4BHCA

Crystal structure of the m. tuberculosis o6-methylguanine methyltransferase r37l variant
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
165
structure length
165
Chain Sequence
MVHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSLTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALLELEKSRAPADLTLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Studies on the M. Tuberculosis O6-Methylguanine Methyltransferase and Mutated Variants.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords METHYLATED-DNA--PROTEIN-CYSTEINE METHYLTRANSFERASE
total genus 40
structure length 165
sequence length 165
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4bhcA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4bhcA01
4CICA 4RB2C 3MWMA 1A04A 2VBXA 4ZH4F 1J2XA 4HX4A 1TNSA 2L3DA 4Q47A 3TDUC 3HTSB 3V8JA 2W57A 1TNTA 3L09A 1E17A 1EV7A 4U88A 5CVVA 3KCCA 1YYVA 5J8CA 4HF2A 2BEOA 4EJTA 1S29A 3FM3A 5DCMB 5DCFA 5CJ9A 4OIPF 2QBYA 3E97A 1K79A 5F1RA 2BE5F 3ZN0A 4G7ZF 4IF4A 2M30A 5HDNA 1R58A 2KKOA 4EM0B 4EGYA 3WTZA 2XROA 1GXQA 5HS9A 3VOEA 1REPC 4CDGA 3TO9A 3PFIA 4HLYA 4Y17A 5JR3A 2LF8A 2L54A 1IN6A 4S05A 2IVMA 2EWNA 1OKRA 2FE3A 3KE2A 1IN8A 2ZO4A 2ZFWA 4HAMA 4EM1A 2IJLA 5ILSA 1AWCA 1WKMA 1R22A 1R5GA 1T0FA 1DPUA 2DQLA 5ERIA 2XGXA 3O2PE 4A0YA 4ASNA 1HKSA 2QQ9A 1S8NA 2XIGA 1MZBA 1K7AA 4R8HA 2GXBA 3IRQA 2ZMEA 4U7BA 2M5WA 3R0AA 4IRIA 2M1BA 1XGMA 1GHCA 2QENA 2EJRA 1P4AA 2OZ6A 2MLGA 1E2XA 2VBYA 3ECOA 2PI0A 3ZMUA 1YG2A 1WI9A 3HSEA 2ESHA 3EQLF 1IRGA 4ENKA 3QAHA 1KU2A 2WTEA 4UUVA 4UVCA 1UB9A 2Y75A 4FHTA 1CF7A 1UFMA 4TV7A 1IAWA 2DAOA 4IVNA 3U1DA 4G8XA 4UNOA 4MTEA 3SXYA 2UXNA 1XSDA 2GQQA 4G94A 4IPAA 2EA4A 1T39A 3B73A 2ZNYA 1SD4A 2DI3A 3J80Z 1BIAA 2M8EA 3DP7A 4HA8A 4KNYA 3WTYC 1O57A 1BOAA 3KLNA 3GZ6A 4L9JA 2V6CA 1I27A 4YG2F 2ZBKA 1PDNC 4NQWA 1FYLA 4R79A 1XGOA 1PP7U 3F3XA 3HTUA 1SD5A 1ZLJA 2IW5A 4A0ZA 4EM2A 3SFZA 2NAZA 3HHGA 4I0AA 2PN6A 3ERED 5LEKA 1P4XA 4DQ2A 4HDVA 1R23A 1GXPA 4BHPA 3N97A 3OV8A 4MEYF 3REOA 2TDXA 1O3SA 4XSZF 2J5OA 1BN5A 2E7XA 3PQKA 1HBXG 5ICEA 2LSOA 1V4RA 1FP1D 1Y0UA 2DTRA 3H92A 2DO7A 4L5JA 4UVAA 1IN4A 3MAJA 3RI4A 1B9MA 5BS6A 2A5YB 4BHCA 4IRHA 3RPUA 1YLFA 2EA2A 2YPRA 3BOQA 1FOKA 1GVJA 1EH7A 3JTGA 1ODDA 5L3DA 3FX3A 5FO5A 5LRSA 1U3EM 2K02A 4LG0B 4HX8A 2E1CA 2B0LA 1BI0A 3BJAA 4RS8A 1OYWA 4GGGA 1W7PB 3TOBA 4QWQA 1KYWA 2R3SA 5LHIA 5FFZA 1MKMA 3LA7A 4OOIA 2RNJA 4ESBA 5A2QK 4HF1A 3BJOA 4AIHA 2FBHA 2XVCA 1ON2A 2F2EA 4RGXA 4OU0A 2VXZA 3GFJA 2VT2A 5AIPA 3I58A 1YW7A 3JSPA 2KIMA 2XUBA 4HLXA 5D5WB 4ENJA 3ZMTA 1PUEE 4HW0A 2VT3A 3Q9VA 4Q5SF 1Z6TA 2EFPA 2PFBA 2OZUA 5D8LB 4EVIA 5HVQC 1ZN2A 2OAZA 1W7PA 2JPBA 4KUMA 4IHTA 1XSVA 4ON0A 2DPDA 5KVRA 4HZFA 2FBIA 5E1WA 4Q4ZF 2GZWA 1XGNA 4OIQF 4G7HF 4WK8F 1FLIA 3G3ZA 4JBAA 3WTTC 4AD9A 2V9VA 4LB6B 3JAMZ 4ZYEA 2EV0A 4HQEA 4LB5A 3CO6C 3E6BA 4PCQA 4RB0A 4A0XA 5A2QZ 1U5TC 2E1NA 1XDSA 1FX7A 4MTDA 3RKWA 4L9TA 1ZRDA 4EV0A 3FHZA 2HKOA 2CO5A 1STZA 5D4RA 5FLXZ 1FPQA 1MGTA 3WE3A 4EQQA 5E8IA 2VC1A 4N9IA 2KJBA 2W85A 3KETA 1OPCA 4XBFA 5DD8A 1SD7A 3GWZA 5K5OA 1IW7F 3WTVC 1OR7A 4PZJA 3L00A 3LA3A 1ZG5A 3CO7C 1FBQA 4NHJA 3U9GA 1LDKB 4EMSA 1P6RA 2PG4A 2QBYB 2XKPA 2HQRA 4EJWA 6PAXA 5DCMA 1ZG1A 2XAJA 3DPTA 1R1UA 2MH9A 2YR2A 3WGIA 2QWWA 4LK0F 4BYYA 1P4WA 1QO0D 5HOOA 3SZPA 1R1TA 4OMZA 2L4MA 2C6YA 3KP7A 3RIRA 3KP4A 3V4GA 1RZ4A 2ZCWA 2DT5A 2RC4A 4RGSA 1ZARA 2MH2A 3F8FA 2CW0F 1IN5A 1YW9A 3TO6A 3GX4X 1Q1HA 2STTA 3R60A 2RN7A 4KICA 2Z9OA 5L3EA 2JTVA 3KLOA 3QOPA 2ISYA 3MQ0A 5E20A 3LA2A 3IHUA 1BI3A 4I09A 2RKHA 3CUOA 1B1BA 2PLYA 4OIRF 1EH6A 3P9CA 3HSFA 4WXDA 1PP8F 1MD0A 3GEZA 2NNNA 2K4BA 3E6DA 4EJOA 1J0RA 2YU3A 3T5XA 4O3MA 3F6OA 2QM3A 1L0OC 3LSTA 3CLOA 4A5MA 4XLPF 3WU1B 1RUNA 3M7GA 4H0EA 4HDUA 2O6GE 1HSJA 4P96A 2HEOA 3L9FA 4AIKA 3I59A 3GYHX 4P5OA 2OQRA 3FXUA 3T0YA 2VBZA 3SHFA 2VOOA 1SFUA 5DUKA 5BQTA 1Z05A 1R5HA 3P7NA 1ON1A 4BXUA 1TTYA 4MQ9F 1J75A 4U0VA 5D8KB 1KYZA 2V79A 5JHUA 4S04A 2G7HA 1B4AA 4M6YA 4MGRA 1Z1DA 1QPMA 4G6QA 2FQ3A 4LGWA 2KIUA 3MEXA 1LQ1A 1X3UA 5KK1A 3I59B 3TGNA 1LDDA 1YFHA 1RUOA 4UHTA 3KZZA 1H9GA 3HRUA 2D1HA 1USTA 2YX4A 3BPXA 1WWXA 4DNCA 2BYVE 1ZRCA 5LHHA 1KA8A 1JHHA 3RKXA 1TBXA 5LHGA 5DV5A 1KU9A 1CGPA 4KIGA 4RAYA 5ICGA 4ZZDA 1RI7A 4OIOF 4A6EA 1ULYA 1K6OA 1YS7A 2FNAA 2OA4A 5F6FA 4LG0A 1SMYF 1OMIA 4Y13A 2HZTA 3Q5FA 4BQAA 3DV8A 2ESNA 1SD6A 2ACJA 3FM5A 2V1DA 2RVCA 4BNCA 3BWGA 3QP5A 4I02A 2XKOA 5L3BA 1TQIA 2QYOA 2IT0A 2UWMA 3F22A 3J80K 3FWEA 3HUGA 4GCVA 2FMLA 3WE2A 2W25A 3L2CA 1DP7P 4MNUA 1QNTA 2PBIA 3J7AO 4FX0A 1HW2A 1HXDA 1ZLKA 3ZPLA 3BDDA 2G7UA 1QQIA 2CYYA 3E5UA 2HS5A 4BHBA 4GYIA 3R4KA 1DUXC 1UHWA 2IP2A 3E5XA 4P55A 3K9TA 2VC0A 4L0YB 3WTWC 4L9VA 2P7VB 5IT9K 1XB4A 2H6CA 2A07F 3M8FA 1FT9A 2CSOA 4IXAA 4F7ZA 2WV0A 1SMTA 4U0YA 2O8XA 4P9UA 2GWRA 3JW4A 4OMYA 4HOBA 3RPQA 4LLNA 1J5YA 4KYWA 1BIBA 3FXQA 2X4HA 2A61A 2FSWA 3G73A 2PMUA 1JGSA 3FMSA 3ML6A 1F9NA 3ZMSA 3QP6A 1HKQA 3TOAA 3ROUA 5FB2A 3I54A 2NNYA 1FSEA 2P8TA 3PQJA 2HOEA 3K0LA 5J8FA 3TKYA 4RAZA 1JE8A 3KFWX 4YIIA 3K69A 3HOTA 2LDUA 3HYIA 5E18F 2DBBA 1ZYRF 2DK8A 2R7DA 3FMQA 3SZTA 2XAFA 2ETHA 4EJUA 2LF7A 2CQKA 