4BHCA

Crystal structure of the m. tuberculosis o6-methylguanine methyltransferase r37l variant
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
165
structure length
165
Chain Sequence
b'MVHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSLTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALLELEKSRAPADLTLFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLATED-DNA--PROTEIN-CYSTEINE METHYLTRANSFERASE
publication title Biochemical and Structural Studies on the M. Tuberculosis O6-Methylguanine Methyltransferase and Mutated Variants.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 40
structure length 165
sequence length 165
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4bhcA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4bhcA01
2X4HA 1I5ZA 2Q2EA 3MWMA 4U7BA 5BPIA 4LMYA 1J5YA 3R6SA 2V1DA 4RGXA 4JK1X 3W6JB 3W6KB 4IHSA 3GFLA 1JXSA 1OR7A 1J59A 4KN7X 2EFOA 2X0LA 4KIGA 2XAFA 3GZ6A 3GWZA 2VC1A 4ZYEA 4AD9A 2Z3YA 2M5WA 3LQRA 3HRTA 5CVUA 3LQQA 2A07F 1MJ9A 2FRHA 1KQ9A 1R7JA 2LNBA 1ZREA 2FE3A 2CSOA 2DK5A 4LLGF 4EM0B 1W7PD 2D2WA 3DV8A 3MFKA 4L5IA 2IJLA 1SMYF 5JHUA 3JTGA 4G7ZF 2VOOA 3HSFA 4HV5A 4S04A 4KN4X 4EJVA 2XASA 2DU9A 3DPLC 2ZO4A 4H0EA 3JTHA 4RGSA 1Z91A 3PFIA 1DPRA 1EH6A 3IC7A 3T1BA 4A0ZA 2EA4A 3ML6A 2Z99A 3KEQA 3TO9A 1OPCA 5K5OA 3FXRA 4YFKF 1ZRDA 2VBXA 2L4AA 2OA4A 3ABTA 5E20A 2P5KA 1HSTA 2FMLA 3MZYA 4RB2C 3KP2A 3RPUA 4L18B 4OIPF 2A68F 3G73A 5FLXK 4M72A 5HS7A 4PZJA 4EV0A 4HOBA 4KUMA 5JR3A 2FQ3A 1K78A 2EFQA 1Z6TA 2DK8A 2L02A 3TQNA 1USSA 5D5WB 2V6CA 4Y17A 2A6HF 3E97A 2NNYA 2HTSA 3WTTC 1V3FA 1SMTA 3F8MA 4BXUA 2Z5UA 2FOKA 4UUVA 2GZWA 2RVCA 1IN4A 4UVBA 2F5FA 3JW4A 5K5QA 2F5DA 2D45A 2EJRA 4FX4A 3QP6A 1B4AA 3GFJA 1ZAOA 1HSJA 3DQVC 2NYXA 3QAHA 3KZYA 5LHGA 1XGOA 3CUQB 4ETSA 2B0LA 3U2RA 1UB9A 1J75A 4LGWA 1W4MA 4IRIA 2XROA 4LJZF 3GLXA 2RV8A 2DPDA 3M7GA 4KICA 3CO7C 4E70A 3VFZA 4YG2F 4NB5A 1ZG5A 2ACJA 3BY6A 3GXOA 1MJAA 1RI7A 5D4RA 1B6AA 2DFIA 1YS7A 3EDPA 3RYPA 2BE5F 5D5UB 1J2XA 3CUOA 4MQ9F 2XHKA 1BM9A 4FHTA 2STWA 3DKWA 4I98B 2YPRA 2EFNA 3V7RA 2A69F 3D5LA 3GX4X 5A2QZ 2ZNYA 1FPQA 4AWXB 5LGUA 4BHBA 3R61A 4BQAA 1E17A 2DI3A 1OYYA 1JHFA 3HSEA 3RTRA 3MEXA 1P2FA 2XAHA 3V4GA 1QGPA 1CGPA 4PDKA 3VB2A 3ZMSA 2KIFA 2O6GE 4ENMA 3IKVA 3HRSA 2V1UA 2XGXA 3P9KA 4LB6B 2AS5F 2OZUA 1LEAA 3LWFA 1YW7A 2JSCA 5FFZA 1D5VA 2EV6A 4UXNA 4IHTA 2LKPA 2Y75A 4M74A 2V79A 2P5VA 1WI9A 2UWMA 4GO1A 1YO5C 2PG4A 1UHMA 1FSEA 4KMUX 1E2XA 1J9IA 1WWXA 4IRGA 3RIRA 1U5TB 3QU3A 2LSOA 1ON2A 1LB2A 3LA3A 3WGIA 4LG0B 4RS8A 4QLCU 1MD0A 3QRFF 2MLKA 1BI1A 3BPXA 3H3UA 1D8JA 2JRTA 3F8BA 5CVIA 4U0YA 2RN7A 3RPQA 5KVRA 1O3SA 3K2ZA 4QWQA 1IN8A 3SHFA 1LNWA 1TTYA 1ZRFA 2BEOA 4LK0F 4ZZLA 1QPMA 1YW8A 2AXLA 5DDGA 5KK1A 1D8KA 3SZTA 1F4KA 4G7HF 2O0YA 1X3UA 2IW5A 1XGSA 2EK5A 2ZJ2A 1C0WA 3JSOA 1IW7F 2EFWA 3K1PA 2KJCA 4CYDA 3ZMZA 1REPC 2W24A 3VODA 2EWNA 2BYVE 2OAZA 5L3EA 5H6QA 2KRFA 3FM3A 1WRJA 1H9TA 3NQOA 4WF2A 2JZYA 2QUFA 1QZZA 2MA3A 2ADUA 5HDNA 3KLOA 1PDNC 5FO5A 1ZLKA 1PUEE 1YYVA 2RQPA 4RGRA 2HYFA 1EH7A 4B8XA 3RYRA 2HGCA 1FYLA 1FOKA 3BJAA 1FX7A 2DAOA 1K79A 5BMZA 1T38A 4OINF 1R5GA 4ENKA 3C18A 4AIJA 4RGUA 4AIHA 2CG4A 1B9MA 1ZH5A 1P4AA 3EQLF 4L0YB 4ZYDA 3V7SA 2PI0A 1KU9A 1V4RA 1O3RA 2EA2A 4FX0A 1SFUA 3WE2A 3T8RA 1WQ2A 1DPUA 2D1HA 3DXJF 5D4SA 2F5EA 4MTEA 2HS5A 3I59B 1S7OA 2RC4A 5CVVA 4S05A 1S29A 4GYIA 4O5VA 1XDSA 2XKOA 3BP8A 4MGRA 4P9UA 1BJAA 2QENA 4L9TA 1GXQA 3WTYC 4PGHA 2P5LC 1FZPB 1P4XA 1R23A 5L3CA 4IPAA 1QQIA 3DFGA 4Q5SF 2PEXA 1L0OC 3BJOA 3IWFA 5HVQC 5FD6A 3IRRA 2CQKA 4I0BA 3E5UA 5L3DA 3TGNA 3JAMK 2M8EA 4IF4A 2K27A 3U1DA 4A6DA 5DUIA 1R1TA 4MTDA 1O3QA 3M9AA 2CO5A 1CF7B 2QLZA 2VN2A 1EH8A 4HX7A 3FF5A 2IA2A 1MJBA 2ELHA 3I64A 4HQMA 2BBYA 1GXPA 2COMA 5DD4A 1ZG3A 4B09A 3SFZA 1SD7A 4HDVA 3LSTA 3P9IA 2FBHA 4XLNF 1VTNC 4I2OA 3WTWC 1KU2A 1U8RA 3GEZA 4Z2YA 3IRQA 3F8CA 1QO0D 1HXDA 1XDUA 2HDCA 2UXNA 3HOSA 4RB1A 2A3SA 3CDHA 3F72A 4OIOF 3V8JA 3C1DA 3CO6C 2LF7A 5FB2A 3HSRA 3J80K 5CLSA 1UCRA 4PGGA 1QNTA 1IF1A 1S6LA 3P7NA 2R3SA 2W25A 3ZP5A 1XGNA 2XKPA 2IA1A 3FMSA 4CZZA 1FBQA 2MH9A 2UXXA 2WWYA 1T6SA 2PMHA 4EJUA 1W5TA 2CYYA 3LA7A 5D6EA 3WTVC 5BS6A 1UFMA 3WG9A 4YFNF 1S3JA 3F8FA 2E1NA 2A61A 1ON1A 3D0SA 1F9NA 3QOPA 1U78A 3ZMVA 4IXAA 4M9SA 1G3SA 1K7AA 4WX9A 1T98A 4CO8A 3KCCA 4L9JA 4HYEA 4MQVA 1ZRCA 1XB4A 2QYOA 2P6TA 5ILSA 5J8CA 5DEQA 5L3GA 4GGGA 2JPCA 4HW0A 2IRFG 5ERIA 1TNTA 1Q1HA 1KQ8A 4KDPA 3HOTA 2W84A 2DQLA 3FZVA 3GYHX 4M6YA 3KP5A 3KP4A 3WGGA 3T0YA 1ZGAA 5DV5A 1JGSA 4L5JA 2ZNZA 2P8TA 1MZBA 2HWVA 3MQ0A 3EYYA 4Q48A 2EV0A 1ZGJA 3K9TA 1KU3A 2MC3A 5DUKA 4XSXF 2OU2A 4ON0A 4NQWA 2VOPA 3NRVA 2KKOA 2IPQX 5BQTA 3ZN1A 1BBYA 5ILVA 3JSPA 2HYGD 2JTVA 1XCBA 2QZ8A 4HF1A 1O3TA 1A04A 1F1ZA 5IT9Z 3ZMDA 3G3ZA 4XSZF 5DCFA 1XSXA 2YR2A 1K78B 2VBZA 4O3MA 3E5XA 2VT2A 4OU0A 1P4WA 1WSUA 3FXUA 5HOOA 4ENNA 3GF2A 5ICFA 1FYKA 2FA5A 2P7VB 5D5XB 1HQCA 3FMRA 1RZ4A 1ZLJA 4EJTA 4O6JA 3ROUA 4YFXF 1ZN2A 3WTXC 4FT8A 3TDUC 2VODA 1BOAA 3IL2A 5LGTA 3WTUC 3WTZA 4CDGA 2GIVA 1B59A 4BNCA 4ESJA 1K6OA 4OOIA 1U6GA 3M1EA 1BN5A 2IT0A 1SD4A 4A5MA 3KE2A 1YFHA 1STZA 1XN7A 3H92A 1IRFA 1KU7A 