4BHCA

Crystal structure of the m. tuberculosis o6-methylguanine methyltransferase r37l variant
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
165
structure length
165
Chain Sequence
MVHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSLTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALLELEKSRAPADLTLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Studies on the M. Tuberculosis O6-Methylguanine Methyltransferase and Mutated Variants.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords METHYLATED-DNA--PROTEIN-CYSTEINE METHYLTRANSFERASE
total genus 40
structure length 165
sequence length 165
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4bhcA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4bhcA01
1JHFA 2ZKZA 2ZMEA 1TLHB 2F5FA 5JHUA 3I58A 2XROA 5L3DA 3HRMA 2QBYA 2M87A 2DPUA 2L4AA 1G3TA 4KFCA 2RV8A 2H94A 3MEXA 3TDUC 1P4AA 1LEAA 1Z91A 3FMSA 1FP1D 4LG0A 5BPIA 2FE3A 1RNLA 2L4MA 3C1DA 3SQNA 1PUEE 3ZN0A 1HKSA 1IN7A 3G73A 4OOIA 3WU0A 4BXUA 2XKPA 4A0ZA 4N0BA 2Q0OA 3EETA 1BM9A 6PAXA 1KU3A 3H3ZA 3I53A 3JSOA 2FXAA 4N9IA 1R5GA 2NYXA 3ZMZA 4XLNF 3ECOA 4ZZDA 1FOKA 2DTRA 3MFKA 3QAHA 3HOSA 2D2WA 1H9TA 3LQQA 2BGCA 3WU1B 5L3CA 3E5XA 2IA0A 3TDZC 5BQTA 4UV8A 3R60A 3H3UA 1B9NA 4XSZF 4IPAA 4FHTA 4IXAA 2A68F 3F6VA 3IC7A 4B8XA 1IN4A 5F6FA 2RDPA 3R4KA 5AONA 4FX4A 2QQAA 5L3EA 5H6QA 1G3SA 1TNSA 4LB5A 4M74A 2IPQX 4ENMA 1P6RA 3V7CA 2KKOA 4G7HF 4R1HA 4KNYA 4OIPF 3BOQA 1FYKA 5ILSA 2V1DA 4KDPA 2J5PA 2X4HA 2AXLA 4LB6B 2QYOA 2EFQA 3WE3A 2V6CA 4ZYGA 1W7PA 2VT3A 1AWCA 2JRTA 4A2UA 1U2WA 2CQKA 3V7RA 3KP2A 1O3TA 1XN7A 4OMYA 2EJRA 4MNUA 5LHIA 1XD7A 4IRHA 5JFRA 1H0MA 4KN4X 1RZ4A 3KZZA 4YG2F 1XSXA 2ELHA 1I6XA 2ZXJA 1ZLJA 1Z05A 2HEOA 5D4SA 1HSTA 5LGUA 3RYPA 2PEXA 2OAZA 1E17A 3BWGA 1QPMA 1O3QA 2FRHA 3KP4A 4KIFA 2EK5A 3V7SA 3M1EA 2MLKA 5D4RA 3K2ZA 4Q4ZF 2EB7A 4L9NA 3WTWC 4GCVA 3BJOA 3M8FA 3JSPA 4LK0F 4UHTA 1F1ZA 1YLFA 2AS5F 1OR7A 5HOOA 1J59A 1K7AA 4BH9A 2E1NA 4Z2YA 4E70A 2ZFWA 4I0BA 2P4WA 3F72A 3QPTA 2M45A 2PJPA 4UXNA 4L5IA 1X3UA 3WTVC 1HKQA 3F23A 2HGCA 5CVRA 3Q5FA 1OMIA 3PFIA 4LLLA 5LGNA 4EM1A 4JBAA 2VBZA 1JHHA 2HZTA 2VC1A 3GLXA 1IN5A 1U5TC 1GVJA 4GYGA 2XASA 3E5UA 1ZRCA 2H09A 4OU0A 4ZYDA 3G3ZA 5FD6A 1A04A 1CF7A 4YFKF 2IP2A 4Q48A 4U7DA 4UVBA 1Z9CA 1QQIA 1QZZA 2HS5A 3IRRA 3FMQA 4I01A 3FF5A 1BOAA 4ESBA 2R3SA 5HLIA 5CJ9A 5JR3A 1RUOA 1BI0A 4RS8A 1J2XA 2QENA 3R6SA 4H0EA 1ZN2A 2KRFA 1U78A 5AIQA 4Q5SF 1FLIA 4EQQA 1TW3A 4AIJA 1YS6A 4LLGF 2MBFA 2YX4A 1ODDA 1I5ZA 3ABUA 1UCRA 2LF7A 2M30A 2O6GE 3R0AA 4UV9A 2R7DA 2LSOA 3L00A 2MH2A 2YR2A 5J8FA 3EYIA 2YPRA 3VEPA 1H9GA 2Z5UA 3M8EA 3C3WA 3JTGA 1KYWA 2O0YA 3R0JA 5CLSA 2XGXA 5E1WA 1ON2A 2PQ8A 1GHCA 4A6DA 4IJAA 4M73A 3IKVA 4LD5A 2HYFA 4U0YA 5HLGA 5D5XB 1B59A 3VODA 1XDUA 3CDHA 3SFZA 5LEJA 1NHAA 3F8CA 2EFPA 2GWRA 4BHCA 3DEUA 3RPUA 2Q8KA 3LA7A 3TKYA 4LMYA 2XHKA 1W7PB 2Z9OA 2FMYA 4QWQA 4EM2A 5CVJA 3PQJA 1B1BA 1MJ9A 1FBQA 2A3SA 1FX7A 2KJCA 2QWWA 5L3GA 4ZYHA 2VBWA 3E6CC 3ZN1A 3NQOA 5HLHA 3KETA 4MTEA 3K1NA 4XBFA 1O7FA 3ZQ7A 3BY6A 2GA1A 5BMZA 1QNTA 3E97A 4KMFA 2E7XA 3BJAA 3J80K 2DK8A 1USSA 3ZMUA 2XAFA 2A61A 1FNNA 4ETSA 3F6OA 3WTSC 4IRIA 2KIMA 1MZBA 2FBIA 1SD7A 1CF7B 4CGZA 1TQPA 3K69A 5DD8A 1XGMA 3ISPA 4O5VA 5E20A 4UNOA 1EH8A 5DCFA 4G9YA 5BPDA 5DCMB 2JPCA 3J81Z 1SFUA 4FT8A 3ULQB 1XGSA 5J6XA 2W85A 1R23A 5CYVA 2HQRA 3HHGA 2D45A 4A6EA 1ZRDA 4RGUA 4U7BA 2DU9A 2DAOA 3CUQC 1D8JA 1F9NA 1QZYA 3WTUC 4L0ZB 1J7KA 2OA4A 3WGGA 2XAQA 4I09A 3GFJA 3DPTA 5ERIA 4KMUX 5FD5A 3ML6A 3ELKA 5K5QA 2VE8A 2H6CA 2RGVA 3RPQA 2A07F 4NHJA 2Y75A 2EFOA 2K4JA 4EVIA 1CGPA 4HV6A 2XAHA 5LEKA 1FPQA 2FEZA 2MC3A 1C0WA 1UHWA 1U3EM 2A6EF 3CLOA 3PQKA 1DDNA 4HBLA 1IRFA 5D8LB 5FO5A 4K2EA 4MGRA 1R7JA 3ZP5A 1T98A 2WTEA 4HLXA 1YTYA 5KK1A 3FXQA 2OD5A 1T38A 2W84A 1T6SA 1QGPA 1T0FA 3K1MA 4OMZA 3FZVA 3JAMZ 4CZZA 3RYRA 2L54A 2GIVA 2QBYB 3LAPA 1R1UA 4ZH4F 3WTXC 1WRJA 4PCQA 1Z7UA 4BHPA 2ZNYA 3C7JA 