5FGMA 2RQPA 4KDPA 3KEOA 1IRFA 1QZYA 4M6XA 1C0WA 3GFMA 3IWZA 5LGNA 2HKXA 3GFLA 4Q48A 1MDMB 1W4MA 3CUQA 2D45A 2FU4A 3WG9A 1TW2A 4A2UA 3CUQC 5D5XB 3V8KA 5K5RA 1BJAA 1G6NA 4XRFA 4QLCU 2JZYA 1T38A 1J9IA 2Y0MA 2AXLA 3V8LA 1WSUA 5D5VB 5H20A 3QU6A 1DDNA 1FY7A 2VE9A 3V7CA 5IT3A 2QQBA 3MZYA 2K86A 4ZYHA 1YQAA 3F23A 4NB5A 4B8XA 3DFGA 4CYDA 2Y48A 5AIQA 3GF2A 4L5IA 1IXCA 2V1XA 4ENMA 5D6FA 2IA0A 2K4JA 2DFIA 3KP2A 1ZGAA 2D2WA 2A6EF 2STWA 3EETA 4YFXF 1NHAA 3HIFA 1BC7C 3R61A 2VBWA 2H94A 1HW1A 4D0PA 1BI1A 5E1ZB 4RGRA 2QZ8A 3S2WA 2OU2A 3RYRA 4YIFA 3DF8A 1BC8C 3J81K 5H6RA 2KIFA 3L7WA 4HBLA 3ZMZA 3VB2A 2WC2A 1HQCA 2O61A 1G3SA 2R7FA 3C7JA 1ZGJA 2W84A 3I0TA 3KP6A 5IT9Z 3LQQA 2J5PA 1O3RA 4UV8A 5JVTA 2ZKZA 5JI6A 2VOPA 1K78B 1IZ1A 5FLXK 4KIBA 3WTSC 5F64A 1IN7A 3ABTA 2RGVA 1B9NA 4HYEA 4WF2A 4G7OF 3E6CC 1ZHFA 1FYKA 1D3YA 1S7AA 3GW2A 3CUQB 3F8NA 1B59A 3I53A 5DD4A 3HRTA 4ZYGA 3FF5A 5LLQA 4I2OA 2DLLA 2G9WA 3V7SA 4KIFA 2RV8A 3GFIA 5D5UB 1XCVA 3ZQ7A 3BY6A 5BPIA 2MC3A 2O0YA 3N4MA 4ZYDA 5EEHA 2PJPA 3V7RA 1SFEA 1Z7UA 5LRRA 3IC7A 1K78A 4B09A 5DDGA 2FF4A 2FRHA 2HDCA 1MJAA 5FD6A 1BM9A 2DU9A 2CWEA 1P92A 1Z9CA 2ISZA 2A6HF 4FT8A 1MJ9A 4L9NA 4KN4X 1FBSA 2FOKA 2EV6A 3ZN1A 3MCZA 4LD5A 5AONA 1R7JA 1YTYA 3OOPA 1I1SA 4KFCA 2PEXA 4HV5A 1FNNA 5E1XA 4G9YA 4CO8A 4A6DA 3M1EA 5K5QA 1FWZA 2AS5F 4HF0A 5LEJA 3J81Z 5LGUA 3NRVA 1OYIA 5CYVA 1F5TA 3P9IA 3JTHA 1CF7B 3IKTA 4LJZF 2BBYA 1FBUA 1W5TA 5ILVA 4OINF 2HTSA 1FP2A 1P2FA 3C3WA 2P6SA 1U6GA 5CVRA 3GUDA 3MFKA 3O3KA 3W6JB 1O3TA 2DK5A 3CDHA 1O7LA 2LNBA 3F8MA 1RNLA 2JT1A 1S7OA 1EH8A 4ETSA 1FZPB 2VODA 4A12A 4E70A 4LFUA 3LQRA 2P4WA 5EEGA 2HYFA 1YW8A 3T8TA 1G3TA 3K1MA 1ZG3A 3QPTA 1D8KA 1LB2A 1G4DA 2IA2A 2GA1A 1QZZA 5TRDA 1Z6RA 2HWVA 3JSOA 4WXCA 1FSHA 4WX9A 2UXXA 5DUIA 1IF1A 4BH9A 3CTAA 2UZKA 2K27A 5HDKA 2VONA 4EJVA 4I01A 4O5VA 1J7KA 2HGCA 2JRTA 4EGZA 4KA4A 2A69F 3I64A 2W24A 4JQFA 2DPUA 1D5VA 1H9TA 1BI2A 2MBFA 2H09A 3BPVA 2IRFG 4M9ZA 1ZH5A 1T6SA 2EB7A 3B02A 3IRRA 2ZJ2A 3SQNA 1U5TB 3ELKA 2O03A 4N0BA 1XD7A 2FEZA 1R00A 5ICCA 3T8RA 4HQMA 4Y15A 1KQ8A 5CVIA 2QQAA 3H3ZA 2ZXJA 3VODA 3GXOA 3E5QA 5ICFA 2BGCA 2L01A 5CLSA 2CG4A 1U8RA 3NEUA 3ZMDA 4RGUA 2ZNZA 5CVJA 4IJAA 2P7CB 4KN7X 3H3UA 2VN2A 2OBPA 1TQPA 1MJBA 2FA5A 1U78A 3HSRA 2XAGA 1XN7A 4UV9A 2M87A 5TJJA 1I6XA 3P9KA 2EFWA 3HHHA 4ENNA 1F4KA 2FXAA 3R6SA 4ESJA 2MLKA 1HW5A 2EFQA 2Q0OA 2MD5A 1W5SA 3E3VA 1IUYA 2L02A 1TW3A 4M71A 3RJPA 1XDUA 3Q9SA 4HX7A 5HLGA 1HSTA 1ONVA 3LFKA 1XMAA 1LEAA 1TQMA 2JPCA 1WQ2A 2EFOA 2IA1A 2P5KA 4GYGA 2EV5A 1LNWA 4PGHA 1HKTA 3F8CA 2JSCA 1W7PD 1S6LA 5LBQA 2P5LC 5D4SA 1MDMA 1D8JA 3T1BA 2Z99A 4YFNF 4GXOA 4ESFA 1UHMA 4U0WA 1IXSB 1QGPA 1V3FA 4UXNA 5HDGA 4MEXF 2MA3A 3HRSA 2FMYA 1G3WA 5JFRA 3KEQA 4KT5C 2HTJA 4KMUX 2X0LA 5E17F 3RYPA 2BV6A 3IWFA 1USSA 1RIOH 2PMHA 1XSXA 3DPLC 3QU3A 2CGPA 1ZAOA 3DXJF 2Q8KA 1KQ9A 3FXRA 4I7HA 4I0BA 2Z3YA 4JK1X 3FZVA 4LLLA 3I4PA 1I1GA 3EDPA 2EK5A 4HV6A 3ABUA 2GXGA 2FBKA 4UVBA 2COMA 2L4AA 3HRMA 3BJ6A 4I98B 1L3LA 1R36A 3I71A 3C18A 3ISPA 3HOSA 2H6BA 3VEPA 3WU0A 3RDIA 3GLXA 1KU3A 2H27A 4AVPA 2HQNA 1YIOA 5DEQA 1FC3A 3FMRA 2EFNA 4PDKA 1SFXA 2WWYA 3ZP5A 3LAJA 3IKVA 1LJ9A 2RDPA 2XASA 4AWXB 1O3QA 4MHGA 1UCRA 2ADUA 2F5EA 3COAC 4M9SA 2YSRA 2O3FA 3GZ5A 2XAHA 1F1ZA 1VTNC 4CZZA 2E7WA 1ZRFA 1AOYA 2QVOA 4MQVA 5L3CA 4M74A 3JAMK 5LGTA 3D5LA 2GA2A 1H0MA 2FNPA 2XRNA 2GIVA 3D0SA 2F5FA 3KP3A 3F21A 1YS6A 2F5DA 2KRFA 3M9AA 1XCBA 1O7FA 3NQOA 2P5VA 4L18B 4WCGA 3K1PA 4IRGA 4M9XA 3K1NA 3O6BB 2HFHA 4K2EA 1T2KA 3C1DA 1JHFA 3M8EA 4FX4A 2IPQX 3EYYA 2XV4S 3AAFA 4N9HA 3WTUC 1J59A 4IHSA 5L3FA 3BZ6A 2LKPA 4WWCA 2OD5A 4PGGA 1U2WA 3LWFA 1XGSA 3ECHA 3QPHA 1JXSA 4YFKF 2YX7A 4U7DA 4R1HA 2VE8A 3F8BA 1T98A 2PQ8A 5ILUA 3LAPA 2NS0A 1KGSA 3BROA 4XSXF 2HYGD 5E8GA 1QBJA 3TDZC 2D1VA 3F72A 3TQNA 2A68F 3EYIA 1G3YA 3DEUA 4L0ZB 2NRAC 4O6JA 5D6EA 4M73A 2NYXA 3IL2A 1KQ0A 2ELHA 2KJCA 2V1UA 3F6VA 4A5NA 5BPDA 3RTRA 1U5TA 4WXHA 1R1VA 5H6QA 4M72A 1IXRC 3DQVC 2Z5UA 1FYMA 1TLHB 4LLGF 5J6XA 5ED4A 4LMYA 3BP8A 2QUFA 2QLZA 5BMZA 3CJNA 5FFXA 2CFXA 1B6AA 3KP5A 4KMFA 1LEBA 4LK1F 4RB1A 1XMKA 3WODF 2DW4A 5HS8A 2HR3A 2M45A 5L3GA 1WRJA 1LVAA 4GO1A 2ZMEB 3ULQB 3U2RA 4CHUA 3I5UA 5BOXA 3MZHA 1S3JA 4BAYA 2Q2EA 5HLHA 3WGHA 5FD5A 4ZZLA 5DYMA 2XHKA 3KZYA 5HS7A 3DKWA 4Z2YA 2P6TA 1KU7A 2A3SA 1I5ZA 1BBYA 3GVAA 3QRFF 2K7LA 4CXFA 5HLIA 1DPRA 3RKYA 3GO5A 4AIJA 2GAUA 4XLNF 4RB3C 2Z33A 1YO5C 2F5CA 4P9FA 3WGGA 1SAXA 3ZMVA 1OYYA 1ZREA 1Z91A 2XAQA 2DQRA 3WTXC 3K2ZA 4G6DA 5CVUA 3VFZA 2OQGA 5K1YA 4CGZA 3TO7A 1LDJA 3EUHA 3R0JA 3E6MA 3W6KB
chains in the Genus database with same CATH superfamily
