4BHCA

Crystal structure of the m. tuberculosis o6-methylguanine methyltransferase r37l variant
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
165
structure length
165
Chain Sequence
MVHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSLTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALLELEKSRAPADLTLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords METHYLATED-DNA--PROTEIN-CYSTEINE METHYLTRANSFERASE
publication title Biochemical and Structural Studies on the M. Tuberculosis O6-Methylguanine Methyltransferase and Mutated Variants.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 40
structure length 165
sequence length 165
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4bhcA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4bhcA01
2F5FA 2FNPA 3LQQA 4AWXB 4YFNF 2BGCA 4UNOA 3QPTA 1FX7A 1IXSB 3MCZA 4L9VA 3I54A 3PQJA 3ZMTA 3AAFA 1XCVA 3E6CC 1IAWA 3MAJA 3JSPA 1R00A 4R8HA 3Q5FA 1J75A 2LNBA 2PMUA 1UHWA 4WF2A 2AXLA 1BC7C 2GQQA 3E5QA 4ENJA 5IT3A 1BOAA 1ZREA 2CGPA 3KP7A 5DDGA 2DO7A 1FYMA 3BJOA 2PN6A 3KFWX 2J5PA 4HDUA 5LGNA 4G6QA 3MFKA 3C3WA 3GEZA 3GFLA 2EK5A 3O3KA 3V7RA 2V1XA 4KMUX 2GXBA 5L3GA 4P5OA 2NAZA 1LDJA 1BI3A 2FEZA 1PP8F 1O3RA 3I53A 1DPRA 5BS6A 3FXUA 5HDGA 4AIHA 2G7HA 1XCBA 1YW8A 2IT0A 3GVAA 2K27A 1JGSA 5ERIA 1B6AA 2P6SA 3EUHA 1OYYA 2IVMA 4WXCA 1OYIA 4U7BA 1DP7P 4CZZA 1S29A 2VODA 3K2ZA 5K1YA 3RPQA 3F6VA 4HV6A 4M9SA 5ICEA 5K5QA 2MD5A 3BWGA 4Q47A 3ZP5A 3PFIA 3H3UA 1PP7U 2KIMA 4UV9A 4LLLA 1B59A 4U88A 3KP2A 5CVRA 2PI0A 3DEUA 1HSJA 4RB0A 4KNYA 2KKOA 2XKOA 1FT9A 5L3DA 2HTJA 2OBPA 2VOPA 3JTHA 2Y48A 5LEKA 4EM1A 5HLGA 1P4AA 5LHGA 4ZYHA 1FC3A 1ZAOA 2GIVA 1FLIA 2W57A 3JAMK 2X0LA 3HSFA 1O57A 3WGIA 4IXAA 3JAMZ 1P2FA 1QO0D 3QP5A 4GXOA 3ZQ7A 1YYVA 4U0WA 1G4DA 1XDUA 3E5UA 3MZHA 3FM3A 2IA1A 3DQVC 3ZMZA 4N9HA 2FBIA 4KYWA 3IC7A 4LB6B 3LA2A 3TOAA 1YTYA 4YIFA 2EV0A 3F8MA 3B02A 5LHIA 1IF1A 5JVTA 4Q48A 3KP3A 4M9ZA 3V8KA 3NEUA 2RC4A 2BEOA 2HFHA 3CUQB 4E70A 2B0LA 1E2XA 3K9TA 3K0LA 1HW2A 1Z91A 2KIUA 2DTRA 3I59B 2V6CA 1ONVA 4A2UA 2ZMEA 4CDGA 3FXQA 1IN5A 1A04A 1BI2A 2JTVA 3SZPA 3JTGA 2VT3A 2QUFA 2QM3A 4XLPF 4MGRA 2FU4A 2XASA 3U2RA 2R7DA 3O2PE 1TQMA 2R3SA 3EYYA 4BXUA 3F8NA 3HTSB 2K4JA 1TLHB 3GZ6A 5L3FA 5ICGA 3KP5A 2HYFA 2ADUA 1R5GA 2ZNYA 4Y15A 4LG0A 3O6BB 3BDDA 1R5HA 4O3MA 1WI9A 3ROUA 4P96A 3HHHA 4KIBA 2XAFA 2JT1A 1G3TA 4BH9A 4JQFA 3KP6A 1XGOA 4HA8A 2LF7A 1YW7A 2UXXA 3I0TA 2FSWA 4AIKA 3V7SA 1U5TC 1U8RA 4WK8F 2L54A 3GFJA 4PGGA 4YIIA 2FQ3A 4IF4A 1GVJA 1K7AA 2DBBA 3IKVA 5DV5A 1SMYF 1TNSA 2D1VA 2LF8A 4BHBA 3I64A 4DNCA 4L9JA 5L3EA 1K6OA 2IA2A 2K4BA 1AOYA 1QQIA 3R60A 2VC1A 2GXGA 3DPTA 3I4PA 1PDNC 2VC0A 1ZH5A 2R7FA 3GUDA 3E97A 3ZMSA 4G8XA 3OV8A 2VONA 4G9YA 2QLZA 2IRFG 2F2EA 2CQKA 1HKQA 1OMIA 2PG4A 5LLQA 2VBWA 1RUOA 4ON0A 3GX4X 4UVAA 2LSOA 4BAYA 2O03A 1MDMA 2OAZA 5L3CA 1XMKA 1MJBA 2EFNA 2KJBA 2XIGA 1V3FA 1FYKA 4L0ZB 5F6FA 3U1DA 5DYMA 5LEJA 3VB2A 3WU1B 3COAC 3TOBA 4A5MA 2NRAC 1R22A 3QAHA 2FE3A 3R4KA 1MJ9A 4IRIA 2DFIA 4HF1A 4Z2YA 2A07F 2YX7A 3FXRA 2HTSA 4OOIA 2H94A 2FBHA 2OQGA 2QBYB 4MQ9F 2PLYA 2HKOA 1QNTA 4LK0F 5E17F 3CLOA 2ELHA 4RB1A 2EA4A 3CUOA 2O8XA 5FLXZ 3Q9SA 2LKPA 4WWCA 3CDHA 1ZRDA 1FP2A 2QENA 2ZBKA 2LDUA 2STTA 2F5CA 4MEXF 4LLGF 1TQPA 3BPVA 4I09A 4AD9A 3VOEA 2VN2A 1BIBA 4CO8A 5FB2A 2A6EF 5TRDA 1KU2A 2BYVE 2P7CB 3N4MA 2MBFA 4HV5A 2W84A 3P9IA 2H09A 3GW2A 3DF8A 2D1HA 1S7AA 2DI3A 2GA1A 4KFCA 3KCCA 2AS5F 1XN7A 2RKHA 4ASNA 4NHJA 2OA4A 2YX4A 1IXCA 4KDPA 4OIOF 1G6NA 2M30A 3SHFA 3WE2A 2ESNA 3L09A 2Z99A 1Z6RA 1TW2A 4A0YA 2QZ8A 5D6EA 3GYHX 2IP2A 3ZN0A 2FMYA 3ECOA 2XROA 4FT8A 5E8GA 2BE5F 1ZN2A 1XD7A 2CSOA 1F1ZA 4RB2C 2QWWA 1U6GA 2NS0A 1XGNA 4FX4A 4ZH4F 4GYIA 1W5TA 4S04A 1XB4A 3TO7A 4B8XA 5A2QK 4L18B 4KUMA 4S05A 5A2QZ 5K5OA 4H0EA 5BQTA 1FSHA 2QYOA 4UXNA 1U5TA 3ABTA 2ZXJA 5D5VB 1RI7A 3WTZA 1YO5C 1LB2A 3IRRA 1OKRA 2VBXA 3HTUA 2P5KA 3D5LA 4EMSA 3E6MA 1JHFA 1OR7A 2BV6A 2Z33A 3VFZA 1MD0A 2DU9A 5D5XB 4ZZLA 5D5UB 3LWFA 3FMQA 5BPDA 3ZMVA 3MEXA 2MLKA 4ESFA 4OMYA 3SZTA 1QPMA 2DPDA 4ZYEA 3GZ5A 2UZKA 1GXQA 4BYYA 5IT9K 1HXDA 2ESHA 1KYZA 4M9XA 5DUKA 1O3SA 2DAOA 3SXYA 5ICCA 5AIQA 3EETA 2RGVA 5IT9Z 2QQBA 2NNYA 3IKTA 1LQ1A 2MC3A 2HYGD 2ZKZA 5BPIA 3KZYA 5DCMA 4Y17A 1UFMA 1KQ0A 3FMRA 1W7PD 3FX3A 5D4SA 4U7DA 1WQ2A 4IJAA 4L5IA 3HYIA 5D5WB 3JSOA 4RB3C 4UUVA 1I6XA 1Y0UA 4EM2A 1XMAA 4O6JA 4EGYA 3WTTC 1TNTA 3RYPA 2HEOA 1MKMA 1S8NA 2GZWA 2E7XA 5DD8A 2PQ8A 1ZARA 1J7KA 3E3VA 1FY7A 1R1VA 1QZYA 1JXSA 1XSDA 2K86A 4IRHA 1FPQA 2HGCA 4A0ZA 4P9UA 2P6TA 2XUBA 2EJRA 3HSEA 2XGXA 2JRTA 4G7HF 3ABUA 1FBUA 1IN4A 1KA8A 2Z9OA 2CFXA 3HRMA 2VBYA 5LHHA 1LJ9A 5ILVA 4LD5A 1CF7A 5JFRA 2HQRA 3RYRA 4RAYA 2TDXA 4PDKA 3BOQA 3GFMA 2QVOA 2Q8KA 4L0YB 4WXDA 2O61A 4OMZA 2O0YA 3REOA 1T2KA 4CXFA 3V7CA 3HRUA 1IRFA 4HZFA 1DPUA 2XAQA 1H9TA 5JR3A 1EV7A 2ZJ2A 1SFXA 1JE8A 3ISPA 3F6OA 4A6DA 4ESJA 5CLSA 2STWA 5TJJA 4M6YA 1RZ4A 1Z1DA 2OZUA 4MNUA 3LFKA 2E1NA 1J0RA 2WTEA 5DEQA 3ECHA 3F8BA 4UVBA 1CF7B 1BBYA 2IJLA 4WXHA 3TO9A 3KETA 3BY6A 5HOOA 1B9NA 3FHZA 5ILSA 4WCGA 4BHPA 1S7OA 4KN7X 1D5VA 2A61A 4MQVA 2P4WA 3W6JB 4YG2F 2VE9A 2M5WA 4EJUA 3WGGA 