2FBIA 4EJWA 4LK1F 2FEZA 1B9NA 3HTUA 3HHHA 3K1NA 3N97A 1O57A 4ESFA 4KFCA 4WXCA 3F8NA 2GQQA 4G8XA 3N4MA 4LLLA 2RKHA 3ERED 2HKXA 2E7XA 3M8EA 5H20A 2HKOA 4HZFA 4OMYA 3I71A 2ESNA 4LG0A 4KNYA 5ICEA 1TLHB 3I54A 2D1VA 4WXDA 2FF4A 2E1CA 1LVAA 3E3VA 2DW4A 3J81Z 2UZKA 4UV9A 4WK8F 2V1XA 3GFIA 3IKTA 3L00A 3BZ6A 1MGTA 3KLNA 3O3KA 2GWRA 3T5XA 2H6BA 4KIBA 3WE3A 2BV6A 2FNAA 3R4KA 1XSDA 3F6VA 4MHGA 1KQ0A 3J7AO 3ABUA 2K4JA 4WCGA 4UVCA 3FX3A 2ZXJA 4I02A 4U88A 1TW2A 1U2WA 3HTSB 2IP2A 1J7KA 3KFWX 4Q4ZF 5K5RA 1RNLA 2P7CB 1HW2A 1BI2A 5HDGA 3KZZA 2XAGA 4XRFA 4HQEA 3ECHA 3WGHA 4L9VA 2YU3A 5IT3A 2H27A 2HR3A 2DPUA 5CVJA 3L09A 1WKMA 2VONA 3BOQA 4BAYA 3HUGA 3IHUA 1T39A 5J6XA 1FBUA 1HW1A 2Y48A 3FHZA 4RB0A 4XBFA 1BIAA 2GXGA 5AONA 3E6DA 2XV4S 2DBBA 4OIQF 1DDNA 4D0PA 2R7DA 3E6BA 3Q9SA 2FNPA 2Q8KA 5A2QK 3M8FA 4ZH4F 3QP5A 2GAUA 1IN6A 2NAZA 1UHWA 4I7HA 1W7PB 3I59A 1QBJA 2RNJA 1HKTA 2HQRA 4ZZDA 2ZCWA 4GYGA 1MDMB 1Z9CA 1ZG1A 3SQNA 4A0YA 4AIKA 1I27A 2P4WA 2PMUA 3R0JA 4G6DA 4R1HA 5D5VB 2ETHA 2OBPA 3ZMTA 2ZMEB 2GA2A 1KYWA 5JFRA 3DEUA 2O61A 2K4BA 1DP7P 1LQ1A 2YX7A 2GA1A 2H94A 1G3WA 1XMKA 3U9GA 1T0FA 4RAZA 2J5PA 4ZYHA 3OOPA 1G3TA 1FNNA 4HX4A 5E8GA 2R7FA 1S7AA 2M30A 1CF7A 2PJPA 2DT5A 4LD5A 3ZN0A 4UVAA 5ICGA 5BPDA 3GZ5A 3BJ6A 3RDIA 1ONVA 4CXFA 1OMIA 3ELKA 3R60A 4Q47A 5FLXZ 3P9CA 4IRHA 4P55A 2M1BA 1YQAA 5LEKA 2O3FA 2FSWA 4MNUA 3T8TA 4L0ZB 4Y13A 1KYZA 2XVCA 4UV8A 4MEYF 1ZHFA 2L4MA 4BHCA 1XMAA 3KP6A 3GVAA 1IAWA 4Y15A 2BGCA 1FWZA 2VBWA 4HX8A 3VEPA 5J8FA 3TO6A 2XAQA 5DCMB 3F6OA 2QBYB 2HEOA 1HKQA 2FXAA 5LBQA 3RJPA 1GVJA 1B1BA 3KEOA 4GXOA 2QQBA 3AAFA 2IA0A 1YTYA 3F22A 1I1SA 1HW5A 5AIPA 5L3BA 3HRUA 3K1MA 1TQPA 2W57A 5EEGA 1J0RA 3ECOA 3SXYA 3I58A 1BI0A 1SAXA 4KIFA 1JE8A 3TO7A 4LLNA 2ISYA 5LRRA 3LA2A 1PP8F 4A0XA 1SFXA 1FT9A 4DQ2A 3FM5A 1EV7A 5ILUA 2H09A 1IUYA 1H0MA 3PQKA 2VT3A 2XRNA 5D8LB 1I6XA 3K0LA 3V8KA 1TBXA 1TW3A 3I5UA 5HLIA 2QVOA 3DP7A 3B73A 1YS6A 5FFXA 2EV5A 4AVPA 1BC8C 1OKRA 3HYIA 4EVIA 1LEBA 5LHHA 4CHUA 5E1ZB 4P9FA 1MKMA 2PN6A 4UHTA 2VC0A 5CYVA 1G3YA 1JHHA 3CLOA 4EJOA 4K2EA 2CFXA 3E5QA 5DYMA 3MCZA 2DTRA 3BWGA 4TV7A 3ZMUA 3F3XA 2QM3A 4L9NA 2O03A 3EYIA 4OIRF 5E17F 2OQGA 2ESHA 1LDJA 3C7JA 5D6FA 2G7HA 2YSRA 4R79A 2OZ6A 4XLPF 2L01A 5K1YA 3CUQA 3RKXA 1ZYRF 3MAJA 1F5TA 5LGNA 2XIGA 4JQFA 5HS9A 1XCVA 4WWCA 3CTAA 4M9ZA 2K02A 1R1UA 1S8NA 4HAMA 1O7LA 4LB5A 1D3YA 5LRSA 3R0AA 4U0WA 2OD5A 4ZYGA 4YIFA 1Z1DA 3BPVA 3KP3A 2HZTA 3WU1B 2Q0OA 3WU0A 3FMQA 4R8HA 1H9GA 4HLXA 2JT1A 4ESBA 1SD6A 2E7WA 5LHIA 3TOAA 2PLYA 5DD8A 5EEHA 4YIIA 1IN5A 3GO5A 3V8LA 3LAPA 3COAC 2G9WA 2W85A 1FY7A 2M87A 1AWCA 1R36A 2QWWA 1R5HA 1RUOA 4IVNA 5HLHA 5JI6A 1RIOH 4G9YA 3QPHA 4EGYA 4HDUA 1GHCA 2L54A 1BI3A 2LDUA 1G4DA 4LFUA 2QQ9A 3EUHA 5F6FA 2RGVA 3F21A 3PQJA 2VE8A 1FC3A 2DO7A 3I4PA 1KA8A 1LDDA 5HDKA 3TKYA 1Y0UA 2M45A 4MEXF 3TOBA 1XSVA 4CGZA 4HLYA 2NRAC 3HHGA 4ENJA 2A6EF 1NHAA 1OYWA 2VBYA 2K7LA 1AOYA 5E8IA 1G6NA 1FP1D 3QU6A 3BDDA 1HKSA 3HRMA 3FWEA 5FD5A 2FMYA 1SFEA 2PFBA 4EGZA 5E18F 1P6RA 1SD5A 1U5TA 1ULYA 2STTA 1FSHA 1W5SA 4NHJA 3NEUA 3L7WA 2Y0MA 1FYMA 2F5CA 1IXSB 3RKWA 4UNOA 4RAYA 1U3EM 1FP2A 3RKYA 4G6QA 4ASNA 5TRDA 4HA8A 2YX4A 4M73A 2KIMA 3GW2A 4F7ZA 2VE9A 3KP7A 2HFHA 2ZBKA 2FU4A 3QPTA 3S2WA 3OV8A 4HF2A 5H6RA 3FXQA 1P92A 3HIFA 4HF0A 2PBIA 2DQRA 5ICCA 1ODDA 2P6SA 2HTJA 3E6MA 4BH9A 5IT9K 2DLLA 5CVRA 5E1XA 4BYYA 3GFMA 1Z6RA 5E1WA 2V9VA 4P96A 1RUNA 4KYWA 1T2KA 3CUQC 3ZQ7A 4HV6A 2JPBA 5HS8A 3E6CC 4DNCA 4U7DA 2CGPA 4BHPA 1ZARA 3BROA 1IZ1A 1YLFA 2MD5A 3I0TA 3JAMZ 1TNSA 4WXHA 1W7PA 4EM2A 3L9FA 2XUBA 2EFPA 2J5OA 1Z7UA 1TQIA 2TDXA 3RI4A 1MDMA 4M6XA 1IN7A 1LJ9A 1R58A 5TJJA 4G7OF 1USTA 1YW9A 4M9XA 1KGSA 5LLQA 1IRGA 3SZPA 5CJ9A 6PAXA 2EB7A 2RDPA 3LAJA 3ZPLA 3B02A 2ZMEA 4KA4A 4KMFA 5L3FA 4GCVA 3EETA 3TDZC 1IXCA 2CWEA 2G7UA 3DPTA 2ZKZA 2WV0A 4OMZA 1QZYA 3K69A 1HBXG 2F2EA 3DF8A 4I0AA 5BOXA 2A5YB 2C6YA 1L3LA 2WC2A 2HOEA 3J80Z 3F23A 4HBLA 2MH2A 3V7CA 1FBSA 2ISZA 3Q5FA 1O7FA 1TQMA 4N0BA 2PQ8A 2IVMA 3LFKA 2QQAA 2LF8A 3O6BB 1FLIA 2CW0F 3C3WA 2MLGA 4JBAA 2XAJA 1I1GA 4N9IA 5D8KB 3MZHA 4PCQA 3J81K 2FBKA 3IWZA 4G94A 2WTEA 3GUDA 2NNNA 4RB3C 2H6CA 5F1RA 5LEJA 4EM1A 3REOA 4CICA 3I53A 2OQRA 4KT5C 4N9HA 5JVTA 3O2PE 2MBFA 2Z9OA 3CJNA 4A12A 3L2CA 3Q9VA 5DCMA 1OYIA 2ZFWA 2HQNA 1YIOA 4M71A 4A2UA 2VXZA 3WODF 2QBYA 1U5TC 3H3ZA 3WTSC 1BIBA 4A6EA 4EMSA 4I01A 4P5OA 3ISPA 5FGMA 1R1VA 4A5NA 3KETA 2L3DA 3ULQB 1R22A 5AIQA 1PP7U 4U0VA 2NS0A 1YG2A 2KJBA 4I09A 1XD7A 2Z33A 5F64A 5HLGA 1R00A 1IXRC 4EQQA 3VOEA 2O8XA 2KIUA 2K86A 2GXBA 4IJAA 1Z05A 5ED4A 1BC7C 1DUXC 1XGMA 1LDKB
chains in the Genus database with same CATH superfamily