4CICA 4RB2C 3MWMA 1A04A 2QGUA 2VBXA 4ZH4F 1IRZA 5F3WA 1J2XA 4HX4A 4XK4A 1IGNA 2KRHA 1JK2A 1TNSA 2L3DA 4JI8E 4CCNA 4PFPA 4ABZA 1STUA 4NQWB 4OAZA 1XX5A 1N25A 4Q47A 3TDUC 3C4BA 1AH5A 3HTSB 5J1UA 3V8JA 3MKLA 2GM4A 2XF6A 2W57A 1TNTA 2I9IA 3L09A 1E17A 5AC4A 1VQOI 1EV7A 3K70C 3A03A 3OL4A 4U88A 1VQ8I 5CVVA 1LFUP 3KCCA 4IL6C 3BC8A 1YYVA 5J8CA 2VE7C 3JRGA 2X6YA 4GEQB 2EOYA 2KZGA 4HF2A 2BEOA 4EJTA 1K4SA 1IV8A 1S29A 2V9KA 4R2SA 1WJDA 3TL4X 2YPNA 3S1NJ 2K5CA 3FM3A 5DCMB 1S5LC 5DCFA 1FMVA 2DA7A 5CJ9A 3HOVJ 3ADGA 4OIPF 1TT5B 3CJTB 1VFCA 2LT7A 1RC9A 2NVTJ 4JX6A 2QBYA 1IBME 3E97A 3CCEI 5C4XJ 1K79A 4D5FA 2A05A 3LSHA 1B72B 4IHWA 3H09A 5IV8B 1YZ9A 2GPIA 5F1RA 2L7FP 5KHDA 2BE5F 2M34A 3FBNB 2BY2A 3ZN0A 4G7ZF 4IF4A 3UK3C 2M30A 5HDNA 1R58A 2KKOA 2M4KA 2F6CA 2LBFA 4EM0B 4EGYA 3RCOA 1UMQA 3WTZA 1P7JA 4YRVA 2XROA 2YZTA 1ETQA 1GXQA 2FUG2 5HS9A 3VOEA 1REPC 4N4RB 2NS8A 4CDGA 3TO9A 3PFIA 4GKJE 4W97A 1OJLA 2AQEA 4HLYA 4Y33A 4Y17A 4M30A 2EN7A 3OYIA 5JR3A 2LF8A 4RMNA 1TZLA 2FGGA 4D1QA 2L54A 4DKKA 5IT9C 3EUHC 1IN6A 4S05A 3M1CA 2M1SA 2DOFA 2IVMA 2EWNA 3GTGJ 1OKRA 2IAIA 4XLHA 2FE3A 5E3OA 3QWLA 2EM2A 3KE2A 1SEUA 1IN8A 2ZO4A 4I99C 4DMIA 1OQYA 2ZFWA 4HAMA 4EM1A 1JTYA 2DDBA 2IJLA 4B47A 3IH4A 3QG5C 5ILSA 1AWCA 1WKMA 1R22A 1R5GA 2EZLA 4BE2A 1T0FA 1DPUA 2DQLA 3Q0UA 1NG6A 2LMZA 3J7ZI 5ERIA 2XGXA 3O2PE 4C3HJ 2DJNA 2YU9J 4A3CJ 4A0YA 4ASNA 2OC6A 1HKSA 2QQ9A 1S8NA 1Z0XA 2XB5A 1MZBA 2XIGA 3BCAA 1UN6B 3SDGA 1MBEA 2LE2A 3EUKL 4PJ0C 1HNZE 1K7AA 2M7BA 3L1PA 3HBLA 2WZOA 4HNTA 1Y1WJ 4R8HA 2GXBA 2JYAA 1JJ6C 2LO3A 1X4PA 3IRQA 2ZMEA 1NTCA 1UELB 2M5WA 3NWSA 3R0AA 4U7BA 2YTPA 2W4SA 1SVOA 2M1BA 3A0BC 1W36C 4IRIA 1TF3A 2R7QA 1XGMA 2R5ZB 1VQMI 1GHCA 1YRNB 2QENA 2EJRA 1P4AA 2OZ6A 2V83A 2MLGA 4M0VA 2BOLA 1E2XA 2VBYA 3ECOA 2WY8Q 3C6KA 4B3XA 3ZMUA 2PI0A 2EOIA 1Y8RB 1WI9A 1YG2A 4F93B 5GTHC 3L2QA 2K4VA 2DMPA 2DMUA 3HSEA 4FISA 2ESHA 3EQLF 1IRGA 4ENKA 3QAHA 2G0EA 1KU2A 2H1KA 1WCMJ 3E7LA 2WTEA 4P78A 2E35A 4UUVA 4UVCA 2JSPA 1UB9A 2Y75A 2YSPA 3OR1C 2WAQN 3JRDA 1R71A 1EA3A 2EPZA 1WJBA 1IQOA 1IQSA 4FHTA 2CUEA 1CF7A 1UFMA 4YELA 1YJWI 5KL2A 1KZHA 4TV7A 2VXDA 3BG9A 1WPKA 1IAWA 3MHSC 2DAOA 4JI5E 4IVNA 3U1DA 4F9AB 4G8XA 3QPLA 4UNOA 4MTEA 3SXYA 2UXNA 2YTIA 2CS3A 1XSDA 2GQQA 2LVHA 4G94A 4IPAA 2EA4A 1TWCJ 1T39A 2O9LA 1GT0C 3B73A 2ZNYA 1SD4A 2DI3A 3PJRA 3J80Z 1BIAA 3W3CA 2M8EA 3DP7A 3H36A 4PSXA 4HA8A 4KNYA 2EOXA 3WTYC 3OY9A 1O57A 4FCYA 1JTXA 1BOAA 5J1RA 4DR6E 2V26A 3KLNA 3GZ6A 3FKJA 1A31A 4L5NC 2I10A 4XLEA 4E7JA 4L9JA 2EBIA 2V6CA 1Q1VA 2YTQA 3ABKH 1PJRA 1I27A 4XKCA 4C2MJ 4YG2F 2ZBKA 1RR8C 5LD2C 1PDNC 4NQWA 3A4CA 1WJ5A 1FYLA 4R79A 1XGOA 3TP3A 4A93J 1PP7U 2EQ3A 3F3XA 2XSJC 2HOTA 3CJRB 2TCTA 3HTUA 1JK1A 3AL0B 4BJ6C 1SD5A 3VPRA 3GCMA 4BY7J 4NUBA 3CESA 4I6ZA 1ZLJA 4F9CB 1F2IG 2IW5A 4A0ZA 4EM2A 1U0JA 2LYCA 1WH5A 2ELKA 3SFZA 2Y0SA 3BCBA 5KL4A 5KL3A 4LF4E 2NAZA 1MBFA 2CUFA 3ESWB 4HSTA 2L7MP 3HHGA 2EPLX 3S3OA 1ZTRA 2UV1A 2EPNA 2CH0A 1MBGA 4CUGA 4A3EJ 1YX3A 2E1MA 4I0AA 1VQ6I 1SANA 1HDDC 2A6TA 2PN6A 1P4XA 5LEKA 4DQ2A 3ERED 2LUQA 1Z77A 3TW6A 5KAFC 3QPSA 4HDVA 1R23A 3OYEA 3IH3A 2JPAA 1GXPA 4BHPA 4R2AA 2K9SA 2MABA 1WJCA 4W1UA 3N97A 3OV8A 4MEYF 3REOA 2TDXA 2HU9A 1O3SA 4XSZF 2J5OA 1BN5A 1IDZA 2E7XA 3IUOA 3PQKA 3MKWB 1HBXG 3UKGA 2YSOA 2CTDA 3OS2A 2IS1A 5ICEA 2YRMA 2FX0A 2E19A 1UG2A 2Y31A 3CF2A 2VQFE 4RLFA 2LSOA 3ERMA 2R0QC 1V4RA 2BVLA 4JI0E 4M2ZA 2GLIA 1FP1D 1Y0UA 3OYDA 2DTRA 4BC9A 3ZQGA 4MLVA 3H92A 2DO7A 4L5JA 5CFFE 2PMZN 4UVAA 2DMQA 1IN4A 3MAJA 3FKIJ 3RI4A 3AFHA 3DTIA 4PJJA 5FROA 1B9MA 5BS6A 2MC4A 2A5YB 1ZU1A 3NAUA 4BHCA 2FJ1A 3DTKA 3O8HA 2EMGA 1MNDA 2EORA 2L5QA 4IRHA 3C2HA 2RQQA 1MMGA 3S2HJ 2WV1A 4HG2A 1ZR4A 3RPUA 1YLFA 2EA2A 2YPRA 3BOQA 2NUEA 3CCQI 4S0HB 1FOKA 4OX9E 1IV6A 1GVJA 1EH7A 3DLAA 3JTGA 1ODDA 4DR4E 2XSDC 1EKEA 3THOB 5L3DA 3FX3A 2BB8A 4JI3E 1X1PA 5FO5A 3BR2A 5LRSA 1U3EM 3LMLA 1LE8B 2K02A 2EOQA 3DTEA 4BQQA 4LG0B 2L3JA 4HX8A 2E1CA 2BXZA 5HODA 4F9BB 4WSPA 3IAM2 2HPMA 2B0LA 3A1YA 2B7VA 1BI0A 3HTXA 5EGOA 2EPMX 3BJAA 4RS8A 2EOZA 1OYWA 2GOMA 1V5GA 3K4BA 4GGGA 1W7PB 3TOBA 4QWQA 2DSYA 5HNFA 1MH4A 5IOYA 2EM4A 4R8OA 1KYWA 2R3SA 5LHIA 4Q28A 5FFZA 1MKMA 1D0ZA 3LA7A 2QKMB 3HOXJ 2V1NA 4OOIA 2RNJA 3TBIA 4ESBA 2DMIA 1WI3A 5A2QK 3A2KA 4HF1A 2CSHA 1TWFJ 2EN8A 3BJOA 4HTGA 2EM7A 2N8XA 4AIHA 3MHHC 2ECCA 2V7FA 2FBHA 1TL8A 2XVCA 1ON2A 3ZCOA 1FOYA 2F2EA 3ZXSA 3IWCA 3HB9A 3M07A 1TWAJ 5EG0B 3DCFA 1F36A 4RGXA 4LIUA 1I6HJ 2VL8A 4OU0A 2DGCA 1LKXA 2VXZA 3GFJA 2FTXB 2HYJA 2VT2A 5AIPA 1VQ5I 3I58A 1YW7A 2EWLA 1IBLE 3K4JA 2LLKA 2BW3B 4PJNA 2KIMA 5B3SH 3JSPA 5J40A 2BHYA 2JVHA 2XUBA 2WADA 4HLXA 3BG6A 5D5WB 1T4OA 4ENJA 3ZMTA 1T4NA 3GLLA 1PUEE 3H5RA 4HW0A 3S17J 1X48A 5A2QC 2VT3A 3CMMA 3Q9VA 4Q5SF 1N78A 2YTDA 1Z6TA 2EFPA 2PFBA 3LSJA 2QSGX 2GIZA 2IS2A 2OZUA 5D8LB 4EVIA 1R9TJ 3ZQQA 4A3BJ 5HVQC 2DRPA 2EP3A 1ZN2A 2OAZA 5EF6A 2ME6A 1W7PA 1FMWA 2JPBA 5EEAA 2E2HJ 3VYXA 3S1MJ 4KUMA 4IHTA 1MMNA 1OISA 1X5WA 5LL6R 3CDLA 5F0HA 5CKTA 3OYMA 1XSVA 4OOGC 4BJTA 4JYKA 4ON0A 2DPDA 3S3MA 5KVRA 1N75A 4HZFA 2MDGA 1VI0A 2FBIA 4D7MA 3CC4I 4ANJA 1QHHD 5B1AH 3A01A 5E1WA 2ADRA 4Q4ZF 2GZWA 3HOZJ 1UHZA 1I50J 4O43A 1MBJA 1XGNA 2BHZA 4OIQF 2JA5J 3QYEA 1T08B 2DLKA 3BIDA 4G7HF 4NNJA 2V4JC 2DT7B 4WK8F 1FLIA 4DV7E 3IV5A 3G3ZA 3FHNA 1D0XA 4JBAA 3CP2A 3WTTC 4AD9A 1QHGA 4H4KC 4N4OB 2DDAA 1IDYA 2V9VA 1HA8A 4LB6B 3JAMZ 3ZR8X 1ETYA 4ZYEA 2M0CA 1ZR9A 1O0WA 5FKMA 3TQMA 3EPLA 1XMQE 2EZKA 2R5ZA 1SFKA 2M4GA 2WAQA 5GADJ 2LTRA 1HNXE 1TN9A 2EV0A 3Q0WA 4NC8A 2EMXA 2K3PA 4HQEA 2R7SA 4LB5A 3CO6C 3E6BA 4PCQA 1Z3YA 3OYFA 4RB0A 4A0XA 5A2QZ 1JKPC 1AKHA 1U5TC 4NDLA 3EUAA 2JA6J 2PJRA 2M8GX 3ZRGA 2E1NA 1A6QA 3HUGB 3WU2C 4XKBA 