4ESBA 2IW5A 4R1HA 3P7NA 2VE8A 2HQNA 1ON2A 4I2OA 1YW9A 1H0MA 3GWZA 1GXPA 1RNLA 5HS7A 2PFBA 1TTYA 3F8CA 4LLNA 4Q4ZF 1SD4A 4Q5SF 1IUYA 1XGSA 2JPBA 3DV8A 1T0FA 4HOBA 3RKYA 1WRJA 5J6XA 2MH9A 2ZMEB 3T8TA 2A68F 4YFKF 3I71A 5CYVA 1H9GA 3ELKA 3F22A 1W7PA 3G73A 3HRSA 2A3SA 3HOTA 1J2XA 1FWZA 4M73A 5HDNA 1IRGA 5AONA 4YFXF 2G7UA 3RKWA 3IHUA 3M8FA 5LBQA 3M7GA 4LG0B 4OIRF 4OIPF 5LRSA 5KVRA 4OINF 3GFIA 1ZRFA 2L3DA 3LAJA 4M72A 4RGRA 1S6LA 5J8FA 1BIAA 3FWEA 4L9TA 2DPUA 3KLNA 4P55A 2COMA 3GO5A 2VBZA 1VTNC 1DUXC 4XSZF 1WKMA 2VOOA 4HQEA 3G3ZA 1JHHA 1Z7UA 2V1UA 1WSUA 2BBYA 2WC2A 3NRVA 5CVIA 4RGXA 4O5VA 5E8IA 5JHUA 1TBXA 1D8JA 3WU0A 4FX0A 1R36A 2HDCA 1Z05A 2E1CA 1ZLJA 4KT5C 2HWVA 4I0AA 1R23A 2PEXA 3C1DA 1T6SA 3K1PA 1E17A 1KQ9A 3PQKA 1LEBA 3S2WA 5H6RA 2EWNA 4RGUA 5ILUA 2W24A 1R58A 4MHGA 3TDUC 4EJVA 3J81K 1ZLKA 2WV0A 3WTXC 1LVAA 2YPRA 2X4HA 5H20A 2PBIA 3HRTA 1QGPA 3K1MA 2DQRA 4HLYA 3J81Z 1S3JA 4TV7A 1KU3A 4MTEA 4CICA 2FBKA 5E1WA 3F23A 4KN4X 1WWXA 3R0JA 1MDMB 3L9FA 2RN7A 1FP1D 2Z3YA 3FMSA 4WX9A 5FLXK 2OZ6A 1QZZA 4CGZA 3ZPLA 3T0YA 1ZG3A 4KMFA 2DK5A 5DD4A 2D45A 1T38A 1SMTA 3JW4A 4HF0A 2HOEA 1ON1A 3SQNA 4AVPA 1YIOA 5CVJA 3HSRA 3CUQC 5ED4A 5JI6A 1XDSA 3F72A 3ZN1A 3LAPA 1J59A 3RI4A 1ZYRF 3V8LA 2A69F 1X3UA 1STZA 2CG4A 1AWCA 2C6YA 2FNAA 2P8TA 4L5JA 1I27A 1YS6A 3WG9A 2FRHA 1ODDA 1ZG5A 5HS9A 3CTAA 3H3ZA 5EEGA 1D3YA 2XVCA 1K78A 1ZGAA 3KP4A 3TO6A 1EH7A 3TDZC 1MZBA 3MZYA 3BJ6A 4IPAA 2GAUA 1IN6A 3L2CA 3HOSA 1B4AA 3ULQB 3CO6C 1P92A 1TQIA 1Z6TA 2MA3A 1USSA 2XAGA 1RIOH 4UHTA 3T8RA 3HIFA 4PCQA 4PZJA 2EB7A 3P9CA 2IA0A 3IWZA 4EVIA 2JPCA 6PAXA 4LK1F 5HS8A 1F4KA 4N9IA 3D0SA 1BC8C 2CWEA 4P9FA 3FM5A 3K69A 3WTYC 1UB9A 4AIJA 3RIRA 1P6RA 2DT5A 5BMZA 1K78B 3J7AO 1KU7A 2NNNA 5FD5A 3KEQA 4HX4A 4CHUA 3FF5A 3WE3A 1ZRCA 1DDNA 1KYWA 4HAMA 4RS8A 4PGHA 4LJZF 4NQWA 2RNJA 5FGMA 2EA2A 3T5XA 3DKWA 3LSTA 2Z5UA 4IHTA 1D8KA 1HBXG 2V9VA 2ISYA 1L3LA 3W6KB 2H27A 3KLOA 1R1TA 1XGMA 3BZ6A 4NB5A 5J8CA 4HQMA 2XAJA 1U2WA 2ZNZA 2EV6A 3K1NA 3WTVC 2KJCA 2KIFA 2DW4A 2A6HF 3QU6A 5E1ZB 2CYYA 2EFQA 3OOPA 1U78A 3WTUC 2J5OA 1U5TB 2M1BA 4KIGA 4HYEA 1XSXA 3R0AA 4N0BA 2O6GE 2DLLA 1KU9A 1OPCA 5D8KB 2RVCA 2YR2A 4RGSA 1HKTA 3L00A 1YLFA 4FHTA 1G3YA 4U0YA 4G6DA 2ETHA 4EQQA 1P4XA 4I7HA 3C18A 2VT2A 2F5EA 1REPC 3NQOA 2MLGA 2P5VA 2MH2A 2OQRA 3QPHA 2HS5A 3RTRA 4EJTA 3I58A 1O7LA 2FA5A 4M74A 2GWRA 4XSXF 4HLXA 4HF2A 5BOXA 2RDPA 3RDIA 3Q9VA 3EYIA 5DCMB 4L9NA 1IZ1A 4XRFA 1O7FA 4U0VA 1IW7F 2JSCA 3LA7A 5FFZA 3TKYA 3RPUA 4EM0B 3BJAA 4M6XA 1IN8A 3P9KA 3EQLF 3WGHA 2M87A 3IWFA 4GYGA 4UVCA 3GF2A 4XBFA 1YFHA 3SFZA 1YQAA 2M8EA 2L02A 2P7VB 2QQ9A 3CUQA 5AIPA 4GCVA 1XSVA 2W25A 1KQ8A 4I0BA 1BM9A 4HX7A 1BI0A 2K7LA 4I02A 2FMLA 1USTA 3WTWC 5L3BA 2FF4A 3ZMDA 3I59A 1G3WA 2FXAA 2HR3A 2XV4S 2UXNA 1F5TA 4ENNA 1BN5A 2WWYA 1RUNA 4ZYGA 1T98A 4HW0A 1V4RA 1IXRC 2XKPA 3V4GA 1BI1A 4BHCA 5FD6A 4GO1A 4G7ZF 1ULYA 2A5YB 2RV8A 5F1RA 2EFPA 2V79A 1K79A 1T39A 1FBQA 3GLXA 2G9WA 3WTSC 4QWQA 1FOKA 2XHKA 1EH6A 4BQAA 4UV8A 5D8LB 4F7ZA 3M1EA 3L7WA 1I1SA 1J5YA 2E7WA 5E20A 5EEHA 3M8EA 4A0XA 4HX8A 3KEOA 3BP8A 3WODF 2CO5A 3N97A 2H6BA 2DQLA 4A12A 1FZPB 1O3QA 3T1BA 5HLIA 2V1DA 4KA4A 3VODA 1F9NA 4R79A 1YG2A 2EV5A 2L4AA 5LGUA 4LGWA 1HW1A 3FZVA 3TQNA 1C0WA 5K5RA 3ERED 4EJWA 4IHSA 2NYXA 4I98B 2ZO4A 3CJNA 3QU3A 4BNCA 1TW3A 1OYWA 1ZGJA 5CJ9A 5E18F 1LNWA 3F21A 1GHCA 4JBAA 3IL2A 1P4WA 2HKXA 4ZYDA 2M45A 3I5UA 3BROA 3KE2A 1R1UA 3HHGA 4EV0A 2YSRA 1W7PB 4JK1X 3DFGA 2OD5A 1SFEA 2VXZA 2Y75A 3VEPA 4KIFA 4MTDA 4EJOA 3R61A 3LQRA 4GGGA 1J9IA 2CW0F 2O3FA 4A5NA 3H92A 1W5SA 1BJAA 5KK1A 4MEYF 1O3TA 4ETSA 1FYLA 4Y13A 1W4MA 4G94A 1HW5A 3B73A 4EGZA 2FOKA 1MGTA 5D6FA 2YU3A 1Z9CA 1SD6A 5H6QA 5E1XA 5D4RA 4HDVA 4DQ2A 2QBYA 3F3XA 1NHAA 1FNNA 1I1GA 1QBJA 1ZHFA 4ENMA 2L01A 3QOPA 5LGTA 1MJAA 4D0PA 2QQAA 1LDKB 4M71A 2PMHA 2W85A 4A6EA 4K2EA 4HBLA 3QRFF 4ZZDA 2Q2EA 3J80K 3RKXA 2XRNA 1EH8A 1FSEA 4RAZA 4I01A 3E6BA 3J80Z 3CO7C 1SD5A 1L0OC 4CYDA 1YS7A 3R6SA 4LFUA 5CVVA 4IRGA 2Q0OA 4ENKA 3DP7A 3F8FA 2H6CA 3V8JA 3IRQA 4QLCU 1FBSA 4KICA 5CVUA 3DPLC 4XLNF 3ZMUA 2IPQX 3BPXA 2OU2A 5ICFA 2Y0MA 4B09A 3EDPA 2ISZA 2JZYA 3QP6A 3E6DA 4LB5A 1UHMA 1G3SA 2PJPA 4G7OF 2UWMA 1CGPA 3U9GA 2EFWA 2F5DA 1UCRA 3DXJF 4OU0A 5F64A 2RQPA 3C7JA 3MQ0A 1LEAA 2EFOA 1LDDA 3E5XA 1R7JA 2D2WA 3GXOA 5HVQC 3TGNA 1PUEE 1HQCA 2L4MA 1SAXA 1Q1HA 1I5ZA 5DCFA 1HSTA 3M9AA 1SD7A 2ACJA 3HUGA 4OIQF 2DK8A 3KZZA 1ZG1A 2KRFA 3ML6A 5DUIA 1B9MA 1U3EM 3MWMA 3LA3A 2P5LC 2ZFWA 2K02A 3RJPA 2XAHA 1B1BA 2ZCWA 1IN7A 2HZTA 4IVNA 4LMYA 1KGSA 2GA2A 1SFUA 5FO5A 5FFXA 1HKSA 5HLHA 5HDKA 5LRRA
chains in the Genus database with same CATH superfamily
