4YIIA 4S05A 2DK5A 2ZB9A 4MLQA 1NEIA 4BQQA 1D1CA 4M3BA 3GTMJ 1LLMC 1NHAA 1YX5A 2ZFWA 3L2UA 3MHSC 4U87A 2IA0A 5H20A 1F43A 3FM3A 2CV2A 2CMPA 5HLIA 3PO3J 3BTIA 4BCAA 3MHHC 3QP6A 2JOBA 4YG2F 1W4MA 2B63J 3J80K 2ZJRF 1DDNA 1FOWA 2XKPA 3SFZA 3F6GA 1Y6IA 3VYYA 4IXAA 2CT1A 4HBLA 5A2QK 5AC5A 1XS9A 2KDZA 1FSHA 2CGPA 2YU9J 3IHUA 4MFEA 5ERIA 3ZQGA 1KGSA 3HOTA 3H09A 2V26A 2RQLA 3TEDA 4I8OA 2LG4A 3ZGKA 5K7FA 4HA8A 3K4CA 3RKQA 3VWBA 4AVPA 4HNTA 1O3QA 2EL4A 2LO3A 1OYIA 2KFDA 2YUSA 5LGTA 2XGCA 4HEIA 1VTNC 4WFTA 4C2UA 4AUXA 3FF5A 4HAMA 3RQIA 4QPOA 2EPMX 2JVHA 5IV8B 1NCSA 4F9BB 5E3LA 2VBXA 1E2XA 4E7HA 1R23A 3LAJA 2DI3A 1D5VA 4CYCB 4OWRB 2QBYB 2L3JA 1PUFA 3WTUC 1VQ4I 4ITVA 2VODA 1FEXA 2QQ8A 1O7LA 2GWRA 3FMRA 4RGUA 3KZZA 2CWEA 3IH3A 2DOFA 3QWLA 1OQYA 3C2BA 3JCUC 2CUZA 3IH4A 1FTTA 1Q1VA 3ZQLA 1WJFA 3ESWB 1BJAA 2QLZA 3OV8A 4CDGA 1BOBA 2EPUA 3AUZA 4F55A 3J7AO 2XAFA 1X2MA 1J2XA 4KDPA 2XAHA 3UNGC 1QO0D 4X66E 3SZTA 2DMQA 2O9LA 2LRSA 1IW7F 5BOXA 1ZRCA 2XAQA 5DUKA 2XRNA 2DGCA 1JUPA 2CH0A 1LQ1A 2LT7A 5JI6A 2DIXA 2VPLA 2Q8UA 1P47A 2YTFA 4PGGA 5AONA 3PNVA 3S2HJ 3GEZA 4EGZA 3MWMA 1XD7A 2HQNA 4WXDA 1PDNC 2HGCA 4RGSA 4BQAA 4MIMA 3PUFA 4LK0F 2KHXA 2VPRA 5JLXA 4A5NA 3S1RJ 2WWYA 2EOXA 4HSTA 4HLYA 1HF0A 4UVBA 2FXAA 2EM9A 2A3SA 3D5LA 1B1BA 3BROA 4AIDA 1MBJA 4JYKA 4UVCA 2E19A 1N3GA 4PFPA 9ANTA 3ZP5A 3PNYA 4I0BA 2Q0OA 2WBSA 1C0WA 4LF7E 3MFKA 2MLGA 4KITB 3IKTA 1HSJA 4ANJA 3OYDA 5AASA 2OTJI 2GAUA 3KEOA 2EPCA 3S3NA 1I3QJ 2CUEA 2H6CA 3HPGA 4ASNA 2X1DA 2YTPA 1XGOA 2W1OA 2EIMH 2DN0A 3ECOA 4BUPA 1MH4A 3GTJJ 1YQAA 2EM4A 3K4KA 4BJTA 4A6DA 2ODRD 1ETOA 3RI4A 3LMMA 4D1QA 2LTSA 2YTEA 4L9TA 2MABA 1QBJA 2FE3A 4Y33A 1IUYA 2EORA 1S7AA 4AYBN 4ENJA 2XGDA 1ZAOA 2AQFA 2Z33A 3B02A 5DV5A 1J7KA 2PJRA 1STZA 2W4SA 2E5LE 4R2DA 1ON1A 2ZXHA 2YTQA 4UV9A 1IXSB 4ZYHA 5C4XJ 3HRTA 4QLCU 2R5YA 2MH2A 2JXPA 5DUIA 4IEJA 1S8NA 2TDXA 4WXHA 2DLKA 2M4KA 2V9KA 2ZKZA 1ON2A 2E1OA 4IKFA 1MBHA 4KUMA 4PJNA 5FLMJ 2YU8A 1S9HA 2XDVA 3I9V2 1RUNA 2K7LA 2W85A 1BR1A 4P1WA 2BOLA 3GTQJ 1XDSA 2VBWA 5J3LA 5D4SA 3DKXA 1S6LA 2Z1DA 3CF2A 3IWFA 1T56A 2CU7A 1U5TB 5KL7A 2IGKA 3EUHA 4BXUA 1DGRM 4BEHB 2ESNA 3TL4X 4O3MA 1ZH5A 2UXXA 3DU6A 4XKBA 1QU6A 4NBQA 2OV7A 4R2RA 2EPKX 3DWLE 5CVRA 5K5RA 4L9NA 3RMPA 1SAUA 4PK4A 3HOXJ 4C30A 1ACIA 1FOYA 2LREA 2PQ8A 2RNGA 3FBIB 2EILH 1X47A 4JI7E 2R5ZB 3F0CA 1VF9A 2YTGA 3RYPA 2BHZA 3LSMA 4DBRA 5E1ZB 2MH9A 2EPZA 2DT7B 2NYXA 1FJGE 1YX3A 2P5VA 2QKMB 3F8BA 3QYFA 2D9HA 1EKEA 2W00A 2IGMA 2NRAC 2MSYA 1YOVB 3PL8A 4MEYF 3WE2A 1B72B 