2X4HA 2ZM6E 1I5ZA 2EPAA 1X1BA 2Q2EA 3IH3A 4A3KJ 1BL0A 3JRFA 2V7FA 2LH9A 3MWMA 5IWAE 3DBHB 1WH5A 5TGTA 1A1HA 4U7BA 1XPXA 5HLTA 3K4KA 1VF9A 5BPIA 4W1UA 1FIPA 2BHYA 4OWRB 2VJ5A 4LMYA 1J5YA 3R6SA 3I4NJ 2LTPA 4D9JA 2V1DA 4RGXA 5IP9J 4JK1X 3BR3A 3CZ6A 3D5RC 2VPRA 3W6JB 3F0CA 2ZJPF 2IHR1 3BZCA 3W6KB 5KAIC 5EEAA 4IHSA 3GFLA 1JXSA 1OR7A 1J59A 4XNFA 1ZR4A 1SC7A 1NCSA 4KN7X 2EFOA 2X0LA 3DTEA 4DUYE 1T33A 4KIGA 3RZOJ 4G12A 3PO3J 2XAFA 3CP8A 2EMHA 3GZ6A 2F48A 3GWZA 2VC1A 4ZYEA 4AD9A 2V88A 3DCFA 3G1LA 2VKVA 1FJGE 1B72A 2Z3YA 2LREA 2M5WA 3LQRA 4ITVA 2HJJA 2M4IA 3MHHC 3HRTA 4BQNA 5CVUA 2V87A 2DDBA 3LQQA 2A07F 2N8GA 1N75A 1MJ9A 2FRHA 1KQ9A 1ITYA 2DJIA 2EOJA 1TT0A 4M3EA 1R7JA 2LVSA 2CMPA 2LNBA 3IP4B 1ZREA 1X1DA 5GPAA 4FETA 4YHHE 4M3DA 3HPZA 2E1MC 2EBIA 2CSOA 2FE3A 2DK5A 1Y1WJ 4LLGF 1MMNA 4M3BA 2FJ1A 1Y8RB 4J8ZA 3HOVJ 2D5VA 5FLVA 2FQ4A 4EM0B 1W7PD 1B8IB 2CRGA 4C30A 2VJJA 3FXLA 4AYBN 1NK3P 2D2WA 3IAM2 3DV8A 3MFKA 4L5IA 1M1EB 2IJLA 3JR9A 1SMYF 5JHUA 2DODA 3JTGA 4G7ZF 1UZCA 1V55H 3HSFA 3LMMA 4HPQA 4HV5A 4XKCA 2VOOA 2HGHA 4I6ZA 2Y2ZA 4DIQA 2LD5A 4R2CA 3BG3A 1TWFJ 4S04A 4KN4X 4EJVA 1ZTRA 2XASA 4DR6E 4BXFA 1XMQE 2DU9A 2M9AA 2K9MA 1OCRH 1PYVA 3PUBA 3DPLC 3PSIA 5IPAA 2ZO4A 5GAGJ 1IBKE 1JTXA 4H0EA 2DA7A 3JTHA 1X19A 1PUFA 4RGSA 3BGHA 1Z91A 1XNRE 2N3GA 3PFIA 1DPRA 2BOLA 4BJTA 3LSHA 2LJUA 1EH6A 3DF6A 1YYWA 3IC7A 1JKPC 3BG6A 3T1BA 4A0ZA 2EA4A 3CCVI 3OYGA 3ML6A 2Z99A 3KEQA 4PJLA 1FIAA 3TO9A 1OPCA 2CW7A 2JVHA 3O8HA 2L7FP 3FXRA 5K5OA 4B3SE 3PIPF 4YFKF 1MNMC 1X6FA 5F04A 3W2WA 3DEEA 2VBXA 4XONA 1ZRDA 4DR5E 2L4AA 2OA4A 3ABTA 2DIXA 5E20A 2P5KA 1HSTA 2FMLA 3MZYA 2L33A 4X9JA 2XPUA 3NAUA 4RB2C 3KP2A 4NXME 5H2FC 2HOAA 3RPUA 3JRHA 4L18B 4NZVA 4OIPF 2A68F 3G73A 4CCNA 1RKTA 5FLXK 2L2KB 3SEZA 2LFBA 1IC8A 4M72A 3S1QJ 1GZ6A 5HS7A 3FDYA 1MMGA 1OFCX 4PZJA 2IS6A 3HBLA 1YJWI 4EV0A 2MC5A 4HOBA 4KUMA 3AKZA 5JR3A 2FQ3A 1K78A 2NS8A 2EFQA 2YTJA 2EM3A 2CQQA 1Z6TA 1VZ0A 1A6QA 2DK8A 1T0FC 4CCOA 3BLYA 1DP3A 4FE4A 2EL5A 3EPZA 2E5NA 2L02A 2EL6A 3TQNA 3W2VA 1USSA 5D5WB 2LMZA 4JX5A 3OYHA 2DCEA 2DMUA 2V6CA 4Y17A 3RQIA 3DLLF 2A6HF 3E97A 2QA4I 4BE0A 5EDNA 2NNYA 3BTIA 2YTDA 1EKZA 2HTSA 3K4BA 3WTTC 1WCMJ 3CCJI 1V3FA 1PJQA 3KYDB 1N33E 1SMTA 2VASA 1UMQA 3CCQI 4MO7A 4RAGA 1BBOA 3F8MA 4BXUA 2Z5UA 2DA5A 1GQEA 3AG2H 3RKQA 4BUPA 2EM9A 4B4CA 5F3WA 2DGCA 4LF4E 3S8PA 1GT0C 4R2DA 2V83A 2FOKA 3AV0A 2W4SA 1SVMA 4ANJA 3K4JA 2CQXA 4UUVA 3PM1A 2GZWA 2RVCA 1IN4A 5IT9C 2YTGA 4UVBA 4JV5E 2E5ZA 3OYLA 4AM3A 1XTAA 2F5FA 3JW4A 2EMZA 3J7ZI 1GV2A 3J7Yp 5K5QA 2F5DA 2YPNA 1H8AC 1WFXA 2D45A 1MEYC 4BQQA 3ZQLA 1X4PA 4BY7J 2E60A 2EJRA 4CH7A 3QP6A 4FX4A 1B4AA 3GFJA 1ZAOA 2EMYA 5JHFA 5FRNA 1HSJA 3DQVC 2NYXA 3QAHA 5EF6A 1IMUA 3KZYA 5LHGA 1DGCA 1YX5A 1XGOA 3CUQB 4ETSA 2JA2A 2DLQA 4F9CB 2EQ1A 5C4JJ 3AL0B 4DR3E 2B0LA 1TF6A 3ZQIA 4GEQB 2YUSA 2CSHA 3U2RA 2G0EA 1UB9A 1K4SA 4A3CJ 1J75A 1VQ6I 4LGWA 5CFFE 1W4MA 4DZPA 2IS2A 3OR1C 4IRIA 3PO2J 2XROA 1D1AA 3MD2A 5KL2A 4LJZF 3GLXA 4R8OA 2LBSB 2RV8A 3OMYA 2DPDA 1BR2A 3M7GA 3F6GA 4KICA 2CUEA 2VQGA 3CO7C 3FXOA 1ERDA 4E70A 3VFZA 1JJ6C 4YG2F 2EINH 1UILA 4NB5A 1X2NA 2KISA 3HGGA 5EG0B 1ZG5A 5KAFC 2ACJA 3BY6A 3S32A 3BBGA 3GXOA 1MJAA 3LSRA 1RI7A 2ZC2A 5D4RA 1R49A 1B6AA 4UB8C 1VQ5I 2GBYA 3H3VK 5IP6A 3CF2A 2DFIA 4RMNA 4R2AA 1YS7A 3EDPA 3RYPA 2BE5F 2IS1A 1WGXA 1Y0NA 2AQEA 3PNVA 4NUBA 4F55A 1J2XA 2XB0X 5D5UB 3CUOA 3GTMJ 4WYQB 2JUCA 3GBGA 4MQ9F 2XHKA 3TW6A 1BM9A 4FHTA 2STWA 4O43A 3DKWA 4I98B 2YPRA 1FOXA 2EFNA 4E7KA 4JX6A 2K5CA 1WJCA 2QGUA 3V7RA 2A69F 3JRBA 4LG3A 1VFCA 2RAEA 4NC6A 1I39A 1J5EE 3D5LA 3DU6A 3GX4X 5A2QZ 1ZGWA 2JSPA 2KP6A 2ZNYA 1FPQA 1ENHA 4PJ0C 4AWXB 5LGUA 2H36X 1SFKA 2R7RA 5IYCJ 1U0JA 4BHBA 1MBHA 3R61A 2FOWA 1GDTA 4BQAA 1E17A 2DI3A 5J1YA 1OYYA 1D1BA 4JI1E 1JHFA 2M9HA 3HSEA 2R76A 1DGRM 3RTRA 4JI3E 4R2EA 1V5EA 3MEXA 1P2FA 5FKLA 2XAHA 1F36A 1VQMI 3V4GA 1QGPA 1FTZA 1CGPA 3LNQA 4PDKA 2PJRB 3VB2A 3ZMSA 2HPIA 4LF8E 3K4MA 2KIFA 2Y9YA 5CPRB 3FXMA 2PMZA 2O6GE 4DW6A 2EN3A 4ENMA 4M30A 4AC0A 3IKVA 3HRSA 5BR8E 3VYYA 2V1UA 2XGXA 5AE1A 4LF6E 3P9KA 4LB6B 4F52A 4RAFA 2AS5F 3VSKA 1TT5B 2OZUA 4MLQA 5J3LA 2EN7A 2K85A 2EPOA 2VQLA 1LEAA 3SZGA 2ZXHA 4AVZA 1GLNA 3LWFA 2MC4A 5GAEJ 3E0JB 1YW7A 3L2QA 2E5LE 4BS9A 5M5XJ 5T6JA 3OIQA 2JYAA 4PSWA 1EJ9A 1WZ2A 2AO9A 3FXKA 2JSCA 2MSYA 3LSIA 3ZOQB 3J81C 2JPAA 2ENAA 1YUJA 5FFZA 1D5VA 2EV6A 4UXNA 4IHTA 3VYRB 2LKPA 4W97A 3DTIA 2Y75A 3BT9A 4IL6C 4E7SA 2QEXI 4XLCA 4M74A 2V79A 1R9TJ 2EQ3A 3HOZJ 4FISA 2P5VA 2VKDA 3ASOH 1WI9A 4M3GA 2UV1A 3WHBA 2VJIA 3LSJA 3BF2A 5KL5A 2F6CA 2UWMA 1OLTA 4GO1A 1A31A 2MDRA 1L4SA 1YO5C 4Y7NJ 1ETKA 3THNA 3CESA 2R92J 2PG4A 1UHMA 1FSEA 1NG6A 1POGA 2HNHA 4KMUX 1E2XA 1J9IA 2DJNA 1XC5A 2JK3A 3HPHA 1WWXA 4UUSA 1E0EA 5LFAA 5A6BA 2YTOA 1QU3A 4IRGA 3RIRA 1AKHA 2L7ZA 3HOUJ 2PRTA 4BDZA 4GRIA 1U5TB 2HQAA 3QU3A 2LSOA 1ON2A 1LB2A 5GP9A 1JUMA 3LA3A 3WGIA 3T1HE 4LG0B 3P1XA 4RS8A 4QLCU 3A01B 2PMZN 4M2ZA 1YZ9A 1WVRA 1MD0A 3QRFF 1UHSA 2DYSH 2MLKA 3L2RA 1BI1A 1RR7A 4DBQA 4RLQA 4XN3A 5EJCA 3BPXA 5GADJ 1P7IA 3H3UA 1D8JA 2LKXA 1N36E 2KLOA 2JRTA 3F8BA 5CVIA 4U0YA 3GTOJ 5B5EC 2RN7A 2XC7A 3RPQA 5KVRA 1O3SA 3K2ZA 1EA3A 3AG1H 4QWQA 1QHHD 3AG4H 2CV0A 2R7UA 1IN8A 4XORA 3SHFA 1LNWA 2MABA 1V54H 3PL8A 1BW6A 1TTYA 2DMNA 2BEOA 2F4OB 1ZRFA 2LLKA 3V42A 1VQ4I 4LK0F 3RQ4A 4ZZLA 1T4OA 4LITA 1QPMA 1YW8A 2AXLA 5DDGA 2K7IA 1TZLA 5KK1A 2EM2A 1MBGA 1D8KA 3SZTA 1RC9A 1F4KA 1YSAC 4G7HF 2NVXJ 2O0YA 2GHFA 1X3UA 2IW5A 3CCUI 1XGSA 2WBTA 2EK5A 2ZJ2A 3SYTA 3H5AA 1C0WA 1N34E 3JSOA 1IW7F 2EFWA 3K1PA 3TP3A 2X6WA 1EKEA 2KJCA 3C2BA 4CYDA 1N32E 2X6YA 3A0HC 2X6XA 3ZMZA 1HNZE 4XRMA 1REPC 1BJZA 2W24A 2X48A 3VODA 1VQ8I 