2RNGA 2F5FA 1ETQA 2FNPA 3LQQA 2L5QA 4PK4A 4AWXB 2IEKA 4NDLA 5KL5A 2NUGA 4YFNF 2VASA 4BC9A 2BGCA 3VYUB 4UNOA 3QPTA 2Y30A 1FX7A 1IXSB 1XG1A 3MCZA 5B1AH 1IBME 2R7ZJ 1MBHA 2HJJA 3MD2A 4L9VA 1HR0E 3I54A 3PQJA 5GTHC 5T6JA 3ZMTA 3IH3A 1V5GA 1LFPA 3AAFA 3DKYA 1YIJI 1XCVA 2CUJA 5E3OA 3E6CC 1IAWA 3MAJA 3JSPA 1R00A 2ZJPF 1J26A 1PYVA 2YTOA 1WXRA 4C9YA 3OTOE 1PJSA 2DMYA 3CMMA 4BBRJ 4R8HA 3Q5FA 1J75A 2HQAA 2BY3A 2LNBA 2PMUA 4PFOA 1W36C 3SDGA 5HNHA 1UHWA 1RKWA 4WF2A 3VYYA 3S1RJ 2XDVA 2DGCA 3JRIA 2AXLA 1BC7C 2GQQA 2LC2A 2CW8A 3E5QA 4ENJA 5IT3A 1WHNA 1BOAA 1ZREA 5B5EC 2CGPA 2YU8A 3KP7A 3LLHA 5DDGA 2DO7A 1FYMA 3BJOA 2EM4A 2PN6A 3VYXA 2JJ7A 2NS8A 3HXLA 2J5PA 3KFWX 3MHSC 1YHQI 1N78A 4HDUA 4IEJA 5LGNA 4G6QA 3MFKA 3C3WA 4AM3A 3JREA 1PDAA 3GEZA 1XMOE 3GFLA 2EK5A 2IGOA 2MDRA 3O3KA 1BBOA 4NQWB 3V7RA 2V1XA 1R9TJ 3ADLA 1W0UA 3MVPA 4KZSA 4CYCB 4KMUX 2GXBA 3MKLA 4P5OA 1ETKA 5L3GA 1NEIA 2NAZA 2M0CA 1LDJA 1FJGE 1BI3A 2FEZA 3KPHA 1PP8F 1O3RA 2YRKA 2CUFA 2LTPA 2OPTA 3I53A 2GLOA 1RKTA 2JOBA 1DPRA 5BS6A 3FXUA 2ZXIA 1K83J 5HDGA 4AIHA 2H8RA 2G7HA 2X48A 3DBLB 1XCBA 1A5JA 1YW8A 2IT0A 4NC7A 3ASOH 3GVAA 2K27A 1JGSA 2M4IA 1IGNA 1X1PA 5ERIA 1B6AA 2P6SA 3EUHA 1OYYA 2DDBA 2IVMA 4WXCA 1OYIA 4LU9A 4Y33A 1TT0A 4U7BA 2M8GX 3OYEA 1DP7P 3A01A 2HU9A 3CDLA 4CZZA 1S29A 2VODA 2KONA 5KL3A 1W36D 3ADGA 3K2ZA 5K1YA 1PUFB 3LFUA 3GMEA 2IS2A 1QPIA 2F5VA 3RPQA 1YI2I 2L2KB 3F6VA 4HV6A 1JUMA 4M9SA 1PJTA 2D5VA 4JX5A 5ICEA 5K5QA 2V4JC 2MD5A 2HPIA 3BWGA 4Q47A 3PSIA 3ZP5A 3PFIA 4PJ0C 4DV2E 2GXAA 4A3MJ 1JGGA 3H3UA 5J47A 3M99B 1PP7U 2KIMA 4UV9A 2QA4I 3WU2C 2EN7A 4LLLA 1B59A 2HXOA 4FISA 4U88A 1VQMI 4WYQB 5IP9J 2YRHA 3GTJJ 1LVKA 2E60A 3CCRI 1QU6A 3FXKA 3KP2A 2FQ4A 5CVRA 2PI0A 2DRPA 3DEUA 4Q28A 2KOUA 3H9JA 1X5WA 1HSJA 4RB0A 2XGCA 2YZTA 2KQRA 4KNYA 1MMSA 2KKOA 2W1OA 2XKOA 1SFOJ 1FT9A 5L3DA 3K4CA 2CQQA 2HTJA 2OBPA 2VOPA 3JTHA 2Y48A 2R5YA 4C3IJ 3HGYA 4RHBB 5LEKA 2EMAA 4EM1A 1UZCA 3CESA 1YYWA 4R03A 3NAUA 1R71A 5HLGA 1P4AA 3WHCA 3FXLA 1KYQA 2RPCA 2RS6A 5LHGA 3M4OJ 4ZYHA 3RKQA 3AG3H 3A4CA 4DR3E 4NXNE 1FC3A 1ZAOA 2FOWA 2GIVA 3ABLH 2YTPA 1FLIA 3FDYA 2W57A 3JAMK 2X0LA 3HL2A 2I9IA 1J5EE 3HSFA 4DJAA 2EPKX 4IL6C 1O57A 3WGIA 2JWTA 1MH3A 2AQFA 4AQYE 1FEXA 2HXIA 4IXAA 4BKXA 3JAMZ 2EE8A 1P2FA 3J7YJ 2ZM6E 3DLAA 1LKXA 2DXIA 1QO0D 2R7QA 5H2FC 5FLMJ 3L1PA 3QP5A 4BEHA 5C3EJ 4GXOA 1N36E 3ZQ7A 2LTSA 4BDZA 4C2UA 1YYVA 2CRGA 4WPYA 5DNYA 4U0WA 4IHWA 2EM0A 2DN0A 1G4DA 1XDUA 2X6YA 5LFAA 3E5UA 2M7QA 3MZHA 3FM3A 1LLMC 3CQZJ 2IA1A 2BB8A 4GKJE 2VL8A 3DQVC 3PNYA 3ZMZA 4N9HA 2FBIA 4DYQA 4KYWA 3IC7A 1SR9A 2ODRC 4LB6B 3LA2A 4GFBA 2LR8A 3TOAA 2DDAA 1D0XA 1YTYA 3QYBA 1T8IA 2R5YB 3QOEA 4YIFA 2P0WA 2L9RA 2HVSA 4NHRA 2I13A 2Z16A 1EKZA 2MW8A 5BR8E 2JA2A 5K7FA 2EV0A 3F8MA 4S0HB 2B7VA 3B02A 2EOIA 2ZFUA 2ME6A 2YTGA 5LHIA 2Y9ZA 1IF1A 5JVTA 4Q48A 1MMNA 3KP3A 1UG0A 3DBRB 3H5NA 2DT7B 4Q35B 4M9ZA 3V8KA 3NEUA 2YWQA 2RC4A 1P9QC 1SVMA 2E1MA 2BEOA 4FCYA 2VJIA 1FMVA 2HFHA 3CUQB 1KONA 4F55A 4JYAE 4E70A 3BR5A 2B0LA 5M3FJ 1TZLA 2XPWA 4CCOA 4DGWB 4BBSJ 1E2XA 3E0JB 4QTRA 3K9TA 5GTIC 3K0LA 2MC4A 1HW2A 2EMBA 3K4BA 2KZGA 1MNMC 2RQLA 4KJZA 3BBGA 4BBYA 1Z91A 2FTXB 4W1UA 2XSDC 1APLC 2KIUA 2DTRA 3QQAA 3I59B 2FJ1A 1HNZE 1RRJA 2V6CA 2XB0X 1E0EA 1ONVA 2W48A 2ZMEA 3K10A 4A2UA 4CDGA 4GKKE 3FXQA 1MBFA 1IN5A 2ENHA 3ECRA 1OJLA 9ANTA 1BI2A 2DA2A 3LSRA 2EM9A 1V5EA 2JTVA 3SZPA 2VT3A 3JTGA 2QUFA 2E2HJ 2QM3A 1E3PA 4XLPF 1A31A 1Y1WJ 4MGRA 2FU4A 2QKLB 2B9DA 2XASA 2ODRD 3U2RA 4OAZA 3LSGA 2R7DA 1IC8A 2DTZA 3O2PE 1TQMA 2R3SA 2VB6A 4I6ZA 3EYYA 1UAAA 4BXUA 3F8NA 2EQ1A 2GOMA 3HTSB 2K4JA 3C6KA 1SVLA 2M4GA 3K4JA 3H9GA 1TLHB 2EOQA 3GZ6A 1GLNA 3HB9A 2A5WA 5L3FA 1Z1BA 4HNVA 5ICGA 2JR1A 3EPZA 3KP5A 2HYFA 3Q3SA 2EPZA 2ADUA 1IBKE 2JVGA 1R5GA 2ZNYA 4LIVA 4Y15A 4LG0A 4HNUA 3O6BB 1D1CA 2K3PA 3BDDA 3HEFA 4BL0B 1R5HA 2BVLA 4TUIA 4O3MA 1WI9A 3ROUA 2PJRA 2DA6A 4P96A 3C2GA 3HHHA 2R4GA 4FE4A 4MIMA 2DB2A 4KIBA 2YTNA 2WY7Q 2XAFA 5F1JA 1VFCA 4PSWA 4XOTA 1ETYA 5DM7F 2JT1A 2LUQA 2E5LE 1G3TA 3K6GA 2EIKH 2EMXA 5IP7J 4L5NC 4BH9A 4JQFA 3KP6A 2YU9J 4M3DA 1XGOA 4OAYA 4HA8A 1S9HA 2LF7A 3UK3C 2X51A 1YW7A 4R8OA 2UU9E 2UXXA 2CPNA 2EMLA 3I0TA 5EG0B 2FSWA 4JI4E 4AIKA 1JTYA 2PMZN 3KYLA 3V7SA 2EH3A 2BBGA 1U5TC 1U8RA 3V42A 4WK8F 2UUAE 2L54A 4LIUA 3GFJA 4PGGA 4YIIA 2FQ3A 3IWBA 2H8WA 1WH7A 2VKDA 4A3KJ 2EM6A 4IF4A 1GVJA 1K7AA 2KPMA 1HDPA 1M1EB 2DBBA 3IKVA 3OYHA 1OR7C 5DV5A 2F6CA 3PIPF 2QSGX 1SMYF 1TNSA 2D1VA 2LYCA 3CP8A 2LF8A 4BHBA 3I64A 1ZR4A 3TP3A 4LG3A 5AC4A 4DNCA 4L9JA 2JRMA 5L3EA 1K6OA 2IA2A 3FIGA 2K4BA 1AOYA 2EL5A 1QQIA 1N3GA 1WJBA 2VQCA 2A25A 2I8DA 4JI8E 3R60A 2VC1A 2GXGA 2VLAA 3DPTA 1IUFA 3I4PA 1PDNC 5A6AA 2VC0A 1ZH5A 2LBSB 2R7FA 3PUFA 3ZR8X 3GUDA 1W5CC 3E97A 3ZMSA 1Z0XA 4G8XA 1UJ8A 1AKHA 4B44A 1Z67A 3OV8A 3T1HE 1BA5A 3OIOA 2OV7A 2R7UA 3AV0A 2E71A 2VONA 2KLOA 4IKFA 4G9YA 2QLZA 3OYCA 2IRFG 1Y0NA 1FJLA 4KHPE 2F2EA 3LL7A 2CQKA 1HKQA 1OMIA 2PG4A 5LD2C 1Y6IA 3JRCA 5FJ8J 5LLQA 1X3ZB 5A6BD 2VBWA 1RUOA 5GAHJ 4ON0A 3GX4X 3BG5A 4UVAA 1JI8A 1YX3A 2LSOA 4R2RA 4BAYA 4R2DA 1H88C 4CZCA 3VSKA 3DKXA 2O03A 1MDMA 5IYBJ 2OAZA 5IP6A 4HSTA 4YRVA 5L3CA 1XMKA 5IOYA 4Z6YA 2CU7A 1MJBA 2EQ0A 2K4VA 2LUPB 1ORKA 2EFNA 2EZIA 3OMLA 1VQ9I 2LFBA 5J1RA 2KJBA 2XIGA 5FLVA 3ZQIA 1V3FA 3H5AA 3J80C 1MEYC 3HTXA 4XORA 3IH2A 4UB8C 3J7Yp 1FYKA 1MW7A 3FKJA 4L0ZB 4R2QA 3CF5F 5F6FA 2JUGA 3GCMA 5C4JJ 2VQFE 1BR4A 3U1DA 5DYMA 2YTQA 3OWTA 1MBGA 1I50J 5LEJA 2BY1A 3EQ1A 3VB2A 2N3GA 3IAM2 4JI7E 2CUEA 1ETVA 1F43A 1JT6A 3WU1B 3C2BA 3F0CA 3FXJA 3K7AJ 4PUSA 3COAC 3TOBA 4A5MA 1UILA 3AKZA 2NRAC 1IDYA 1R22A 2DOAA 3QAHA 4XQFA 2FE3A 2CQ7A 3R4KA 2K5CA 1MJ9A 1I3AA 4IRIA 