2EM3A 1SD5A 4LG3A 1U9NA 3L9FA 4IHVA 2A6EF 1JXSA 5H6QA 3OS1A 4MQVA 5LL6R 3HKZA 4TV7A 4ZYAA 1G4DA 1XNQE 4ZTJA 5IOZA 2DFIA 1G2DC 4V2GA 3BCBA 4LFBE 2B7EA 5KVRA 5A6BD 4BJ5C 1I1GA 2V1XA 1LDKB 2DFFA 1YE9A 3ERMA 1Y56A 5J8CA 1AHDP 2JQ7A 1A1JA 1JJ6C 3S17J 2BY2A 3C4TA 1BBYA 3K4BA 4DOZA 1YRNB 3EPLA 1BA5A 4PFOA 2V4JC 4V19K 4FASD 2DT6A 2LK2A 3IAS2 2EN1A 3V7RA 5ILVA 5D8KB 2L9RA 4A5MA 4CUGA 1KYWA 1BI3A 1MBKA 2M0MA 2FQ4A 2GHFA 3KZIC 1QGPA 4XL9A 4OIQF 4RAFA 4MLOA 3DKWA 4GFBA 5ICCA 3JTGA 2ZFUA 4D7NA 3E0JB 3H3ZA 4E6KG 1PJQA 3ADLA 2IXSA 2FRHA 1UILA 3NEUA 3HXLA 2F5VA 1YS6A 2MDRA 1HSTA 5BNGA 3HUGA 4JI0E 1A1HA 1T2KA 3BG6A 2ZMEB 4LF8E 1S7OA 1H0MA 2M3AA 5CLSA 3QRFF 4HLXA 2M1BA 3AL0B 1E17A 5J8FA 1B8IB 5TISC 4P9UA 2NOJB 4A3GJ 3IWBA 3O8HA 2C6YA 3LSTA 4DZJA 2H09A 4RB0A 1ETVA 3JRFA 1UHSA 1WJDA 3HOYJ 1N78A 2OF7A 2EZ6A 2RREA 1UJ8A 4EM1A 2L8TA 3LFUA 4B3ME 2KIMA 2BXYA 3BC8A 1BI0A 1IUFA 4HDUA 4OIPF 1I94E 2EN3A 5CJ9A 3QU3A 2D45A 5J1RA 5C44J 4ZZLA 4B47A 4L0ZB 3HHGA 2LVSA 3T1YE 3EQ1A 4M30A 2R7OA 3I58A 4AIHA 3M8FA 1KYZA 3E5UA 3FISA 4EJWA 1FBUA 3LNQA 2HQRA 4BC7A 3H0DA 3CP8A 1MW7A 4BC9A 4B4CA 5IPAA 1D5YA 4J01A 3E1SA 3EPJA 1FY7A 5F0HA 3TMOA 2DT5A 1FYKA 2X6XA 3EDPA 3TOAA 2G7HA 2W57A 2DOAA 3BZCA 2KOUA 1ONVA 4HTGA 2VBYA 2X0LA 1YW9A 2VI6A 1V55H 3QG5C 2RAEA 4L5NC 2VXDA 3BTJA 1MNDA 2HTJA 4G6TB 6PAXA 1AH5A 3C4BA 2XC7A 1ORKA 2J7JA 2L4MA 2AS5F 4OOGC 4LMYA 3TP3A 2J5PA 2EMLA 3J7Yp 4RLFA 3KFWX 4CZZA 1ZRFA 4OIOF 4L5IA 1HKSA 3PIOF 2EV5A 5KNLA 2ZJ2A 4B3SE 1R4NB 3K7AJ 4KICA 4RAGA 3HSFA 4DNCA 4DUYE 3V8LA 3PSFA 4C3JJ 1CGPA 1OCPA 1YUJA 3E5XA 2XHKA 4R2QA 1X19A 2K02A 2M8EA 5JVTA 4BXXJ 2M9HA 4PJ0C 4MLVA 5EYRA 4XLPF 5E79C 4A3JJ 5TSEA 2V9PA 1UN6B 2W7NA 2CUFA 2DFHA 2MG4A 2NVQJ 2JYAA 1WH5A 3O3KA 2FV4B 2LBFA 1G3WA 4HYEA 4W97A 3GZNB 3JRIA 4LFUA 1FMVA 5F04A 1OISA 3ZOBA 2XSJC 4JK1X 5HDKA 1RIOH 3ZN1A 1UG0A 4X64E 2EZLA 4LLGF 3LSIA 1LVAA 2JVGA 2V89A 2QUFA 2GPIA 1MJBA 5AE2A 4C9YA 4A3LJ 3AV0A 1FSEA 1XC5A 4WF2A 2NS7A 2EPPA 5AC4A 4KYWA 2YU5A 5EEHA 3IWDA 2KL4A 2Q2EB 3I3LA 1OMIA 5FD5A 2K4JA 3CDLA 2FNPA 4P5OA 2JVAA 2YRKA 4YRVA 4OIRF 1WJ5A 4F2JC 1K78B 4E7LA 2VIXA 2JWOA 3C7JA 1SEUA 4GKJE 1IBME 2K85A 2RS6A 2QCOA 5JFRA 1SVOA 2EOZA 3GTKJ 5FRMA 3K0LA 4WPYA 4AD9A 5AE3A 2L9NA 3JRCA 5E3NA 1FIAA 1IGNA 3T8RA 2WAQA 3P1XA 5ILUA 3JRHA 2ADRA 1EV7A 2ZBKA 1ZU1A 5M5YJ 2P4WA 5FO5A 5JVGF 3W6JB 3L2CA 2J5OA 2EN8A 4WSPA 5A2QZ 3OYLA 2CS3A 5A69A 4GZNC 3O6BB 3QQAA 1FWZA 3GW2A 1T4OA 1S29A 4RHBB 1QPIA 1YLFA 5EJCA 1DP3A 2ZXWH 5A6AA 2VQLA 3JRAA 1MH3A 4F91B 