3SZPA 2RC4A 3ECHA 1UFMA 5K1YA 3KEOA 2G7UA 3P9CA 4TV7A 2H27A 3J7AO 3T8RA 2P8TA 1XGOA 2HYGD 4HF1A 3F3XA 1QBJA 2RQPA 3L09A 1LJ9A 4OIRF 3K1PA 3DXJF 3IL2A 1B9MA 1HQCA 3VFZA 3TGNA 1L3LA 2QM3A 5J8CA 3BJ6A 5E18F 3FMRA 4MQ9F 4NQWA 1W5TA 2FOKA 2BYVE 1ONVA 5H20A 4IHTA 2M5WA 2PMUA 3P9KA 3FX3A 1G3WA 1G3YA 1UHMA 1Q1HA 2GA2A 1MD0A 2HR3A 2NAZA 4RB0A 2OBPA 2XKOA 1B6AA 1REPC 3TOBA 4WXCA 4BNCA 2K02A 2FQ3A 2CSOA 4I02A 1DPRA 2CG4A 1RI7A 4HOBA 4BAYA 2V79A 2E1CA 4I98B 4UVCA 2P5VA 5E8GA 3MZYA 1IUYA 3QP6A 3QU6A 3REOA 2DBBA 2XUBA 1SD6A 2FU4A 2PN6A 2O8XA 2IA2A 1GXQA 4PGHA 5D6FA 1BBYA 1TNTA 1S3JA 1QO0D 2EV5A 1SD4A 3TO9A 5AIPA 4QLCU 5HS7A 1S8NA 1S6LA 1MDMA 2L02A 2RKHA 1RIOH 2HTJA 3ZMDA 1ZARA 4ZZLA 3M7GA 1VTNC 3Q9SA 4EGYA 5ICGA 5LLQA 3P9IA 4BHBA 1SMTA 1P2FA 1U5TB 2YSRA 1R1VA 3WTZA 2EFWA 3FM5A 2FBKA 2QUFA 4B09A 2ZO4A 1OPCA 2EV0A 3DPLC 3LAJA 3CO7C 1J0RA 4L9TA 1WQ2A 4WWCA 1FZPB 1SMYF 2ADUA 1KQ8A 2GXBA 1KGSA 4HQEA 4L9VA 4UVAA 2MD5A 2W57A 2Z3YA 1HW5A 4G7OF 5LRRA 4U88A 2JZYA 4G94A 1XCBA 2VT2A 4Y15A 1U6GA 4OIQF 5ICEA 3BP8A 1R00A 3MAJA 2DK5A 1EV7A 3NRVA 3HRUA 2JSCA 2NNNA 2HTSA 2DW4A 3WGHA 1MGTA 3R61A 3H92A 1LDDA 1ZRFA 3O3KA 1J5YA 1Z1DA 5FLXK 3T5XA 2CGPA 1ZGAA 2VBXA 4L18B 5D5WB 5CVIA 2ISZA 3FXUA 1LDJA 2B0LA 2ZMEB 2QLZA 1F5TA 3I5UA 1DUXC 5E17F 2STTA 3L7WA 4M72A 1V3FA 3ZMTA 1SD5A 5IT3A 3QPHA 4HF2A 1HW1A 2HQNA 4YIIA 2BE5F 4BQAA 4LK1F 3SXYA 1D3YA 3LQRA 5F64A 3MQ0A 4M9ZA 4I2OA 2V1XA 4WXHA 1TQMA 4LFUA 2DQLA 2JT1A 2DT5A 2V9VA 3K9TA 4HV5A 3VOEA 5FB2A 2L01A 3DFGA 1O7LA 3OV8A 5LBQA 5L3FA 3T1BA 1P92A 2FNAA 1XMAA 2Q2EA 3HYIA 5IT9K 3I64A 2OU2A 5DEQA 3P7NA 4GYIA 4RAYA 3ZPLA 2A69F 5D8KB 5ICCA 4GXOA 3CUOA 1PDNC 3AAFA 3E6MA 1R5HA 4RGXA 2F5CA 1ZYRF 2VE9A 3B73A 2D1HA 2VOPA 1KU9A 1ZGJA 1BC8C 2OZUA 5LHHA 3F22A 5E1XA 1BJAA 3RKXA 4CDGA 3VB2A 4S05A 2EV6A 1OKRA 4P9FA 4S04A 2Z99A 2HKOA 5F1RA 3COAC 4EGZA 4AVPA 2K4BA 4WXDA 2X0LA 1YW7A 1YS7A 3DF8A 4A12A 1WSUA 3ZMVA 4HAMA 5DV5A 2O03A 2EFNA 3GVAA 1HW2A 3E5QA 2XVCA 1OYIA 4R8HA 1J9IA 3KEQA 1O3RA 1FT9A 3RKYA 4YIFA 1P4XA 3GW2A 1FY7A 3CUQB 1U5TA 4WK8F 3GFIA 2FNPA 1IXRC 2J5OA 3TOAA 1UB9A 3KFWX 1K6OA 5DYMA 5A2QZ 3EYYA 2P6TA 2P7CB 1W5SA 2OZ6A 4PDKA 4MHGA 2V1UA 5K5RA 2G9WA 3RKWA 4EJUA 4ENJA 3BDDA 3I59A 4IHSA 4CYDA 5DUIA 3RJPA 4NB5A 3QOPA 3TO6A 2P6SA 2G7HA 3EUHA 3CUQA 4P55A 3RDIA 3TQNA 2JTVA 4HF0A 3Q9VA 1ULYA 5HDNA 3GFLA 1GXPA 3E6DA 2WC2A 2HDCA 1Y0UA 2FF4A 2QQ9A 4PZJA 2WWYA 1FSHA 3EDPA 1T2KA 5IT9Z 5HDKA 1LEBA 4KIGA 1XSVA 3I0TA 1FBSA 3M9AA 3GO5A 4AWXB 3F8NA 2VXZA 2STWA 3T0YA 1O3SA 1IF1A 3QU3A 4KIBA 4RB3C 1AOYA 3HIFA 4MTDA 1TQIA 3V8LA 4KA4A 2UXXA 4YFNF 2PMHA 4ENNA 3EQLF 3WTTC 5LHGA 1FC3A 1ZHFA 3BZ6A 2RN7A 1SFXA 3KP7A 3GUDA 3HSRA 2GQQA 5L3BA 5HVQC 3OOPA 1D5VA 2DFIA 2DO7A 4HX7A 4EMSA 3WODF 3KLOA 3HHHA 5LRSA 4LJZF 4ASNA 1MJBA 1R1TA 3BROA 2HFHA 1B4AA 2PI0A 1YYVA 3U2RA 1BIAA 1I27A 3HTUA 3KCCA 4KT5C 5FLXZ 1XMKA 4IVNA 4MQVA 5EEHA 1IZ1A 1ZAOA 5DDGA 3LWFA 4M9SA 1BI2A 3F8MA 1P4WA 4OIOF 3HRTA 1XDSA 3MCZA 2ACJA 4RGRA 1U8RA 3NEUA 1LNWA 2VONA 2ZNZA 3RTRA 3CO6C 1LVAA 4ESFA 1O57A 4D0PA 4G6DA 4M9XA 1F4KA 3KP6A 5ILUA 5CVVA 3U9GA 5FGMA 2EWNA 2IA1A 2NNYA 2LNBA 4G6QA 1IAWA 1IN6A 3L2CA 4EJOA 1I1SA 4CICA 3TO7A 5D5VB 4L0YB 2R7FA 4HX8A 3RIRA 1IRGA 1G4DA 3QP5A 2KIUA 2EA2A 3ZMSA 4P5OA 4JK1X 2VBYA 1KQ0A 1FSEA 4N9HA 1TBXA 1EH6A 4KICA 1PP7U 1L0OC 2QQBA 2RNJA 3IRQA 4XRFA 1W7PD 2FA5A 2W24A 3LA3A 3I54A 4ESJA 4HDVA 4U0WA 1FBUA 2VC0A 1MJAA 3HSEA 5ED4A 3CTAA 2H6BA 1RUNA 1G6NA 2O61A 4MEYF 2LF8A 1ZH5A 2F2EA 5D5UB 2TDXA 1SFEA 1FWZA 1WKMA 3MWMA 5H6RA 5E8IA 4L5JA 3V8JA 3V4GA 1KU7A 4A0XA 5DD4A 4UUVA 2W25A 4I0AA 3DP7A 2ETHA 4M6YA 1WWXA 2XRNA 5CVUA 2OQRA 1BIBA 1FYMA 5HS8A 3GZ5A 4A5NA 2NRAC 4RB1A 4F7ZA 2IVMA 2GXGA 1YIOA 4R79A 4IRGA 4Y17A 5FFXA 4HA8A 4BYYA 3K0LA 4P96A 3HRSA 4EM0B 2BV6A 4Q47A 3GEZA 3J81K 3QRFF 3T8TA 1JE8A 4M6XA 2P7VB 1ZLKA 4HX4A 2UZKA 2PFBA 4Y13A 3FHZA 4WCGA 3IKTA 2ESHA 3I4PA 3GZ6A 2E7WA 3DKWA 4HLYA 3GYHX 3W6JB 