3AL0B 4XMYA 2DFIA 5A6JA 1TF6A 4HF1A 2ID3A 4HEA2 4Z2YA 2A07F 5FKKA 3S1QJ 2YX7A 4XONA 3FXRA 2HTSA 1K61A 4OOIA 2H94A 3HKZA 1WPKA 1X3WB 2FBHA 2OQGA 2QBYB 2LP0A 3IV5A 3DF6A 4MQ9F 5J4VA 5CFFE 2R76A 2PLYA 2HKOA 1QNTA 4LK0F 3HQ1A 4RLQA 2HDWA 5E17F 2LKSA 1XC5A 1LFUP 1B72A 3CLOA 2ELHA 4RB1A 3IUOA 1JJ8C 2EA4A 3CUOA 2I10A 1Z7LA 1TP4A 2NOGA 1ETWA 2O8XA 3K2AA 3VYTB 3Q9SA 3NWTA 4YEJA 5FLXZ 2LKPA 1WZ2A 4X66E 4WWCA 3AUZA 4PFPA 1A1LA 4W97A 2B7EA 1JKPC 1VQ5I 4M0VA 2Q2EB 3CDHA 1LE8A 4YHHE 1SAUA 4B1RA 1CQTA 2K85A 2DMPA 5EZGA 3DBHB 1ZRDA 2YSPA 1ZAAC 1VF9A 5GPAA 2TCTA 1FP2A 2QENA 2ZBKA 3W2VA 5J3LA 3HOYJ 2JUCA 2LDUA 2STTA 2F5CA 1WJAA 1X19A 3S3MA 2L2MA 2LY9A 4RMNA 4CCMA 4MEXF 4LLGF 2M4KA 1TQPA 2E5ZA 3BPVA 2V6EA 4I09A 1FKAE 5F0HA 4AD9A 4PJNA 3VOEA 1P7JA 3MKYB 4AC0A 2VN2A 1BIBA 4CO8A 5FB2A 1OCPA 3D1NI 2A6EF 3VYSB 2GPIA 1OCCH 5TRDA 4LFCE 1KU2A 2BYVE 1WCMJ 2P7CB 3N4MA 2VPLA 2MBFA 3P1XA 4HV5A 2W84A 2EN2A 3P9IA 1PJQA 2H09A 3GW2A 3DF8A 2K9LA 2D1HA 4D1QA 2ZJQF 1S7AA 1RC7A 4DV1E 2DI3A 2GA1A 4KFCA 1FOWA 2BOLA 3KCCA 2AS5F 2V86A 1R49A 2R5ZB 1XN7A 2RKHA 2EOHA 4ASNA 4JI3E 4NHJA 3VPRA 3OYNA 2OA4A 3H35A 2YX4A 2EN1A 1IXCA 4KDPA 4OIOF 2KDOA 1G6NA 2M30A 4X1EA 2DOEA 3SHFA 3WE2A 3ONQA 2XF7A 2ESNA 1Y8RB 2WAFA 3VK6A 3L09A 2EIJH 3LSMA 2Z99A 1X1AA 1Z6RA 1TW2A 2X6WA 4A0YA 2QZ8A 2NVYJ 5D6EA 3GYHX 1S72I 2XF5A 2IP2A 3ZN0A 2EPOA 2FMYA 2EP3A 3ECOA 2XROA 4FT8A 2K3FA 2E34A 2EN3A 2V9KA 1YYOA 2F4MB 5E8GA 2BE5F 4MLOA 3S3OA 1ZN2A 2O7OA 1XD7A 2CSOA 2KT0A 4JI6E 1F1ZA 4RB2C 2QWWA 5E3LA 2RSMA 1U6GA 2NS0A 1X58A 2YT4A 2V1NA 4B3RE 4RA2A 3CCJI 2EBIA 4IHVA 2WAQN 1XGNA 3AFHA 2R7WA 4FX4A 4ZH4F 4GYIA 4XM3A 1UHSA 2DIXA 1W5TA 2L3CA 3DJWA 2LOOA 4S04A 3HUGB 2QCOA 1XB4A 2UUZA 1JUPA 5GP9A 2EMKA 5AE3A 2EOYA 3TO7A 4B8XA 5A2QK 4L18B 2LT7A 1WHQA 1T0FC 1ZBTA 2EPPA 2GBYA 2YTEA 4KUMA 4S05A 3CC2I 2V85A 3PUBA 4B3SE 5A2QZ 2LBFA 4C30A 5K5OA 1LPQA 2D9HA 4BCAA 4H0EA 2L9VA 5CQEA 3N05A 1X6FA 5BQTA 1QVTA 1VQOI 1FSHA 1F2IG 4QIWN 4L8NA 2QYOA 1YJ9I 5C4XJ 2VF1A 4UXNA 1G2HA 4XLAA 3HG9A 3UR3C 1VI0A 2CJJA 4BJ6C 1U5TA 3ABTA 2ZXJA 5D5VB 4J8ZA 1HOMA 1RI7A 4B3ME 3L2UA 3THOB 3WTZA 1YO5C 3JRGA 4XLHA 1LB2A 2WBSA 1PJRA 3KX2A 3ZXSA 3OYKA 3IRRA 1OKRA 2VBXA 3HTUA 3H1CA 2P5KA 2E72A 2LY1A 4F6MA 2HI3A 2EZLA 1MMAA 2CUZA 3AG1H 3D5LA 3ZQGA 4AYBA 4EMSA 3E6MA 2V8QB 4X6AJ 1OR7A 1JHFA 1N75A 3C4BA 4G6TB 5FKOA 3OS2A 2BV6A 5J40A 4M3EA 3ZQHA 1NK3P 4KITB 1IQSA 2Z33A 1RQ0A 3VFZA 1MD0A 2NXNB 2CMPA 2DU9A 1QU3A 5D5XB 2LVHA 3JRBA 1KZHA 3CC7I 1YJWI 4ZZLA 5D5UB 3LWFA 4DR7E 1OCOH 3FMQA 1ZQ3P 2MC6A 2VI6A 3ZMVA 2WY8Q 3MEXA 4BU2A 5BPDA 3VSLA 2MLKA 4ESFA 5FKNA 4ZDPA 3SZTA 1V54H 3UNGC 4OMYA 1T4NA 1A1KA 1QPMA 2DPDA 4ZYEA 4I76A 3OL4A 3GZ5A 2UZKA 1GXQA 4BYYA 1X1CA 5IT9K 1HXDA 3BLYA 2ESHA 4N4NB 1HF0A 1KYZA 4M9XA 5DUKA 2LBFB 3A1YA 1O3SA 2DAOA 3SXYA 5ICCA 5AIQA 3EETA 4ZDLA 5IXMB 1DGRM 2RGVA 2ZC2A 5IT9Z 2WB1N 2QQBA 2NNYA 2X1EA 4RDUA 3IKTA 2WBMA 1LQ1A 1BW5A 2MC3A 4DYCA 2HYGD 2ZKZA 1SC7A 5BPIA 3KZYA 5DCMA 4Y17A 1UFMA 1KQ0A 2OC6A 1R4MB 4DUYE 1NTCA 3FMRA 4M6VA 3HC7A 1W7PD 2XC7A 3FX3A 5D4SA 3OYDA 5BNGA 1DGWY 1WQ2A 2LG4A 2LLKA 4IJAA 4L5IA 4U7DA 1Z21A 3HYIA 1D0ZA 2J7JA 5D5WB 3OSFA 2RTXA 4HTGA 3C6MA 3JSOA 4RB3C 4LFAE 4BACA 4U87A 3O8HA 4UUVA 2CT1A 1I6XA 1IRXA 1Y0UA 1UHZA 4EM2A 1MNDA 1XMAA 3ASNH 4O6JA 4EGYA 3LMMA 3CMAI 3GLLA 1X4PA 2AHQA 3WTTC 1Y56A 2KP6A 1TNTA 4MFEA 3Q0WA 3RYPA 2EM2A 1BL0A 2V87A 1MSFC 5TSEA 3ZQFA 2HEOA 1MKMA 2VQEE 1S8NA 2GZWA 3EPKA 2E7XA 2H1LA 3SDBA 5DD8A 2DMUA 2PQ8A 1ZARA 4BXXJ 4DR6E 1J7KA 2DMQA 2P81A 3OYLA 4XRSG 1X4OA 1DI2A 4LITA 3FBNB 2EOZA 2EZ6A 3E3VA 1FY7A 3LNQA 1R1VA 1WJPA 1QZYA 4IOCF 4XKBA 1JXSA 4C2MJ 1N77A 1XSDA 2IAIA 2K86A 2XF6A 3DTIA 4A3FJ 3A01B 1MSEC 3JAMC 1JKOC 4JI5E 4A3GJ 4IRHA 1FPQA 3CMYA 1D0YA 2EQ3A 2HGCA 4A0ZA 4DYRA 3G2BA 1X1BA 4P9UA 4DV6E 2P6TA 4IHXA 2NUEA 2XUBA 3H9QA 2EJRA 4MFDA 2X9DA 3HSEA 1IG7A 2ADRA 2XGXA 2JRTA 1RR7A 3L2QA 4G7HF 3ABUA 1FBUA 2OCEA 4OX9E 1XPXA 1IN4A 4B3TE 4R2CA 1KA8A 2A6TA 2V88A 2MYSA 2Z9OA 2CFXA 2XSJC 3HRMA 4CCKA 2VBYA 4RLFA 5LHHA 1LJ9A 4QSHA 1FTTA 2IBDA 4IQ4A 5ILVA 1ZR2A 1HNXE 3LSJA 1XNRE 2DSYA 4LD5A 3HOZJ 1CF7A 1O4XA 1VNDA 5JFRA 2HQRA 3RYRA 4RAYA 1ACIA 2BZTA 2TDXA 3BTJA 2KMUA 4PDKA 3BCBA 3BOQA 3GFMA 2QVOA 1PVEA 2Q8KA 3MHHC 3P5JA 1MBJA 1JT0A 4L0YB 4CUGA 4XLCA 4DKKA 4WXDA 3JU0A 2O61A 4OMZA 1LUJB 2O5RA 4E7ZA 2O0YA 3CJTB 1YRNA 2FV4B 3EPJA 3REOA 3ZRGA 2AXTC 5KL4A 1JTXA 1T2KA 2DA1A 1Q1VA 4CXFA 3S1MJ 3V7CA 3HRUA 3MMYB 2GIZA 3TQMA 3PL8A 1IRFA 4NC8A 4HZFA 1F36A 1DPUA 2XAQA 4LF6E 1H9TA 2EM5A 5JR3A 1EV7A 1W0TA 4JX6A 2ZJ2A 5KL7A 1SFXA 1JE8A 3ISPA 2A05A 1VQLI 2OCCH 4XLFA 3VHTB 4DR5E 3F6OA 5EJCA 4A6DA 4ESJA 1IV6A 5CLSA 1VQNI 2E19A 4BQQA 2R0QC 3HOXJ 5TJJA 1NH3A 4M6YA 2STWA 2KHXA 1RZ4A 1Z1DA 2OZUA 4MNUA 3S2DJ 1JK2A 2NVTJ 3LMLA 3LFKA 4HRIA 2E1NA 3MSWA 1J0RA 1U9OA 4F52A 4BEHB 2LE2A 2WTEA 5DEQA 4V2FA 3I4MJ 2KZVA 3ECHA 3F8BA 2BXZA 1V55H 4UVBA 5GAEJ 2DFEA 3S3NA 1CF7B 4F9BB 2LMZA 1BBYA 1OISA 4BE0A 1J09A 2X6XA 3NARA 5IPAA 1GDTA 1BB8A 2QKMB 2EMWA 1YUIA 3UKGA 2IJLA 4A3LJ 4WXHA 3TO9A 3S15J 4D5FA 3KETA 1FIAA 1A1GA 3BY6A 4AU7A 5HOOA 3IWCA 1B9NA 3FHZA 3X2QH 5ILSA 4L5EA 3K70C 3ZCOA 4DOZA 