3GLXA 4ENNA 3VODA 5F1JA 4F6NA 1MMGA 3F8CA 2FOKA 1LFPA 5J6XA 1XDUA 3JTHA 5D5XB 1X3UA 4V2FA 2VC0A 3V8KA 2HZTA 1YUIA 4RGRA 3E5QA 2R7WA 3S3MA 3U2RA 2K9QA 3W2WA 2IS2A 4B3RE 1BI1A 2LH9A 2R7SA 2KDOA 3GFLA 2PX9A 1RPWA 4MGRA 4LLLA 4CICA 5J47A 3TO6A 1B59A 2R76A 1R5ID 2E1CA 4LF9E 2A5WA 3BR5A 2JTVA 1KU2A 3BR3A 4ZJZA 4BBSJ 4AU7A 2IHR1 2BY0A 2ELKA 3CUQC 4KIGA 1Z91A 5E8IA 2CUJA 2O8KA 3VOEA 2M1SA 3M99B 3KEQA 1RUOA 1QQIA 2E34A 4IX7A 1BW6A 2YRHA 2ADUA 1X49A 4KNYA 3ABTA 3BOQA 3TO9A 4UXNA 3V7CA 4FE4A 3MKYB 2NUEA 1APLC 3HEFA 1IN5A 1J75A 4CSWA 3FKIJ 1E3PA 3LLHA 4UUTA 1G59A 2VB6A 2YTJA 3ECHA 4Q48A 2M4IA 3BG7A 3C6KA 3F23A 1NH3A 2ZSIB 2PMZN 3BF2A 3M1CA 4KWYA 1A6QA 4O5VA 4I6ZA 2A05A 3AG3H 3ZQ7A 1TF6A 1CF7B 4M74A 1X1BA 3D0SA 3DXJF 4GXOA 4XN3A 2EMCA 2VRDA 4BMJA 3OYKA 1FBSA 1X1CA 2HR3A 2HU9A 3IKVA 5J4VA 2DMIA 2HJJA 2O7OA 3E6CC 1PP8F 4UUVA 1N77A 1SD6A 3R60A 4P55A 3LSHA 3ROUA 1WKMA 2HDWA 3CCLI 2KIFA 2XAUA 1MJ9A 3HOWJ 1RC7A 4A3FJ 1E3OC 1JGSA 4BYYA 1A1LA 3MZYA 2RSIA 5LHIA 4JX6A 2E5NA 1ZLJA 5D5UB 4I99C 1ZGWA 2IS6A 1OYWA 4U0WA 3OOUA 2M87A 4MTEA 3CQZJ 4L18B 4HPQA 2VONA 2XRLA 2BY1A 3RKWA 4LG0B 2B9SA 4BQNA 2N3HA 1TNSA 1OCRH 4LB6B 3CO7C 1GQEA 4GCVA 3A01B 2KPMA 1KYQA 3MZHA 1MJAA 2F4OB 4M3FA 2G7UA 3OMYA 5E3MA 2ACJA 1FOKA 4JI6E 1IJWC 1X1PA 1RR7A 1QZZA 3TQMA 1WQ2A 2RKHA 3N97A 3CTAA 3OIPA 4DKKA 2K3PA 3LA3A 5H6RA 3WHCA 2X1CA 2EPRA 2GQQA 2QM3A 4RB3C 1ZR2A 3G1LA 4MHGA 3NARA 2LY1A 1LPQA 1GDTA 4BY1J 1X58A 1OCCH 2KIQA 4FX0A 2BVLA 2M4GA 2CFOA 4XLEA 1ZYRF 2H6BA 2LD5A 1BN5A 5FKNA 5LRRA 1T33A 5E18F 1GV5A 4E70A 2L0KA 3ZMVA 2VQEE 2EM8A 3ML6A 3DBLB 2P6TA 1HNXE 2UXNA 3N4MA 3DTKA 3AKZA 2O6GE 1K61A 2D1HA 4B3XA 2V1NA 4JI4E 4DV7E 3JTZA 1MDMB 2DO7A 3ABKH 1HQCA 3IV5A 1KA8A 4ZDLA 4E7ZA 5GPCA 4I2OA 3LA7A 3ZCOA 4A3IJ 4H4KC 2DU9A 4JP0A 1G2HA 1ETWA 1BM9A 1T6SA 4CZCA 1R9TJ 2EINH 4XMYA 2LLKA 3MD2A 2W84A 3FK7A 4L9JA 3KP4A 1HNWE 2NNNA 3OIOA 4HZFA 4Z6YA 3CMMA 4DW6A 1S3JA 1RR8C 3ELKA 1P7IA 1WHQA 2DLQA 3IH2A 5EGOA 5KL6A 1O0WA 3W2VA 2R7DA 1Y1VJ 4HF2A 4XKWA 3KWRA 4RH8A 2O8XA 3BR1A 3S15J 4WCGA 1LFUP 2UU9E 2KT0A 3JAMC 1WJBA 1W36D 3H0GJ 5E17F 3H1CA 4XR6A 3IC7A 2EOQA 1QZYA 4G7OF 1U6GA 2QBYA 2Y2ZA 4I98B 2F2EA 3VYRB 5JHUA 2N8XA 5L3EA 3KCCA 4IHWA 2RVCA 2L2KB 3A4CA 5DM7F 4LGWA 2IS4A 5TRDA 2MKNA 3H92A 4M6XA 4EM2A 2GXBA 5D5VB 2JJ7A 1R22A 2LTPA 2PEXA 4BL0B 2X85A 4GDFA 3QPLA 4EEFG 1A35A 2HOTA 4ESBA 3ZN0A 2B7TA 1YS7A 2V87A 4F9AB 3LSPA 2O5RA 5FLVA 2ENCA 1YIJI 2FX0A 4YIFA 2FJ1A 3MEXA 3ASNH 4HEA2 5AIQA 1JI8A 3Q9SA 1P4AA 5F0FA 4D5FA 