1XDSA 3W2WA 1ZK8A 2MKDA 4F55A 2BVMA 2EM0A 2JRMA 1IBKE 1X47A 2LKXA 2WBMA 1FX7A 1E3HA 3RKWA 4MTDA 2F4VE 4L9TA 2XF7A 4DOZA 3Q0VA 2L92A 1ZRDA 1JKOC 2EL6A 4EV0A 3FHZA 2N3HA 2HKOA 2KT0A 2CO5A 3IH2A 3ABMH 3PIOF 1G2FC 1STZA 3CQZJ 9ANTA 2HXOA 5D4RA 2F4MB 5FLXZ 1FPQA 2UUBE 1MGTA 1B8IA 4JV5E 1JUPA 3WE3A 4DV3E 4EQQA 2QSFX 5E8IA 4V2FA 2VC1A 4E7ZA 1GTKA 4ZJZA 4E7HA 1GDTA 4N9IA 2MC6A 2R93J 4QPOA 2KJBA 4ZTJA 2DYRH 2W85A 4LFBE 2DCEA 3H9JA 3KETA 3OYNA 4A3MJ 3CMEI 1J5EE 1OPCA 4XBFA 5DD8A 4F6MA 1UZCA 3VYYA 3OIQA 1XTAA 1SD7A 4YHHE 4IJDA 1RRJA 2ODRC 4BS9A 3GWZA 5IP9J 4CA0A 5K5OA 2L9RA 1IW7F 3WTVC 4IO9F 2R76A 4F52A 3W2AA 1ORKA 1OR7A 3HJEA 4P1WA 4PZJA 2VKVA 1RKWA 3L00A 3LA3A 3VSLA 2VPLA 2FOWA 1BR2A 1ZG5A 4DV0E 2IGMA 3PNVA 1EF4A 3CO7C 1FBQA 3KWRA 4C2TA 3AG1H 1XMOE 1FTTA 4NHJA 3U9GA 4ZDOA 1YE9A 2MG4A 5DTDA 1LDKB 2ZMEC 4M3GA 1P6RA 1SVMA 2F4IA 2PG4A 5GPAA 4EMSA 2QBYB 1E0EA 2L8TA 2XKPA 1OCPA 4BC7A 1WJFA 4JI4E 2HQRA 3C2BA 2KZVA 4EJWA 1I39A 6PAXA 5DCMA 3OYLA 2H36X 1DI2A 1ZG1A 1NEIA 2XAJA 4PJMA 3DPTA 2DXIA 3EPKA 3H5NA 1R1UA 3G4SI 2MH9A 4F3QA 4RDUA 1WJPA 2DJIA 2Q8UA 2NUFA 1QZEA 2YR2A 1MBKA 2DT6A 1V55H 4LOCA 3JRHA 3IWDA 2EMZA 3WGIA 4DV1E 4HPQA 2KLOA 1Y0NA 1T8IA 1JI8A 4B48A 2QWWA 4LK0F 4BYYA 1P4WA 1QO0D 5HOOA 3SZPA 1R1TA 1R4NB 1J26A 4OMZA 1KONA 1ERDA 2L4MA 2C6YA 2RS7A 2O8KA 1YPNA 3KP7A 2JVAA 3RIRA 2VLAA 1A1HA 2K9MA 1GVDA 3KP4A 4II3A 1QPIA 3I56I 3V4GA 1RZ4A 2ZCWA 4QSHA 3DEEA 2PJRB 2R7TA 3K4CA 2DT5A 2RC4A 2Y2ZA 4RGSA 1ZARA 5IP6A 4UUSA 2MH2A 3JCUC 3F8FA 2CW0F 1DQUA 5F27A 1IN5A 2RQLA 1YW9A 3TO6A 5KNLA 3GX4X 3M3YJ 4E4HA 3J7Yp 2E34A 4KHPE 3WG7H 1Q1HA 4ZDPA 2DMTA 2DOEA 3C6MA 2F48A 2STTA 4A3IJ 1X4OA 3WHCA 4A3GJ 2I13A 3PIPF 1X1BA 2QQ8A 3R60A 4ZC3A 1X19A 4KISA 2VRDA 2RN7A 4KICA 2XRLA 2Z9OA 2EMHA 4X65E 3DEWA 5L3EA 2JTVA 4CYCB 3KLOA 3QOPA 3S16J 5KL5A 2ISYA 4X6AJ 2JVGA 3VWBA 1FKAE 3MQ0A 5E20A 4CCMA 3FDYA 1UHSA 3LA2A 1ZKGA 3IHUA 2H8RA 1BI3A 4BBYA 1GLNA 1IJWC 1MMSA 1LPQA 1AA7A 2M9HA 4I09A 2RKHA 1BL0A 1YRNA 2E1MB 3CUOA 1B1BA 5JVGF 2HPIA 2PLYA 2EZHA 2BY3A 2VJ5A 4OIRF 1IUFA 1VQ4I 2CT1A 1KJKA 1EH6A 3HM5A 2EOHA 4AYBN 3CMAI 2RSMA 1X3ZB 3N05A 3P9CA 4G6TB 3HSFA 4WXDA 1PP8F 1POGA 1MD0A 4RBOA 3GEZA 2DA2A 2NNNA 1AKHB 3SJMA 2K4BA 3E6DA 4EJOA 1J0RA 2YU3A 1U9NA 4QIWN 1W36D 3T5XA 2CPNA 4O3MA 3MZ8A 2YU5A 5AASA 4XONA 3GTLJ 2YRKA 1TF6A 2Q1ZB 3F6OA 3ZQCA 4BBSJ 2EPCA 1E3OC 2QM3A 3FIGA 1R6RA 2HJJA 1L0OC 4LITA 4B4CA 4WYQB 3LSTA 2BW3A 1K83J 3CC2I 3C4TA 3CLOA 1GZ6A 4A5MA 4XLPF 3WU1B 1RUNA 1X3CA 2D9HA 1JUMA 2EN2A 3M7GA 2H1LA 3DF6A 4H0EA 4HDUA 2O6GE 2JN6A 1AU7A 1A36A 1HSJA 4P96A 2HEOA 3L9FA 4AIKA 3I59A 4P5OA 3GYHX 4KT6A 2OQRA 3MSWA 1DGWY 1SVLA 2DA5A 3OYAA 3FXUA 3T0YA 2VBZA 2YS9A 4Z6YA 3SHFA 3AG2H 2VOOA 1SFUA 2WCC3 5DUKA 5BQTA 1Z05A 3IP4B 1R5HA 3P7NA 2VF1A 1ON1A 3BQZA 3H3VK 2N8GA 4BXUA 1TTYA 2MFZA 2HVQA 2LK2A 4UB6C 4UUTA 1X2NA 4MQ9F 3LLHA 1T56A 1J75A 2W7NA 2DFFA 4U0VA 5D8KB 3GTPJ 3NARA 1KYZA 2V79A 5JHUA 4S04A 4B3ME 1YOVB 2M2EA 2R7RA 2G7HA 1B4AA 2WA0A 3PUFA 2EZ6A 4M6YA 4MGRA 1Z1DA 5LFAA 2JOXA 1W0TA 1FIPA 1QPMA 2L7KA 4G6QA 3HPGA 2FQ3A 2CJJA 4LGWA 2NVXJ 4LFAE 1MBHA 2KIUA 3MEXA 1LQ1A 2V86A 3PL8A 4FE4A 3W2VA 2XC7A 1X3UA 5KK1A 1Y39A 1YI2I 3I59B 2EN3A 3TGNA 3S1QJ 2EPKX 4IEJA 3BR5A 1OLTA 3OYBA 2ZB9A 2ZM6E 1G59A 1LDDA 1VF9A 2HQAA 4NC7A 1YFHA 1RUOA 4WFTA 1RKTA 1V54H 3RZDJ 2LD5A 4UHTA 3KZZA 4II2A 2YTOA 2OTLI 2ODRD 1TC3C 1MEYC 1V5EA 4YEJA 3HOUJ 1H9GA 2BY1A 4O4KA 3VYRB 3HRUA 3TMOA 1SR9A 2D1HA 1USTA 2GLOA 5LMUE 1Z7LA 2YX4A 3BPXA 1WWXA 4DNCA 2BYVE 3K70D 3LSGA 3AG4H 3OIOA 1ZRCA 2UXDE 5LHHA 4GZNC 4C3IJ 3H35A 2MC5A 1KA8A 1JHHA 4AU7A 3RKXA 5C4JJ 1TBXA 5LHGA 3JRIA 5DV5A 4AIDA 1KU9A 1CGPA 2EPPA 1HR0E 4KIGA 1T0FC 4RAYA 2L7ZA 5ICGA 3LSKA 4ZZDA 2CQXA 1RI7A 4A6EA 4OIOF 1LLMC 2P81A 5T6JA 1ULYA 1ZR2A 1OCRH 1K6OA 1YS7A 2FNAA 2OA4A 2IS6A 5F6FA 3JAMC 4LG0A 1SMYF 3KYDB 2EINH 3K2AA 4ITVA 1OMIA 2LKSA 3BTJA 4Y13A 3G71I 4AVZA 2HZTA 3CC7I 3Q5FA 4BQAA 3DV8A 2X51A 1JJ8C 2ESNA 2IEKA 1SD6A 4B3AA 2ACJA 4J8ZA 4A3KJ 4V19K 2K9NA 1RESA 3A01B 3FM5A 2ZC2A 2EPRA 2AQFA 1K6YA 4D9JA 3GBGA 2EOEA 4XLFA 5F0CA 1Y1VJ 2W48A 1N33E 2B7TA 2V1DA 2RVCA 4BNCA 2EQ0A 3BWGA 3QP5A 4I02A 2XKOA 5L3BA 1TQIA 2QYOA 2IT0A 2UWMA 2EQRA 4CCJA 3F22A 3J80K 1JT0A 2PRTA 3FWEA 4LG3A 3ZGKA 3HUGA 1DGRM 4GCVA 2Y9ZA 4E7SA 2FMLA 3WE2A 2Y30A 5IP7J 4KZSA 2W25A 3L2CA 1OCOH 1DP7P 3MVPA 3AV0A 4MNUA 2O7OA 1QNTA 2ZJPF 2PBIA 3J7AO 2EMLA 2XGDA 4FX0A 2N3GA 3PM1A 1HW2A 2X6OA 1HXDA 1VQ7I 1ZLKA 3ZPLA 3FXOA 2XAUA 3GTOJ 3J81C 1WFXA 3BDDA 2NVYJ 2G7UA 3S32A 1QQIA 2CYYA 3CZ6A 1BR1A 2Z2SB 4LF6E 2WBSA 1QA6A 3E5UA 4GFBA 2HS5A 1RPWA 4BGDA 1T4LB 2VQEE 3MKZA 4BHBA 4GYIA 3KYLA 2B63J 2KFDA 1DGCA 3HL2A 2WAEA 2ENHA 2JY9A 4GKKE 3R4KA 1ZBTA 5AE2A 4FQGA 1DUXC 2DODA 1UHWA 2IP2A 3E5XA 1TT0A 4P55A 3DWLE 3K9TA 1A1IA 2KP6A 2VC0A 3TW7A 4L0YB 5B5EC 3WTWC 1WHNA 3VHTB 4L9VA 4V2GA 2P7VB 5FLMJ 3K10A 2L2NA 2CQNA 3RQ4A 5IT9K 2R7VA 1XB4A 4B3TE 1JKRC 1GV5A 2H6CA 2KHMA 2A07F 2M0MA 4OWRB 3MD2A 3M8FA 3B6CA 1BBOA 2Y0SN 2HDDA 1FT9A 2CSOA 3OYCA 3P1XA 1R4MB 4B3RE 4IXAA 4F7ZA 2MD0A 2WV0A 1SMTA 1W1WE 4U0YA 2QEXI 2O8XA 4LTYA 1OCZH 2HXIA 2JQ7A 1OCCH 4P9UA 2VB6A 3UNGC 