4WCGA 4GZNC 1G2FC 4DZPA 4GRIA 3F9KA 4BHPA 1S7OA 2XPUA 4KN7X 1NCSA 3GTPJ 1D5VA 3GTKJ 1PUEE 2A61A 2B63J 4DV7E 4MQVA 2P4WA 3W6JB 4YG2F 3L2WA 2MDGA 2VE9A 2M5WA 4EJUA 3WGGA 3OYAA 2NVQJ 3CDIA 2KIQA 2RQQA 4ESBA 4ZTJA 2IW5A 2F8BA 1UMQA 4R1HA 3CLQA 4UB6C 3P7NA 1MH4A 2E1MB 4E7HA 4M3GA 4M30A 2LVSA 2VE8A 2HQNA 2OUMA 1ON2A 2YS9A 4I2OA 2YRMA 1BR1A 4R2SA 1YW9A 1H0MA 3GWZA 1GXPA 2CV0A 1RNLA 2EM3A 3HZJA 1O0WA 4IHYA 4UUSA 5HS7A 3KYDB 2PFBA 1H89C 1TTYA 3F8CA 4LLNA 4Q4ZF 1SD4A 4Q5SF 1ZK8A 1IUYA 3CJRB 3SYTA 2L3JA 2EOEA 1OLTA 1XGSA 1TWCJ 2JPBA 3DV8A 1T0FA 1MIJA 2EIMH 4HOBA 4HSRA 4XKVA 3RKYA 1WRJA 3HPSA 5J6XA 4A3IJ 3M3YJ 4M2ZA 4UY8I 2MH9A 1WJFA 4BC7A 2ZMEB 3T8TA 2A68F 2KHMA 3ZQCA 4F92B 4YFKF 5IY5H 1EA3A 3JRAA 3I71A 5C44J 4EEFG 4RM3A 5CYVA 1H9GA 3ELKA 1YUJA 3F22A 1W7PA 2XGDA 3G73A 2NS7A 4B4CA 2NVUB 4XNFA 2L92A 1N25A 1AH5A 3AG4H 3OYGA 2B3TB 3HRSA 4E7IA 5LMUE 1GZ6A 3CCVI 5FKMA 3HPGA 2A3SA 3OIQA 3HOTA 1J2XA 3BTLA 3K70D 3F6HA 1FWZA 4CH7A 4F54A 4M73A 4C3HJ 1YPNA 1HA8A 2OTLI 5KAIC 5HDNA 4Y4RA 1B8IA 5AONA 4YFXF 1IRGA 4LTYA 2HOAA 2G7UA 2KDZA 3CCEI 1X6HA 4AUXA 3RKWA 2LTRA 1A1IA 3IHUA 2BHYA 1KJKA 3BG3A 5DTDA 3M8FA 2ENAA 5LBQA 3M7GA 5TGTA 4BE2A 4LG0B 4OIRF 4OIPF 1Z3XA 3ZQLA 5HODA 2WV1A 5LRSA 2PJRB 2ID6A 5KVRA 2E1OA 4E7KA 1YJNI 3HBLA 4OINF 5M5XJ 1EJ9A 3T1YE 3GFIA 2DFFA 1ZRFA 2L3DA 3LAJA 1WJCA 4M72A 3PM1A 4RGRA 1UN6B 2UXDE 4LFBE 1HCRA 1S6LA 5J8FA 1MMGA 1BIAA 3FWEA 3IP4B 3E1SA 4L9TA 4PJLA 2DPUA 2E2JJ 3KLNA 4P55A 1STUA 4ZTFA 5GADJ 2COMA 3GO5A 2EOJA 2VBZA 3S93A 4XKCA 3OYJA 4R2EA 1VTNC 2DYRH 1DUXC 3MZ8A 1WKMA 4XSZF 2L2NA 3JTZA 2VOOA 4HQEA 2EINH 3G3ZA 2V9PA 4B3AA 2ZB9A 1JHHA 1Z7UA 5F08A 3PJRA 2V1UA 4DR2E 1OCZH 1WI3A 1WSUA 2BBYA 2WC2A 3NRVA 5CVIA 4RGXA 2EORA 4O5VA 5E8IA 5JHUA 4X64E 1TBXA 2VKVA 3A03A 3WU0A 3CCUI 4FX0A 1D8JA 1R36A 4YIRX 3BQYA 2HDCA 3U21A 5EEAA 2EMCA 3JRHA 1Z05A 2WADA 2E1CA 2K7IA 1ZLJA 1ZTRA 4KT5C 2HWVA 3KYCB 1VQ6I 4XIDA 1HLVA 5M5WJ 2O8KA 4I0AA 3W6VA 1R23A 2KFDA 2PEXA 5IYDJ 3MKZA 2DJIA 3C1DA 4BJ5C 1T6SA 3K1PA 1E17A 2V89A 3OY9A 4CCLA 2UXBE 3KIOA 2JA7J 3S8PA 3RZDJ 1BR2A 3G1OA 1TC3C 1GUUA 1KQ9A 3S17J 3PQKA 1XMQE 1QHHD 4J19A 1LEBA 4JI2E 3S2WA 4FTHA 4IO9F 3H36A 1HC8A 3H09A 4NNJA 2GOXB 2IGKA 3MN2A 3CD6I 5H6RA 1TWGJ 4BS9A 4AVZA 1K6YA 2EWNA 1TWHJ 4RGUA 1T95A 3S16J 5ILUA 4M3BA 2E35A 2R1FA 2W24A 4YY3E 1R58A 4MHGA 3TDUC 4EJVA 3J81K 1ZLKA 2WV0A 3WTXC 1LVAA 4X8WA 2YPRA 2X4HA 1AKHB 5H20A 2EZHA 2PBIA 3HRTA 4B48A 2WZOA 1IMUA 2L7FP 1QGPA 3K1MA 2DQRA 1OQYA 2JYAA 2L6MA 4HLYA 2EILH 3J81Z 2DYSH 4P1WA 1LFBA 1S3JA 3FBIB 4F93B 4TV7A 4DZJA 1KU3A 2VRDA 4MTEA 4CICA 2FBKA 5E1WA 5JLXA 1YE9A 3F23A 1X2MA 3E7LA 2ZXHA 3HDDA 3FXMA 4KN4X 1WWXA 2IS6A 3R0JA 4XICA 1MDMB 3L9FA 3FK6A 2RN7A 1FP1D 2EZKA 2Z3YA 3FMSA 4WX9A 5FLXK 4LF7E 2OZ6A 1QZZA 1U8BA 2QGUA 4CGZA 3ZPLA 3T0YA 2YTJA 4I99C 3SZGA 1ZG3A 4KMFA 2DK5A 3GTOJ 5DD4A 2D45A 1T38A 4DV5E 4BQOA 3BZKA 1SMTA 1FIPA 3JW4A 4HF0A 1GTKA 3D5SC 2HOEA 1ON1A 2ECBA 3SQNA 3I9V2 4AVPA 2HGHA 1YIOA 5EYRA 4HG2A 5CVJA 1A35A 2IHR1 3HSRA 3CUQC 5EZHA 5ED4A 4IQJA 5JI6A 2VQGA 4JP0A 1XDSA 4XK4A 2VKEA 3HGGA 4WFTA 3IH4A 2OF7A 4A3CJ 3F72A 3BR0A 3ZN1A 2EM8A 1BBGA 4B43A 2M0MA 4D7MA 2EL4A 3LAPA 2BW3A 1J59A 4A3BJ 4ZC3A 3RI4A 1ZYRF 2DJNA 3HPHA 5KNLA 3V8LA 2A69F 2EPCA 5AASA 1X3UA 1UELB 2F48A 3S1NJ 2E2IJ 1XMXA 1STZA 2CG4A 1SANA 2EPUA 3CCQI 5K7ZA 1ZELA 1AWCA 2R93J 5GAGJ 2C6YA 4MLVA 2FNAA 2XGEA 1NK2P 2P8TA 4CSWA 4L5JA 4X62E 1A36A 1X48A 1I27A 1YS6A 5LMNE 3WG9A 2FRHA 1ODDA 1ZG5A 5HS9A 3CTAA 2ZJRF 3K4NA 5EGOA 3K6QA 3H3ZA 2PMZA 3BCAA 5EEGA 2XVCA 1D3YA 2BY2A 1K78A 1B72B 1HNWE 4KISA 2Q1ZB 1ENHA 1ZGAA 3KP4A 3RPUD 2MSYA 3TO6A 1DU0A 1EH7A 3TDZC 1MZBA 3MZYA 4JV5E 3BJ6A 2VE7C 5B3SH 2W82A 3J7AY 4IPAA 1DGCA 1G2DC 2GAUA 4ITVA 1IN6A 3L2CA 4FASD 3HOSA 1B4AA 1LE8B 3ULQB 1AA7A 3CO6C 1P92A 1ZBQA 1TQIA 2EN8A 1Z6TA 2MA3A 1USSA 3LSIA 3OYFA 3BGHA 2K9MA 1DP3A 2MKDA 1QVUA 3H3VK 2XAGA 2LCEA 3RQIA 2NABA 2WBTA 1W1WE 1RIOH 4UHTA 5B1BH 5F27A 4BUPA 3T8RA 2UUBE 3HIFA 1N32E 3OS0A 2DLKA 4PCQA 4PZJA 2HQ5A 4V19K 4JI1E 2WBUA 2EB7A 1HKSA 3P9CA 4O5GA 2IA0A 3IWZA 3OYIA 4EVIA 4B3XA 4R2PA 2LO3A 2JPCA 6PAXA 3GZNB 4LK1F 4XKWA 3SFIA 1G59A 3FXOA 4LF5E 3B6AA 5HS8A 1F4KA 4N9IA 4C2TA 4V2GA 3CC4I 3D0SA 2VQLA 1WJ5A 1BC8C 3LOCA 2CWEA 4GDFA 4P9FA 4ABZA 3L2VA 3EPHA 2LH9A 1R6RA 5A6KA 1VQ7I 4PJMA 3FM5A 3K69A 3WTYC 5IOZA 1UB9A 5A2QC 5E79C 4AIJA 1ZGWA 4K0KE 3CMEI 1HDDC 3LSKA 3RIRA 1P6RA 2R92J 2X1DA 2DT5A 2EPNA 2MFZA 5BMZA 2LD5A 1K78B 3J7AO 3J7ZI 1KU7A 1RETA 2NNNA 5FD5A 3KEQA 3CJQB 4HX4A 4CHUA 3SEZA 3H0GJ 3FF5A 3WE3A 1ZRCA 1DDNA 1KYWA 4HAMA 4RS8A 4PGHA 2KRHA 4LJZF 4IX7A 1IBLE 3TL4X 4NQWA 1E3HA 2ECCA 2RNJA 1IV8A 1RR8C 3C4TA 2BY0A 3G1MA 1D5YA 4CYCA 2F4IA 3RSNA 2HVRA 4LF8E 5CPRB 2JA8J 5FGMA 2EA2A 2XRLA 2R7VA 2B9SA 3T5XA 3DKWA 2L9SA 3W3CA 5J4YA 3LSTA 3EUKL 2Z5UA 4IHTA 3RCOA 1D8KA 4I8OA 3BIDA 3RQ4A 4HPQA 3OYBA 5A6BA 3BG7A 2LREA 3PNTA 1HBXG 3HM5A 3GBGA 2JPAA 1XNQE 2V9VA 2ISYA 1L3LA 4BE1A 4M9VC 4DW6A 4IOAF 3WG7H 3W6KB 2ELZA 2VJJA 3EPLA 3BR6A 3B6CA 1R4NB 2H27A 3KLOA 1QRYA 1R1TA 1XGMA 4P78A 2EPAA 2EMYA 3DLLF 3BZ6A 4NB5A 4CCJA 5J8CA 3QYEA 5JVGF 1GT0C 2QSHX 2GM4A 1L4SA 4HQMA 2W7NA 