1QHGA 1YIOA 1IV6A 5TGTA 4AVZA 2DRPA 1TQPA 3K6QA 2WBUA 2V86A 3HM5A 4XONA 4FK5C 2EOSA 3SYTA 3WG7H 3RZDJ 4KISA 5BS6A 1H89C 3DQVC 3E6DA 3HZJA 1DQ3A 2WTEA 3S2WA 3SZGA 4DV3E 3HC7A 3FMQA 5CKTA 4DYQA 3CCQI 2QSGX 2HYGD 1X6HA 3S1MJ 3OS0A 2EMGA 3WTVC 4DV0E 2GXAA 3ONQA 5KAIC 4IZZA 2FD5A 1E0EA 1AAYA 2M0CA 3W6VA 1YHQI 3GO5A 2KZVA 2I8DA 1MBGA 2FQ3A 4F52A 2WAFA 4A2UA 3PNTA 1IN4A 2E1MB 5IP7J 3IL2A 4M2ZA 1ZARA 1BOAA 2HXOA 4II3A 4Q5SF 4BS9A 5GTIC 2YPRA 4I7HA 1D1AA 1IMUA 2EN4A 5B3SH 3Q3SA 4G6DA 4PSWA 2JPBA 2OBPA 2CQ7A 3GVAA 3T8TA 1DGWY 4LIUA 1AKHA 2HQ5A 4KIFA 1T39A 4N0BA 1IXCA 4Y7NJ 5C4JJ 4BQOA 4O24A 3WTWC 1BJZA 3OOPA 3K4MA 1XCBA 3HIFA 1WZ2A 4PZJA 2ELZA 2LV2A 2HVSA 4L9VA 4M71A 4MO7A 4S04A 2DJNA 3O8GA 1W7PA 5B5EC 2FU4A 1V5EA 4QPQA 1GLNA 4G9YA 2DQLA 2HEOA 2HHHE 1BBOA 1TL8A 5F64A 2JUGA 2MD5A 1TLHB 3C2GA 3DPTA 2EOJA 5AE1A 3GZ5A 3K9TA 2K40A 3HRUA 4M6VA 2F4IA 1YFHA 1N25A 4IF4A 1X1AA 1FP1D 2DTRA 5JHFA 5FLXC 4DR5E 2E60A 5HLTA 3H9JA 5DCMB 3ABMH 2L7FP 2PBIA 3DJWA 3C18A 4R2PA 1YTYA 1FYMA 2MKDA 4A0YA 4IPAA 2ID3A 3PO2J 2GA1A 4WXCA 5HS8A 3OSGA 3GWZA 3FXKA 4X1EA 1U5TC 1VQ9I 2L01A 4LK1F 1KZHA 1ZTRA 5EEGA 4NXME 2AQEA 3CO6C 1UZCA 3M1EA 2WBMA 1JK1A 4HG2A 1AA7A 4IL6C 1QPMA 2OC6A 2R3SA 3CLOA 3K1PA 3J7AY 3F8MA 4DV4E 2RQQA 1RNLA 3S93A 4BE2A 3VSKA 1V5FA 1PJRA 3BTLA 3K2ZA 2EMZA 3BGHA 4HW0A 1B4AA 3FDYA 4XICA 3LL7A 1YW7A 3ASOH 3ECRA 1JK2A 2YTDA 1WHUA 1B72A 1IRXA 4M3EA 1ETXA 2VLAA 4IHSA 2CO5A 2RQPA 1QU3A 2JP9A 3A0HC 4YFKF 3PUBA 4NC6A 1IN6A 2V7FA 2PRTA 2EZKA 3QP5A 1H8AC 1YJWI 3RDIA 2LKXA 3CMAI 1OR7A 3HTSB 5DNYA 4M3GA 1F2IG 3C2HA 3L2VA 2Y31A 3JAMZ 4OX9E 3QPTA 1DU0A 4EATA 1B6AA 5B1BH 1OR7C 2EH3A 3I54A 1TNTA 3G1OA 3VPRA 3JREA 1PJSA 3E97A 1IDYA 5HS7A 2V9VA 2Z3YA 1I6XA 2L9VA 4IJAA 3Q0WA 3I55I 1GT0C 1VQLI 2F4VE 3Q5FA 3HDDA 2YT4A 3Q0UA 5DS9A 4A0ZA 3GTGJ 2IGNA 1D0XA 3DPLC 3TQNA 2F48A 1WWXA 2L6MA 3LSKA 2I13A 2I5UA 5M3MJ 3THNA 2E2HJ 2ZSHB 2RDPA 4HF0A 1W5CC 4Q4ZF 3WTSC 2N8GA 4XN0A 3OYFA 3DFGA 4OMZA 2GA2A 1E3HA 4K2EA 2L92A 4LOCA 1PUFB 3H35A 3M7GA 3WU2C 4LU9A 1TTYA 2YTNA 1UCRA 5DTDA 2WY7Q 4DR6E 3J7AG 1Z05A 1IXRC 1XG1A 3F8NA 2CV0A 1G3TA 4D5CA 4NXNE 2DW4A 3CCVI 2H94A 4ENMA 2K9LA 4I0AA 1RESA 4EJOA 2IBDA 1QNTA 3GBGA 2JRTA 3JW4A 2KQRA 3KIOA 2LE2A 4OINF 1SFEA 2H8RA 2GIVA 5T6JA 2OPTA 4BAYA 1P4WA 2FA5A 5CQGA 3SQNA 3OYNA 2Y9ZA 3CMEI 1TBXA 2MBFA 1W36C 3A02A 3I0TA 3L09A 2M8GX 1RQ0A 2IPQX 4HNUA 2CQNA 1R7JA 3M9AA 1ZK8A 3NWSA 5BPDA 1JHHA 1ZG3A 3EUKL 1R5HA 2K4VA 2LMZA 5LFAA 5BQTA 4HQMA 1D1BA 1Z3XA 2K9NA 2EOYA 4RBOA 3I4PA 