1HSJA 1YW9A 2QVOA 2K27A 3N97A 1SAXA 1IXSB 3I59B 4AD9A 1TW2A 1LQ1A 2P5LC 4HYEA 3DV8A 3F8FA 1R36A 4JQFA 3SHFA 4EV0A 1D8KA 3BPVA 4M71A 1ZG5A 2GZWA 3GXOA 4O6JA 2LDUA 5HS9A 1XCVA 1KQ9A 5A2QK 4EJVA 2C6YA 1W4MA 2ZJ2A 2KJBA 1YG2A 2BEOA 2M1BA 4AIHA 1MDMB 1OYYA 2IRFG 4DNCA 2A5YB 4A0YA 4A5MA 1KU2A 2HOEA 1IXCA 1IN8A 1DP7P 1K79A 3GFMA 3L9FA 1DPUA 5LGTA 2ZBKA 2UWMA 5DCMA 2IW5A 4HZFA 4PGGA 2O3FA 3WE2A 3F21A 3ABTA 2P5KA 4L9JA 2ISYA 1S7AA 5KVRA 4G7ZF 4LGWA 1Z6TA 5K5OA 2CO5A 2YX7A 2ZCWA 1ON1A 2PG4A 4CO8A 4HQMA 3SZTA 2NS0A 3O6BB 1Z6RA 4GO1A 3W6KB 3IWZA 4IF4A 1TTYA 3HOTA 5TJJA 3LA2A 1YO5C 2Z33A 3D0SA 1K78A 3LFKA 2DQRA 2F5EA 4EJTA 1S7OA 2FMLA 2RVCA 3RI4A 2OQGA 3KZYA 4XSXF 1E2XA 2DPDA 2BBYA 3IWFA 4RB2C 2HWVA 5TRDA 3S2WA 1S29A 2KIFA 5FFZA 3J80Z 1I1GA 3KP3A 1MKMA 2HKXA 3U1DA 3V8KA 3HTSB 4KUMA 5ILVA 1R22A 5EEGA 2LKPA 2CFXA 3D5LA 2QZ8A 1T39A 1HKTA 1K78B 1WI9A 2XAGA 2K86A 3MZHA 3ROUA 1HXDA 1YW8A 4HDUA 1JXSA 1BI3A 4ENKA 3I71A 2COMA 3KE2A 4U0VA 3HUGA 3F8BA 4DQ2A 2IJLA 3B02A 4OINF 1USTA 2CYYA 5JI6A 3WTYC 5ICFA 2XIGA 4WX9A 1ZG1A 3N4MA 3DQVC 1PP8F 4MEXF 2A6HF 3JTHA 3ERED 4P9UA 1IW7F 4CHUA 4HW0A 2ESNA 5BOXA 1FP2A 4AIKA 4ZYEA 3CJNA 5D6EA 1HBXG 3GF2A 4WF2A 5E1ZB 2DLLA 1R58A 1XGNA 2YU3A 1XSDA 4KYWA 4LG0B 3GX4X 4RGSA 2M8EA 1LDKB 1V4RA 3LSTA 1STZA 4ON0A 2VOOA 1YFHA 2PLYA 4KN7X 4YFXF 3WG9A 2GAUA 2D1VA 2F5DA 1FYLA 3KLNA 1XB4A 2K7LA 4GGGA 2L3DA 2VN2A 4LLNA 2MH9A 3BPXA 2VODA 2Y48A 4CXFA 1BI1A 3JAMK 5BS6A 1LB2A 2PBIA 2FSWA 2CWEA 4EJWA 2FBHA 1BN5A 3FM3A 5HDGA 4I7HA 2Y0MA 3FWEA 2JPBA 3O2PE 1YQAA 3FXRA 3IHUA 2MLGA 1JGSA 3WGIA 2DI3A 2XAJA 1ZG3A 2MA3A 1J75A 2EA4A 2WV0A 3E3VA 3GWZA 3KP5A 2UXNA 4XLPF 5JVTA 4G8XA 3C18A 2XV4S 3JW4A 4O3MA 1BC7C 5DUKA 1KYZA 2CW0F 1KA8A 3HSFA 4FX0A 2IT0A 1OYWA 1ZREA 1EH7A 4RAZA 3E6BA
chains in the Genus database with same CATH superfamily
1JHFA 2DA2A 4LF7E 2ZKZA 2LBSB 2ZMEA 2R7UA 4XOTA 3DKXA 1TLHB 2F5FA 5JHUA 1FKAE 3I58A 3S1QJ 2R5YB 2XROA 5L3DA 3QG5C 1HCRA 5J40A 5IP7J 1EF4A 3A1YA 3HRMA 2QBYA 1FMWA 2M87A 2DPUA 3S1MJ 2HJJA 2JR1A 3G1MA 2LV2A 4LG3A 2XRLA 2L4AA 1G3TA 5EZGA 2RV8A 4KFCA 3JTZA 3MHSC 4BJ5C 2H94A 1UAAA 2LK2A 3MEXA 4Y33A 2LY9A 3L2RA 2M0MA 3CCRI 3DBRB 2IAIA 3TDUC 1U9NA 2AQFA 3CP2A 1P4AA 2UU9E 3BG7A 1LEAA 1Z91A 4XIDA 2EPXA 4Y4RA 1ZR2A 3FMSA 1FP1D 2W1OA 4LG0A 2JVAA 2E60A 5AC4A 4BQOA 2BY2A 2O7OA 4RLFA 1PYVA 2F4VE 3OMYA 5BPIA 3H09A 2FE3A 1RNLA 2L4MA 2ZXWH 3C1DA 3SQNA 1IRXA 1VFCA 1PUEE 4A3LJ 3ZN0A 1JTYA 1MMGA 2HI3A 2XAUA 1A1JA 1HKSA 2BXYA 2FX0A 3OY9A 3IH3A 2EIJH 1IN7A 1Y56A 3G73A 4OOIA 4C3JJ 2LKXA 3WU0A 1A1FA 1S5LC 4BXUA 3HGGA 3S8PA 2VKEA 1BA5A 2XKPA 3VK6A 1VQ5I 1CQTA 1OR7C 4A0ZA 2R7RA 2Q2EB 4N0BA 1X1DA 2JUCA 2Q0OA 3EETA 3BF2A 1BM9A 6PAXA 4F9BB 4XMYA 4BQNA 4FCYA 4LF8E 5E3OA 4NC6A 1KU3A 3H3ZA 2LY2A 2M34A 3I53A 4IHYA 3H5NA 3T1HE 3THNA 2UUZA 3CCJI 4IKFA 2EPMX 2HVSA 3JSOA 2FXAA 4N9IA 2IBDA 1R5GA 1QU6A 2NYXA 3ZMZA 3ESWB 2LKSA 4XLNF 2HVQA 3ECOA 2W4SA 2ELKA 4RAFA 4XN0A 4ZZDA 1FOKA 2DTRA 2YS9A 2DOAA 1T08B 3MFKA 3OR2C 2JMWA 3ZRGA 1VQ8I 3QAHA 3HOSA 2D2WA 3HOVJ 2EMYA 1ZU1A 3ERMA 3G2BA 1H9TA 1JTXA 2GLIA 2I9IA 3LQQA 1JKRC 2BGCA 2DMQA 2L9NA 3QYFA 2W48A 4N4OB 3WU1B 5L3CA 1LE8A 4F55A 3E5XA 2LJUA 2IA0A 3CMMA 2OTLI 3TDZC 5BQTA 2L92A 2ME0A 4UV8A 1POGA 3R60A 3H3UA 4KHPE 4BJ6C 1R71A 1B9NA 1EKEA 4XSZF 2EOYA 4ZDOA 3KX2A 4IPAA 4FHTA 4CYCB 4IXAA 4DMIA 2A68F 2JOBA 2NUEA 3EPJA 3F6VA 3IC7A 4B8XA 1IN4A 2PX9A 1GQEA 5F6FA 2EZKA 2RDPA 1S72I 4RAGA 3R4KA 5AONA 4FX4A 3K4NA 3MD2A 4IHXA 1HC8A 1Q1VA 2EM0A 3FXOA 2EM2A 2QQAA 5L3EA 2BVLA 5H6QA 1G3SA 1TNSA 4LB5A 4XLEA 2WBMA 4M74A 3GTLJ 4FQGA 4DBQA 2IPQX 2DT6A 3HC7A 2KDZA 4ENMA 1P6RA 3V7CA 2WY8Q 2KKOA 4G7HF 1PJRA 3HB9A 4R1HA 4KNYA 2YTFA 4OIPF 1BBGA 3A0BC 1YUJA 2VJIA 3BOQA 4R2RA 3K4BA 1FYKA 1D1CA 5ILSA 2V1DA 3BR3A 3WHCA 2LE2A 4KDPA 3HPHA 2J5PA 2IXSA 2X4HA 3BR0A 3PNTA 1IBLE 2DRPA 2AXLA 4LB6B 2QYOA 2EFQA 3AFHA 3WE3A 2VQFE 2V6CA 4ZYGA 1W7PA 3HKZA 2DOEA 2EMAA 1W0TA 2VT3A 