2XAJA 5IT9C 2HZDA 2N8GA 2OJED 2JN6A 4BDYA 2M34A 1U2WA 1RPWA 2EWLA 2ZNZA 1PUFA 4D7NA 5IYCJ 4XRSA 3J7AG 3U1KA 2EV6A 5EF6A 3G4SI 2KISA 3K1NA 1TN9A 5CQGA 2CQNA 3WTVC 2KJCA 3C2HA 2JY9A 5LL6R 2KIFA 2K9QA 4QPOA 2DW4A 1P47A 2A6HF 3VYRB 1FMWA 1X6EA 3QU6A 2PX9A 5E1ZB 2GLIA 2CYYA 4AIDA 3PFYA 2EFQA 3OOPA 2YSOA 1U78A 3TP0A 3WTUC 2E36A 2CV2A 1Z77A 2J5OA 1E3OC 2Y2ZA 4E7LA 4X0GA 3FKIJ 3ZOQB 1G8XA 2HVQA 4II3A 1U5TB 2M1BA 4KIGA 4F2JC 4WSGA 4HYEA 2EPRA 3BR1A 1XSXA 3R0AA 3CF2A 2FD5A 3OMYA 2Y31A 4N0BA 5JHFA 2O6GE 2VPRA 2DLLA 1KU9A 1OPCA 5D8KB 3BT9A 3QWLA 2RVCA 1A1JA 2YR2A 4RGSA 1ETXA 1R5ID 4E6KG 1HKTA 3L00A 3BR3A 4H4KC 1YLFA 4FHTA 1G3YA 3H0DA 4U0YA 4G6DA 2WCC3 2ETHA 4EQQA 1P4XA 4I7HA 3C18A 4KWYA 2VT2A 2F5EA 3HOWJ 2HYJA 1REPC 3DEEA 2EMHA 3NQOA 2MLGA 3ABMH 2P5VA 2MH2A 4A3JJ 1TF3A 1MMDA 2OQRA 3QPHA 4XOPA 2JA6J 2HS5A 3RTRA 4EJTA 3I58A 3AL0C 4NZVA 2MG4A 2CSHA 4IZZA 2YTFA 1T56A 2G0EA 4X9JA 1O7LA 2FA5A 4M74A 5F3WA 2GWRA 2ICWG 1I39A 5F0FA 3BTIA 2VXDA 2MD0A 1ITYA 1BOBA 1U0JA 2K9SA 3ADIA 4XSXF 4HLXA 4O4KA 4HF2A 5F04A 1QHGA 4XL9A 4DBQA 5BOXA 1JKQC 4JI0E 2RDPA 3RDIA 3Q9VA 3EYIA 5DCMB 2K9NA 5FRNA 2EMZA 4L9NA 1IZ1A 4XRFA 1O7FA 4U0VA 1IW7F 4XLEA 3W2AA 4IJDA 2JSCA 3LA7A 5FFZA 3CZ6A 2EOOA 3S14J 2RREA 4A3EJ 1UG2A 1AU7A 5ADZA 3JRFA 1TWFJ 2L8TA 1WGXA 2VQHA 2FGGA 1ZU1A 3TKYA 4PSXA 3RPUA 1X2NA 4EM0B 2W00A 3BJAA 2R7RA 4M6XA 2JP9A 1XX5A 2QEXI 1IN8A 3I4NJ 3O8GA 3M1CA 3P9KA 5FRMA 2Z2SB 3EQLF 5IV8B 2WAEA 3WGHA 2M87A 3FHNA 5DM6F 3IWFA 4GYGA 2EQRA 4UUTA 2EN6A 3M07A 4UVCA 3KWRA 3GF2A 4XBFA 1YFHA 4LF9E 1TT5B 2I5UA 1UBDC 3SFZA 3OYMA 1YQAA 2M8EA 1MNEA 2L02A 2YPNA 3IWDA 2P7VB 2QQ9A 1V5FA 4ANJA 3CUQA 1X49A 3A2KA 1QA6A 4OOGC 4F9AB 3CCMI 2FUG2 5AIPA 4BJTA 4NUBA 4GCVA 4RH8A 1XSVA 2DMTA 2W25A 3GTQJ 4FK5C 3DTKA 2TRTA 3EUAA 1KQ8A 4I0BA 1BM9A 2XPVA 2AQEA 4HX7A 2H1KA 2WAQA 5JLWA 4GEQB 3BQZA 1BI0A 2K7LA 4I02A 2FMLA 1USTA 3VWBA 3WTWC 4HEIA 3OOUA 1JKRC 3PO3J 4II2A 3QYFA 1MBKA 2FF4A 1FOYA 5L3BA 2IS1A 4PJJA 2LRSA 4ZYAA 3ZMDA 3I59A 1G3WA 2FXAA 2HR3A 4IS1C 2XV4S 2JA5J 2UXNA 1F5TA 2V7FA 4ENNA 1VQKI 2DA7A 1BN5A 2CFOA 4KT6A 3QG5C 2WA0A 3HPZA 2WWYA 2VJ5A 1RUNA 4ZYGA 3PSFA 5GPCA 2QF7A 3CCYA 1T98A 1OCTC 4HW0A 1V4RA 1IXRC 3OR2C 4FE7A 3F6GA 2XKPA 1IO2A 3V4GA 5A69A 1BI1A 4FETA 5J1UA 2CH0A 1I94E 4BHCA 3GTMJ 5FD6A 4GO1A 4G7ZF 1S5LC 4A69C 4XN3A 1I3QJ 2ELJA 2VIXA 2VJ4A 2XAUA 5B66C 2LKXA 1ULYA 2A5YB 5FROA 2RV8A 1H8AC 5KHDA 3TW6A 4RAFA 5F1RA 2EFPA 2V79A 1T4OA 5AE1A 1K79A 1T39A 1FBQA 1YRNB 2DODA 1FTZA 3GLXA 2N3HA 3G71I 5F0CA 1YITI 1T4LB 1U9NA 2G9WA 3WTSC 3QPLA 3BR2A 1NG6A 2CTDA 3QODA 3TW7A 4CCNA 2YU5A 2Y0SN 2Y69H 3HOVJ 4FQGA 1T33A 4QWQA 1FOKA 3PIOF 1Y1VJ 1DU6A 3HKZN 2XHKA 1EH6A 2DA4A 4XN0A 4BQAA 3OIPA 3JRDA 4LF4E 2Y9YA 4OWRB 2VUMJ 3VDXA 2DMIA 1WVRA 1JJ6C 4UV8A 5EDNA 1A1HA 2WB1A 3K4MA 2M2EA 5D8LB 3ZQQA 2L2OA 5EG0A 2LRDA 4F7ZA 1MBEA 1VQPI 3M1EA 3L7WA 5CKTA 2ELYA 2JVHA 2ELKA 4CA0A 5J1YA 1I1SA 2EPXA 1J5YA 2E7WA 1Z3YA 5E20A 2IS4A 2E5NA 3FIWA 5EEHA 3I3LA 1WHUA 3M8EA 4A0XA 4HX8A 3KEOA 2L9NA 4DR1E 3BP8A 3WODF 2MGQA 2CO5A 3N97A 2H6BA 2DQLA 1FOXA 4A3DJ 4A12A 4E7SA 1FZPB 4X65E 4F6NA 2W4SA 4BMJA 1YX5A 1O3QA 2UUCE 3T1BA 5HLIA 2V1DA 4KA4A 1RESA 2BHZA 2IXSA 3VODA 1F9NA 2HC5A 2M1SA 3CP2A 1GQEA 4R79A 1YG2A 2DFHA 2EV5A 1DQUA 1GV2A 2L4AA 3KEYA 3WHBA 5LGUA 3DU6A 4LGWA 1HW1A 2ZSHB 3BTCA 3FZVA 3TQNA 4D9JA 1C0WA 5K5RA 3ERED 3JCUC 4EJWA 3GTLJ 4D5CA 4IHSA 2DOFA 2V26A 3L2RA 3BF2A 2NYXA 2QSFX 4E7JA 4ZDOA 2X85A 4I98B 1YZ9A 3ZGKA 2KRCA 2ZO4A 1X47A 3CJNA 3QU3A 4BNCA 1TW3A 1N34E 4TUGA 1OYWA 1ZGJA 4UUSB 2F4VE 5CJ9A 2ZSIB 5E18F 1LNWA 3F21A 2CS3A 4Y52J 1GHCA 2DA3A 4DIQA 4DR4E 2XB5A 1QZEA 4JBAA 3IL2A 2R7TA 2HNHA 1P4WA 2HKXA 4JX4A 2EN4A 4XR6A 3RZOJ 4ZYDA 2M45A 1NG7A 2LY2A 3H5RA 3I5UA 1JK1A 2JSPA 3BROA 2H36X 3KE2A 1R1UA 1K4SA 3HHGA 4EV0A 4C3JJ 5AE2A 2NUFA 2YSRA 4BXFA 1WJDA 4O43A 1WFXA 1W7PB 2LJHA 4JK1X 1EF4A 4B47A 3DFGA 3Q0VA 2LV2A 2ZXWH 2OD5A 2EOSA 1SFEA 2M7AA 2VXZA 2Z1DA 2ME0A 1WH5A 2Y75A 3VEPA 4NC6A 1GVDA 4KIFA 2JMWA 3OS1A 4MTDA 3DCFA 4NXME 4EJOA 3ABKH 1B8IB 3R61A 1WJEA 1AHDP 2EMIA 2CW7A 3LQRA 4GGGA 1J9IA 2CW0F 2O3FA 4A5NA 1K4TA 2IGNA 3EUHC 3H92A 1W5SA 1BJAA 2M9HA 4MO7A 5KK1A 4BY1J 2JOXA 4R2AA 4MEYF 3G1LA 1O3TA 4ETSA 4F3QA 1ZKGA 1BW6A 4DBRA 3OR1C 1T08B 2BXYA 3AG2H 3S32A 1EKEA 1XTAA 5KL2A 2JK3A 1FYLA 2COBA 5HNFA 4Y13A 3LSPA 1W4MA 1S7EA 2CQXA 3DTEA 4G94A 1HW5A 3B73A 4J01A 4EGZA 2EM7A 2RAEA 2FOKA 1MGTA 4DV3E 4BGDA 3ZOBA 2DT6A 2X1CA 5D6FA 2YU3A 4YELA 4JYKA 3J81C 1Y39A 2GHFA 3ESWB 3JR9A 2EPFA 1RC9A 1Z9CA 2HOSA 1SD6A 5H6QA 2L7MP 2JQ7A 5E1XA 1X3CA 5D4RA 4HDVA 2UXCE 2LJUA 1P7IA 3G6EI 4DQ2A 2QBYA 3F3XA 1NHAA 2EPLX 3THNA 1FNNA 5KCMA 2LK2A 2EOMA 1I1GA 1TL8A 1I6HJ 2ENCA 1QBJA 1ZHFA 2RS7A 4E4HA 4ENMA 2L01A 3QOPA 5HLTA 2R7SA 2NVXJ 2MKNA 1BJZA 4P7DA 5LGTA 3FK7A 2DMNA 1MJAA 4D0PA 2QQAA 3MKWB 1LDKB 2L7KA 5DS9A 4M71A 3CCLI 1N33E 2PMHA 2W85A 4A6EA 2HPMA 4WSPA 4K2EA 3KZIC 3DU5A 4HBLA 3QRFF 4ZZDA 1XS9A 4AYBN 4DV4E 2Q2EA 5FLXC 2EOFA 2OTJI 3I56I 3J80K 2HHHE 3RKXA 2MC5A 2XRNA 1SVOA 2LMDA 2NOJB 1EH8A 2FX0A 1FSEA 4RAGA 4RAZA 2M7BA 3TMOA 4I01A 3E6BA 4JOMA 2EL6A 4F9CB 1YYKA 3QPSA 5K7HA 3K4LA 3J80Z 3CCSI 