4MQ9F 2Z2SB 2PMUA 1FC3A 1LUJB 4P96A 5KL4A 5D8LB 1Z6RA 4XLAA 2EFOA 2OZUA 2EFQA 2F8BA 4JI2E 1SC7A 2GLOA 1MGTA 2F5CA 2RN7A 3HHHA 4D0PA 3NWTA 2XB0X 2UWMA 3FX3A 1G6NA 4J00A 4CCJA 2Z9OA 1LE8A 1FTZA 1KU3A 2XF5A 1LKXA 3K6GA 1WI3A 1IO2A 1TT5B 3RPUD 4AM3A 1XN7A 3R6SA 5KL5A 4N9HA 2FSWA 2V1DA 4NQWA 2CRGA 5C3EJ 1WJPA 1IBKE 1Y0NA 2E71A 2HOAA 4G8XA 4S0HB 2E2JJ 4ABZA 2PJRB 1S7EA 4BDYA 5F1RA 4OAZA 2RGVA 2R7TA 4J19A 2A68F 5LMUE 3SDGA 2VT3A 3AG1H 3OYAA 2UZKA 5CFFE 4R2SA 2EQ3A 3JRDA 2EFPA 3H5NA 3KZYA 2R7UA 3MAJA 3FXLA 4BH9A 1I27A 1N32E 3K69A 2VN2A 4XLNF 2CQKA 4KT5C 4G7HF 2ELHA 2WAEA 3QOPA 1Y39A 2ZCWA 2ZJPF 1TW2A 3ISPA 2RC4A 2JT1A 4DZPA 4QTRA 1SMYF 3DTIA 4AIJA 1GV2A 1J09A 2K4BA 2HWVA 3K4LA 4NHRA 1QRYA 4LD5A 3HJEA 3SXYA 2BGCA 1F36A 1H9GA 2BE5F 2V6EA 4CHUA 5D6EA 1JT6A 4B1RA 1NK3P 5CQEA 4KT6A 3WG9A 4R8OA 2QF7A 2NS8A 1FP2A 4M0VA 3OS2A 2ISYA 4KZSA 5ADZA 2AO9A 2JPCA 3RZOJ 1MIJA 3HGGA 1BL0A 3SJMA 1PVEA 2KZGA 2P6SA 1ZRDA 3WTYC 2ME6A 3W2AA 3FBNB 4M9SA 4RAZA 3F9KA 2B3TB 3WU1B 1DGCA 1DU6A 4XQFA 1JTXA 3G3ZA 3VHTB 3ZPLA 5BMZA 5IT3A 2LBSB 1LFBA 3M8EA 4F92B 2VJ5A 3U9GA 1DPRA 3JSOA 3VDXA 2XKOA 2M7QA 1MBFA 2DFEA 2YX7A 3O2PE 4XRSG 2P5LC 1ETQA 3L00A 3KP2A 2R1FA 2HC5A 4M6YA 2KJCA 2MFZA 3R0AA 2HVRA 2H1KA 1YJ9I 2CJJA 3HSRA 2PMZA 4IOAF 2Z16A 2B7VA 4WX9A 4Q47A 1NG6A 5FKLA 4X9JA 3E3VA 1Z1BA 2DA2A 1I50J 2RV8A 4NNJA 4X62E 2XASA 2EV0A 4BGDA 2EPLX 3WTXC 1Y8QB 4UB6C 1JUMA 2BYVE 3S1QJ 2EIKH 2QZ8A
chains in the Genus database with same CATH topology
2IRFG 2XROA 2A5YB 2COMA 1HKTA 2EA2A 2STWA 3IWZA 3FWEA 1Z1DA 3GF2A 5E1XA 3PQKA 1XSDA 1AOYA 4ESJA 5LLQA 1UFMA 3E6BA 1Q1HA 4EM0B 2L3DA 1Z9CA 3I59A 1V3FA 1UHWA 1H9TA 1F1ZA 2YU3A 5LEJA 4CXFA 2HTSA 2KIUA 3TDUC 1USTA 3JAMK 1IRGA 2LF8A 3I64A 4LJZF 4KN7X 2ZXJA 3DP7A 1DP7P 2IW5A 1XMAA 2L02A 3TGNA 2PI0A 2QYOA 3VEPA 1SD4A 3RYRA 4MTDA 5D5WB 3C1DA 4OU0A 5DEQA 3U1DA 2D1VA 2HDCA 3R4KA 5ICEA 4U88A 1F9NA 3IRQA 1BC7C 3I71A 4CYDA 3HRMA 1MZBA 2CG4A 4RGXA 2PLYA 3CUQA 3ZMDA 1OYYA 2FMLA 3DF8A 2LDUA 5CVUA 2JSCA 3WU0A 2Y0MA 1AWCA 1ZN2A 4PDKA 1YO5C 4BNCA 2QENA 1BC8C 3P7NA 3I5UA 2EFWA 3WODF 2CW0F 4UVAA 4GYIA 3LAPA 3TO7A 1LDDA 2CYYA 1MD0A 1R58A 2STTA 4I01A 4R79A 3CDHA 2HOEA 5LRSA 5L3BA 2IP2A 2E7WA 2YR2A 2DAOA 2LKPA 4ZZDA 2X4HA 5E1WA 2VE9A 1ZLKA 5K5OA 4QWQA 2QQAA 3E6MA 5FLXK 2ETHA 3JSPA 2FMYA 1YYVA 2EFNA 1JE8A 1F4KA 4G6QA 1GVJA 2DPUA 3BPVA 4IRGA 1P4XA 3ZMSA 1P2FA 5LGNA 4ENKA 3FM5A 2VOPA 4R8HA 3KETA 4RB1A 4NHJA 5FB2A 4XBFA 2BV6A 2FF4A 2O0YA 1I5ZA 2WV0A 3I53A 4CO8A 2FNAA 1K79A 1KQ8A 