1IDZA 2K9MA 1AWCA 4O5GA 2ELYA 2JRTA 4A2UA 1U2WA 2CQKA 2M4KA 4WFTA 3V7RA 3K4CA 1ZBQA 1N32E 3KP2A 4XICA 1O3TA 1XN7A 1NK3P 5M3MJ 4OMYA 2LMZA 2LYCA 2IEKA 2EJRA 3HBLA 4MNUA 5LHIA 5E3NA 1XD7A 4IRHA 4BU2A 2L7KA 5JFRA 1H0MA 4KN4X 3JRHA 3QODA 1RZ4A 3KZZA 3O8HA 4YG2F 1XSXA 2R76A 2DCEA 1UMQA 2DMUA 2ELHA 1I6XA 2HPIA 2ZXJA 3BQZA 1ZLJA 1Z05A 4C3IJ 2HEOA 3S32A 5D4SA 2LO3A 1HSTA 5LGUA 3OIOA 2L3CA 3RYPA 2PEXA 2OAZA 1WXRA 1E17A 3BWGA 1QPMA 2EOSA 1O3QA 4R2AA 2DMNA 2UUCE 1QPIA 2EMIA 3QOEA 2FRHA 3KP4A 4KIFA 2IGMA 4N4NB 2EK5A 3V7SA 3JRCA 4BC7A 3M1EA 2MLKA 1VNDA 1WJ5A 3HZJA 3LLHA 5D4RA 2HQ5A 2RPCA 4MFEA 2O8KA 3S2HJ 3K2ZA 4Q4ZF 3BR6A 5FKKA 2EB7A 1O0WA 2UXBE 2E36A 4L9NA 3WTWC 2E1MA 5KL4A 3HQ1A 4GCVA 3H9GA 5GPAA 2YT4A 5AC5A 3BJOA 3VDXA 3M8FA 4YRVA 4JI4E 3JSPA 4LK0F 5EF6A 2EILH 1XX5A 2R7OA 5K7ZA 1NH3A 4UHTA 3PJRA 2MDRA 3FISA 1F1ZA 3IH2A 1YIJI 1YLFA 3JRGA 1NK2P 2AS5F 3BG6A 1OR7A 2F5VA 1A36A 5KAIC 3ZQQA 5HOOA 3S3OA 1J59A 2PMZA 4B44A 1K7AA 4BH9A 2V9PA 2E1NA 2H36X 3VYRB 4Z2YA 4E70A 1DGWY 4DV1E 1NCSA 2ZFWA 4I0BA 1RRJA 2YRHA 2P4WA 2EMXA 2L5QA 3KWRA 3LMLA 3F72A 3DTKA 3QPTA 2M45A 1IMUA 2PJPA 2V83A 2PMZN 4UXNA 4L5IA 1X3UA 2HXIA 1HKQA 3WTVC 3F23A 2HGCA 3F6HA 3CF2A 5CVRA 4CCOA 3Q5FA 1OMIA 2L9SA 3PFIA 2J7JA 2M1SA 4LLLA 1ERDA 1F36A 5LGNA 4EM1A 4JBAA 1M1EB 2VB6A 4A3JJ 2VBZA 1JHHA 2B3TB 2HZTA 2VC1A 3GLXA 1IN5A 1U5TC 4R03A 1GVJA 3ZQHA 4GYGA 2XASA 4RM3A 3E5UA 1ZRCA 2H09A 4OU0A 4ZYDA 4B47A 1DU6A 1D0XA 3G3ZA 3BCBA 4I8OA 3M99B 4F2JC 5FD6A 1A04A 1CF7A 4YFKF 2E2HJ 3BGHA 2CMPA 2IP2A 3L2QA 2QKMB 3VYYA 5EGOA 4Q48A 4U7DA 4UVBA 2ECBA 5E3LA 5IOYA 2FUG2 1Z9CA 2YTGA 1Y6IA 1QQIA 3IP4B 1QZZA 2HS5A 4RA2A 2CUFA 3IRRA 3FMQA 4I01A 3BR5A 2L6MA 3C4BA 3AL0B 2DGCA 3FF5A 3FK6A 2D9HA 5M5WJ 1BOAA 2EOJA 4ESBA 2R3SA 5HLIA 5CJ9A 1LKXA 2DFEA 2LBFA 2FTXB 2YRKA 3DTEA 5JR3A 1RUOA 1BI0A 2FD5A 4JI8E 4RS8A 1SVMA 4PJMA 1J2XA 2EM4A 2EM6A 2QENA 3R6SA 3OS1A 4H0EA 1X5WA 1ZN2A 2KRFA 1U78A 2Y9ZA 4YY3E 5AIQA 4Q5SF 1FLIA 1N75A 2Z16A 4A3MJ 1UHSA 2V88A 4EQQA 1TW3A 4ZTJA 4AIJA 1YS6A 4LLGF 2KPMA 3ABLH 2QKLB 2MBFA 2VKVA 4G6TB 2YX4A 1ODDA 4DV7E 1I5ZA 3ABUA 1UCRA 2LF7A 2ZJQF 2M30A 1X48A 3FBNB 3GZNB 1ZGWA 3CMEI 2WV1A 4HPQA 1YPNA 2O6GE 1T56A 2FJ1A 2LY1A 3R0AA 3W3CA 2EQRA 2EZHA 4YELA 1X1BA 4DOZA 4UV9A 2DLKA 2R7DA 3K6GA 4TUGA 2LSOA 3L00A 5ADZA 2MH2A 5A69A 2YR2A 1X2MA 4NC8A 1F2IG 2N3HA 5GAEJ 3MZ8A 1E0EA 5J4VA 2KFDA 5J8FA 5E3MA 3EYIA 3GTKJ 2BY3A 4W1UA 2YPRA 5LD2C 5CKTA 1YJNI 2JRMA 3TP3A 3M4OJ 3VEPA 2EM3A 3I4NJ 1P47A 1DGCA 2PJRA 1H9GA 4IS1C 2Z5UA 4Z6YA 3M8EA 3C3WA 2BHYA 3JTGA 1KYWA 3OYNA 1R6RA 2O0YA 3ONQA 3R0JA 2VQHA 3AG3H 2QSGX 5CLSA 2EMGA 4NXNE 2XGXA 3OTOE 5E1WA 1ON2A 2PQ8A 1TC3C 2TCTA 1GHCA 5K7HA 1U0JA 4A6DA 3OSFA 4GFBA 4X64E 4IJAA 4M73A 3CCUI 2HPMA 1Z3XA 4JI1E 3IKVA 2KOUA 1HA8A 3BC8A 4LD5A 1WZ2A 2CU7A 4B3SE 2HYFA 4IHWA 2K3PA 4U0YA 1B72B 2CSHA 5DS9A 1A6QA 3EUKL 3LSPA 2EM5A 5HLGA 1ZBTA 5D5XB 2EOZA 2HNHA 3DPUA 3O8GA 2B7EA 2COBA 2X6YA 4BXXJ 2FGGA 3S15J 1TWFJ 3T1YE 2LTSA 5KAFC 1B59A 1T0FC 1R4MB 3VODA 4CUGA 1IBME 4IOAF 4UUSA 2K7IA 2M9AA 4ZJZA 1JUMA 1XDUA 3CDHA 3SFZA 5LEJA 1NHAA 1VI0A 2V86A 4LFAE 2OPTA 4CCLA 3F8CA 4WSPA 2EFPA 2HDWA 1FJLA 2GWRA 4BHCA 3J7YJ 4W97A 4I76A 1YSAC 3DEUA 3PUBA 4IZZA 4AVZA 1UELB 4F3QA 3RPUA 4BDZA 3OYBA 1VZ0A 3ZR8X 2Q8KA 2N8GA 4LIVA 3LA7A 4H4KC 3TKYA 4LMYA 1TP4A 2XHKA 2RSMA 1W7PB 1XNQE 2Z9OA 2EOXA 3MSWA 4BC9A 1I39A 2FMYA 4QWQA 4EM2A 5CVJA 2EN7A 1UG0A 4D1QA 2EN4A 1NTCA 1RKTA 2R7VA 3PQJA 1ETXA 2VQCA 1YUIA 1B1BA 3CCYA 2CUEA 1MJ9A 1FBQA 2A3SA 3SEQA 1G8XA 3K70D 4DR2E 3OWTA 1OCTC 4RH8A 1FX7A 2KJCA 3A01B 1JKQC 2QWWA 1I3QJ 3BZKA 3CMYA 2IS1A 4FE4A 5L3GA 3X2QH 4ZYHA 1GT0C 4NBQA 2VBWA 3E6CC 3ZN1A 1JK1A 2EPAA 3NQOA 3CF5F 1PKPA 4AC0A 2QSHX 3M1CA 2JWTA 1PVEA 3CLQA 1UILA 4QSHA 4B4CA 4DV5E 2VPLA 5HLHA 3KETA 3H9JA 3K1NA 3LSHA 4MTEA 1O7FA 4XBFA 3BBGA 3JRFA 3ZQ7A 3BY6A 5E79C 5EZHA 2GA1A 3RCOA 2QA4I 1SC7A 5BMZA 2ZJPF 1W0UA 4F54A 1QNTA 2XPWA 4XKWA 2F8BA 