1MSFC 2GWRA 2EMFA 3KYCB 3K4LA 2E2JJ 3JW4A 4OMYA 2M4IA 2ELJA 4HOBA 2A25A 2ZXHA 3RPQA 4LLNA 3S8PA 1J5YA 2LJUA 1X1DA 4KYWA 3HPZA 1BIBA 3FXQA 3H0GJ 5E79C 3KPHA 1BB8A 3J7AG 3SEQA 2QSHX 2X4HA 2A61A 2FSWA 3G73A 2HC5A 2WBTA 2PMUA 3DBHB 1JGSA 3FMSA 3ML6A 1FTZA 3ZQLA 1F9NA 2DFHA 1IO2A 3ZMSA 1HOMA 3QP6A 3GTQJ 1HKQA 2VQHA 3BZKA 3TOAA 4BE0A 3DKYA 1ITYA 4JI6E 1XNRE 1E3PA 3ROUA 5FB2A 3KIOA 2XGCA 3I54A 2NNYA 1FSEA 2P8TA 1SC7A 3PQJA 2HOEA 4BDYA 3K0LA 2EILH 5J8FA 3TKYA 4RAZA 2AXTC 3KFWX 4YIIA 1JE8A 3K69A 4B3SE 3HOTA 1X6EA 2LDUA 2EL4A 3G1OA 3HYIA 2VQCA 2HDWA 5E18F 2E36A 2DBBA 1ZYRF 5GAGJ 3MKYB 2DK8A 4D7NA 2R7DA 2GBYA 2EN4A 4X62E 5EGOB 2EPXA 4NBQA 3ZQHA 5KL6A 4DV2E 2EMCA 3FMQA 3SZTA 1ZELA 2DFEA 2ETHA 2XAFA 4EJUA 2LF7A 2CQKA 1AAYA 1BW5A 5FGMA 2RQPA 4KDPA 5FRMA 1T95A 1X1CA 2WBUA 4UB8C 3KEOA 5IYBJ 1IRFA 3HC7A 1IMUA 1QZYA 3D1NI 3H5AA 1UG0A 4M6XA 3RMPA 1C0WA 1MNMC 3GFMA 3CP8A 3IWZA 1BR4A 2CUJA 2DTZA 2HOSA 5BNGA 5LGNA 5TISC 2EPOA 2HKXA 3CD6I 3GFLA 2CW7A 4Q48A 3J7AY 1MDMB 1SFOJ 2OTJI 1MH3A 1W4MA 3CUQA 1UILA 2YTFA 1VNDA 2ZSIB 4M3BA 2D45A 3F0CA 1PJSA 2FU4A 4A3DJ 3IAS2 2JR1A 1D1CA 3FBIB 3WG9A 2JA8J 5JLXA 1TW2A 4A2UA 3CUQC 2XPUA 3S14J 4Y4RA 5D5XB 3V8KA 5K5RA 4R2PA 1RETA 4DV4E 1BJAA 2ZFUA 1G6NA 4KWYA 4XRFA 4QLCU 2JZYA 4NXME 1T38A 2Z1DA 4NZVA 1J9IA 4P7DA 2Y0MA 3MMYB 2B3TB 2WB1N 2R5YB 2LV2A 2DOAA 2AXLA 4F2JC 2K9QA 2DLQA 3V8LA 1WSUA 5D5VB 3ADLA 5H20A 4BBRJ 4DV6E 2ID3A 4XLCA 3QU6A 3HQ1A 1DDNA 3JU0A 1FY7A 2VE9A 5K7ZA 2VJJA 3H0DA 3FXLA 4DYRA 4DJAA 1R49A 2UXBE 2KQRA 3V7CA 3CCUI 2EM5A 3SFIA 5IT3A 4CYCA 1Z21A 1LFPA 1ETOA 3JREA 3BR1A 2QQBA 4GDFA 3MZYA 2K86A 4ZYHA 5EYRA 1YQAA 3F23A 4NB5A 4B8XA 3DFGA 3AL0C 1XMXA 4CYDA 4IHXA 2Y48A 4XN0A 3E0JB 5AIQA 3GF2A 2MDRA 4L5IA 1IXCA 2V1XA 3BLYA 3RPUD 4ENMA 5D6FA 3AUZA 2IA0A 2XF5A 3BR6A 2K4JA 4UUSB 2DFIA 3BTCA 3KP2A 4Y7NJ 1ZGAA 2D2WA 3EPZA 2A6EF 2EIMH 2STWA 3M99B 1MMAA 1M1EB 3DBLB 3EETA 4BCAA 4YFXF 1NHAA 3HIFA 2MGQA 1BC7C 3VYUB 3R61A 2VBWA 2H94A 4R03A 1JGGA 1HW1A 4D0PA 2R92J 1BI1A 5E1ZB 4EATA 5A69A 1D0YA 4RGRA 4DUZE 4DIQA 2QZ8A 3S2WA 1I3AA 5B66C 2OU2A 3RYRA 4YIFA 3DF8A 2LFBA 1BC8C 2EM8A 3J81K 5C3EJ 5H6RA 2YTEA 2CUZA 2KIFA 4LF7E 3L7WA 4HBLA 2CMPA 5M5WJ 3HG9A 5EDNA 3OSFA 2A5WA 3ZMZA 1X6HA 3DJWA 3VB2A 2AO9A 2BZTA 3CDIA 1X6FA 1GV2A 3J7YJ 2WC2A 1RC7A 1HQCA 2OCCH 1WZ2A 1SAUA 4ZYAA 1A1JA 5EG0A 2O61A 3FIWA 1G3SA 1B8IB 3FISA 3CJQB 1D1AA 3KEYA 1YHQI 4D5CA 2R7FA 3OS1A 3C7JA 1ZGJA 1ZQ3P 2W84A 1TWHJ 3I0TA 2YU8A 4RM3A 3KP6A 3ZOBA 4NHRA 4DZPA 1B69A 3PFYA 5IT9Z 2KDOA 2HI3A 5HNHA 3LQQA 4ZTFA 2J5PA 1O3RA 4UV8A 2B9DA 3QYBA 5JVTA 3T1HE 2ZKZA 1ETXA 5JI6A 2VOPA 2CQQA 4RLQA 2KMUA 3G2BA 1K78B 2K40A 1IZ1A 5FLXK 5GP9A 5FKNA 3P5JA 4KIBA 2VQGA 3WTSC 5F64A 1IN7A 3ABTA 2RGVA 1B9NA 4HYEA 4NC6A 4WF2A 4XOPA 1ACIA 2EMBA 3B6AA 4G7OF 3I4MJ 4XKWA 3E6CC 3BQYA 1ZHFA 3VYTB 4M6VA 1A1LA 2WAFA 1FYKA 3K4KA 1D3YA 4LIVA 2IHR1 4AC0A 1K4TA 4DGWB 2CRGA 1S7AA 3BTLA 3CUQB 3GW2A 3F8NA 4BMJA 1IC8A 5FKKA 1Z1BA 2HVSA 1B59A 2JA2A 5GTIC 4AYBA 1F43A 3I53A 5DD4A 2UU9E 1U8BA 2VASA 4DYCA 4BJ5C 4AQYE 3HRTA 2DMYA 5M3MJ 4ZYGA 3FF5A 5LLQA 4I2OA 2DLLA 2M9AA 3EPHA 1YUJA 2G9WA 3I55I 2ME0A 3V7SA 4KIFA 2RV8A 3O8GA 3GFIA 3VYSB 1UJ8A 5D5UB 2KDZA 2EOOA 4MO7A 4XNFA 1XCVA 2YT4A 3ZQ7A 2K85A 2JUGA 3BY6A 5HLTA 2MC3A 5BPIA 2M7QA 2O0YA 3N4MA 2NABA 1Z3XA 3U1KA 4ZYDA 3LSRA 2EM6A 3FXJA 3SEZA 5EEHA 1G2HA 2LBFB 4I8OA 3QOEA 2PJPA 2LBSB 2XB0X 3V7RA 4BEHB 1SFEA 1Z7UA 1UAAA 4BU2A 5LRRA 4X64E 1S72I 3EPJA 2EMKA 4CZCA 2ZSHB 3G6EI 4QTRA 2ZJRF 3IC7A 2OF7A 2LRDA 1K78A 2HOAA 3PSFA 4B09A 5DDGA 4BE1A 2W82A 2Q2EB 2FF4A 5K7HA 2FRHA 1HF0A 2HDCA 2DA1A 1MJAA 3VSKA 1WHQA 5FD6A 1BM9A 2YUSA 2DU9A 2CWEA 1P92A 4CCKA 1Z9CA 1H88C 3HKZA 2ISZA 3L2UA 1MW7A 2A6HF 2AHQA 4FT8A 2DYSH 3HOYJ 4X9JA 1MJ9A 2R7ZJ 1A1KA 4L9NA 2CFOA 2DN0A 4KN4X 1UBDC 1FBSA 4BACA 2FOKA 2EV6A 3ZN1A 2Y69H 2EN6A 1DP3A 3MCZA 4CCOA 4FETA 4BQOA 3A02A 4LD5A 5AONA 1R7JA 1YTYA 2JWTA 4IZZA 2YTJA 3OOPA 2L3CA 1X49A 4BQNA 1I1SA 1VZ0A 4KFCA 2PEXA 2LUPB 2JMWA 4HV5A 3U21A 1DU0A 1FNNA 5E1XA 4G9YA 4CO8A 4A6DA 3M1EA 1PJTA 5K5QA 2MYSA 2XPWA 3DLLF 3BG5A 1FWZA 2R7XA 2EOMA 2I5UA 2EZIA 2AS5F 4HF0A 5LEJA 2EH3A 3GZNB 3J81Z 1D5YA 5LGUA 3NRVA 2HGHA 2LH9A 1BBGA 1OYIA 5CYVA 2IGKA 3NWTA 1NH3A 1F5TA 1N32E 3P9IA 3JTHA 3JTZA 2LG4A 1CF7B 3BR3A 3IKTA 3FXMA 4LJZF 2BBYA 3I9V2 1FBUA 1W5TA 1PVEA 2NA2A 2R7WA 5ILVA 5J4VA 4OINF 2HTSA 3CCSI 1FP2A 4MLQA 1P2FA 3C3WA 1CQTA 4HSRA 2P6SA 5GAHJ 1U6GA 1BA5A 2JK3A 4HNVA 5CVRA 2HVRA 2E2IJ 3GUDA 3MFKA 3O3KA 3W6JB 3OYHA 1O3TA 2DK5A 1H8AC 3CDHA 1O7LA 2LNBA 1NG7A 4NXNE 3F8MA 1RNLA 3DU6A 2JT1A 1S7OA 4XORA 1EH8A 3OMLA 1WH7A 4ETSA 1FZPB 5BR8E 4C2UA 5J1YA 2VODA 4MIMA 4PSWA 4A12A 4E70A 1PUFB 2JWOA 4M3FA 2V8QB 5TSEA 4LFUA 1QU6A 1D1BA 3LQRA 5KCMA 1A1FA 4XQFA 1TP4A 3IWBA 2P4WA 5EEGA 2HYFA 4HEIA 1YW8A 3T8TA 1WJEA 1G3TA 3K1MA 1ZG3A 3QPTA 1OFCX 1D8KA 1LB2A 1G4DA 2IA2A 2LP0A 2GA1A 2VUMJ 1QZZA 5TRDA 1Z6RA 2KHXA 4A3LJ 2HWVA 3JSOA 3H9QA 4JI2E 2B7EA 2VJ4A 4WXCA 1FSHA 4JX5A 2EOJA 4CH7A 4DBQA 4WX9A 1RQ0A 3BT9A 4E7IA 2RREA 1YJNI 1VQNI 4R2DA 4F91B 3H1CA 2UXXA 2PX9A 5DUIA 1K61A 4J19A 2UUZA 3LMMA 2EPAA 3C2GA 2NS7A 1IF1A 2EMWA 3M4OJ 