1WRJA 2Z99A 4OMYA 4HQEA 3B73A 2HYFA 4AIKA 5E8GA 4UNOA 4KN4X 4U0YA 4I02A 3WGIA 2XAGA 2M45A 2HKXA 4Z2YA 2M5WA 4FT8A 2O61A 2XGXA 3F22A 2QQBA 3F8FA 3L7WA 1XMKA 1K6OA 3BP8A 3T0YA 4EGYA 5FD6A 4MNUA 4RS8A 3CUOA 5HVQC 4ZYEA 3WGHA 1P6RA 2A69F 3BJOA 4XSXF 1SMTA 4EMSA 2K27A 1J9IA 2G9WA 2ZNYA 1FLIA 1XSVA 3BWGA 2P7VB 2DQRA 1REPC 1W5TA 4JQFA 3REOA 3GUDA 1R00A 5E20A 2VT2A 4KFCA 3F6OA 1TQIA 1D8KA 2W24A 1HW2A 2V79A 1O7FA 1IAWA 3VB2A 4RAYA 3WE3A 1U8RA 1R1TA 2IA1A 2MA3A 1FBQA 4MEXF 5HLHA 1UHMA 1IN7A 1D3YA 3RTRA 1HBXG 5DD8A 1U78A 2A61A 4OOIA 3F21A 2VXZA 5LBQA 4HV5A 4IRHA 2XVCA 2A07F 3BJ6A 2OQGA 3RKYA 2L54A 2IT0A 2H27A 5HLGA 2KKOA 2P5KA 2CSOA 1J0RA 4GGGA 3VFZA 3PQJA 4XSZF 2EV6A 1SD7A 3EYYA 3FXQA 4HX4A 4XRFA 1PP7U 3RKXA 4HOBA 3WTTC 4IHTA 2VOOA 2EB7A 1ULYA 4HX8A 3F6VA 5LGUA 4CGZA 4M9ZA 1XGMA 1EH6A 4U7DA 3V8JA 1U5TA 5D4RA 1ZG1A 3ABUA 3EYIA 1IF1A 3T5XA 4L5JA 1ZGJA 1SFUA 1BIBA 1G3YA 2FBIA 4KMFA 1FT9A 2VE8A 3HRSA 2ZNZA 3WTZA 3C3WA 5IT9K 4G7ZF 2OU2A 1OPCA 1FPQA 4HF1A 1LEAA 5CYVA 2R7FA 3HTUA 4LLNA 2P8TA 1LDJA 3MQ0A 4I09A 2VC1A 1TQMA 2OD5A 1XCVA 2B0LA 1T98A 1FNNA 1USSA 3ULQB 4HX7A 5FFZA 3KE2A 4YFNF 3IRRA 2EK5A 3FXUA 4JBAA 2L4AA 1EH7A 2YX4A 2NS0A 2ZMEA 1BIAA 1R36A 4EV0A 5DYMA 3J81K 4N9IA 5HOOA 1W7PB 2NAZA 5L3FA 1RI7A 2ESHA 3K1NA 2QVOA 3SHFA 1Z6TA 5ICFA 3SZPA 2W25A 2KRFA 1GHCA 3LQRA 2K86A 5LHHA 2QQ9A 3FHZA 3NRVA 5L3CA 1HXDA 3G73A 2PMHA 2PJPA 4M9XA 1XGNA 3R0JA 3KLOA 2E1NA 4KMUX 1WSUA 1O3SA 1I1SA 3GFMA 1YW8A 1EH8A 2BBYA 2M30A 3AAFA 1DPUA 3BDDA 3FMSA 5FFXA 5FLXZ 1F5TA 2PFBA 2Q8KA 2RNJA 1WI9A 2CFXA 3PFIA 4EVIA 5ICGA 3TDZC 3GX4X 1OKRA 4A6EA 2NNYA 4EJVA 1U3EM 2Q2EA 2OAZA 2P7CB 1XGSA 3RJPA 1K78A 1ODDA 4B8XA 1ZG5A 4EJUA 1SAXA 1HW1A 4ZYDA 2Z5UA 3BPXA 4YFXF 4F7ZA 2XAJA 1IN8A 2GXGA 1R1VA 3LWFA 2EA4A 4BHCA 4P9FA 3W6KB 1R5GA 5D6FA 1XSXA 3H3UA 4IVNA 5HDNA 1L3LA 1K7AA 2Y75A 3ZMUA 1J59A 2WC2A 5CVIA 3GYHX 1YG2A 5FGMA 1GXQA 5BPIA 1TW3A 3EETA 4BHPA 1G3SA 2XV4S 3QPHA 5K5QA 5CVJA 5K1YA 2JZYA 2DK8A 5CVVA 2LSOA 4H0EA 3FXRA 1B9MA 4M73A 4ESFA 1J5YA 2EJRA 2A6HF 3KP6A 4GO1A 1P92A 1DUXC 1D8JA 4B09A 1CF7A 2PN6A 2ZO4A 1RZ4A 3F3XA 4U0VA 2AXLA 2BEOA 3MCZA 3RIRA 5HDGA 2Y48A 2GZWA 1ZGAA 3QU6A 3J80Z 4EQQA 4LG0A 2YSRA 2DPDA 3NQOA 1KQ0A 4IRIA 3LFKA 2VBZA 4ZYGA 4EJTA 2D2WA 3DV8A 2E7XA 3QAHA 4A12A 3ZMTA 5F6FA 4LB5A 2IVMA 5LHGA 3P9CA 4O6JA 2FBKA 2LNBA 1ZREA 1W5SA 5DDGA 1FZPB 1HKQA 4Y15A 2OZ6A 4R1HA 4NB5A 5HS9A 3HOSA 3RPUA 4UHTA 1MDMA 1A04A 5AIPA 4GYGA 3BJAA 3KP5A 3I59B 3ERED 3EQLF 5JR3A 1XB4A 4ETSA 5DCFA 5LEKA 3GZ6A 