3E97A 1TF3A 4KMFA 2E7XA 4BJTA 2XGCA 5IXMB 2F4OB 2LTPA 4S0HB 4XLCA 3BJAA 2IGNA 3J80K 3PO3J 2DK8A 1USSA 3ZMUA 1YRNB 3PSIA 2XAFA 2A61A 2CH0A 3VPRA 1WHNA 2YTPA 1FNNA 4ETSA 2M0CA 3F6OA 4BL0B 1VQMI 4DGWB 3WTSC 4NHRA 4GKJE 3C2HA 4IRIA 2JP9A 3J80C 2KIMA 3BTIA 1MZBA 2FBIA 1SD7A 1CF7B 4B48A 4CGZA 1TQPA 3K69A 5DD8A 3VSKA 1XGMA 1D1AA 3ISPA 4O5VA 5E20A 4UNOA 2EORA 2CQ7A 1EH8A 1WJFA 3WHBA 1T4NA 5DCFA 3S3MA 3ZOBA 3CD6I 4HEIA 2EMLA 4DV0E 4G9YA 5BPDA 5DCMB 4LFBE 2EQ3A 2JPCA 3GLLA 3J81Z 1SFUA 2EPNA 1PUFA 1N77A 4FT8A 3ULQB 1BW5A 2VJ5A 2BW3B 1XGSA 1MNDA 4WYQB 2Y69H 5J6XA 2W85A 1R23A 4CCMA 3DF6A 1H89C 1QVTA 3H5RA 5CYVA 2HQAA 2YTIA 2XC7A 2HQRA 3HHGA 2D45A 2EL6A 2JY9A 5LMUE 1RPWA 4A6EA 1ZRDA 2IHR1 3IAS2 2L33A 4RGUA 4U7BA 1FIPA 5BR8E 2DU9A 2DAOA 5CFFE 3I9V2 1SVLA 5IYCJ 1I6HJ 3CUQC 1D8JA 3QQAA 2LRDA 3H9QA 3CCVI 2CQQA 2VI6A 1F9NA 1QZYA 4PUSA 4XOPA 3WTUC 3HEFA 1J7KA 4L0ZB 2OA4A 3WG7H 3WGGA 2DIXA 3OMLA 3JRIA 2XAQA 4I09A 2OF7A 3GFJA 2DLQA 3DPTA 5ERIA 4KMUX 4FE7A 2MSYA 2TRTA 5FD5A 5FJ8J 3BTCA 3ML6A 3ELKA 5K5QA 2YWQA 3BT9A 2VE8A 2W7NA 3LMMA 2H6CA 2RGVA 4HEA2 4JV5E 3PNVA 3RPQA 3JU0A 2JA5J 2A07F 5GP9A 1KJKA 4NHJA 3LOCA 2R5ZA 2Y75A 3TEDA 2EFOA 2GBYA 4PK4A 2K4JA 4BS9A 1FTTA 3TQMA 1R9TJ 4DKKA 4EVIA 2LC2A 1CGPA 2EN1A 3IWDA 1A1KA 1DGRM 4HV6A 2CUJA 2MD0A 2XAHA 5CQGA 5LEKA 3UR3C 1FPQA 2L3JA 2HU9A 2FEZA 2HZDA 5AE2A 3FHNA 1QZEA 2MC3A 3A01A 1C0WA 2K9SA 4BY1J 1UHWA 3KYLA 1U3EM 2M3AA 2YTDA 3G71I 2BW3A 2A6EF 1X6EA 2R7WA 4M6VA 3C4TA 3CLOA 2R93J 3PQKA 4DV2E 1DDNA 2V89A 5FRNA 3I56I 4HBLA 1IRFA 5D8LB 1YX3A 1HNXE 1GV5A 5FO5A 3W2VA 4K2EA 4MGRA 1ZK8A 3D5SC 1R7JA 5K7FA 3ZP5A 1T98A 2WTEA 4HLXA 1S7EA 3CCLI 3FKJA 1YTYA 2VUMJ 1XMOE 2YSPA 5KK1A 3IWCA 3FXQA 4IEJA 2OD5A 1T38A 4JI7E 1U9OA 4R2CA 2W84A 5TSEA 5C4XJ 1T6SA 1QGPA 1SEUA 4MLQA 1T0FA 5GAHJ 3E7LA 3EPZA 3K1MA 4OMZA 3FZVA 2R92J 1QA6A 3JAMZ 4CZZA 3RYRA 3MN2A 2L54A 2GIVA 1X3CA 2EL4A 2QBYB 3BG9A 3LAPA 1WJBA 1R1UA 4ZH4F 5F0HA 2DFFA 3WTXC 4A3BJ 1WRJA 3DU5A 3V42A 3SEZA 2HHHE 2PJRB 5F3WA 4D7NA 2JVGA 4PCQA 1LLMC 2ZXHA 1MBKA 3S3NA 1Z7UA 2EM7A 3Q0UA 2KZGA 2AHQA 2ZNYA 3F0CA 4BHPA 2IGKA 1MNEA 3C7JA 2EMBA 3SZPA 3J7AG 2RC4A 3ECHA 2EOEA 1UFMA 4XONA 1TF6A 5K1YA 4C3HJ 3KEOA 4E7JA 1BW6A 5CPRB 3K10A 2EPOA 4ANJA 2YU8A 3LSKA 3C6KA 2G7UA 2DN0A 3DKYA 3P9CA 4TV7A 2H27A 3J7AO 4IHVA 3T8RA 2P8TA 1IV6A 1XGOA 2HYGD 4HF1A 3S1NJ 2YTNA 1VQ7I 3F3XA 1BJZA 1QBJA 2WAQA 2RQPA 3L09A 4JYKA 1LJ9A 4OIRF 3K1PA 5A6KA 3DXJF 4JI6E 1DI2A 3D5RC 1B9MA 1HQCA 1MBGA 3IL2A 2LVHA 2EL5A 3VFZA 2LOOA 3TGNA 2G0EA 1A6IA 1L3LA 4X62E 1RETA 2QM3A 5J8CA 3DWLE 2RAEA 3BJ6A 5E18F 1W36D 2ADRA 1WCMJ 3P5JA 2Q1ZB 3FMRA 4MQ9F 4NQWA 1W5TA 2FOKA 4PJJA 2CV1A 3AV0A 2GOMA 3NWTA 2ENAA 5J1UA 3Q0WA 2BYVE 1ONVA 5H20A 3ADGA 4IHTA 1YOVB 9ANTA 2M5WA 3HM5A 2UXCE 2PMUA 2X6WA 3FX3A 3P9KA 4II3A 5A6BD 1QRYA 2WB1A 1G3WA 3VYUB 3W2WA 1MIJA 1G3YA 2F48A 1UHMA 2XGEA 1Q1HA 2A05A 2GA2A 2JVHA 1MD0A 2HR3A 2E71A 2NAZA 2VRDA 4M3GA 4RB0A 2OBPA 2FQ4A 5B66C 1OCZH 4XR6A 2XKOA 1HF0A 1B6AA 5M5YJ 1REPC 3TOBA 4WXCA 3U21A 2K9NA 4BNCA 1P7JA 1MMSA 2K02A 2FQ3A 1V5EA 2CSOA 1YYWA 4RDUA 2DTZA 4I02A 4R2EA 2LJHA 4F9CB 2YTEA 1DPRA 4E7IA 3K6QA 2L0KA 1MMAA 2CG4A 2N3GA 3RMPA 1IJWC 1RI7A 3C2GA 4HOBA 5EG0A 4BAYA 4DV6E 2V79A 2E1CA 3QPLA 4I98B 1VF9A 3FXMA 1JKPC 4UVCA 2ZMEC 2P5VA 3AG4H 1GTKA 5E8GA 3CC2I 5F27A 3GTMJ 3Q0VA 3MZYA 1FEXA 3DJWA 2QQ8A 1IUYA 4B3ME 1YE9A 1BBOA 1NEIA 3QP6A 3QU6A 3REOA 2ZXIA 2Q8UA 2CQXA 2DBBA 5T6JA 3OYDA 3H3VK 2XUBA 1SD6A 2FU4A 2EPFA 4DUZE 2PN6A 4B3TE 2LVSA 2YU9J 2DA3A 4WSGA 1N34E 2ZSHB 1JK2A 3DBLB 4M3EA 2O8XA 2IA2A 1X4OA 1GXQA 1LVKA 2HXOA 4PGHA 1KZHA 5D6FA 1BBYA 3JR9A 1MBEA 3CC4I 1TNTA 2ENCA 1S3JA 4PJLA 1QO0D 2EV5A 2JK3A 1SD4A 5LL6R 3TO9A 2GIZA 2YTOA 1RESA 5AIPA 4QLCU 5HS7A 2KRHA 4YIRX 2ODRC 1S8NA 3VHTB 2M7AA 2Y2ZA 1SAUA 2ELZA 3MKLA 5DM7F 4KT6A 2ZC2A 2VE7C 1W5CC 5C4JJ 4E7KA 1FMVA 1AKHB 1S6LA 3TL4X 2MABA 2CJJA 1MDMA 5IP6A 2L02A 2RKHA 1RIOH 2UUAE 5B5EC 2CW8A 2HTJA 