3PO2J 3CO7C 2N8XA 1IQOA 1SD5A 4QPQA 1L0OC 3SEQA 4CYDA 1YS7A 3OSGA 3Q0UA 3R6SA 2Y0SA 2DLQA 3BZCA 4RM2A 5AC5A 3ADJA 4LFUA 5CVVA 4IRGA 2Q0OA 4ENKA 3DP7A 3F8FA 3RMPA 2H6CA 3LSHA 2R7OA 3V8JA 3D5RC 3S2HJ 3IRQA 1ERDA 1DQ3A 1POGA 4QLCU 1FBSA 5FKLA 1IDZA 4EATA 4KICA 2L0KA 3W2WA 5M5YJ 5CVUA 2QQ8A 3DPLC 4XLNF 5E3MA 3ZMUA 2HDDA 2L33A 1PKPA 1JUSA 2IPQX 3BPXA 3HOUJ 2UV1A 1IJWC 2OU2A 5ICFA 2R5ZA 3K4KA 2EMGA 4BY7J 3TBIA 1A6QA 2Q8UA 2Y0MA 4DUZE 1RMDA 5KAFC 2V83A 4B09A 3HJEA 3EDPA 3NWSA 2ISZA 2YTIA 2DA5A 2JZYA 3E6DA 3QP6A 4LB5A 5KL6A 5IWAE 3BG9A 3TEDA 1UHMA 5E3NA 1G3SA 2PJPA 4G7OF 2UWMA 1CGPA 2B7TA 4Y7NJ 3U9GA 2NA2A 2EFWA 4J00A 3A02A 2EMFA 1AAYA 4N4RB 4F91B 2F5DA 1UCRA 3DXJF 3OL3A 2RSIA 4OU0A 5F64A 1YOVB 2RQPA 3C7JA 1SFKA 2R7XA 3A0BC 3BG6A 3MQ0A 1LEAA 2K40A 2MABA 2M9AA 2EFOA 2EJ4A 3DWLE 3I55I 4DV0E 1YSAC 2JXPA 1OFCX 4NBQA 2PRTA 1LDDA 3M8JA 1GV5A 1A1FA 3E5XA 1R7JA 2E1MC 4HNTA 2D2WA 3GXOA 5HVQC 2HOTA 3IAS2 2F4OB 3TGNA 4XRMA 1HQCA 4LOCA 2IGMA 2L4MA 2L7ZA 4RBOA 2VKHA 1SAXA 2YUSA 1Q1HA 1ZR9A 1I5ZA 2M3AA 5DCFA 3SJMA 1HSTA 2EOXA 3A0HC 3M9AA 4MLQA 3ERMA 3BC8A 1SD7A 2BW3B 1X1DA 2X6OA 1VQ8I 2ACJA 3HUGA 4OIQF 1IRZA 2BVMA 2EPMX 2DK8A 3KZZA 1ZG1A 2KRFA 3ML6A 2DCEA 5DUIA 3DEWA 1B9MA 1U3EM 4M3FA 4O24A 2JWOA 3MWMA 3LA3A 4Y3OA 1TWAJ 2P5LC 4N4OB 1OCRH 5TISC 2ZMEC 2ZFWA 2K02A 3PNVA 4BQNA 3GTGJ 2O9LA 4A93J 4G12A 2CV1A 1D1AA 3RJPA 2XAHA 1VQ4I 1B1BA 2ZCWA 2JVAA 1D1BA 3DPUA 1IN7A 1ETOA 1B69A 4ZJZA 2HZTA 4IVNA 5EGOB 4LMYA 1A6IA 1KGSA 2GA2A 2KL4A 1SEUA 1Y8QB 2AO9A 1VZ0A 5M3MJ 1SFUA 3FISA 5FO5A 4DMIA 5FFXA 1A04A 2YTDA 5HLHA 5HDKA 5LRRA
chains in the Genus database with same CATH topology
2F5FA 2FNPA 3LQQA 4AWXB 4YFNF 2BGCA 4UNOA 3QPTA 1FX7A 1IXSB 3MCZA 4L9VA 3I54A 3PQJA 3ZMTA 3AAFA 1XCVA 3E6CC 1IAWA 3MAJA 3JSPA 1R00A 4R8HA 3Q5FA 1J75A 2LNBA 2PMUA 1UHWA 4WF2A 2AXLA 1BC7C 2GQQA 3E5QA 4ENJA 5IT3A 1BOAA 1ZREA 2CGPA 3KP7A 5DDGA 2DO7A 1FYMA 3BJOA 2PN6A 3KFWX 2J5PA 4HDUA 5LGNA 4G6QA 3MFKA 3C3WA 3GEZA 3GFLA 2EK5A 3O3KA 3V7RA 2V1XA 4KMUX 2GXBA 5L3GA 4P5OA 2NAZA 1LDJA 1BI3A 2FEZA 1PP8F 1O3RA 3I53A 1DPRA 5BS6A 3FXUA 5HDGA 4AIHA 2G7HA 1XCBA 1YW8A 2IT0A 3GVAA 2K27A 1JGSA 5ERIA 1B6AA 2P6SA 3EUHA 1OYYA 2IVMA 4WXCA 1OYIA 4U7BA 1DP7P 4CZZA 1S29A 2VODA 3K2ZA 5K1YA 3RPQA 3F6VA 4HV6A 4M9SA 5ICEA 5K5QA 2MD5A 3BWGA 4Q47A 3ZP5A 3PFIA 3H3UA 1PP7U 2KIMA 4UV9A 4LLLA 1B59A 4U88A 3KP2A 5CVRA 2PI0A 3DEUA 1HSJA 4RB0A 4KNYA 2KKOA 2XKOA 1FT9A 5L3DA 2HTJA 2OBPA 2VOPA 3JTHA 2Y48A 5LEKA 4EM1A 5HLGA 1P4AA 5LHGA 4ZYHA 1FC3A 1ZAOA 2GIVA 1FLIA 2W57A 3JAMK 2X0LA 3HSFA 1O57A 3WGIA 4IXAA 3JAMZ 1P2FA 1QO0D 3QP5A 4GXOA 3ZQ7A 1YYVA 4U0WA 1G4DA 1XDUA 3E5UA 3MZHA 3FM3A 2IA1A 3DQVC 3ZMZA 4N9HA 2FBIA 4KYWA 3IC7A 4LB6B 3LA2A 3TOAA 1YTYA 4YIFA 2EV0A 3F8MA 3B02A 5LHIA 1IF1A 5JVTA 4Q48A 3KP3A 4M9ZA 3V8KA 3NEUA 2RC4A 2BEOA 2HFHA 3CUQB 4E70A 2B0LA 1E2XA 3K9TA 3K0LA 1HW2A 1Z91A 2KIUA 2DTRA 3I59B 2V6CA 1ONVA 4A2UA 2ZMEA 4CDGA 3FXQA 1IN5A 1A04A 1BI2A 2JTVA 3SZPA 3JTGA 2VT3A 2QUFA 2QM3A 4XLPF 4MGRA 2FU4A 2XASA 3U2RA 2R7DA 3O2PE 1TQMA 2R3SA 3EYYA 4BXUA 3F8NA 3HTSB 2K4JA 1TLHB 3GZ6A 5L3FA 5ICGA 3KP5A 2HYFA 2ADUA 1R5GA 2ZNYA 4Y15A 4LG0A 3O6BB 3BDDA 1R5HA 4O3MA 1WI9A 3ROUA 4P96A 3HHHA 4KIBA 2XAFA 2JT1A 1G3TA 4BH9A 4JQFA 3KP6A 1XGOA 4HA8A 2LF7A 1YW7A 2UXXA 3I0TA 2FSWA 4AIKA 3V7SA 1U5TC 1U8RA 4WK8F 2L54A 3GFJA 4PGGA 4YIIA 2FQ3A 4IF4A 1GVJA 1K7AA 2DBBA 3IKVA 5DV5A 1SMYF 1TNSA 2D1VA 2LF8A 4BHBA 3I64A 4DNCA 4L9JA 5L3EA 1K6OA 2IA2A 2K4BA 1AOYA 1QQIA 3R60A 2VC1A 2GXGA 3DPTA 3I4PA 1PDNC 2VC0A 1ZH5A 2R7FA 3GUDA 3E97A 3ZMSA 4G8XA 3OV8A 2VONA 4G9YA 2QLZA 2IRFG 2F2EA 2CQKA 1HKQA 1OMIA 2PG4A 5LLQA 2VBWA 1RUOA 4ON0A 3GX4X 4UVAA 2LSOA 4BAYA 2O03A 1MDMA 2OAZA 5L3CA 1XMKA 1MJBA 2EFNA 2KJBA 2XIGA 1V3FA 1FYKA 4L0ZB 5F6FA 3U1DA 5DYMA 5LEJA 3VB2A 3WU1B 3COAC 3TOBA 4A5MA 2NRAC 1R22A 3QAHA 2FE3A 3R4KA 1MJ9A 4IRIA 2DFIA 4HF1A 4Z2YA 2A07F 2YX7A 3FXRA 2HTSA 4OOIA 2H94A 2FBHA 2OQGA 2QBYB 4MQ9F 2PLYA 2HKOA 1QNTA 4LK0F 5E17F 3CLOA 2ELHA 4RB1A 2EA4A 3CUOA 2O8XA 5FLXZ 3Q9SA 2LKPA 4WWCA 3CDHA 1ZRDA 1FP2A 2QENA 2ZBKA 2LDUA 2STTA 2F5CA 4MEXF 4LLGF 1TQPA 3BPVA 4I09A 4AD9A 3VOEA 2VN2A 1BIBA 4CO8A 5FB2A 2A6EF 5TRDA 1KU2A 2BYVE 2P7CB 3N4MA 2MBFA 4HV5A 2W84A 3P9IA 2H09A 3GW2A 3DF8A 2D1HA 1S7AA 2DI3A 2GA1A 4KFCA 3KCCA 2AS5F 1XN7A 2RKHA 4ASNA 4NHJA 2OA4A 2YX4A 1IXCA 4KDPA 4OIOF 1G6NA 2M30A 3SHFA 3WE2A 2ESNA 3L09A 2Z99A 1Z6RA 1TW2A 4A0YA 2QZ8A 5D6EA 3GYHX 2IP2A 3ZN0A 2FMYA 3ECOA 2XROA 4FT8A 5E8GA 2BE5F 1ZN2A 1XD7A 2CSOA 1F1ZA 4RB2C 2QWWA 1U6GA 2NS0A 1XGNA 4FX4A 4ZH4F 4GYIA 1W5TA 4S04A 1XB4A 3TO7A 4B8XA 5A2QK 4L18B 4KUMA 4S05A 5A2QZ 5K5OA 4H0EA 5BQTA 1FSHA 2QYOA 4UXNA 1U5TA 3ABTA 2ZXJA 5D5VB 1RI7A 3WTZA 1YO5C 1LB2A 3IRRA 1OKRA 2VBXA 3HTUA 2P5KA 3D5LA 4EMSA 3E6MA 1JHFA 1OR7A 2BV6A 2Z33A 3VFZA 1MD0A 2DU9A 5D5XB 4ZZLA 5D5UB 3LWFA 3FMQA 5BPDA 3ZMVA 3MEXA 2MLKA 4ESFA 4OMYA 3SZTA 1QPMA 2DPDA 4ZYEA 3GZ5A 2UZKA 1GXQA 4BYYA 5IT9K 1HXDA 2ESHA 1KYZA 4M9XA 5DUKA 1O3SA 2DAOA 3SXYA 5ICCA 5AIQA 3EETA 2RGVA 5IT9Z 2QQBA 2NNYA 3IKTA 1LQ1A 2MC3A 2HYGD 2ZKZA 5BPIA 3KZYA 5DCMA 4Y17A 1UFMA 1KQ0A 3FMRA 1W7PD 3FX3A 5D4SA 4U7DA 