2EMXA 5F0HA 4KISA 1BB8A 3EPHA 2EWNA 2BYVE 2OAZA 5L3EA 5H6QA 2KRFA 1ZU1A 3FM3A 2XB5A 1WRJA 3BG9A 4HSTA 1H9TA 2LTRA 3NQOA 4LFBE 4BXXJ 4WF2A 2JZYA 2QUFA 1JTYA 1QZZA 2LBFB 4YY3E 2MA3A 2ID6A 5DNYA 1T95A 2ADUA 5HDNA 2NVTJ 2K3PA 1QU6A 1A1KA 3PFYA 2R7ZJ 4R2PA 1YJNI 4AUXA 3KLOA 1PDNC 4A3IJ 2F4IA 5FO5A 1ZLKA 2RSIA 1UAAA 1PUEE 2HC5A 3HUGB 1YYVA 2CQ7A 2RQPA 4RGRA 2QSHX 1GV5A 2VKEA 2HYFA 3S3MA 3EUHC 1D1CA 3PUFA 1EH7A 4B8XA 3FKJA 3RYRA 2HGCA 1FYLA 1FOKA 1W1WE 3BJAA 4EEFG 2HDDA 2ME6A 2HI3A 2HPMA 3JU0A 2XRLA 1FX7A 4F93B 3JRIA 2DAOA 1K79A 1LFBA 2E1MB 4DV7E 2EQ0A 2WAQN 1MNDA 5BMZA 1T38A 4OINF 2HHHE 1R5GA 4ENKA 3C18A 1HLVA 1IJWC 4AIJA 2PX9A 1JI8A 4RGUA 4AIHA 1ETWA 4DV6E 1MBEA 2CG4A 1B9MA 3H35A 1ZH5A 4BL0B 1P4AA 3EQLF 4E6KG 1IRXA 2MD0A 4D5FA 4L0YB 2AQFA 2E1OA 4ZYDA 3V7SA 2EMLA 2PI0A 2EMBA 1KU9A 2KRHA 4LFAE 4NDLA 1V4RA 1O3RA 3OL4A 2EA2A 3H9JA 2RS7A 4FX0A 4AQYE 1SFUA 3WE2A 4HEA2 1WQ2A 3T8RA 2D1HA 3DXJF 5JLWA 1DPUA 2EOOA 3HM5A 5D4SA 1MIJA 2F5EA 4MTEA 2HS5A 2VB6A 3CQZJ 3K10A 4IHWA 3I59B 1S7OA 2RC4A 5CVVA 3GTQJ 2E35A 1VQ7I 4F2JC 4S05A 2R5ZA 1S29A 2NVQJ 3B6CA 2XPVA 3OS2A 2WCC3 4GYIA 2V4JC 4Y52J 1OISA 1X1PA 4O5VA 3OSFA 1XDSA 2XKOA 3BP8A 4MGRA 4P9UA 3OSGA 1BJAA 2QF7A 2W82A 2E2JJ 2QENA 4XLAA 2EMCA 5FLXC 4V2FA 4L9TA 2EM5A 3FXJA 2YZTA 1MSEC 1GXQA 4XRSA 2DA1A 4PGHA 3QYFA 3WTYC 2P5LC 4CCJA 1FZPB 3VHTB 3A4CA 3CJTB 1IBME 1P4XA 2YS9A 3ZXSA 4P78A 4A3EJ 1R23A 4CCKA 5K7HA 2VXDA 5L3CA 5E3MA 3PSFA 4IPAA 1UHZA 4M6VA 1QQIA 4JI6E 3DFGA 4FASD 5AE3A 4I76A 4Q5SF 5K7FA 2PEXA 3OMLA 1L0OC 1X1CA 3DU5A 3BJOA 3IWFA 1JT6A 3TP0A 5HVQC 4ZYAA 3K4LA 5FD6A 1ORKA 2EOSA 1IBLE 3IRRA 2ENHA 2CQKA 4I0BA 3E5UA 2CV1A 2LRSA 5IOZA 2VQHA 5L3DA 1LKXA 3TGNA 4RDUA 3JAMK 4AYBA 2M8EA 4IF4A 2K27A 3U1DA 4A6DA 4CYCA 4JYAE 2E2IJ 5DUIA 1R1TA 4MTDA 2YSPA 2UU9E 1O3QA 4RH8A 3M9AA 2XF5A 2V86A 2CO5A 1CF7B 2QLZA 2DOFA 1ZR9A 2VN2A 1EH8A 5J1UA 4HX7A 3CCSI 2CU7A 3FF5A 3PIOF 3A2KA 2IA2A 4BC9A 1MJBA 1R5ID 2ELHA 2OF7A 2YWQA 3I64A 4S0HB 5C44J 4WPYA 4ABZA 4Y4RA 4HQMA 2DN0A 3EPKA 2BBYA 1GXPA 2COMA 2VRDA 2BZTA 2F8BA 2VL8A 2YTQA 5DD4A 2DA2A 1B8IA 1ZG3A 2ZJQF 3ZGKA 4B09A 2L9NA 3SFZA 5IY5H 4DYRA 2H1KA 1SD7A 4HDVA 1BA5A 3LSTA 4DR2E 2K4VA 3P9IA 2BXZA 2FBHA 4XLNF 2JRMA 1D5YA 1RC7A 1VTNC 4I2OA 3WTWC 3M3YJ 1KU2A 1K6YA 2EPFA 3GEZA 3HC7A 4Z2YA 1U8RA 3IRQA 4PK4A 4IJDA 1MNEA 3F8CA 3FK7A 5E3LA 1QO0D 1HXDA 1AAYA 1XDUA 2Y31A 4Y33A 2HVSA 2AHQA 2HDCA 1UJ8A 3H0GJ 2R7XA 2UUBE 3OYDA 1T08B 2UXNA 3HOSA 1NEIA 2YTEA 2L9RA 4RB1A 2A3SA 1LFPA 3CDHA 3F72A 4OIOF 1NTCA 2A05A 3V8JA 2MKDA 5KHDA 3C1DA 3G2BA 2X9DA 2IAIA 2E34A 2L5QA 1WJ5A 2LF7A 2NOGA 3G71I 3CO6C 2H8RA 2EPKX 2M7QA 5GTHC 5DM7F 4O4KA 5FB2A 2RSMA 1LFUP 3SDGA 3HSRA 3J80K 3OY9A 1MMDA 1UG2A 5CLSA 2DDAA 3FK6A 1UCRA 1MH3A 4CCMA 4PGGA 2R4GA 1QNTA 2F4MB 1IF1A 1S6LA 3BR0A 2E19A 3P7NA 2FUG2 2N3HA 2R3SA 2W25A 3ZP5A 2FV4B 4O24A 1XGNA 4ZC3A 1R6RA 3M4OJ 1GVDA 1HNWE 2KMUA 2XKPA 1YIJI 2IA1A 2WY7Q 3FMSA 4XM3A 4CZZA 4DV0E 2ZMEC 3CC4I 1G2DC 1FBQA 2MH9A 4IHVA 2UXXA 3CMEI 2WWYA 1G2HA 1T6SA 4C3JJ 2PMHA 1VI0A 4EJUA 4DGWB 1W5TA 2CYYA 2R93J 4WSPA 3CDIA 4DZJA 2UUZA 2NUGA 4M3FA 3LA7A 4JI7E 5D6EA 3WTVC 2VJ4A 2LJHA 1TWGJ 1MBKA 1UFMA 3WG9A 4YFNF 3DBLB 1S3JA 5BS6A 3F8FA 3CCLI 2E1NA 3A03A 3OOUA 3OYEA 2BHZA 2A61A 1ON1A 3IUOA 2R7SA 3D0SA 1YHQI 1F9NA 2IBDA 3QOPA 2ZB9A 1U78A 2EP3A 3ZMVA 4BCAA 2BY2A 1OCCH 1DU0A 4IXAA 5DTDA 4M9SA 1IDZA 1UELB 1G3SA 1YJ9I 1K7AA 3S17J 2EPUA 4WX9A 1T98A 4CO8A 2O7OA 3KCCA 5A6JA 3QOEA 4L9JA 4HYEA 4C3HJ 4MQVA 4C9YA 4IOCF 4X62E 3ADIA 4DJAA 1ZRCA 1XB4A 2QYOA 2P6TA 1UN6B 2DA3A 2L9SA 1E3PA 5ILSA 4AIDA 2GM4A 5J8CA 2JUGA 5DEQA 5L3GA 4HNVA 4GGGA 2JPCA 4HW0A 4V2GA 3OYKA 2IRFG 1KZHA 5ERIA 1R71A 2FGGA 3CLQA 2EOYA 5GAHJ 3A02A 2EWLA 5FKNA 2DMQA 3OYFA 1TNTA 4B3ME 1Q1HA 2JY9A 1KQ8A 4KDPA 1QHGA 2OV7A 3HOTA 1U8BA 1Y39A 4A3JJ 2W84A 2DQLA 3FZVA 3GYHX 2GXAA 4M6YA 4MLOA 3KP5A 2BXYA 3KP4A 2YTIA 3C6KA 3NARA 1D0ZA 4A3DJ 3KX2A 2NOJB 2JOBA 2VPLA 1I94E 1I3AA 4PSXA 3WGGA 1HDPA 2E2HJ 1X47A 2R0QC 5DS9A 3S16J 1S7EA 4X65E 3W3CA 1QZEA 3T0YA 1NG7A 1G8XA 1ZGAA 2HXOA 1WXRA 5DV5A 1JGSA 5HNFA 1HDDC 1MMSA 2LUQA 4L5JA 1I6HJ 2ZNZA 3KWRA 2P8TA 5IXMB 1MZBA 5JLXA 2HWVA 2DT7B 3MQ0A 3EYYA 2AXTC 4Q48A 2EV0A 1SAUA 2E72A 1X48A 1HF0A 1ZGJA 3K9TA 1KU3A 1Z7LA 2EMIA 3BZKA 2MC3A 5DUKA 5KL4A 4X8WA 4XSXF 2OU2A 3EPLA 4ON0A 1JT0A 3HOWJ 4HEIA 4NQWA 3QG5C 1SVOA 4G6TB 5A6AA 2VOPA 3NRVA 2KKOA 2JWOA 3A1YA 2IPQX 2V9PA 1VQOI 4H4KC 4P7DA 1QPIA 3I56I 5BQTA 5CQEA 3KZIC 3ZN1A 1BBYA 5ILVA 3JSPA 2LT7A 2DMPA 3VYSB 5IYBJ 3E1SA 2HYGD 4A69C 2EH3A 3H0DA 2JTVA 1XCBA 2QZ8A 1YITI 4HF1A 4IQJA 4C2MJ 5EG0A 2VI6A 4JP0A 4JYKA 1O3TA 3BIDA 2DA4A 3RMPA 2EZIA 2EOQA 4JI5E 4D7NA 4UUTA 1A04A 1F1ZA 5IT9Z 2RQQA 4XQFA 3ZMDA 1DU6A 2YU5A 3G3ZA 2LG4A 2ELKA 4XSZF 4Q28A 5DCFA 3BR5A 3A0BC 4LOCA 2BB8A 1XSXA 3ABMH 2YR2A 1K78B 2BVMA 2VBZA 1H89C 4BMJA 4O3MA 2HYJA 1MH4A 2LE2A 3E5XA 3CCMI 2VT2A 4OU0A 2X6OA 3LLHA 1TN9A 4PJMA 1P4WA 2BY0A 1WSUA 4UY8I 3ABKH 3FXUA 4BQOA 5HOOA 4ENNA 3GF2A 5ICFA 1FYKA 2EMKA 1T56A 2DOEA 2FA5A 2P7VB 5D5XB 3S3NA 1HQCA 3C2HA 3FMRA 1RZ4A 1ZLJA 4EJTA 4O6JA 3ROUA 4YFXF 1ZN2A 3MN2A 3WTXC 2ADRA 2XGDA 4FT8A 1CQTA 3BTJA 