3ZMDA 5KL2A 4BBRJ 1ZARA 4ZZLA 2NVXJ 1B8IB 4Q35B 2I10A 3M7GA 2R5ZB 2M7BA 3Q9SA 1VTNC 1VQ4I 4V2GA 2EE8A 4EGYA 1I50J 1WJDA 5ICGA 5LLQA 2VQLA 3P9IA 4BHBA 1SMTA 3CCQI 1B69A 1P2FA 2WAQN 4UY8I 1UN6B 1U5TB 3MKZA 3BLYA 1MMDA 2YSRA 1YYOA 1R1VA 4HNVA 2VQEE 2DMTA 3WTZA 2EFWA 3ASNH 3FM5A 2WY7Q 2FV4B 2FBKA 3KIOA 2QUFA 1TWHJ 2JWOA 4G12A 4B09A 2ZO4A 2EOFA 2AO9A 4XL9A 1OPCA 2EV0A 1O4XA 3F9KA 1Y39A 3DPLC 3LAJA 1Z0XA 3AG2H 3CO7C 5EDNA 2EPZA 4LFCE 2EOHA 1PUFB 3KEYA 2H8WA 4MFDA 2ELJA 1J0RA 2CTDA 4BXFA 3K2AA 2UUBE 4LOCA 4L9TA 5IPAA 1OQYA 4RBOA 2R0QC 1WQ2A 4DJAA 2R7ZJ 4WWCA 3S93A 1FZPB 1SMYF 2ADUA 2MYSA 2GXBA 1KQ8A 1KGSA 1T95A 3GTQJ 1AH5A 2NA2A 2VXDA 2W00A 1K6YA 4PSXA 2EOOA 3OYAA 4HQEA 4L9VA 2L7MP 2MD5A 2W57A 2Z3YA 2NOJB 1HW5A 3K7AJ 4HSRA 4UVAA 5LRRA 4G7OF 4X8WA 4U88A 2BY1A 2NUGA 1UZCA 1D5YA 2JZYA 2JJ7A 4G94A 1XCBA 1D0ZA 2ID6A 5TISC 2VT2A 4Y15A 1U6GA 4OIQF 5ICEA 2EM8A 4CCJA 2DJIA 1IV8A 1N36E 2JN6A 4AQYE 2HGHA 3BP8A 1R00A 3EPHA 5FKLA 4XKCA 3MAJA 2DK5A 4EATA 1EV7A 3NRVA 1AU7A 3HRUA 3IV5A 2JSCA 2NNNA 4PSWA 3HOWJ 1X6HA 4YEJA 2HTSA 4Y52J 2DW4A 4BDYA 4BKXA 3AG1H 3WGHA 1MGTA 5J47A 3N05A 3BR2A 3R61A 3CZ6A 3H92A 1LDDA 1ZRFA 4R2QA 1D1BA 5HNFA 3CJQB 3O3KA 4X0GA 1J5YA 1YX5A 1Z1DA 3ABKH 1ZTRA 4MIMA 3BR1A 2L9VA 4XN3A 1N78A 5FLXK 3T5XA 2CGPA 2M9HA 1ZGAA 1Z7LA 2R4GA 2VBXA 4OAZA 4L18B 2RNGA 5M5XJ 4NQWB 5D5WB 2X48A 5CVIA 1IDYA 5A2QC 3ABMH 2ISZA 3FXUA 3OIPA 5LFAA 3MHHC 1LDJA 2B0LA 2ZMEB 1X6FA 2QLZA 1GLNA 1MH4A 1F5TA 1OFCX 1A1LA 2CUZA 1JT0A 1X49A 3I5UA 4RM2A 4X6AJ 2LCEA 5DTDA 1DUXC 2X1EA 1Z3YA 1Y8RB 5E17F 2M4IA 2STTA 3L7WA 4XM3A 1WJCA 4NDLA 4BBSJ 2JQ7A 4M72A 2XPUA 4KJZA 1V3FA 3FIWA 2KIQA 5FKNA 1QHHD 3ZMTA 1XMXA 3S16J 4V2FA 1SD5A 5IT3A 2JXPA 3QPHA 4HF2A 1HW1A 2HQNA 4YIIA 2WA0A 1H88C 2BE5F 4BQAA 1ETYA 4U87A 4LK1F 3SXYA 3CC7I 1R4NB 2XSJC 1D3YA 5FKMA 2EH3A 2DXIA 4CCKA 3LQRA 4DYCA 3DEEA 2VKDA 3M07A 5F64A 2L2MA 3MQ0A 3FXJA 4M9ZA 2V6EA 2OCCH 2NS7A 4I2OA 4XRMA 2KHXA 4J8ZA 4UUTA 2V1XA 2LTRA 2MG4A 1QU3A 4WXHA 1TQMA 4LFUA 2DQLA 1WPKA 2JT1A 2X1DA 5EGOB 1QVUA 2E1MB 2DT5A 2V9VA 4A3DJ 4EEFG 3P1XA 1MBFA 3K9TA 2EINH 2R7QA 4HV5A 3RZDJ 4LF6E 3VOEA 5FB2A 2L01A 3DFGA 3TP0A 1LUJB 2X6OA 2ZB9A 3SDBA 1O7LA 3OV8A 3HKZN 5LBQA 4DW6A 5L3FA 3T1BA 1P92A 3CQZJ 2FNAA 1ETVA 4DR4E 1XMAA 2Q2EA 2XSDC 4JI2E 3HYIA 5IT9K 3I64A 5EYRA 2R5YA 2OU2A 5DEQA 3P7NA 2ODRD 4L8NA 4NZVA 4GYIA 4RAYA 5J1RA 4JYAE 3ZPLA 1RR7A 3S17J 3TW7A 2A69F 2XF6A 3MKWB 1Y0NA 5D8KB 1G2HA 1WJPA 5ICCA 1MH3A 3LSMA 4GXOA 3CUOA 3ZGKA 2MC4A 1PDNC 3AAFA 2M8GX 2KHMA 3E6MA 1R5HA 4BQQA 4RGXA 4F91B 2F5CA 2XF7A 1ZYRF 4AM3A 2R7SA 4DV4E 2ZJRF 1VQ9I 2VE9A 4ZYAA 3B73A 2D1HA 4CSWA 4FASD 2VOPA 3HOUJ 1KU9A 1ZGJA 1BC8C 3HOYJ 2OZUA 2VKHA 4UB8C 5LHHA 3F22A 2DDBA 5E1XA 2XPVA 1YZ9A 1BJAA 3RKXA 4CDGA 4UB6C 4D9JA 4I6ZA 1EKZA 2I13A 1SFOJ 3J81C 4A69C 3VB2A 1A35A 4S05A 1YRNA 2EBIA 2DMPA 2EV6A 1OKRA 3DBHB 4P9FA 4S04A 1IRZA 1E3OC 4KWYA 5KL3A 1FOWA 2K3FA 2XDVA 1WFXA 2Z99A 2HKOA 2ID3A 5F1RA 1JUSA 1MMNA 2DSYA 1HR0E 3SFIA 5DNYA 1YI2I 4DR6E 1LPQA 3HOXJ 3OYMA 3M3YJ 4M9VC 1ETQA 3COAC 4EGZA 2CRGA 4A3CJ 4GZNC 1GDTA 2JOXA 4AVPA 2RSIA 2K4BA 3QYEA 5IOZA 4WXDA 3VYXA 2X0LA 1YW7A 3THOB 2L7ZA 2LREA 1YHQI 1PJQA 2NABA 4E6KG 1A5JA 4FTHA 2E2IJ 4F6NA 2EQ0A 2EMHA 3PUFA 3W2AA 1YS7A 4OWRB 4IOCF 1G59A 2LD5A 3DF8A 4JX4A 4A12A 3UKGA 4DYQA 1WSUA 1WH7A 3OYLA 3RZOJ 3ZMVA 4RMNA 4HAMA 5DV5A 4KZSA 3GBGA 3CCMI 2O03A 2A25A 2Z1DA 2EFNA 3GVAA 1HW2A 3E5QA 2XVCA 4GDFA 3HUGB 2V87A 1MNMC 5IYBJ 2B7VA 3NARA 1OYIA 2V9KA 4R8HA 1J9IA 3RPUD 2OC6A 3KEQA 1O3RA 1FT9A 3RKYA 4YIFA 1P4XA 3GW2A 1FY7A 3CUQB 2E72A 1U5TA 4B1RA 1JJ8C 2WBTA 2KONA 3HOZJ 4WK8F 1IUFA 3GFIA 3CMAI 2FNPA 1X3WB 1IXRC 2OCEA 4DZJA 1AKHA 4F9AB 2JPAA 1X58A 2X85A 2J5OA 4AYBA 4BACA 5IWAE 2KL4A 3TOAA 4LF9E 4AIDA 1MSFC 3GTJJ 3A02A 1UB9A 2DOFA 3KFWX 2B7TA 3PIOF 3BTLA 1K6OA 2YUSA 5DYMA 4DZPA 5A2QZ 3EYYA 1Z21A 2P6TA 2P7CB 1PJTA 2AQEA 2DODA 1W5SA 2OZ6A 2V4JC 4OAYA 1A1GA 4PDKA 4MHGA 5C3EJ 