4BH9A 3LFUA 4K0KE 3CTAA 2X6WA 2Y9YA 2K27A 3LNQA 2UZKA 1NK2P 5HDKA 3OR2C 4B43A 2VONA 3KX2A 3LSIA 1W0UA 4EJVA 5F1JA 3LSMA 4I01A 1JT6A 4O5VA 5CQGA 1J7KA 2HGCA 2JRTA 5FJ8J 2EOSA 4L8NA 3I4NJ 3TEDA 4EGZA 3QODA 4XR6A 3CCYA 2ECBA 2FQ4A 4KA4A 5FLVA 5A6AA 2A69F 1JUSA 4PFOA 1GUUA 1I3QJ 3I64A 4OAYA 2W24A 4JQFA 3JRAA 1OCTC 5FKOA 4HEA2 2DPUA 1D5VA 1H9TA 2CV0A 1BI2A 1PDAA 2MBFA 2H09A 3BPVA 5TGTA 2KOUA 3KZIC 4PJLA 2IRFG 4IOAF 2NOGA 4M9ZA 1ZH5A 2YTGA 2D5VA 5CQEA 3F9KA 5J3LA 2EIJH 1T6SA 4BXFA 2EB7A 2M3AA 3DBRB 3B02A 3IRRA 1IRXA 4I76A 4C9YA 2E1MC 2ZJ2A 3SQNA 5IWAE 1U5TB 3ELKA 3BTIA 1FEXA 1NCSA 2O03A 2EIKH 5IPAA 4N0BA 2EN1A 1XD7A 2FEZA 5J4YA 5A6BA 1PUFA 2OV7A 2BBGA 1R00A 5ICCA 4AUXA 3T8RA 4HQMA 3BF2A 1QVTA 1HCRA 4Y15A 1KQ8A 2L2OA 4X1EA 5CVIA 5FRNA 4XL9A 2QQAA 3CCLI 2KPMA 2OPTA 1A6IA 2VKEA 3H3ZA 2ZXJA 3OOUA 2EMIA 1J09A 2QCOA 4DV5E 3VODA 3GXOA 3E5QA 3OYJA 5ICFA 3GTJJ 3RSNA 1N34E 2GHFA 1MMDA 2GXAA 4O24A 5M5XJ 2KIQA 2BGCA 2P0WA 2KL4A 1IG7A 3BZCA 2L01A 5CLSA 2CG4A 4N4NB 1YYKA 1U8RA 3F6HA 3NEUA 3ZMDA 4RGUA 2ZNZA 3GMEA 1MNEA 3PNTA 4IJAA 3LOCA 5CVJA 2P7CB 1KYQA 4KN7X 3H3UA 2VN2A 2OBPA 4BY1J 1TQPA 1MJBA 1HLVA 3ZOQB 1QVUA 2FA5A 5KL7A 1Y6IA 3E1SA 4ZDLA 4M3DA 3K7AJ 2R7OA 4TUIA 3S93A 1U78A 3HSRA 2XAGA 5E3NA 1XN7A 4M3EA 3S3NA 4UV9A 2M87A 5TJJA 1I6XA 3ZQIA 3WHBA 3P9KA 3RQIA 2EFWA 1N36E 3HHHA 2OUMA 4ENNA 2EPFA 1F4KA 3HPSA 2FXAA 3R6SA 3DU5A 4ESJA 2MLKA 1HW5A 2EFQA 2Q0OA 3W6VA 4LF9E 2MD5A 4MLOA 3CMYA 3ASNH 1MIJA 1JKQC 2RSIA 1W5SA 3F6GA 4E7KA 2JOBA 3E3VA 2NVQJ 1IUYA 2L6MA 1PYVA 4F6NA 2L02A 4C3JJ 1TW3A 4M71A 3RZOJ 3RJPA 3ADIA 1YYWA 1XDUA 3QQAA 2YWQA 3PNYA 3Q9SA 2LJHA 2X1EA 4HX7A 2EE8A 5IYCJ 3CCMI 5HLGA 1ZBQA 2EQ1A 2JXPA 1HSTA 3OTOE 1ONVA 2JP9A 5F0FA 3LFKA 4RH8A 1XMAA 3H9GA 3OYKA 1HDPA 1XG1A 2ID6A 3X2QH 1LEAA 1TQMA 5M3FJ 4XRSG 2JPCA 2KRCA 1WQ2A 4BL0B 2EFOA 1A5JA 3DKXA 2IA1A 2P5KA 3ONQA 4GYGA 2EV5A 4HNUA 3HEFA 3FK6A 3SZGA 4XICA 1LNWA 4PGHA 1HKTA 3F8CA 2X9DA 2JSCA 3VK6A 1W7PD 1S6LA 5LBQA 2RNGA 2P5LC 5D4SA 1MDMA 1D8JA 1ZAAC 3BG7A 3T1BA 3CCJI 2Z99A 4YFNF 4GXOA 4ESFA 1BJZA 1UHMA 2ZXIA 5EZGA 4U0WA 1NK3P 1IXSB 1QGPA 1V3FA 1A1GA 2O5RA 2LY9A 4UXNA 2VI6A 4IQ4A 5HDGA 5E3MA 2MA3A 3UR3C 3HRSA 2HQ5A 4MEXF 2FMYA 2EMYA 3DPUA 1G3WA 1QU3A 5JFRA 1YUIA 1VQ9I 4XRMA 3KEQA 3OWTA 2EJ4A 4FASD 4JX4A 2FV4B 4KT5C 2HHHE 2W1OA 5IOZA 2CV1A 2V9PA 2K3FA 1EJ9A 1N77A 3HPHA 3HGGA 2L2KB 4XKVA 2HTJA 4KMUX 5FLXC 2X0LA 5E17F 3RYPA 1LUJB 2BV6A 3IWFA 1YJ9I 1USSA 1RIOH 2PMHA 1XSXA 3DPLC 2E5LE 3QU3A 2CGPA 1ZAOA 3DXJF 2Q8KA 4JI7E 2IXSA 3JRBA 4LF5E 1KQ9A 3FXRA 4I7HA 4J00A 5AE3A 5FKLA 1O4XA 4I0BA 2Z3YA 4DW6A 4JK1X 4FE7A 5JHFA 5EZHA 3FZVA 2GOXB 4YIRX 3ASOH 2X48A 4LLLA 1RR7A 2JUCA 3I4PA 5AC5A 1XNQE 1I1GA 3EDPA 2EK5A 5GPCA 4HV6A 3ABUA 2GXGA 4IX7A 2FBKA 3K6GA 2X1CA 4UVBA 5IXMB 3AG3H 4IHYA 2K9LA 2L0KA 2COMA 4F92B 2L4AA 3HRMA 3BJ6A 4F54A 1HC8A 4I98B 1L3LA 4R2QA 1R36A 3I71A 1N3GA 1PKPA 3C18A 3HOWJ 5DM7F 3ADJA 3ISPA 3HOSA 4JYAE 3PO3J 3BGHA 1YSAC 2H6BA 3VEPA 1ENHA 2I8DA 3WU0A 2ZJQF 3RDIA 3GLXA 2ENAA 4WPYA 1KU3A 2XPVA 4C30A 3ECRA 1EKZA 3BBGA 2XGEA 3CLQA 2HZDA 2H27A 4AVPA 2NOJB 1YITI 4B1RA 2PMZA 2VKDA 1MSEC 2BY0A 3L2RA 1VQKI 2NUGA 2HQNA 1YIOA 2ZXWH 1X3WB 2R4GA 5DEQA 2QA4I 1FC3A 4BKXA 3FMRA 4DR2E 2EFNA 2B9SA 3J80C 2R7UA 4JP0A 1YYOA 3JRFA 4PDKA 1SFXA 2WWYA 4BDZA 3ZP5A 4RAFA 4R2RA 3LAJA 3IKVA 1RMDA 1LJ9A 2RDPA 1ETVA 2XASA 3PO2J 4AWXB 4DZJA 2V89A 2DA6A 1O3QA 2BXYA 4X0GA 5DS9A 4MHGA 1LFBA 4IKFA 1UCRA 4U87A 2CW8A 2ADUA 1FOWA 2F5EA 3QYFA 3COAC 2IGNA 2UXCE 1YIJI 4M9SA 2YSRA 2O3FA 3GZ5A 2XAHA 1F1ZA 4CZZA 1VTNC 2V6EA 2LTPA 2E7WA 5A6BD 1ZRFA 3OYGA 4X8WA 4DBRA 1AOYA 2E60A 2LREA 2RAEA 2WB1A 2EL5A 3T1YE 2QVOA 3Q3SA 4MQVA 5L3CA 4BXXJ 4M74A 3JAMK 3HXLA 5LGTA 2DA4A 3THNA 4XOTA 1P7IA 3BG3A 2R5YA 2ELZA 2EOFA 3SDBA 3D5LA 2DMNA 3CCVI 2GA2A 1H0MA 1FJGE 3K4NA 2XRNA 3D0SA 2FNPA 2GIVA 4FTHA 2F5FA 3KP3A 4AM3A 4XIDA 3F21A 5IYDJ 1YS6A 2F5DA 2EMAA 1BOBA 1WGXA 4DR7E 2KRFA 3M9AA 3LSPA 5E3LA 1XCBA 3OMYA 1O7FA 3NQOA 3S1RJ 4X66E 2P5VA 4L18B 3OL3A 3MN2A 3K1PA 4IRGA 4M9XA 4WCGA 3K1NA 3O6BB 5K7FA 2HFHA 3D5RC 3L2WA 2ELYA 2V88A 2E72A 2K7IA 3D5SC 4K2EA 5CPRB 1T2KA 4HRIA 1P9QC 2DIXA 3C1DA 3HDDA 1JHFA 3M8EA 4FX4A 1L4SA 2IPQX 2X1DA 2EM3A 1Y56A 2LRSA 3EYYA 1VQPI 2LC2A 4XN3A 4XRSA 3PSIA 5J47A 2XV4S 2H8WA 3AAFA 4N9HA 3WTUC 1J59A 4IHSA 3FK7A 1DQ3A 4IQJA 1AHDP 4GRIA 5L3FA 4JI1E 1U9OA 3BZ6A 3TP0A 2CQ7A 2LKPA 2OD5A 4WWCA 2YTNA 4PGGA 3PUBA 4IOCF 1U2WA 2OCEA 2Z16A 2NVUB 3LWFA 1VQLI 1OR7C 2LMDA 3SYTA 4FK5C 1XGSA 3GTKJ 3ECHA 4LU9A 3QPHA 1JXSA 4LF8E 2RPCA 2LR8A 1V5FA 4YFKF 4MFDA 1ETWA 3ABLH 2E1OA 2V85A 2L33A 3EQ1A 2YX7A 4U7DA 1FIAA 3I3LA 4R1HA 2L9NA 2VE8A 3F8BA 2CU7A 2WY7Q 1T98A 2PQ8A 5ILUA 3LAPA 2L2MA 4R2EA 2COBA 2NS0A 1KGSA 3OSGA 3BROA 4CSWA 2LY2A 4XSXF 2HYGD 2RTXA 5A6KA 3RKQA 5E8GA 4QPQA 1QBJA 5B1BH 1WVRA 4IHVA 3G1LA 3TDZC 1ZGWA 3ZQFA 2HNHA 1GQEA 2D1VA 2TRTA 2F8BA 3F72A 3TQNA 2QKLB 2A68F 3EYIA 1G3YA 3DEUA 4L0ZB 4LFCE 5F08A 4O6JA 2NRAC 2LCEA 5H2FC 5D6EA 4M73A 2NYXA 4M9VC 2VPRA 2IBDA 3CCRI 2X85A 3IL2A 4Q35B 1KQ0A 2QF7A 2ELHA 1P47A 2KJCA 2V1UA 2JJ7A 2XDVA 3F6VA 4A5NA 5BPDA 3RTRA 1U5TA 4WXHA 1R1VA 1S7EA 