4FX4A 2QWWA 1MKMA 3GFIA 2HS5A 2PG4A 3ZMZA 5IT9Z 4AWXB 4Y17A 2F5DA 2F5EA 4L0YB 4KA4A 4KIBA 1W7PD 3Q9VA 2V6CA 1BI2A 3DEUA 2V1UA 3P9IA 1B9NA 1SFXA 4HV6A 4U7BA 2O3FA 3GFJA 1JHFA 3KP7A 1KU9A 4M72A 3BZ6A 2FEZA 3GXOA 2MC3A 5ED4A 3KP3A 1V4RA 5TJJA 1LEBA 3CUQB 5L3GA 3J81Z 5DD4A 3WGGA 2XUBA 3CJNA 1KU7A 5ILSA 4BHBA 1T0FA 2HFHA 5L3DA 4Y13A 5KK1A 2HKOA 1KQ9A 3T1BA 2O03A 3KLNA 3BY6A 2IJLA 1HW5A 1UB9A 2FBHA 3LQQA 3COAC 1Y0UA 4HDVA 2KJBA 3HSEA 4RB2C 4G94A 1O3TA 1U2WA 2LF7A 2DBBA 3HYIA 1FX7A 1Z7UA 1IZ1A 3TOBA 1LNWA 4ON0A 3V7SA 3F72A 2EWNA 1T38A 1PUEE 1ZHFA 2F5FA 3P9KA 1O3RA 3FZVA 1LJ9A 3LA2A 2OA4A 2MLKA 1LB2A 2XIGA 3R61A 5DCMA 2OQRA 2ISZA 1R1UA 3V4GA 1GXPA 4UV8A 3RPQA 4A0XA 2DLLA 3TKYA 4PCQA 2IA2A 4WK8F 4FHTA 4ZH4F 4WWCA 4DQ2A 1FYLA 1L0OC 4PGHA 3K1MA 1IRFA 1O57A 4YIIA 4S05A 2DK5A 1NHAA 2ZFWA 5H20A 2IA0A 3FM3A 5HLIA 3QP6A 4YG2F 1W4MA 3J80K 1DDNA 2XKPA 3SFZA 4IXAA 4HBLA 5A2QK 1FSHA 2CGPA 3IHUA 5ERIA 1KGSA 3HOTA 4HA8A 4AVPA 1O3QA 1OYIA 5LGTA 1VTNC 3FF5A 4HAMA 2VBXA 1E2XA 1R23A 3LAJA 2DI3A 1D5VA 2QBYB 3WTUC 2VODA 4RGUA 1O7LA 2GWRA 3FMRA 3KZZA 2CWEA 1BJAA 2QLZA 3OV8A 4CDGA 3J7AO 2XAFA 1J2XA 4KDPA 2XAHA 1QO0D 3SZTA 1IW7F 5BOXA 1ZRCA 2XAQA 5DUKA 2XRNA 1LQ1A 5JI6A 4PGGA 5AONA 3GEZA 4EGZA 3MWMA 1XD7A 2HQNA 4WXDA 1PDNC 2HGCA 4RGSA 4BQAA 4LK0F 4A5NA 2WWYA 4HLYA 4UVBA 2FXAA 2A3SA 3D5LA 1B1BA 3BROA 4UVCA 3ZP5A 4I0BA 2Q0OA 1C0WA 3MFKA 2MLGA 3IKTA 1HSJA 2GAUA 3KEOA 2H6CA 4ASNA 1XGOA 3ECOA 1YQAA 4A6DA 3RI4A 4L9TA 1QBJA 2FE3A 1IUYA 1S7AA 4ENJA 1ZAOA 2Z33A 3B02A 5DV5A 1J7KA 1STZA 1ON1A 4UV9A 1IXSB 4ZYHA 3HRTA 4QLCU 2MH2A 5DUIA 4WXHA 1S8NA 2TDXA 2ZKZA 1ON2A 4KUMA 1RUNA 2K7LA 2W85A 1XDSA 2VBWA 5D4SA 1S6LA 3IWFA 1U5TB 3EUHA 4BXUA 1ZH5A 2ESNA 4O3MA 2UXXA 5CVRA 5K5RA 4L9NA 2PQ8A 3RYPA 5E1ZB 2MH9A 2NYXA 2P5VA 3F8BA 2NRAC 3WE2A 4MEYF 1SD5A 3L9FA 2A6EF 1JXSA 5H6QA 4MQVA 4TV7A 1G4DA 2DFIA 5KVRA 1I1GA 2V1XA 1LDKB 5J8CA 1BBYA 3V7RA 5ILVA 5D8KB 4A5MA 1KYWA 1BI3A 1QGPA 4OIQF 3DKWA 5ICCA 3JTGA 3H3ZA 2FRHA 3NEUA 1YS6A 1HSTA 3HUGA 1T2KA 2ZMEB 1S7OA 1H0MA 3QRFF 5CLSA 4HLXA 2M1BA 1E17A 5J8FA 4P9UA 2C6YA 3LSTA 2H09A 4RB0A 4EM1A 2KIMA 1BI0A 4HDUA 4OIPF 5CJ9A 3QU3A 2D45A 4ZZLA 4L0ZB 3HHGA 3I58A 4AIHA 3M8FA 1KYZA 3E5UA 4EJWA 1FBUA 2HQRA 1FY7A 2DT5A 1FYKA 3EDPA 3TOAA 2G7HA 2W57A 1ONVA 2VBYA 2X0LA 1YW9A 2HTJA 6PAXA 2L4MA 2AS5F 4LMYA 2J5PA 3KFWX 4CZZA 1ZRFA 4OIOF 4L5IA 1HKSA 2EV5A 2ZJ2A 4KICA 3HSFA 4DNCA 3V8LA 1CGPA 3E5XA 2XHKA 2K02A 2M8EA 5JVTA 4XLPF 3O3KA 1G3WA 4HYEA 4LFUA 4JK1X 5HDKA 1RIOH 3ZN1A 4LLGF 