2V1UA 5K5RA 1TT5B 2G9WA 2L2OA 3H36A 3RKWA 4EJUA 3DLLF 1APLC 5KL7A 2W82A 2WBUA 4ENJA 2P0WA 3BDDA 2NUFA 3I59A 4IHSA 2L8TA 4HG2A 2K9QA 3MMYB 4CYDA 3S14J 2XGDA 5DUIA 3F6GA 3RJPA 4NB5A 3QOPA 3TO6A 4HSTA 2P6SA 2EOQA 1J5EE 1WJAA 2WB1N 2G7HA 5H2FC 4XRSA 4J19A 3EUHA 2E1MC 2D5VA 3AKZA 3CUQA 4P55A 1FTZA 3RDIA 3TQNA 2X51A 4AUXA 5GTIC 2DFHA 3DTIA 2JTVA 3KYCB 4Y7NJ 4HF0A 3Q9VA 1ULYA 5HDNA 4HTGA 2E5ZA 3PO2J 3GFLA 1GXPA 4DR3E 2JA7J 2EMZA 3E6DA 3NAUA 2WC2A 2HDCA 3RKQA 1IGNA 2KT0A 1Y0UA 1ZELA 2FF4A 2EZLA 2ICWG 2QQ9A 3QPSA 4PZJA 2BBGA 5IV8B 4JI0E 2WWYA 1FSHA 1TWGJ 2EOIA 1K83J 4MLVA 4ZC3A 3EDPA 1VQLI 4IL6C 1T2KA 1ZAAC 5IT9Z 5HDKA 3VWBA 1LEBA 4KIGA 1ZR4A 1XSVA 2KQRA 3I0TA 2HOTA 2BB8A 1UHZA 2VIXA 4Q28A 1FBSA 3M9AA 1L4SA 3GO5A 3RQ4A 4AWXB 2DMIA 3F8NA 2VXZA 2STWA 3T0YA 1O3SA 3IWBA 1IF1A 3QU3A 4KIBA 1IC8A 1IQSA 3S1RJ 2O5RA 4RB3C 1AOYA 3HIFA 3PM1A 5B1BH 2OV7A 4MTDA 3OYKA 1P9QC 1TQIA 3V8LA 4KA4A 2UXXA 1PJSA 4X65E 4YFNF 2CT1A 1P7IA 2PMHA 2NVUB 4ENNA 3EQLF 4FISA 3WTTC 5LHGA 4XK4A 1FC3A 3VSLA 4UUSB 3DU6A 1ZHFA 5JHFA 3BZ6A 4CCNA 1HLVA 2RN7A 1SFXA 2BVMA 1R49A 3KP7A 2EN2A 1YYKA 2LUQA 1ZKGA 3GUDA 3HSRA 1OCOH 2GQQA 5HVQC 5L3BA 3OOPA 1D5VA 1RMDA 3OOUA 2DFIA 2DO7A 4HX7A 4LF5E 4EMSA 2NVTJ 4X66E 3WODF 3KLOA 4R2DA 1UBDC 3HHHA 5LRSA 2DA1A 4LJZF 2LRSA 4F52A 3PIPF 4ASNA 2EPUA 2R7XA 1ITYA 1KYQA 1MJBA 1R1TA 5KNLA 3BROA 2NVYJ 2DT7B 3JRBA 2HFHA 4P78A 4YHHE 2YU5A 5FROA 1B4AA 1OCCH 2HOAA 5HNHA 1DU0A 1OCRH 2PI0A 1YYVA 3SYTA 1LFUP 2DB2A 2Y9YA 3G1LA 4A93J 2GHFA 4R8OA 3U2RA 1BIAA 1LFPA 2DA4A 2NVQJ 2EMCA 1I27A 3HTUA 3K4JA 2YSOA 3KCCA 1Z67A 4M3FA 1IO2A 2BY0A 4KT5C 4QPOA 5B1AH 3OYIA 2MGQA 4GKKE 1XMKA 1BR4A 4IVNA 5FLXZ 1YJWI 2RQLA 2GLOA 1BR1A 4MQVA 5EEHA 2CV2A 1H8AC 1IZ1A 4GEQB 2CS3A 1ZAOA 3OSGA 5DDGA 2L7FP 3LWFA 4M9SA 1BI2A 5F08A 3F8MA 1P4WA 1RC9A 2HYJA 3HRTA 3K4MA 4FETA 4OIOF 2EMFA 5GAGJ 2KISA 1XDSA 3MCZA 4JOMA 2ACJA 5B3SH 4RGRA 1U8RA 3NEUA 3LSRA 2QF7A 2MDGA 1LNWA 4E7SA 2VONA 1TN9A 2ZNZA 3RTRA 2KDOA 3CO6C 1LVAA 4ESFA 2R1FA 1O57A 4DUYE 2WAEA 4D0PA 1VQNI 2YRMA 4G6DA 4M9XA 2VL8A 4BGDA 1F4KA 2JYAA 3CDIA 3KP6A 1V5GA 5ILUA 1DQ3A 2M4GA 1EA3A 5CVVA 4XLHA 3U9GA 2E5LE 4DIQA 3TW6A 5AE1A 5FGMA 3JRDA 4ABZA 4PFPA 2EWNA 2IA1A 2NNYA 3UK3C 3S2DJ 2MC6A 2LNBA 3H1CA 1A1HA 1J26A 4G6QA 1R5ID 1IAWA 3OYCA 1IN6A 3L2CA 4EJOA 1MW7A 1I1SA 4CICA 3TO7A 5D5VB 4L0YB 2R7FA 4HX8A 5F04A 3RIRA 2B63J 1IRGA 1T33A 1G4DA 4DV3E 4F6MA 2DDAA 3QP5A 2DA5A 2IS2A 2KIUA 2EA2A 3ZMSA 2E5NA 3OYJA 2M2EA 4P5OA 1V5FA 4JK1X 2VBYA 4E7LA 2MFZA 4E7ZA 4ZDLA 4IQJA 1JGGA 4D5FA 1G2DC 1KQ0A 3FBIB 1FSEA 4N9HA 4O24A 3KYDB 3ECRA 2FOWA 1TBXA 3K70C 3HJEA 1EH6A 4KICA 2B9DA 3VYTB 1YITI 3IH4A 1PP7U 1L0OC 2QQBA 2RNJA 4B3RE 5AE3A 4I99C 3IRQA 4PJNA 1BB8A 4XRFA 4TUIA 3M8JA 2EZIA 3K4LA 1W7PD 2FA5A 5J1YA 4F93B 3ZQFA 5DM6F 2RQQA 3ZQLA 2V8QB 1I94E 2W24A 2E19A 3LA3A 2KMUA 3I54A 4HDVA 4U0WA 4ESJA 3ZQCA 1HDPA 1FBUA 2ECCA 2VC0A 1MJAA 4M0VA 4R2PA 3EPLA 3HSEA 5ED4A 4IQ4A 3HPZA 3CTAA 2H6BA 1RUNA 1G6NA 2O61A 4MEYF 2MKNA 1N3GA 2VQGA 4DR7E 3WU2C 4MLOA 2LF8A 2A5WA 1ZH5A 2F2EA 5D5UB 2RS6A 5KL5A 2TDXA 4D7MA 2CW7A 2EMKA 4CA0A 1SFEA 1FWZA 5EJCA 4LTYA 3KZIC 1ETOA 1WKMA 4DR1E 1WHQA 2AXTC 2JA2A 2EPRA 5GTHC 3MWMA 1N25A 5H6RA 2EIMH 5E8IA 4L5JA 3V8JA 4V19K 3V4GA 1KU7A 4XNFA 2EMWA 2ENHA 4A0XA 5DD4A 3J7Yp 4UUVA 2W25A 4I0AA 4QTRA 3DP7A 4XRSG 2ETHA 4F92B 4M6YA 1WWXA 2XB5A 2XRNA 5CVUA 2OQRA 1BIBA 2L9RA 5HS8A 1FYMA 1IG7A 1KONA 4M2ZA 1RC7A 2VF1A 3FXKA 3IAM2 2K4VA 3GZ5A 1ETKA 1X4PA 3CJRB 1A31A 4LF4E 2WCC3 4C30A 2DYSH 2KZVA 4A5NA 4JI3E 3HDDA 2YTJA 2JA6J 1GV2A 1MSEC 2NRAC 1DP3A 3SDGA 4RB1A 2CPNA 4X9JA 4F7ZA 2IVMA 4IJDA 2GXGA 1ENHA 1MBHA 1YIOA 1MBJA 3E0JB 4R79A 2LR8A 3QWLA 4J00A 3G4SI 4IRGA 3DEWA 4Y17A 5FFXA 1FIAA 4HA8A 1A1IA 5F1JA 1BL0A 4BYYA 2R7TA 1VQPI 3K0LA 5IYDJ 3LL7A 3GMEA 3LSGA 4P96A 1X1AA 2Y30A 3HRSA 4C2MJ 4FK5C 2ZM6E 4EM0B 2BV6A 1B8IA 1FOXA 3L2VA 4Q47A 3ZXSA 3GEZA 2BXZA 5FKOA 2EJ4A 3J81K 1AAYA 3QRFF 3T8TA 