1WQ2A 4IJAA 4L5IA 3HYIA 5D5WB 3JSOA 4RB3C 4UUVA 1I6XA 1Y0UA 4EM2A 1XMAA 4O6JA 4EGYA 3WTTC 1TNTA 3RYPA 2HEOA 1MKMA 1S8NA 2GZWA 2E7XA 5DD8A 2PQ8A 1ZARA 1J7KA 3E3VA 1FY7A 1R1VA 1QZYA 1JXSA 1XSDA 2K86A 4IRHA 1FPQA 2HGCA 4A0ZA 4P9UA 2P6TA 2XUBA 2EJRA 3HSEA 2XGXA 2JRTA 4G7HF 3ABUA 1FBUA 1IN4A 1KA8A 2Z9OA 2CFXA 3HRMA 2VBYA 5LHHA 1LJ9A 5ILVA 4LD5A 1CF7A 5JFRA 2HQRA 3RYRA 4RAYA 2TDXA 4PDKA 3BOQA 3GFMA 2QVOA 2Q8KA 4L0YB 4WXDA 2O61A 4OMZA 2O0YA 3REOA 1T2KA 4CXFA 3V7CA 3HRUA 1IRFA 4HZFA 1DPUA 2XAQA 1H9TA 5JR3A 1EV7A 2ZJ2A 1SFXA 1JE8A 3ISPA 3F6OA 4A6DA 4ESJA 5CLSA 2STWA 5TJJA 4M6YA 1RZ4A 1Z1DA 2OZUA 4MNUA 3LFKA 2E1NA 1J0RA 2WTEA 5DEQA 3ECHA 3F8BA 4UVBA 1CF7B 1BBYA 2IJLA 4WXHA 3TO9A 3KETA 3BY6A 5HOOA 1B9NA 3FHZA 5ILSA 4WCGA 4BHPA 1S7OA 4KN7X 1D5VA 2A61A 4MQVA 2P4WA 3W6JB 4YG2F 2VE9A 2M5WA 4EJUA 3WGGA 4ESBA 2IW5A 4R1HA 3P7NA 2VE8A 2HQNA 1ON2A 4I2OA 1YW9A 1H0MA 3GWZA 1GXPA 1RNLA 5HS7A 2PFBA 1TTYA 3F8CA 4LLNA 4Q4ZF 1SD4A 4Q5SF 1IUYA 1XGSA 2JPBA 3DV8A 1T0FA 4HOBA 3RKYA 1WRJA 5J6XA 2MH9A 2ZMEB 3T8TA 2A68F 4YFKF 3I71A 5CYVA 1H9GA 3ELKA 3F22A 1W7PA 3G73A 3HRSA 2A3SA 3HOTA 1J2XA 1FWZA 4M73A 5HDNA 1IRGA 5AONA 4YFXF 2G7UA 3RKWA 3IHUA 3M8FA 5LBQA 3M7GA 4LG0B 4OIRF 4OIPF 5LRSA 5KVRA 4OINF 3GFIA 1ZRFA 2L3DA 3LAJA 4M72A 4RGRA 1S6LA 5J8FA 1BIAA 3FWEA 4L9TA 2DPUA 3KLNA 4P55A 2COMA 3GO5A 2VBZA 1VTNC 1DUXC 4XSZF 1WKMA 2VOOA 4HQEA 3G3ZA 1JHHA 1Z7UA 2V1UA 1WSUA 2BBYA 2WC2A 3NRVA 5CVIA 4RGXA 4O5VA 5E8IA 5JHUA 1TBXA 1D8JA 3WU0A 4FX0A 1R36A 2HDCA 1Z05A 2E1CA 1ZLJA 4KT5C 2HWVA 4I0AA 1R23A 2PEXA 3C1DA 1T6SA 3K1PA 1E17A 1KQ9A 3PQKA 1LEBA 3S2WA 5H6RA 2EWNA 4RGUA 5ILUA 2W24A 1R58A 4MHGA 3TDUC 4EJVA 3J81K 1ZLKA 2WV0A 3WTXC 1LVAA 2YPRA 2X4HA 5H20A 2PBIA 3HRTA 1QGPA 3K1MA 2DQRA 4HLYA 3J81Z 1S3JA 4TV7A 1KU3A 4MTEA 4CICA 2FBKA 5E1WA 3F23A 4KN4X 1WWXA 3R0JA 1MDMB 3L9FA 2RN7A 1FP1D 2Z3YA 3FMSA 4WX9A 5FLXK 2OZ6A 1QZZA 4CGZA 3ZPLA 3T0YA 1ZG3A 4KMFA 2DK5A 5DD4A 2D45A 1T38A 1SMTA 3JW4A 4HF0A 2HOEA 1ON1A 3SQNA 4AVPA 1YIOA 5CVJA 3HSRA 3CUQC 5ED4A 5JI6A 1XDSA 3F72A 3ZN1A 3LAPA 1J59A 3RI4A 1ZYRF 3V8LA 2A69F 1X3UA 1STZA 2CG4A 1AWCA 2C6YA 2FNAA 2P8TA 4L5JA 1I27A 1YS6A 3WG9A 2FRHA 1ODDA 1ZG5A 5HS9A 3CTAA 3H3ZA 5EEGA 1D3YA 2XVCA 1K78A 1ZGAA 3KP4A 3TO6A 1EH7A 3TDZC 1MZBA 3MZYA 3BJ6A 4IPAA 2GAUA 1IN6A 3L2CA 3HOSA 1B4AA 3ULQB 3CO6C 1P92A 1TQIA 1Z6TA 2MA3A 1USSA 2XAGA 1RIOH 4UHTA 3T8RA 3HIFA 4PCQA 4PZJA 2EB7A 3P9CA 2IA0A 3IWZA 4EVIA 2JPCA 6PAXA 4LK1F 5HS8A 1F4KA 4N9IA 3D0SA 1BC8C 2CWEA 4P9FA 3FM5A 3K69A 3WTYC 1UB9A 4AIJA 3RIRA 1P6RA 2DT5A 5BMZA 1K78B 3J7AO 1KU7A 2NNNA 5FD5A 3KEQA 4HX4A 4CHUA 3FF5A 3WE3A 1ZRCA 1DDNA 1KYWA 4HAMA 4RS8A 4PGHA 4LJZF 4NQWA 2RNJA 5FGMA 2EA2A 3T5XA 3DKWA 3LSTA 2Z5UA 4IHTA 1D8KA 1HBXG 2V9VA 2ISYA 1L3LA 3W6KB 2H27A 3KLOA 1R1TA 1XGMA 3BZ6A 4NB5A 5J8CA 4HQMA 2XAJA 1U2WA 2ZNZA 2EV6A 3K1NA 3WTVC 2KJCA 2KIFA 2DW4A 2A6HF 3QU6A 5E1ZB 2CYYA 2EFQA 3OOPA 1U78A 3WTUC 2J5OA 1U5TB 2M1BA 4KIGA 4HYEA 1XSXA 3R0AA 4N0BA 2O6GE 2DLLA 1KU9A 1OPCA 5D8KB 2RVCA 2YR2A 4RGSA 1HKTA 3L00A 1YLFA 4FHTA 1G3YA 4U0YA 4G6DA 2ETHA 4EQQA 1P4XA 4I7HA 3C18A 2VT2A 2F5EA 1REPC 3NQOA 2MLGA 2P5VA 2MH2A 2OQRA 3QPHA 2HS5A 3RTRA 4EJTA 3I58A 1O7LA 2FA5A 4M74A 2GWRA 4XSXF 4HLXA 4HF2A 5BOXA 2RDPA 3RDIA 3Q9VA 3EYIA 5DCMB 4L9NA 1IZ1A 4XRFA 1O7FA 4U0VA 1IW7F 2JSCA 3LA7A 5FFZA 3TKYA 3RPUA 4EM0B 3BJAA 4M6XA 1IN8A 3P9KA 3EQLF 3WGHA 2M87A 3IWFA 4GYGA 4UVCA 3GF2A 4XBFA 1YFHA 3SFZA 1YQAA 2M8EA 2L02A 2P7VB 2QQ9A 3CUQA 5AIPA 4GCVA 1XSVA 2W25A 1KQ8A 4I0BA 1BM9A 4HX7A 1BI0A 2K7LA 4I02A 2FMLA 1USTA 3WTWC 5L3BA 2FF4A 3ZMDA 3I59A 1G3WA 2FXAA 2HR3A 2XV4S 2UXNA 1F5TA 4ENNA 1BN5A 2WWYA 1RUNA 4ZYGA 1T98A 4HW0A 1V4RA 1IXRC 2XKPA 3V4GA 1BI1A 4BHCA 5FD6A 4GO1A 4G7ZF 1ULYA 2A5YB 2RV8A 5F1RA 2EFPA 2V79A 1K79A 1T39A 1FBQA 3GLXA 2G9WA 3WTSC 4QWQA 1FOKA 2XHKA 1EH6A 4BQAA 4UV8A 5D8LB 4F7ZA 3M1EA 3L7WA 1I1SA 1J5YA 2E7WA 5E20A 5EEHA 3M8EA 4A0XA 4HX8A 3KEOA 3BP8A 3WODF 2CO5A 3N97A 2H6BA 2DQLA 4A12A 1FZPB 1O3QA 3T1BA 5HLIA 2V1DA 4KA4A 3VODA 1F9NA 4R79A 1YG2A 2EV5A 2L4AA 5LGUA 4LGWA 1HW1A 3FZVA 3TQNA 1C0WA 5K5RA 3ERED 4EJWA 4IHSA 2NYXA 4I98B 2ZO4A 3CJNA 3QU3A 4BNCA 1TW3A 1OYWA 1ZGJA 5CJ9A 5E18F 1LNWA 3F21A 1GHCA 4JBAA 3IL2A 1P4WA 2HKXA 4ZYDA 2M45A 3I5UA 3BROA 3KE2A 1R1UA 3HHGA 4EV0A 2YSRA 1W7PB 4JK1X 3DFGA 2OD5A 1SFEA 2VXZA 2Y75A 3VEPA 4KIFA 4MTDA 4EJOA 3R61A 3LQRA 4GGGA 1J9IA 2CW0F 2O3FA 4A5NA 3H92A 1W5SA 1BJAA 5KK1A 4MEYF 1O3TA 4ETSA 1FYLA 4Y13A 1W4MA 4G94A 1HW5A 3B73A 4EGZA 2FOKA 1MGTA 5D6FA 2YU3A 1Z9CA 1SD6A 5H6QA 5E1XA 5D4RA 4HDVA 4DQ2A 2QBYA 3F3XA 1NHAA 1FNNA 1I1GA 1QBJA 1ZHFA 4ENMA 2L01A 3QOPA 5LGTA 1MJAA 4D0PA 2QQAA 1LDKB 4M71A 2PMHA 2W85A 4A6EA 4K2EA 4HBLA 3QRFF 4ZZDA 2Q2EA 3J80K 3RKXA 2XRNA 1EH8A 1FSEA 4RAZA 4I01A 3E6BA 3J80Z 3CO7C 1SD5A 1L0OC 4CYDA 1YS7A 3R6SA 4LFUA 5CVVA 4IRGA 2Q0OA 4ENKA 3DP7A 3F8FA 2H6CA 3V8JA 3IRQA 4QLCU 1FBSA 4KICA 5CVUA 3DPLC 4XLNF 3ZMUA 2IPQX 3BPXA 2OU2A 5ICFA 2Y0MA 4B09A 3EDPA 2ISZA 2JZYA 3QP6A 3E6DA 4LB5A 1UHMA 1G3SA 2PJPA 4G7OF 2UWMA 1CGPA 3U9GA 2EFWA 2F5DA 1UCRA 3DXJF 4OU0A 5F64A 2RQPA 3C7JA 3MQ0A 1LEAA 2EFOA 1LDDA 3E5XA 1R7JA 2D2WA 3GXOA