3TDUC 2YTNA 3CJQB 2PJRA 3EQ1A 1JGGA 3ESWB 2VODA 1WJDA 1O0WA 5B3SH 1BOAA 2L8TA 2I10A 3IL2A 1SANA 5LGTA 3WTUC 3TL4X 1IG7A 5KL3A 3WTZA 4CDGA 1JKQC 2GIVA 4WFTA 2EM0A 1B59A 4BNCA 1OR7C 2CTDA 1JUPA 2VE7C 1IQSA 2DA6A 1FOYA 3G6EI 2LC2A 2JA8J 2R7QA 4ESJA 1K6OA 4OOIA 4R2QA 1U6GA 3HDDA 3M1EA 3QYBA 1BN5A 2IT0A 2DSYA 2WAFA 1SD4A 1P47A 4A5MA 3KE2A 1YFHA 1STZA 1XN7A 3TBIA 3H92A 1IRFA 1KU7A 4JI0E 3H1CA 1A1FA 2HVRA 2FBIA 4EJWA 3OR2C 4LK1F 2FEZA 3KYCB 4AU7A 2LP0A 1B9NA 3H9GA 2YTPA 5A6KA 1WJBA 3HTUA 1YOVB 1X4OA 3HHHA 2EZ6A 4R2SA 5LMNE 3K1NA 3N97A 2A25A 3K4NA 2EOFA 2QSGX 4RLFA 2ELZA 1O57A 4ESFA 4WSGA 4J19A 3EPJA 4KFCA 2DMYA 5ADZA 4WXCA 5KCMA 3F8NA 3SEQA 3FIGA 3GLLA 2GQQA 2X1CA 3JREA 4G8XA 2UUCE 1E3HA 3MVPA 4KJZA 3N4MA 4LLLA 2RKHA 3ERED 3GTLJ 1T4LB 2K9QA 1ZQ3P 2HKXA 5EGOB 2YRHA 2E7XA 1EF4A 3AUZA 1RETA 3M8EA 5H20A 2HKOA 1OJLA 5M3MJ 4BY1J 2ECBA 4HZFA 4X1EA 5F27A 4FE7A 2VKHA 4OMYA 3I71A 2ESNA 4LG0A 4KNYA 5ICEA 1TLHB 3FBIB 3A01A 1DI2A 3I54A 2QCOA 4CA0A 2D1VA 4WXDA 2FF4A 2E1CA 1LVAA 2Y69H 3E3VA 2V1NA 2DW4A 2KQRA 2BVLA 3L2VA 5FLMJ 1X6EA 3MHSC 4HTGA 3J81Z 2UZKA 1LLMC 4UV9A 4WK8F 2V1XA 2M2EA 3GFIA 4PFPA 3IKTA 2MKNA 3L00A 3VSLA 1V5FA 3H9QA 3RZDJ 3BZ6A 2YU8A 1MGTA 2OTLI 3KLNA 4DYQA 2LMDA 3HZJA 3OIPA 1WHUA 1YRNB 3O3KA 5HODA 1QVTA 3HOXJ 2GWRA 3T5XA 2M0MA 3X2QH 4NBQA 1A1LA 2H6BA 4IHXA 4ZDPA 5EZHA 3AFHA 4A93J 2OUMA 4KIBA 2YSOA 2UXCE 2W7NA 2LY1A 3WE3A 2BV6A 2FNAA 3R4KA 1XSDA 3IAS2 3PNTA 3F6VA 5AC4A 4MHGA 1RMDA 3GTPJ 1KQ0A 4GFBA 3J7AO 1DGWY 2LY9A 3ABUA 3C2GA 2K4JA 3FIWA 1IV8A 5K7ZA 4WCGA 4A3FJ 1RRJA 2L92A 4UVCA 4R2RA 1XG1A 1XMOE 2EPMX 2JXPA 3VYTB 4IOAF 3FX3A 5CQGA 1K61A 2EOIA 2L7KA 2ZXJA 4I02A 4U88A 1TW2A 1U2WA 3NWTA 4BEHB 4EATA 3HTSB 3C4TA 2IP2A 2M3AA 3M07A 1J7KA 5JVGF 3RPUD 3DPUA 3KFWX 4Q4ZF 4PUSA 1FJLA 4PJNA 3CDLA 5K5RA 2IGNA 1Z0XA 3HJEA 5M5YJ 1RNLA 4E7JA 3HKZA 2P7CB 1HW2A 1BI2A 5HDGA 4KT6A 2ZSHB 3KZZA 4HRIA 2XAGA 2EIKH 4XRFA 2Y9ZA 2M7BA 2EN6A 2B9SA 4IQ4A 3KYLA 4HQEA 3ECHA 2DYRH 3ZOBA 3WGHA 2ME0A 2YU3A 4L9VA 5IT3A 3C4BA 3OYIA 2H27A 2EILH 2HR3A 3JAMC 4XKWA 5CVJA 2DPUA 1Q1VA 1TWHJ 2LBFA 2E36A 3WG7H 3L09A 2O8KA 2WAQA 2DB2A 2NABA 4NXNE 2D9HA 1MBJA 1WKMA 2DTZA 3BOQA 2VONA 1ZBQA 2BY1A 4BAYA 2KL4A 1WHQA 2NA2A 2CPNA 4BACA 3ERMA 3HUGA 3IHUA 1T39A 3VK6A 4F9AB 4DV4E 1PJTA 5J6XA 1FBUA 2EE8A 1HW1A 2QSFX 2DT6A 2K9NA 2Y48A 1R4MB 5FJ8J 1IO2A 3FHZA 3M99B 2KONA 1HOMA 4RB0A 3FKIJ 4XBFA 1BIAA 2GXGA 2E1MA 2TRTA 1ETVA 5AONA 1YE9A 3UKGA 3E6DA 4Q35B 2XV4S 3LSPA 2DBBA 4OIQF 2QKLB 4D0PA 1DDNA 1PDAA 1OCPA 2R7DA 1DQ3A 5F0CA 4X6AJ 3SDBA 3H09A 3E6BA 2KOUA 4B3AA 3Q9SA 2FNPA 2Q8KA 2DOAA 2X85A 3G4SI 5A2QK 3M8FA 4ZJZA 4ZH4F 3QP5A 1DQUA 2GAUA 1IN6A 2NAZA 3O8GA 3HTXA 2B7EA 3EUKL 3Q3SA 1FMWA 2KZVA 3HKZN 2L0KA 2NVYJ 1UHWA 1Z3YA 2EPLX 3ZQGA 4I7HA 1W7PB 1A36A 2A5WA 3HOYJ 3I59A 5LL6R 1QBJA 1SR9A 3THOB 4XOTA 2RNJA 2R5YB 1HKTA 3J80C 4TUIA 2HQRA 3I9V2 4V19K 4ZZDA 2ZCWA 1JK2A 1E3OC 4DV5E 1PKPA 4GYGA 1MDMB 1Z9CA 1ZG1A 2FX0A 3SQNA 4A0YA 3CC2I 4GDFA 2JP9A 1X3ZB 4AIKA 1IV6A 2I8DA 1I27A 2P4WA 2PMUA 3LMLA 2Q1ZB 3R0JA 2OJED 3PJRA 4G6DA 4R1HA 5D5VB 2ETHA 1X6HA 2H8WA 4LIVA 1LVKA 2MGQA 3I3LA 2OBPA 3ZMTA 2EN2A 2CQNA 4XMYA 2ZMEB 3M8JA 2GA2A 2EN1A 1KYWA 2K40A 5J4VA 2EIJH 1YI2I 5JFRA 4XN0A 4LF9E 2VF1A 5CKTA 3HXLA 3DEUA 2O61A 2K4BA 3D5SC 1DP7P 1LQ1A 2YX7A 1S9HA 4J00A 2GA1A 2H94A 2F5VA 2H1LA 2I13A 2LOOA 1WH7A 2WAEA 1G3WA 2EZKA 5C4XJ 1XMKA 3U9GA 1T0FA 1Y8QB 1S5LC 2CJJA 4HNTA 3LL7A 4RAZA 1JJ8C 2MC6A 1SFOJ 3I4MJ 2J5PA 2DLKA 1ETYA 1LE8B 2KZGA 4ZYHA 3OOPA 1G3TA 2HOTA 2YTFA 1FNNA 4HX4A 4UB6C 2LKSA 1YPNA 5E8GA 2R7FA 3S1NJ 2L2NA 1FTTA 1S7AA 2M30A 4F92B 2HDWA 4C2TA 1NH3A 1CF7A 2XAUA 2PJPA 2XDVA 3HG9A 1G2FC 4IZZA 2DT5A 4DUZE 1XX5A 4LD5A 3ZN0A 2QKMB 4UVAA 5ICGA 5BPDA 3K6GA 4XICA 4C2UA 2RREA 3GZ5A 3BJ6A 4ZDLA 3RDIA 1ONVA 2V89A 4CXFA 4MLVA 4LF7E 4CZCA 1OMIA 3ELKA 5J4YA 3R60A 1VQ9I 2CS3A 4Q47A 2EZHA 5FLXZ 2KHMA 3P9CA 4IRHA 4P55A 2EPPA 4LU9A 2R7VA 1F43A 2M1BA 2DFEA 1YQAA 5LEKA 3SJMA 3ADJA 2O3FA 2WB1N 2FSWA 4E7HA 4MNUA 4XRSG 3T8TA 3ZQFA 2UXBE 5LMUE 3QWLA 3BG7A 4GKJE 2LY2A 3GCMA 4KITB 1A1GA 2L3JA 2VQCA 3OYJA 1YUIA 4Y3OA 4L0ZB 2R7WA 2EOEA 1K83J 1PJSA 4Y13A 1KYZA 2XVCA 3JCUC 4UV8A 3BTLA 3VDXA 4MEYF 2Z16A 1ZHFA 3KIOA 2L4MA 3LSKA 2J7JA 4LIUA 1IGNA 1TL8A 2XSJC 4BHCA 1OQYA 2EN8A 2K9LA 4L8NA 3BCAA 2JJ7A 3UR3C 3OWTA 1XMAA 2KFDA 3KP6A 4QSHA 4QPQA 3CF5F 3GVAA 1IAWA 4Y15A 3S2HJ 4DOZA 3Q0WA 4DKKA 2BGCA 1FWZA 2VBWA 2M34A 2JWTA 1WHNA 3MKWB 4HX8A 3VEPA 2CFOA 3TO6A 5J8FA 2XAQA 5GPCA 5DCMB 3F6OA 2EM7A 2EMWA 1STUA 2ZXWH 2QBYB 2HEOA 9ANTA 2ICWG 5LD2C 1HKQA 2FXAA 2GLOA 5LBQA 3RJPA 2W1OA 1GVJA 1B1BA 3KEOA 4BE1A 3HGYA 4GXOA 1A35A 2QQBA 3AAFA 2IA0A 2WADA 2V85A 4Z6YA 2ODRC 3HL2A 1YTYA 3F22A 2BW3B 5A6BD 1ACIA 1I1SA 3S3OA 1HW5A 1ZKGA 5AIPA 5L3BA 1WJEA 3HRUA 3K1MA 1TQPA 2W57A 5EEGA 2MFZA 2LRDA 3AG3H 1J0RA 3ECOA 3OYNA 3B6AA 3SXYA 3ASNH 3I58A 2FD5A 2CUFA 1BI0A 3GTKJ 2ODRD 1FOWA 2JOXA 4RA2A 1SAXA 4KIFA 1JE8A 4L5NC 3TO7A 5FKMA 4LLNA 3E7LA 5E3NA 4HNUA 2LVHA 2X1EA 3S93A 4IO9F 3W2AA 3WU2C 5IYDJ 3BG5A 1XMXA 1HNXE 2ISYA 5LRRA 2NUFA 2Z2SB 5FKKA 2Z1DA 2MG4A 3L2WA 3LA2A 1AA7A 4CYCB 1PP8F 3IWBA 4BU2A 