5H6QA 1DU6A 3LL7A 3A0HC 3HGYA 4M72A 4RHBB 1FJLA 2M7AA 2RS6A 2MSYA 4E6KG 1IXRC 2ENCA 5A6JA 1YX5A 2L9SA 3DQVC 1XC5A 2Z5UA 1FYMA 1TLHB 2DB2A 1BW6A 5C44J 3AKZA 4DR3E 1G8XA 4LLGF 4BUPA 5J6XA 5KAIC 5ED4A 3L2VA 4LMYA 2E5ZA 2E71A 3BP8A 3JRCA 5LMNE 2QUFA 2QLZA 2F5VA 5BMZA 3CJNA 4XM3A 1WXRA 1H89C 3K6QA 5FFXA 1A35A 2ICWG 2CFXA 1T33A 2VJIA 1B6AA 3KP5A 3M8JA 4RM2A 1PJQA 4KMFA 4UY8I 2FD5A 1LEBA 2VQLA 1LE8A 4KITB 4JOMA 3JR9A 4A69C 4LK1F 4RB1A 1XMKA 4MFEA 1HNWE 4TUGA 2F4OB 2EPUA 3WODF 2DW4A 4YY3E 4KJZA 5HS8A 1ETKA 2X6XA 4CCLA 2HR3A 2M45A 3HZJA 5L3GA 5GAEJ 4EEFG 2MKNA 4R2CA 1LVKA 3GTMJ 2VIXA 1X58A 5EJCA 1WRJA 1LVAA 4GO1A 2UUAE 2ZMEB 3ULQB 3U2RA 2V87A 2KONA 4CHUA 4Y3OA 2DA3A 1I94E 3I5UA 2JA7J 5BOXA 3MZHA 4WSGA 1S3JA 2UUCE 1QRYA 2Q2EA 4BAYA 5HLHA 3WGHA 5FD5A 4ZZLA 5M5YJ 5DYMA 3FXKA 3BR0A 5F04A 3OIPA 4IS1C 2XHKA 2L9VA 3KZYA 4RAGA 2NXNB 3DKWA 5HS7A 2P6TA 4Z2YA 3CF5F 4O5GA 1KU7A 2A3SA 2E5NA 4BEHA 5JLWA 1I5ZA 5DM6F 1BBYA 4E7LA 2LTSA 4PUSA 4PK4A 3GVAA 3S2DJ 2LOOA 3QRFF 2K7LA 4CXFA 4XLAA 5HLIA 2LY1A 5IY5H 1DPRA 2CV2A 3G1MA 3S15J 2EM9A 2LVSA 3RKYA 3GO5A 4XMYA 1APLC 4A3FJ 4AIJA 2GAUA 4XLNF 4RB3C 2Z33A 1YO5C 2F5CA 1X2MA 4P9FA 1FOXA 3WGGA 3K4MA 1SAXA 5AE1A 2W00A 1Y8QB 5ADZA 3ZMVA 1OYYA 1ZREA 2VKHA 1Z91A 1XS9A 2OJED 2XAQA 4Y52J 4RA2A 1R5ID 2IS4A 2DQRA 1G2DC 2YRHA 3VDXA 3OS0A 1WHUA 3V42A 3WTXC 4G12A 4J01A 3K2ZA 4DR1E 4G6DA 4DR5E 1X1AA 2IGOA 5CVUA 2KISA 1Z67A 1W5CC 1WJAA 3HKZN 4A3JJ 4L5EA 3VFZA 2OQGA 5K1YA 5DNYA 4DUYE 4B44A 2R1FA 1TWGJ 3TO7A 4CGZA 1XPXA 1LDJA 3EUHA 3R0JA 2J7JA 3E6MA 2MW8A 1B72A 1S9HA 4DYQA 3W6KB
chains in the Genus database with same CATH topology
4CICA 4RB2C 3MWMA 1A04A 2VBXA 4ZH4F 1J2XA 4HX4A 1TNSA 2L3DA 4Q47A 3TDUC 3HTSB 3V8JA 2W57A 1TNTA 3L09A 1E17A 1EV7A 4U88A 5CVVA 3KCCA 1YYVA 5J8CA 4HF2A 2BEOA 4EJTA 1S29A 3FM3A 5DCMB 5DCFA 5CJ9A 4OIPF 2QBYA 3E97A 1K79A 5F1RA 2BE5F 3ZN0A 4G7ZF 4IF4A 2M30A 5HDNA 1R58A 2KKOA 4EM0B 4EGYA 3WTZA 2XROA 1GXQA 5HS9A 3VOEA 1REPC 4CDGA 3TO9A 3PFIA 4HLYA 4Y17A 5JR3A 2LF8A 2L54A 1IN6A 4S05A 2IVMA 2EWNA 1OKRA 2FE3A 3KE2A 1IN8A 2ZO4A 2ZFWA 4HAMA 4EM1A 2IJLA 5ILSA 1AWCA 1WKMA 1R22A 1R5GA 1T0FA 1DPUA 2DQLA 5ERIA 2XGXA 3O2PE 4A0YA 4ASNA 1HKSA 2QQ9A 1S8NA 2XIGA 1MZBA 1K7AA 4R8HA 2GXBA 3IRQA 2ZMEA 4U7BA 2M5WA 3R0AA 4IRIA 2M1BA 1XGMA 1GHCA 2QENA 2EJRA 1P4AA 2OZ6A 2MLGA 1E2XA 2VBYA 3ECOA 2PI0A 3ZMUA 1YG2A 1WI9A 3HSEA 2ESHA 3EQLF 1IRGA 4ENKA 3QAHA 1KU2A 2WTEA 4UUVA 4UVCA 1UB9A 2Y75A 4FHTA 1CF7A 1UFMA 4TV7A 1IAWA 2DAOA 4IVNA 3U1DA 4G8XA 4UNOA 4MTEA 3SXYA 2UXNA 1XSDA 2GQQA 4G94A 4IPAA 2EA4A 1T39A 3B73A 2ZNYA 1SD4A 2DI3A 3J80Z 1BIAA 2M8EA 3DP7A 4HA8A 4KNYA 3WTYC 1O57A 1BOAA 3KLNA 3GZ6A 4L9JA 2V6CA 1I27A 4YG2F 2ZBKA 1PDNC 4NQWA 1FYLA 4R79A 1XGOA 1PP7U 3F3XA 3HTUA 1SD5A 1ZLJA 2IW5A 4A0ZA 4EM2A 3SFZA 2NAZA 3HHGA 4I0AA 2PN6A 3ERED 5LEKA 1P4XA 4DQ2A 4HDVA 1R23A 1GXPA 4BHPA 3N97A 3OV8A 4MEYF 3REOA 2TDXA 1O3SA 4XSZF 2J5OA 1BN5A 2E7XA 3PQKA 1HBXG 5ICEA 2LSOA 1V4RA 1FP1D 1Y0UA 2DTRA 3H92A 2DO7A 4L5JA 4UVAA 1IN4A 3MAJA 3RI4A 1B9MA 5BS6A 2A5YB 4BHCA 4IRHA 3RPUA 1YLFA 2EA2A 2YPRA 3BOQA 1FOKA 1GVJA 1EH7A 3JTGA 1ODDA 5L3DA 3FX3A 5FO5A 5LRSA 1U3EM 2K02A 4LG0B 4HX8A 2E1CA 2B0LA 1BI0A 3BJAA 4RS8A 1OYWA 4GGGA 1W7PB 3TOBA 4QWQA 1KYWA 2R3SA 5LHIA 5FFZA 1MKMA 3LA7A 4OOIA 2RNJA 4ESBA 5A2QK 4HF1A 3BJOA 4AIHA 2FBHA 2XVCA 1ON2A 2F2EA 4RGXA 4OU0A 2VXZA 3GFJA 2VT2A 5AIPA 3I58A 1YW7A 3JSPA 2KIMA 2XUBA 4HLXA 5D5WB 4ENJA 3ZMTA 1PUEE 4HW0A 2VT3A 3Q9VA 4Q5SF 1Z6TA 2EFPA 2PFBA 2OZUA 5D8LB 4EVIA 5HVQC 1ZN2A 2OAZA 1W7PA 2JPBA 4KUMA 4IHTA 1XSVA 4ON0A 2DPDA 5KVRA 4HZFA 2FBIA 5E1WA 4Q4ZF 2GZWA 1XGNA 4OIQF 4G7HF 4WK8F 1FLIA 3G3ZA 4JBAA 3WTTC 4AD9A 2V9VA 4LB6B 3JAMZ 4ZYEA 2EV0A 4HQEA 4LB5A 3CO6C 3E6BA 4PCQA 4RB0A 4A0XA 5A2QZ 1U5TC 2E1NA 1XDSA 1FX7A 4MTDA 3RKWA 4L9TA 1ZRDA 4EV0A 3FHZA 2HKOA 2CO5A 1STZA 5D4RA 5FLXZ 1FPQA 1MGTA 3WE3A 4EQQA 5E8IA 2VC1A 4N9IA 2KJBA 2W85A 3KETA 1OPCA 4XBFA 5DD8A 1SD7A 3GWZA 5K5OA 1IW7F 3WTVC 1OR7A 4PZJA 3L00A 3LA3A 1ZG5A 3CO7C 1FBQA 4NHJA 3U9GA 1LDKB 4EMSA 1P6RA 2PG4A 2QBYB 2XKPA 2HQRA 4EJWA 6PAXA 5DCMA 1ZG1A 2XAJA 3DPTA 1R1UA 2MH9A 2YR2A 3WGIA 2QWWA 4LK0F 4BYYA 1P4WA 1QO0D 5HOOA 3SZPA 1R1TA 4OMZA 2L4MA 2C6YA 3KP7A 3RIRA 3KP4A 3V4GA 1RZ4A 2ZCWA 2DT5A 2RC4A 4RGSA 1ZARA 2MH2A 3F8FA 2CW0F 1IN5A 1YW9A 3TO6A 3GX4X 1Q1HA 2STTA 3R60A 2RN7A 4KICA 2Z9OA 5L3EA 2JTVA 3KLOA 3QOPA 2ISYA 3MQ0A 5E20A 3LA2A 3IHUA 1BI3A 4I09A 2RKHA 3CUOA 1B1BA 2PLYA 4OIRF 1EH6A 3P9CA 3HSFA 4WXDA 1PP8F 1MD0A 3GEZA 2NNNA 2K4BA 3E6DA 4EJOA 1J0RA 2YU3A 3T5XA 4O3MA 3F6OA 2QM3A 1L0OC 3LSTA 3CLOA 4A5MA 4XLPF 3WU1B 1RUNA 3M7GA 4H0EA 4HDUA 2O6GE 1HSJA 4P96A 2HEOA 3L9FA 4AIKA 3I59A 3GYHX 4P5OA 2OQRA 3FXUA 3T0YA 2VBZA 3SHFA 2VOOA 1SFUA 5DUKA 5BQTA 1Z05A 1R5HA 3P7NA 1ON1A 4BXUA 1TTYA 4MQ9F 1J75A 4U0VA 5D8KB 1KYZA 2V79A 5JHUA 4S04A 2G7HA 1B4AA 4M6YA 4MGRA 1Z1DA 1QPMA 4G6QA 2FQ3A 4LGWA 2KIUA 3MEXA 1LQ1A 1X3UA 5KK1A 3I59B 3TGNA 1LDDA 1YFHA 1RUOA 4UHTA 3KZZA 1H9GA 3HRUA 2D1HA 1USTA 2YX4A 3BPXA 1WWXA 4DNCA 2BYVE 1ZRCA 5LHHA 1KA8A 1JHHA 3RKXA 1TBXA 5LHGA 5DV5A 1KU9A 1CGPA 4KIGA 4RAYA 5ICGA 4ZZDA 1RI7A 4OIOF 4A6EA 