1LVAA 2QUFA 1MJBA 1FSEA 4WF2A 4KYWA 5EEHA 1OMIA 5FD5A 2K4JA 2FNPA 4P5OA 4OIRF 1K78B 3C7JA 5JFRA 3K0LA 4AD9A 3T8RA 5ILUA 1EV7A 2ZBKA 2P4WA 5FO5A 3W6JB 3L2CA 2J5OA 5A2QZ 3O6BB 1FWZA 3GW2A 1S29A 1YLFA 3GLXA 4ENNA 3VODA 3F8CA 2FOKA 5J6XA 1XDUA 3JTHA 5D5XB 1X3UA 2VC0A 3V8KA 2HZTA 4RGRA 3E5QA 3U2RA 1BI1A 3GFLA 4LLLA 4MGRA 4CICA 3TO6A 1B59A 2E1CA 2JTVA 1KU2A 3CUQC 4KIGA 1Z91A 5E8IA 3VOEA 3KEQA 1RUOA 1QQIA 2ADUA 4KNYA 3ABTA 3BOQA 3TO9A 4UXNA 3V7CA 1IN5A 1J75A 3ECHA 4Q48A 3F23A 4O5VA 3ZQ7A 1CF7B 4M74A 3D0SA 3DXJF 4GXOA 1FBSA 2HR3A 3IKVA 3E6CC 1PP8F 4UUVA 1SD6A 3R60A 4P55A 3ROUA 1WKMA 2KIFA 1MJ9A 1JGSA 4BYYA 3MZYA 5LHIA 1ZLJA 5D5UB 1OYWA 4U0WA 2M87A 4MTEA 4L18B 2VONA 3RKWA 4LG0B 1TNSA 4LB6B 3CO7C 4GCVA 3MZHA 1MJAA 2G7UA 2ACJA 1FOKA 1QZZA 1WQ2A 2RKHA 3N97A 3CTAA 3LA3A 5H6RA 2GQQA 2QM3A 4RB3C 4MHGA 4FX0A 1ZYRF 2H6BA 1BN5A 5LRRA 5E18F 4E70A 3ZMVA 3ML6A 2P6TA 2UXNA 3N4MA 2O6GE 2D1HA 1MDMB 2DO7A 1HQCA 1KA8A 4I2OA 3LA7A 2DU9A 1BM9A 1T6SA 2W84A 4L9JA 3KP4A 2NNNA 4HZFA 1S3JA 3ELKA 2R7DA 4HF2A 2O8XA 4WCGA 5E17F 3IC7A 1QZYA 4G7OF 1U6GA 2QBYA 4I98B 2F2EA 5JHUA 5L3EA 3KCCA 2RVCA 4LGWA 5TRDA 3H92A 4M6XA 4EM2A 2GXBA 5D5VB 1R22A 2PEXA 4ESBA 3ZN0A 1YS7A 4YIFA 3MEXA 5AIQA 3Q9SA 1P4AA 1YIOA 1TQPA 5BS6A 3DQVC 3E6DA 2WTEA 3S2WA 3FMQA 2HYGD 3WTVC 3GO5A 2FQ3A 4A2UA 1IN4A 3IL2A 1ZARA 1BOAA 4Q5SF 2YPRA 4I7HA 4G6DA 2JPBA 2OBPA 3GVAA 3T8TA 4KIFA 1T39A 4N0BA 1IXCA 3WTWC 3OOPA 1XCBA 3HIFA 4PZJA 4L9VA 4M71A 4S04A 1W7PA 2FU4A 4G9YA 2DQLA 2HEOA 5F64A 2MD5A 1TLHB 3DPTA 3GZ5A 3K9TA 3HRUA 1YFHA 4IF4A 1FP1D 2DTRA 5DCMB 2PBIA 3C18A 1YTYA 1FYMA 4A0YA 4IPAA 2GA1A 4WXCA 5HS8A 3GWZA 1U5TC 2L01A 4LK1F 5EEGA 3CO6C 3M1EA 1QPMA 2R3SA 3CLOA 3K1PA 3F8MA 1RNLA 3K2ZA 4HW0A 1B4AA 1YW7A 4IHSA 2CO5A 2RQPA 4YFKF 1IN6A 3QP5A 3RDIA 1OR7A 3HTSB 3JAMZ 3QPTA 1B6AA 3I54A 1TNTA 3E97A 5HS7A 2V9VA 2Z3YA 1I6XA 4IJAA 3Q5FA 4A0ZA 3DPLC 3TQNA 1WWXA 4HF0A 2RDPA 4Q4ZF 3WTSC 3DFGA 4OMZA 2GA2A 4K2EA 3M7GA 1TTYA 1UCRA 1Z05A 1IXRC 3F8NA 1G3TA 2DW4A 2H94A 4ENMA 4I0AA 4EJOA 1QNTA 2JRTA 3JW4A 4OINF 1SFEA 2GIVA 4BAYA 1P4WA 2FA5A 3SQNA 1TBXA 2MBFA 3I0TA 3L09A 2IPQX 1R7JA 3M9AA 5BPDA 1JHHA 1ZG3A 1R5HA 5BQTA 4HQMA 3I4PA 4MQ9F 2PMUA 1FC3A 4P96A 5D8LB 1Z6RA 2EFOA 2OZUA 2EFQA 1MGTA 2F5CA 2RN7A 3HHHA 4D0PA 2UWMA 3FX3A 1G6NA 2Z9OA 1KU3A 1XN7A 3R6SA 4N9HA 2FSWA 2V1DA 4NQWA 4G8XA 5F1RA 2RGVA 2A68F 2VT3A 2UZKA 2EFPA 3KZYA 3MAJA 4BH9A 1I27A 3K69A 2VN2A 4XLNF 2CQKA 4KT5C 4G7HF 2ELHA 3QOPA 2ZCWA 1TW2A 3ISPA 2RC4A 2JT1A 1SMYF 4AIJA 2K4BA 2HWV