3WHCA 3IV5A 3LFUA 3QQAA 4A0XA 2F4VE 3J7YJ 1SFXA 4BJ6C 5IP7J 1FT9A 4DQ2A 4YRVA 3FM5A 4ZTJA 1XS9A 1IUFA 2Q2EB 1NK2P 1EV7A 5ILUA 2H09A 1IUYA 2RPCA 1H0MA 1IDYA 3PQKA 2VT3A 1ZBTA 2XRNA 1X5WA 4BBSJ 2VQFE 3GTJJ 2BY3A 4XLHA 5D8LB 1MW7A 1I6XA 3K0LA 5KL7A 1APLC 3VYUB 3V8KA 4IS1C 1TBXA 1TW3A 3I5UA 5HLIA 1RESA 2QVOA 3RCOA 2JN6A 4NC7A 2L2OA 3K7AJ 1V5GA 4JX4A 3DP7A 4FCYA 1D0YA 2GIZA 2M8GX 3B73A 2O5RA 2UUAE 1YS6A 4OAYA 5FFXA 2JQ7A 2EV5A 4AVPA 1BC8C 1OKRA 2EJ4A 4TUGA 3HYIA 4EVIA 4B3TE 1LEBA 2W00A 5LHHA 4CHUA 5E1ZB 3CCYA 4P9FA 1MSFC 2JA5J 1MKMA 2PN6A 4B1RA 1LPQA 2M4GA 4UHTA 4QPOA 5FKOA 1OCTC 1WPKA 3DEWA 2VC0A 2JR1A 2K3FA 1B72B 1Z1BA 2WBSA 5CYVA 1ZAAC 2K9SA 1A1IA 1TC3C 1G3YA 1JHHA 4BE2A 1U9NA 2OCCH 3CLOA 4EJOA 4XK4A 2ZJRF 4K2EA 4E7IA 2CFXA 3E5QA 5DYMA 3H5NA 1PVEA 2OCEA 2EPZA 2M1SA 3CD6I 3MCZA 2DTRA 3BWGA 4TV7A 4FK5C 3DKYA 1ZK8A 5J47A 2RTXA 3ZMUA 3F3XA 3ZQQA 2QM3A 3VPRA 4L9NA 2WV1A 2O03A 3EYIA 1W5CC 1FMVA 4B48A 4OIRF 2JVAA 2EPXA 3F9KA 3DLAA 2IXSA 2L2MA 3ZR8X 5E17F 2OQGA 1R4NB 3ONQA 2ESHA 2X51A 2B7VA 4LTYA 2FTXB 1LDJA 3C7JA 5D6FA 1P9QC 1Z3XA 2DMIA 3CMYA 2G7HA 5F08A 3IH4A 1IRZA 2YSRA 1W36C 4R79A 2HXIA 2VUMJ 2OZ6A 3Q0VA 4XLPF 2L01A 5K1YA 3JRAA 2HOSA 1I3QJ 3CUQA 4MIMA 1G59A 4FQGA 2VLAA 4N4NB 3RKXA 4X0GA 1O4XA 1ZYRF 3MAJA 3OS1A 1PUFB 1F5TA 1KYQA 2ELYA 5LGNA 1WJFA 3DJWA 2XIGA 4JQFA 1X58A 5HS9A 3JTZA 1XCVA 4WWCA 1W36D 3CTAA 4M9ZA 1X3WB 2K02A 4II2A 1YYKA 1R1UA 1S8NA 4HAMA 1O7LA 4LB5A 1D3YA 2DRPA 3D1NI 2I5UA 4M0VA 5LRSA 3R0AA 4U0WA 1TWAJ 2LYCA 3QYEA 2OD5A 4ZYGA 4YIFA 1Z1DA 3BPVA 3KP3A 2HZTA 3WU1B 2Q0OA 4FTHA 1N77A 3DKXA 3NWSA 3WU0A 3J7AY 3OL3A 3OYCA 3CMAI 2DFHA 3FMQA 4XOPA 4R8HA 1H9GA 4HLXA 1RR8C 2EPRA 2JT1A 4ESBA 2GOXB 1SD6A 3I55I 2E7WA 5FRMA 4DV3E 1GUUA 5LHIA 3TOAA 4D7MA 2PLYA 2LO3A 5DD8A 1Y1VJ 5EEHA 4YIIA 4ZDOA 1IN5A 4JI4E 4IHYA 3GO5A 5B66C 1MMAA 2EM8A 1UBDC 3V8LA 1XNQE 2ENCA 3T1YE 2LCEA 2GOMA 3UNGC 3LAPA 2EM4A 2WBUA 2XSDC 3COAC 2IGMA 2G9WA 2W85A 1FY7A 2M87A 4CCLA 2YRMA 3HQ1A 4IKFA 1AWCA 1I50J 1R36A 2DMTA 3BR2A 1R5HA 2QWWA 2NUEA 1TWCJ 2ECCA 4XKVA 3L2UA 1RUOA 4IVNA 5HLHA 4JOMA 3K2AA 5JI6A 3OIOA 2O9LA 2BBGA 1KJKA 2R7OA 4CSWA 3ABLH 4NQWB 1RIOH 4QIWN 5AE2A 1OCOH 3QODA 4BJ5C 1WJAA 3BQYA 4G9YA 3QPHA 1VQNI 2DFFA 1RKWA 4EGYA 4HDUA 1GHCA 2L54A 1BI3A 4NC8A 4OOGC 3KEYA 4OX9E 1ETXA 1QRYA 2LDUA 4L5EA 4LFUA 5DM6F 3TMOA 1G4DA 2R7TA 3UK3C 2QQ9A 2JA6J 3EUHA 5F6FA 2RGVA 3F21A 1Y56A 3PQJA 2VE8A 1AH5A 3H36A 3VYXA 2NS7A 1FC3A 2DO7A 2RS6A 5EGOA 3U21A 2KDZA 4JI8E 3ZRGA 3I4PA 4HG2A 1JK1A 1KA8A 1WJPA 1LDDA 5HDKA 3ADGA 2JA7J 3TKYA 4XLFA 4ZTFA 1Y0UA 2X1DA 2OPTA 2GPIA 4DV2E 2B9DA 4JI2E 3G1OA 2M45A 4MEXF 3TOBA 2EZLA 4IEJA 5A2QC 1XSVA 4CGZA 4HLYA 3LSMA 3S15J 2NRAC 3HHGA 4I8OA 4ENJA 4PFOA 4XR6A 2EN4A 2A6EF 5IV8B 3K70C 3TQMA 1NHAA 1BOBA 4LFCE 1D0XA 1OYWA 2VBYA 2K7LA 3MKLA 1AOYA 1YRNA 5E8IA 1G6NA 1FP1D 4J01A 3QU6A 3BDDA 1HKSA 3HRMA 5BNGA 3BR6A 2CUZA 4X64E 4N4RB 2XF6A 2YU9J 2RNGA 2XGCA 3FWEA 5FD5A 2FMYA 1SFEA 2PFBA 2MYSA 3DWLE 3M1CA 5E18F 4EGZA 1YYOA 3K70D 3KPHA 1FEXA 5GTIC 1VNDA 1P6RA 4IX7A 1SD5A 1U5TA 1ULYA 2STTA 4DV1E 4DR1E 4LF5E 1FSHA 4F6NA 3OTOE 5HNHA 4BKXA 3ECRA 1SEUA 4BEHA 3OYMA 1W5SA 1VQLI 1BBGA 4NHJA 3NEUA 1VQPI 3Q0UA 3U1KA 3L7WA 4DR7E 3BC8A 2EOHA 2Y0MA 3BTCA 3ZCOA 4XLEA 1FYMA 3JRGA 2F5CA 1IXSB 3RKWA 2I9IA 2V8QB 4UNOA 1W0TA 1Z67A 2V9KA 4RAYA 2W48A 1U3EM 1ETQA 1FP2A 3RKYA 2OTJI 4G6QA 4ASNA 5TRDA 4HA8A 2YX4A 4M73A 3OYBA 4E7LA 3LOCA 2KIMA 3GW2A 4F7ZA 2KT0A 3MKZA 2VE9A 3KP7A 5EZGA 3GMEA 2ZFUA 1A6IA 2HFHA 2ZBKA 2M4KA 1S72I 1TF3A 4XIDA 2FU4A 3QPTA 3S2WA 4XKBA 4QTRA 4D1QA 3C6MA 3OV8A 4HF2A 2EMAA 5H6RA 2L3CA 3K4CA 1JKRC 3FXQA 1P92A 2MW8A 1AU7A 3HIFA 4HF0A 2M0CA 3L1PA 3VWBA 1UG0A 2EPCA 3CMMA 2PBIA 2EOMA 2L6MA 2DQRA 4KZSA 3PNYA 3QPLA 4RM3A 5ICCA 3N05A 5F0FA 5M3FJ 2WY8Q 1ODDA 2P6SA 1ETOA 2LR8A 2WZOA 2HTJA 3E6MA 4BDYA 1Z21A 4BH9A 5IT9K 2Y0SA 4MFDA 2DLLA 5CVRA 5E1XA 1T4NA 4KWYA 1RPWA 4BYYA 3GFMA 1JKOC 4RBOA 1KONA 1Z6RA 5E1WA 2GLIA 2V9VA 2P81A 5FROA 2P0WA 4P96A 1W0UA 2XF7A 1RUNA 4KYWA 1T2KA 2LV2A 3CUQC 3ZQ7A 2WBMA 1X3CA 3HPSA 4HV6A 3AL0C 3EUAA 2JPBA 5HS8A 4F6MA 3E6CC 4DNCA 5F1JA 4U7DA 4GKKE 3S2DJ 2CGPA 4BHPA 4BBYA 2B3TB 1ZARA 4B3XA 1X2MA 1YX3A 4U87A 3BROA 1IZ1A 2QQ8A 2N8XA 3S14J 1YLFA 4X66E 2MD5A 4RM2A 3I0TA 5TSEA 1X1AA 3JAMZ 1TNSA 1ZELA 2CH0A 2KDOA 4WXHA 2CW8A 4YIRX 1W7PA 4EM2A 3L9FA 4E4HA 2R5YA 2XUBA 2EFPA 1X49A 4O5GA 2J5OA 1Z7UA 1TQIA 2TDXA 3RI4A 4UUSB 2EPNA 5C3EJ 3CP2A 1Z77A 4M6XA 1IN7A 3JRDA 1LJ9A 2COBA 2E71A 1R58A 3MZ8A 1MDMA 2EM6A 5TJJA 5M5WJ 4G7OF 4DR4E 1N78A 1AKHB 1HC8A 4NHRA 3MMYB 4P1WA 1USTA 1YW9A 4M9XA 3BR1A 2IS4A 1KGSA 4YELA 3HB9A 5LLQA 4PJJA 3SZPA 5J1RA 1IRGA 5CJ9A 6PAXA 2UXDE 5KNLA 2EB7A 2RDPA 4HSRA 3LAJA 3ZPLA 3G1MA 1ZR2A 2V26A 2XPWA 1PJRA 5J40A 3B02A 2ZMEA 4KA4A 4KMFA 1H88C 2IGOA 5L3FA 3CC7I 4GCVA 3EETA 3TDZC 1F2IG 3H5RA 3DTKA 2ELJA 2EQRA 1IXCA 2Y0SN 2CWEA 4A3BJ 4BBRJ 1HCRA 4CUGA 2G7UA 3DPTA 3CCEI 4DYCA 2ZKZA 1WI3A 2WV0A 4II3A 3BQZA 5AASA 2LUPB 4OMZA 1QZYA 2EMFA 3K69A 1A1JA 2Q8UA 1TP4A 1HBXG 1AHDP 1Y6IA 5AC5A 1IQOA 2F2EA 1RQ0A 3ZQCA 3DF8A 3MSWA 1JUSA 4I0AA 5BOXA 2A5YB 1LE8A 1HA8A 2LK2A 2C6YA 4NNJA 1L3LA 