1ULYA 1K6OA 1YS7A 2FNAA 2OA4A 5F6FA 4LG0A 1SMYF 1OMIA 4Y13A 2HZTA 3Q5FA 4BQAA 3DV8A 2ESNA 1SD6A 2ACJA 3FM5A 2V1DA 2RVCA 4BNCA 3BWGA 3QP5A 4I02A 2XKOA 5L3BA 1TQIA 2QYOA 2IT0A 2UWMA 3F22A 3J80K 3FWEA 3HUGA 4GCVA 2FMLA 3WE2A 2W25A 3L2CA 1DP7P 4MNUA 1QNTA 2PBIA 3J7AO 4FX0A 1HW2A 1HXDA 1ZLKA 3ZPLA 3BDDA 2G7UA 1QQIA 2CYYA 3E5UA 2HS5A 4BHBA 4GYIA 3R4KA 1DUXC 1UHWA 2IP2A 3E5XA 4P55A 3K9TA 2VC0A 4L0YB 3WTWC 4L9VA 2P7VB 5IT9K 1XB4A 2H6CA 2A07F 3M8FA 1FT9A 2CSOA 4IXAA 4F7ZA 2WV0A 1SMTA 4U0YA 2O8XA 4P9UA 2GWRA 3JW4A 4OMYA 4HOBA 3RPQA 4LLNA 1J5YA 4KYWA 1BIBA 3FXQA 2X4HA 2A61A 2FSWA 3G73A 2PMUA 1JGSA 3FMSA 3ML6A 1F9NA 3ZMSA 3QP6A 1HKQA 3TOAA 3ROUA 5FB2A 3I54A 2NNYA 1FSEA 2P8TA 3PQJA 2HOEA 3K0LA 5J8FA 3TKYA 4RAZA 1JE8A 3KFWX 4YIIA 3K69A 3HOTA 2LDUA 3HYIA 5E18F 2DBBA 1ZYRF 2DK8A 2R7DA 3FMQA 3SZTA 2XAFA 2ETHA 4EJUA 2LF7A 2CQKA 5FGMA 2RQPA 4KDPA 3KEOA 1IRFA 1QZYA 4M6XA 1C0WA 3GFMA 3IWZA 5LGNA 2HKXA 3GFLA 4Q48A 1MDMB 1W4MA 3CUQA 2D45A 2FU4A 3WG9A 1TW2A 4A2UA 3CUQC 5D5XB 3V8KA 5K5RA 1BJAA 1G6NA 4XRFA 4QLCU 2JZYA 1T38A 1J9IA 2Y0MA 2AXLA 3V8LA 1WSUA 5D5VB 5H20A 3QU6A 1DDNA 1FY7A 2VE9A 3V7CA 5IT3A 2QQBA 3MZYA 2K86A 4ZYHA 1YQAA 3F23A 4NB5A 4B8XA 3DFGA 4CYDA 2Y48A 5AIQA 3GF2A 4L5IA 1IXCA 2V1XA 4ENMA 5D6FA 2IA0A 2K4JA 2DFIA 3KP2A 1ZGAA 2D2WA 2A6EF 2STWA 3EETA 4YFXF 1NHAA 3HIFA 1BC7C 3R61A 2VBWA 2H94A 1HW1A 4D0PA 1BI1A 5E1ZB 4RGRA 2QZ8A 3S2WA 2OU2A 3RYRA 4YIFA 3DF8A 1BC8C 3J81K 5H6RA 2KIFA 3L7WA 4HBLA 3ZMZA 3VB2A 2WC2A 1HQCA 2O61A 1G3SA 2R7FA 3C7JA 1ZGJA 2W84A 3I0TA 3KP6A 5IT9Z 3LQQA 2J5PA 1O3RA 4UV8A 5JVTA 2ZKZA 5JI6A 2VOPA 1K78B 1IZ1A 5FLXK 4KIBA 3WTSC 5F64A 1IN7A 3ABTA 2RGVA 1B9NA 4HYEA 4WF2A 4G7OF 3E6CC 1ZHFA 1FYKA 1D3YA 1S7AA 3GW2A 3CUQB 3F8NA 1B59A 3I53A 5DD4A 3HRTA 4ZYGA 3FF5A 5LLQA 4I2OA 2DLLA 2G9WA 3V7SA 4KIFA 2RV8A 3GFIA 5D5UB 1XCVA 3ZQ7A 3BY6A 5BPIA 2MC3A 2O0YA 3N4MA 4ZYDA 5EEHA 2PJPA 3V7RA 1SFEA 1Z7UA 5LRRA 3IC7A 1K78A 4B09A 5DDGA 2FF4A 2FRHA 2HDCA 1MJAA 5FD6A 1BM9A 2DU9A 2CWEA 1P92A 1Z9CA 2ISZA 2A6HF 4FT8A 1MJ9A 4L9NA 4KN4X 1FBSA 2FOKA 2EV6A 3ZN1A 3MCZA 4LD5A 5AONA 1R7JA 1YTYA 3OOPA 1I1SA 4KFCA 2PEXA 4HV5A 1FNNA 5E1XA 4G9YA 4CO8A 4A6DA 3M1EA 5K5QA 1FWZA 2AS5F 4HF0A 5LEJA 3J81Z 5LGUA 3NRVA 1OYIA 5CYVA 1F5TA 3P9IA 3JTHA 1CF7B 3IKTA 4LJZF 2BBYA 1FBUA 1W5TA 5ILVA 4OINF 2HTSA 1FP2A 1P2FA 3C3WA 2P6SA 1U6GA 5CVRA 3GUDA 3MFKA 3O3KA 3W6JB 1O3TA 2DK5A 3CDHA 1O7LA 2LNBA 3F8MA 1RNLA 2JT1A 1S7OA 1EH8A 4ETSA 1FZPB 2VODA 4A12A 4E70A 4LFUA 3LQRA 2P4WA 5EEGA 2HYFA 1YW8A 3T8TA 1G3TA 3K1MA 1ZG3A 3QPTA 1D8KA 1LB2A 1G4DA 2IA2A 2GA1A 1QZZA 5TRDA 1Z6RA 2HWVA 3JSOA 4WXCA 1FSHA 4WX9A 2UXXA 5DUIA 1IF1A 4BH9A 3CTAA 2UZKA 2K27A 5HDKA 2VONA 4EJVA 4I01A 4O5VA 1J7KA 2HGCA 2JRTA 4EGZA 4KA4A 2A69F 3I64A 2W24A 4JQFA 2DPUA 1D5VA 1H9TA 1BI2A 2MBFA 2H09A 3BPVA 2IRFG 4M9ZA 1ZH5A 1T6SA 2EB7A 3B02A 3IRRA 2ZJ2A 3SQNA 1U5TB 3ELKA 2O03A 4N0BA 1XD7A 2FEZA 1R00A 5ICCA 3T8RA 4HQMA 4Y15A 1KQ8A 5CVIA 2QQAA 3H3ZA 2ZXJA 3VODA 3GXOA 3E5QA 5ICFA 2BGCA 2L01A 5CLSA 2CG4A 1U8RA 3NEUA 3ZMDA 4RGUA 2ZNZA 5CVJA 4IJAA 2P7CB 4KN7X 3H3UA 2VN2A 2OBPA 1TQPA 1MJBA 2FA5A 1U78A 3HSRA 2XAGA 1XN7A 4UV9A 2M87A 5TJJA 1I6XA 3P9KA 2EFWA 3HHHA 4ENNA 1F4KA 2FXAA 3R6SA 4ESJA 2MLKA 1HW5A 2EFQA 2Q0OA 2MD5A 1W5SA 3E3VA 1IUYA 2L02A 1TW3A 4M71A 3RJPA 1XDUA 3Q9SA 4HX7A 5HLGA 1HSTA 1ONVA 3LFKA 1XMAA 1LEAA 1TQMA 2JPCA 1WQ2A 2EFOA 2IA1A 2P5KA 4GYGA 2EV5A 1LNWA 4PGHA 1HKTA 3F8CA 2JSCA 1W7PD 1S6LA 5LBQA 2P5LC 5D4SA 1MDMA 1D8JA 3T1BA 2Z99A 4YFNF 4GXOA 4ESFA 1UHMA 4U0WA 1IXSB 1QGPA 1V3FA 4UXNA 5HDGA 4MEXF 2MA3A 3HRSA 2FMYA 1G3WA 5JFRA 3KEQA 4KT5C 2HTJA 4KMUX 2X0LA 5E17F 3RYPA 2BV6A 3IWFA 1USSA 1RIOH 2PMHA 1XSXA 3DPLC 3QU3A 2CGPA 1ZAOA 3DXJF 2Q8KA 1KQ9A 3FXRA 4I7HA 4I0BA 2Z3YA 4JK1X 3FZVA 4LLLA 3I4PA 1I1GA 3EDPA 2EK5A 4HV6A 3ABUA 2GXGA 2FBKA 4UVBA 2COMA 2L4AA 3HRMA 3BJ6A 4I98B 1L3LA 1R36A 3I71A 3C18A 3ISPA 3HOSA 2H6BA 3VEPA 3WU0A 3RDIA 3GLXA 1KU3A 2H27A 4AVPA 2HQNA 1YIOA 5DEQA 1FC3A 3FMRA 2EFNA 4PDKA 1SFXA 2WWYA 3ZP5A 3LAJA 3IKVA 1LJ9A 2RDPA 2XASA 4AWXB 1O3QA 4MHGA 1UCRA 2ADUA 2F5EA 3COAC 4M9SA 2YSRA 2O3FA 3GZ5A 2XAHA 1F1ZA 1VTNC 4CZZA 2E7WA 1ZRFA 1AOYA 2QVOA 4MQVA 5L3CA 4M74A 3JAMK 5LGTA 3D5LA 2GA2A 1H0MA 2FNPA 2XRNA 2GIVA 3D0SA 2F5FA 3KP3A 3F21A 1YS6A 2F5DA 2KRFA 3M9AA 1XCBA 1O7FA 3NQOA 2P5VA 4L18B 4WCGA 3K1PA 4IRGA 4M9XA 3K1NA 3O6BB 2HFHA 4K2EA 1T2KA 3C1DA 1JHFA 3M8EA 4FX4A 2IPQX 3EYYA 2XV4S 3AAFA 4N9HA 3WTUC 1J59A 4IHSA 5L3FA 3BZ6A 2LKPA 4WWCA 2OD5A 4PGGA 1U2WA 3LWFA 1XGSA 3ECHA 3QPHA 1JXSA 4YFKF 2YX7A 4U7DA 4R1HA 2VE8A 3F8BA 1T98A 2PQ8A 5ILUA 3LAPA 2NS0A 1KGSA 3BROA 4XSXF 2HYGD 5E8GA 1QBJA 3TDZC 2D1VA 3F72A 3TQNA 2A68F 3EYIA 1G3YA 3DEUA 4L0ZB 2NRAC 4O6JA 5D6EA 4M73A 2NYXA 3IL2A 1KQ0A 2ELHA 2KJCA 2V1UA 3F6VA 4A5NA 5BPDA 3RTRA 1U5TA 4WXHA 1R1VA 5H6QA 4M72A 1IXRC 3DQVC 2Z5UA 1FYMA 1TLHB 4LLGF 5J6XA 5ED4A 4LMYA 3BP8A 2QUFA 2QLZA 5BMZA 3CJNA 5FFXA 2CFXA 1B6AA 3KP5A 4KMFA 1LEBA 4LK1F 4RB1A 1XMKA 3WODF 2DW4A 5HS8A 2HR3A 2M45A 5L3GA 1WRJA 1LVAA 4GO1A 2ZMEB 3ULQB 3U2RA 4CHUA 3I5UA 5BOXA 3MZHA 1S3JA 4BAYA 2Q2EA 5HLHA 3WGHA 5FD5A 4ZZLA 5DYMA 2XHKA 3KZYA 5HS7A 3DKWA