2WC2A 4XL9A 4DMIA 2EMGA 1BW5A 2HOEA 3SFIA 3J80Z 4M9VC 2WB1A 3ADLA 2CUJA 2IGKA 5TISC 3F23A 4HBLA 2MH2A 3IH2A 4OAZA 1VQKI 3S1RJ 3V7CA 2VQEE 2B63J 4N4OB 3CCRI 2ID3A 3GTGJ 1FBSA 2HQ5A 2ISZA 3Q5FA 2OC6A 1O7FA 3W6VA 3HEFA 2HZDA 1TQMA 2EORA 1QA6A 4N0BA 2Y30A 2PQ8A 2IVMA 3LFKA 1BR1A 2QQAA 2LF8A 3O6BB 1FLIA 3HPGA 2CW0F 4F3QA 3C3WA 2MLGA 4JBAA 2XAJA 4MFEA 4F9BB 1I1GA 4N9IA 5B1BH 4I99C 4B43A 5D8KB 3MZHA 4PCQA 3J81K 2FBKA 3OYAA 5IOYA 1BR4A 3IWZA 4G94A 2R1FA 2JVGA 3ZQHA 1N3GA 2KRCA 4E7ZA 2WTEA 1T8IA 5A69A 3F6HA 1K4TA 3GUDA 4A3MJ 2NNNA 1GTKA 4RB3C 2ZXIA 2H6CA 2TCTA 2L9VA 2M7AA 5F1RA 5LEJA 4EM1A 4KHPE 4F91B 1FKAE 3LSGA 3REOA 2YT4A 4CICA 1HR0E 2HVQA 3I53A 2OQRA 4KT5C 1P7JA 4N9HA 2EOZA 2ZSIB 5JVTA 3O2PE 4B3RE 2MBFA 4BGDA 2XGEA 3QPSA 3DBRB 2Z9OA 4B44A 2KHXA 4R03A 5E3OA 2HU9A 3CJNA 3J7AG 2CV2A 4A12A 2B7TA 5E79C 3L2CA 3Q9VA 5B1AH 5DCMA 4F54A 1OYIA 2ZFWA 2HQNA 1YIOA 3TW7A 4M71A 4A2UA 2VXZA 3WODF 2EL4A 2QBYA 4K0KE 1U5TC 3BCBA 1MBFA 1N25A 3H3ZA 3WTSC 3IWDA 3IWCA 1BIBA 3P5JA 4A6EA 5KL6A 4EMSA 4I01A 2IEKA 2NXNB 4P5OA 1LUJB 2VIXA 3CJRB 3ISPA 3FHNA 5FGMA 4DBRA 2MDGA 1R1VA 3GZNB 3TEDA 5EYRA 2V6EA 2LTSA 4A5NA 1J09A 2BW3A 3KETA 2L3DA 4D5CA 3ULQB 2NVUB 1R22A 5AIQA 1PP7U 1U9OA 4C3IJ 2CT1A 4RHBB 1B69A 1A5JA 2DXIA 1SVLA 3MKYB 4U0VA 2KPMA 2NS0A 1YG2A 1OCZH 2KJBA 3FBNB 4I09A 1J26A 1XD7A 2A6TA 4GZNC 2Z33A 5F64A 5HLGA 4A3GJ 1R00A 1IXRC 4EQQA 4A3LJ 3VOEA 2RQLA 2YRKA 2O8XA 3OS0A 3K6QA 2KIUA 2K86A 2GXBA 4BC7A 2EIMH 1Z05A 4IJAA 1QVUA 5ED4A 1BC7C 1DUXC 2R5ZB 1XGMA 3RSNA 3S1MJ 4B47A 4YEJA 2EOXA 3FISA 2JMWA 2WA0A 2L7MP 3JRCA 1LDKB 2KIQA
chains in the Genus database with same CATH topology
2X4HA 1I5ZA 2Q2EA 3MWMA 4U7BA 5BPIA 4LMYA 1J5YA 3R6SA 2V1DA 4RGXA 4JK1X 3W6JB 3W6KB 4IHSA 3GFLA 1JXSA 1OR7A 1J59A 4KN7X 2EFOA 2X0LA 4KIGA 2XAFA 3GZ6A 3GWZA 2VC1A 4ZYEA 4AD9A 2Z3YA 2M5WA 3LQRA 3HRTA 5CVUA 3LQQA 2A07F 1MJ9A 2FRHA 1KQ9A 1R7JA 2LNBA 1ZREA 2FE3A 2CSOA 2DK5A 4LLGF 4EM0B 1W7PD 2D2WA 3DV8A 3MFKA 4L5IA 2IJLA 1SMYF 5JHUA 3JTGA 4G7ZF 2VOOA 3HSFA 4HV5A 4S04A 4KN4X 4EJVA 2XASA 2DU9A 3DPLC 2ZO4A 4H0EA 3JTHA 4RGSA 1Z91A 3PFIA 1DPRA 1EH6A 3IC7A 3T1BA 4A0ZA 2EA4A 3ML6A 2Z99A 3KEQA 3TO9A 1OPCA 5K5OA 3FXRA 4YFKF 1ZRDA 2VBXA 2L4AA 2OA4A 3ABTA 5E20A 2P5KA 1HSTA 2FMLA 3MZYA 4RB2C 3KP2A 3RPUA 4L18B 4OIPF 2A68F 3G73A 5FLXK 4M72A 5HS7A 4PZJA 4EV0A 4HOBA 4KUMA 5JR3A 2FQ3A 1K78A 2EFQA 1Z6TA 2DK8A 2L02A 3TQNA 1USSA 5D5WB 2V6CA 4Y17A 2A6HF 3E97A 2NNYA 2HTSA 3WTTC 1V3FA 1SMTA 3F8MA 4BXUA 2Z5UA 2FOKA 4UUVA 2GZWA 2RVCA 1IN4A 4UVBA 2F5FA 3JW4A 5K5QA 2F5DA 2D45A 2EJRA 4FX4A 3QP6A 1B4AA 3GFJA 1ZAOA 1HSJA 3DQVC 2NYXA 3QAHA 3KZYA 5LHGA 1XGOA 3CUQB 4ETSA 2B0LA 3U2RA 1UB9A 1J75A 4LGWA 1W4MA 4IRIA 2XROA 4LJZF 3GLXA 2RV8A 2DPDA 3M7GA 4KICA 3CO7C 4E70A 3VFZA 4YG2F 4NB5A 1ZG5A 2ACJA 3BY6A 3GXOA 1MJAA 1RI7A 5D4RA 1B6AA 2DFIA 1YS7A 3EDPA 3RYPA 2BE5F 5D5UB 1J2XA 3CUOA 4MQ9F 2XHKA 1BM9A 4FHTA 2STWA 3DKWA 4I98B 2YPRA 2EFNA 3V7RA 2A69F 3D5LA 3GX4X 5A2QZ 2ZNYA 1FPQA 4AWXB 5LGUA 4BHBA 3R61A 4BQAA 1E17A 2DI3A 1OYYA 1JHFA 3HSEA 3RTRA 3MEXA 1P2FA 2XAHA 3V4GA 1QGPA 1CGPA 4PDKA 3VB2A 3ZMSA 2KIFA 2O6GE 4ENMA 3IKVA 3HRSA 2V1UA 2XGXA 3P9KA 4LB6B 2AS5F 2OZUA 1LEAA 3LWFA 1YW7A 2JSCA 5FFZA 1D5VA 2EV6A 4UXNA 4IHTA 2LKPA 2Y75A 4M74A 2V79A 2P5VA 1WI9A 2UWMA 4GO1A 1YO5C 2PG4A 1UHMA 1FSEA 4KMUX 1E2XA 1J9IA 1WWXA 4IRGA 3RIRA 1U5TB 3QU3A 2LSOA 1ON2A 1LB2A 3LA3A 3WGIA 4LG0B 4RS8A 4QLCU 1MD0A 3QRFF 2MLKA 1BI1A 3BPXA 3H3UA 1D8JA 2JRTA 3F8BA 5CVIA 4U0YA 2RN7A 3RPQA 5KVRA 1O3SA 3K2ZA 4QWQA 1IN8A 3SHFA 1LNWA 1TTYA 1ZRFA 2BEOA 4LK0F 4ZZLA 1QPMA 1YW8A 2AXLA 5DDGA 5KK1A 1D8KA 3SZTA 1F4KA 4G7HF 2O0YA 1X3UA 2IW5A 1XGSA 2EK5A 2ZJ2A 1C0WA 3JSOA 1IW7F 2EFWA 3K1PA 2KJCA 4CYDA 3ZMZA 1REPC 2W24A 3VODA 2EWNA 2BYVE 2OAZA 5L3EA 5H6QA 2KRFA 3FM3A 1WRJA 1H9TA 3NQOA 4WF2A 2JZYA 2QUFA 1QZZA 2MA3A 2ADUA 5HDNA 3KLOA 1PDNC 5FO5A 1ZLKA 1PUEE 1YYVA 2RQPA 4RGRA 2HYFA 1EH7A 4B8XA 3RYRA 2HGCA 1FYLA 1FOKA 3BJAA 1FX7A 2DAOA 1K79A 5BMZA 1T38A 4OINF 1R5GA 4ENKA 3C18A 4AIJA 4RGUA 4AIHA 2CG4A 1B9MA 1ZH5A 1P4AA 3EQLF 4L0YB 4ZYDA 3V7SA 2PI0A 1KU9A 1V4RA 1O3RA 2EA2A 4FX0A 1SFUA 3WE2A 3T8RA 1WQ2A 1DPUA 2D1HA 3DXJF 5D4SA 2F5EA 4MTEA 2HS5A 3I59B 1S7OA 2RC4A 5CVVA 4S05A 1S29A 4GYIA 4O5VA 1XDSA 2XKOA 3BP8A 4MGRA 4P9UA 1BJAA 2QENA 4L9TA 1GXQA 3WTYC 4PGHA 2P5LC 1FZPB 1P4XA 1R23A 5L3CA 4IPAA 1QQIA 3DFGA 4Q5SF 2PEXA 1L0OC 3BJOA 3IWFA 5HVQC 5FD6A 3IRRA 2CQKA 4I0BA 3E5UA 5L3DA 3TGNA 3JAMK 2M8EA 4IF4A 2K27A 3U1DA 4A6DA 5DUIA 1R1TA 4MTDA 1O3QA 3M9AA 2CO5A 1CF7B 2QLZA 2VN2A 1EH8A 4HX7A 3FF5A 2IA2A 1MJBA 2ELHA 3I64A 4HQMA 2BBYA 1GXPA 2COMA 5DD4A 1ZG3A 4B09A 3SFZA 1SD7A 4HDVA 3LSTA 3P9IA 2FBHA 4XLNF 1VTNC 4I2OA 3WTWC 1KU2A 1U8RA 3GEZA 4Z2YA 3IRQA 3F8CA 1QO0D 1HXDA 1XDUA 2HDCA 2UXNA 3HOSA 4RB1A 2A3SA 3CDHA 3F72A 4OIOF 3V8JA 3C1DA 3CO6C 2LF7A 5FB2A 3HSRA 3J80K 5CLSA 1UCRA 4PGGA 1QNTA 1IF1A 1S6LA 3P7NA 2R3SA 2W25A 3ZP5A 1XGNA 2XKPA 2IA1A 3FMSA 4CZZA 1FBQA 2MH9A 2UXXA 2WWYA 1T6SA 2PMHA 4EJUA 1W5TA 2CYYA 3LA7A 5D6EA 3WTVC 5BS6A 1UFMA 3WG9A 4YFNF 1S3JA 3F8FA 2E1NA 2A61A 1ON1A 3D0SA 1F9NA 3QOPA 1U78A 3ZMVA 4IXAA 4M9SA 1G3SA 1K7AA 4WX9A 1T98A 4CO8A 3KCCA 4L9JA 4HYEA 4MQVA 1ZRCA 1XB4A 2QYOA 2P6TA 5ILSA 5J8CA 5DEQA 5L3GA 4GGGA 2JPCA 4HW0A 2IRFG 5ERIA 1TNTA 1Q1HA 1KQ8A 4KDPA 3HOTA 2W84A 2DQLA 3FZVA 3GYHX 4M6YA 3KP5A 3KP4A 3WGGA 3T0YA 1ZGAA 5DV5A 1JGSA 4L5JA 2ZNZA 2P8TA 1MZBA 2HWVA 3MQ0A 3EYYA 4Q48A 2EV0A 1ZGJA 3K9TA 1KU3A 2MC3A 5DUKA 4XSXF 2OU2A 4ON0A 4NQWA 2VOPA 3NRVA 2KKOA 2IPQX 5BQTA 3ZN1A 1BBYA 5ILVA 3JSPA 2HYGD 2JTVA 1XCBA 2QZ8A 4HF1A 1O3TA 1A04A 1F1ZA 5IT9Z 3ZMDA 3G3ZA 4XSZF 5DCFA 1XSXA 2YR2A 1K78B 2VBZA 4O3MA 3E5XA 2VT2A 4OU0A 1P4WA 1WSUA 3FXUA 5HOOA 4ENNA 3GF2A 5ICFA 1FYKA 2FA5A 2P7VB 5D5XB 1HQCA 3FMRA 1RZ4A 1ZLJA 4EJTA 4O6JA 3ROUA 4YFXF 1ZN2A 3WTXC 4FT8A 3TDUC 2VODA 1BOAA 3IL2A 5LGTA 3WTUC 3WTZA 4CDGA 2GIVA 1B59A 4BNCA 4ESJA 1K6OA 4OOIA 1U6GA 3M1EA 1BN5A 2IT0A 1SD4A 4A5MA 3KE2A 1YFHA 1STZA 1XN7A 3H92A 1IRFA 1KU7A 2FBIA 4EJWA 4LK1F 2FEZA 1B9NA 3HTUA 3HHHA 3K1NA 3N97A 1O57A 4ESFA 4KFCA 4WXCA 3F8NA 2GQQA 4G8XA 3N4MA 4LLLA 2RKHA 3ERED 2HKXA 2E7XA 3M8EA 5H20A 2HKOA 4HZFA 4OMYA 3I71A 2ESNA 4LG0A 4KNYA 5ICEA 1TLHB 3I54A 2D1VA 4WXDA 2FF4A 2E1CA 1LVAA 3E3VA 2DW4A 3J81Z 2UZKA 4UV9A 4WK8F 2V1XA 3GFIA 3IKTA 3L00A 3BZ6A 1MGTA 3KLNA 3O3KA 2GWRA 3T5XA 2H6BA 4KIBA 3WE3A 2BV6A 2FNAA 3R4KA 1XSDA 3F6VA 4MHGA 1KQ0A 3J7AO 3ABUA 2K4JA 4WCGA 4UVCA 3FX3A 2ZXJA 4I02A 4U88A 1TW2A 1U2WA 3HTSB 2IP2A 1J7KA 3KFWX 4Q4ZF 5K5RA 1RNLA 2P7CB 1HW2A 1BI2A 5HDGA 3KZZA 2XAGA 4XRFA 4HQEA 3ECHA 3WGHA 4L9VA 2YU3A 5IT3A 2H27A 2HR3A 2DPUA 5CVJA 3L09A 1WKMA 2VONA 3BOQA 4BAYA 3HUGA 3IHUA 1T39A 5J6XA 1FBUA 1HW1A 2Y48A 3FHZA 4RB0A 4XBFA 1BIAA 2GXGA 5AONA 3E6DA 2XV4S 2DBBA 4OIQF 1DDNA 4D0PA 2R7DA 3E6BA 3Q9SA 2FNPA 2Q8KA 5A2QK 3M8FA 4ZH4F 3QP5A 2GAUA 1IN6A 2NAZA 1UHWA 4I7HA 1W7PB 3I59A 1QBJA 2RNJA 1HKTA 2HQRA 4ZZDA 2ZCWA 4GYGA 1MDMB 1Z9CA 1ZG1A 3SQNA 4A0YA 4AIKA 1I27A 2P4WA 2PMUA 3R0JA 4G6DA 4R1HA 5D5VB 2ETHA 2OBPA 3ZMTA 2ZMEB 2GA2A 1KYWA 5JFRA 3DEUA 2O61A 2K4BA 1DP7P 1LQ1A 2YX7A 2GA1A 2H94A 1G3WA 1XMKA 3U9GA 1T0FA 4RAZA 2J5PA 4ZYHA 3OOPA 1G3TA 1FNNA 4HX4A 5E8GA 2R7FA 1S7AA 2M30A 1CF7A 2PJPA 2DT5A 4LD5A 3ZN0A 4UVAA 5ICGA 5BPDA 3GZ5A 3BJ6A 3RDIA 1ONVA 4CXFA 1OMIA 3ELKA 3R60A 4Q47A 5FLXZ 3P9CA 4IRHA 4P55A 2M1BA 1YQAA 5LEKA 2O3FA 2FSWA 4MNUA 3T8TA 4L0ZB 4Y13A 1KYZA 2XVCA 4UV8A 4MEYF 1ZHFA 2L4MA 4BHCA 1XMAA 3KP6A 3GVAA 1IAWA 4Y15A 2BGCA 1FWZA 2VBWA 4HX8A 3VEPA 5J8FA 3TO6A 2XAQA 5DCMB 3F6OA 2QBYB 2HEOA 1HKQA 2FXAA 5LBQA 3RJPA 1GVJA 1B1BA 3KEOA 4GXOA 2QQBA 3AAFA 2IA0A 1YTYA 3F22A 1I1SA 1HW5A 5AIPA 5L3BA 3HRUA 3K1MA 1TQPA 2W57A 5EEGA 1J0RA 3ECOA 3SXYA 3I58A 1BI0A 1SAXA 4KIFA 1JE8A 3TO7A 4LLNA 2ISYA 5LRRA 3LA2A 1PP8F 4A0XA 1SFXA 1FT9A 4DQ2A 3FM5A 1EV7A 5ILUA 2H09A 1IUYA 1H0MA 3PQKA 2VT3A 2XRNA 5D8LB 1I6XA 3K0LA 3V8KA 1TBXA 1TW3A 3I5UA 5HLIA 2QVOA 3DP7A 3B73A 1YS6A 5FFXA 2EV5A 4AVPA 1BC8C 1OKRA 3HYIA 4EVIA 1LEBA 5LHHA 4CHUA 5E1ZB 4P9FA 1MKMA 2PN6A 4UHTA 2VC0A 5CYVA 1G3YA 1JHHA 3CLOA 4EJOA 4K2EA 2CFXA 3E5QA 5DYMA 3MCZA 2DTRA 3BWGA 4TV7A 3ZMUA 3F3XA 2QM3A 4L9NA 2O03A 3EYIA 4OIRF 5E17F 2OQGA 2ESHA 1LDJA 3C7JA 5D6FA 2G7HA 2YSRA 4R79A 2OZ6A 4XLPF 2L01A 5K1YA 3CUQA 3RKXA 1ZYRF 3MAJA 1F5TA 5LGNA 2XIGA 4JQFA 5HS9A 1XCVA 4WWCA 3CTAA 4M9ZA 2K02A 1R1UA 1S8NA 4HAMA 1O7LA 4LB5A 1D3YA 5LRSA 3R0AA 4U0WA 2OD5A 4ZYGA 4YIFA 1Z1DA 3BPVA 3KP3A 2HZTA 3WU1B 2Q0OA 3WU0A 3FMQA 4R8HA 1H9GA 4HLXA 2JT1A 4ESBA 1SD6A 2E7WA 5LHIA 3TOAA 2PLYA 5DD8A 5EEHA 4YIIA 1IN5A 3GO5A 3V8LA 3LAPA 3COAC 2G9WA 2W85A 1FY7A 2M87A 1AWCA 1R36A 2QWWA 1R5HA 1RUOA 4IVNA 5HLHA 5JI6A 1RIOH 4G9YA 3QPHA 4EGYA 4HDUA 1GHCA 2L54A 1BI3A 2LDUA 1G4DA 4LFUA 2QQ9A 3EUHA 5F6FA 2RGVA 3F21A 3PQJA 2VE8A 1FC3A 2DO7A 3I4PA 1KA8A 1LDDA 5HDKA 3TKYA 1Y0UA 2M45A 4MEXF 3TOBA 1XSVA 4CGZA 4HLYA 2NRAC 3HHGA 4ENJA 2A6EF 1NHAA 1OYWA 2VBYA 2K7LA 1AOYA 5E8IA 1G6NA 1FP1D 3QU6A 3BDDA 1HKSA 3HRMA 3FWEA 5FD5A 2FMYA 1SFEA 2PFBA 4EGZA 5E18F 1P6RA 1SD5A 1U5TA 1ULYA 2STTA 1FSHA 1W5SA 4NHJA 3NEUA 3L7WA 2Y0MA 1FYMA 2F5CA 1IXSB 3RKWA 4UNOA 4RAYA 1U3EM 1FP2A 3RKYA 4G6QA 4ASNA 5TRDA 4HA8A 2YX4A 4M73A 2KIMA 3GW2A 4F7ZA 2VE9A 3KP7A 2HFHA 2ZBKA 2FU4A 3QPTA 3S2WA 3OV8A 4HF2A 5H6RA 3FXQA 1P92A 3HIFA 4HF0A 2PBIA 2DQRA 5ICCA 1ODDA 2P6SA 2HTJA 3E6MA 4BH9A 5IT9K 2DLLA 5CVRA 5E1XA 4BYYA 3GFMA 1Z6RA 5E1WA 2V9VA 4P96A 1RUNA 4KYWA 1T2KA 3CUQC 3ZQ7A 4HV6A 2JPBA 5HS8A 3E6CC 4DNCA 4U7DA 2CGPA 4BHPA 1ZARA 3BROA 1IZ1A 1YLFA 2MD5A 3I0TA 3JAMZ 1TNSA 4WXHA 1W7PA 4EM2A 3L9FA 2XUBA 2EFPA 2J5OA 1Z7UA 1TQIA 2TDXA 3RI4A 1MDMA 4M6XA 1IN7A 1LJ9A 1R58A 5TJJA 4G7OF 1USTA 1YW9A 4M9XA 1KGSA 5LLQA 1IRGA 3SZPA 5CJ9A 6PAXA 2EB7A 2RDPA 3LAJA 3ZPLA 3B02A 2ZMEA 4KA4A 4KMFA 5L3FA 4GCVA 3EETA 3TDZC 1IXCA 2CWEA 2G7UA 3DPTA 2ZKZA 2WV0A 4OMZA 1QZYA 3K69A 1HBXG 2F2EA 3DF8A 4I0AA 5BOXA 2A5YB 2C6YA 1L3LA 2WC2A 2HOEA 3J80Z 3F23A 4HBLA 2MH2A 3V7CA 1FBSA 2ISZA 3Q5FA 1O7FA 1TQMA 4N0BA 2PQ8A 2IVMA 3LFKA 2QQAA 2LF8A 3O6BB 1FLIA 2CW0F 3C3WA 2MLGA 4JBAA 2XAJA 1I1GA 4N9IA 5D8KB 3MZHA 4PCQA 3J81K 2FBKA 3IWZA 4G94A 2WTEA 3GUDA 2NNNA 4RB3C 2H6CA 5F1RA 5LEJA 4EM1A 3REOA 4CICA 3I53A 2OQRA 4KT5C 4N9HA 5JVTA 3O2PE 2MBFA 2Z9OA 3CJNA 4A12A 3L2CA 3Q9VA 5DCMA 1OYIA 2ZFWA 2HQNA 1YIOA 4M71A 4A2UA