4BEHB 1JE8A 4M6XA 2P7VB 1ZLKA 2EPLX 4HX4A 2UZKA 2PFBA 3ASOH 5KCMA 4Y13A 4E4HA 5IT9C 2RREA 1WJEA 2I5UA 5JLXA 4AYBN 2P81A 1HDDC 1ZR9A 3FHZA 3NWSA 5FLVA 2DYRH 2X1CA 3CJTB 2X9DA 2F4MB 4WCGA 2GM4A 3IKTA 2ESHA 2LBFB 5J4YA 3I4PA 1VQOI 3GZ6A 2E7WA 3DKWA 4AU7A 4HLYA 3FKIJ 4ZTFA 3GYHX 3ZCOA 3W6JB 1TL8A 1HNZE 1SVOA 2E35A 4PFOA 2I8DA 2LFBA 1HSJA 1YW9A 4A3EJ 2QVOA 5C44J 2K27A 4M30A 1B72A 2F6CA 4B3AA 3SJMA 3N97A 1FJGE 1SAXA 1IXSB 2K85A 3I59B 1FOYA 1QHGA 1GZ6A 4AD9A 4BBYA 1TW2A 1V55H 1NG7A 2VJ4A 2IS4A 1LQ1A 2P5LC 2EN3A 4HYEA 3DV8A 1XTAA 3F8FA 1R36A 5FLMJ 3KPHA 2KLOA 5GPCA 4A3GJ 2EZ6A 2EN6A 3OYGA 1HOMA 4JQFA 1X19A 3SHFA 4EV0A 2E2JJ 3JAMC 1D8KA 1EJ9A 1J09A 4XKBA 3BPVA 1MEYC 4M71A 3HGYA 3BG3A 4JP0A 1ZG5A 2E34A 2GZWA 3GXOA 4O6JA 4BEHA 3AUZA 2LDUA 2ME6A 5HS9A 3H35A 2JUGA 2VPRA 1XCVA 1JI8A 1JJ6C 1KQ9A 3LFUA 4EJVA 5A2QK 2C6YA 2YTQA 1W4MA 2ZJ2A 3K4KA 2GPIA 3PL8A 2KJBA 1YG2A 2Y31A 2F4IA 2BEOA 2EM9A 2XF5A 2M1BA 4AIHA 2NOGA 1MDMB 1OYYA 5FLXC 2IRFG 1OLTA 4HNTA 4P7DA 4P1WA 4DNCA 3ZOQB 3IUOA 2A5YB 1WGXA 4A0YA 4A5MA 1KU2A 2VASA 4LU9A 2HOEA 2EP3A 1OISA 1SANA 1IXCA 2XB0X 3A03A 3FK7A 3OYHA 1IN8A 1DP7P 4BUPA 1K79A 3CCSI 3GFMA 2EPCA 3L9FA 1TT0A 3EPKA 2CFOA 1Y1VJ 1DPUA 4K0KE 2Y0SA 5LGTA 2ZBKA 2UWMA 4A3FJ 5DCMA 2IW5A 5AASA 3G1OA 3PFYA 1Z77A 4A3IJ 4QIWN 5F0CA 3OIQA 1GUUA 4HZFA 4C2UA 2LUPB 3I55I 4PGGA 1WHUA 3BQYA 2O3FA 4XQFA 2EPPA 1JT6A 5HLTA 3WE2A 3F21A 5A6JA 1E3PA 3ABTA 4O43A 2WAFA 1RKWA 2P5KA 4L9JA 2DA6A 2ISYA 2K40A 2BZTA 4NUBA 3TMOA 4E7HA 1S7AA 3LNQA 5KVRA 4B43A 4G7ZF 2WADA 4II2A 2YZTA 3HXLA 1Z6TA 2V1NA 4LGWA 4XLAA 1X1CA 5K5OA 2CO5A 2YX7A 2ZCWA 3C2BA 1T4OA 1ON1A 2PG4A 4CO8A 4HQMA 5IY5H 4ZDPA 3SZTA 2Y0SN 2NS0A 2EN8A 3O6BB 3U1KA 1Z6RA 3CESA 4GO1A 3BCAA 2UV1A 4WPYA 1NG6A 2KP6A 5HODA 2YPNA 5F0FA 3OS0A 3W6KB 3LSJA 3IWZA 4IF4A 1TTYA 1XS9A 3GTPJ 3HOTA 5TJJA 3G6EI 3LA2A 3J7AY 1YO5C 2Z33A 2CV0A 3D0SA 1K78A 3JREA 3LFKA 2DQRA 2F5EA 2ZFUA 3E1SA 4DYRA 2IS6A 4XORA 3VYSB 2HC5A 2B9SA 4EJTA 1K4SA 2L2KB 4OX9E 2OUMA 3A0HC 5JVGF 1WH5A 1S7OA 2FMLA 2H1KA 1TWCJ 4D5CA 2DJNA 2RVCA 5GADJ 3RI4A 1F43A 5IP9J 2CQNA 3D1NI 2NS8A 2OQGA 3KZYA 4XSXF 3H0DA 1E2XA 2DPDA 1S9HA 1VQKI 1RQ0A 2BBYA 3IWFA 4RB2C 2HWVA 4M3DA 5TRDA 2EQ1A 2EPKX 3S2WA 1S29A 1K61A 3Q3SA 3H0GJ 4JI5E 5J3LA 2KIFA 5FFZA 2OTJI 3J80Z 2PRTA 4DBRA 2LG4A 3RQIA 1ZQ3P 2HDDA 3BG5A 1I1GA 4HRIA 3KP3A 1MKMA 3RSNA 4L5NC 2HKXA 3AL0C 3U1DA 3V8KA 1X2NA 3B6CA 3HTSB 2ZSIB 4KUMA 3EQ1A 2BOLA 4N4RB 5A6BA 4CZCA 5ILVA 1R22A 1ORKA 1X3ZB 5EEGA 4IO9F 2LKPA 2CFXA 3BTJA 4Y3OA 5EEAA 3D5LA 2QZ8A 2VJJA 1LE8B 1T39A 1HKTA 3QYBA 1K78B 2X6XA 2K9LA 3UNGC 3CP8A 4NC7A 4B3XA 1WI9A 2XAGA 2K86A 3C6MA 4A3KJ 3MZHA 1T8IA 3ROUA 1IQOA 4ITVA 1HXDA 3FXLA 1YW8A 4QPQA 3A2KA 3I3LA 1V54H 1AA7A 2NXNB 4HDUA 1JXSA 1DQUA 1BI3A 2LP0A 2WZOA 4ENKA 3I71A 1ETWA 1JKOC 2MC5A 2COMA 3KE2A 4U0VA 4C9YA 3HPGA 1PDAA 2DMYA 3HUGA 1SR9A 2Z2SB 3F8BA 4DQ2A 3BIDA 2H1LA 2IJLA 4CYCA 5A6AA 3B02A 4OINF 1N33E 3L2WA 3OYEA 1USTA 2CYYA 5JI6A 4BY7J 3WTYC 4PJ0C 5ICFA 1XG1A 2XIGA 4WX9A 2V85A 1ZG1A 4LITA 3N4MA 3L1PA 2QCOA 2QSFX 5BNGA 1XC5A 2IGOA 3DQVC 4BE2A 1PP8F 2UXDE 4MEXF 2A6HF 3JTHA 3ERED 4P9UA 1IW7F 4CHUA 4HW0A 3GTOJ 2ESNA 4DR5E 3DCFA 2JA8J 5BOXA 1IBKE 2GOXB 4X1EA 1TZLA 1FP2A 1WVRA 2LMDA 4AIKA 4ZYEA 3CJNA 3OR1C 4XKVA 5D6EA 4WF2A 3GF2A 1HBXG 3A4CA 1XPXA 2EWLA 5E1ZB 3W6VA 3L2UA 4J01A 5KL6A 2DLLA 2MKDA 3OL3A 4O4KA 1R58A 1XGNA 2YU3A 2VLAA 1XSDA 4KYWA 5M3FJ 4LG0B 1E3HA 2V26A 3GX4X 1OJLA 1RR8C 4RGSA 2M8EA 1W1WE 3H5AA 1U8BA 1LDKB 3HG9A 2O9LA 3ZQGA 4HNUA 1G2FC 1V4RA 3LSTA 1STZA 4ON0A 3ZQIA 3DLAA 4KISA 2VOOA 1YJ9I 1YFHA 5FRMA 4NNJA 2K5CA 2PLYA 1T4LB 4KN7X 1BR2A 3CDLA 3PNYA 2HOSA 4YFXF 1GVDA 3FDYA 5KHDA 1OCPA 1X1PA 2QGUA 2L2NA 3WG9A 2V7FA 2GAUA 4GRIA 1STUA 2D1VA 2LH9A 5JLWA 3HTXA 2F5DA 3MVPA 1FYLA 2GXAA 3KLNA 1XB4A 2LLKA 2K7LA 2KRCA 4GGGA 2L3DA 4RHBB 2VN2A 1Z1BA 3OL4A 4LLNA 1LFBA 3ADJA 2MH9A 3HL2A 3JCUC 1XNRE 1XMQE 3BPXA 2VODA 2QEXI 1ACIA 2Y48A 4BCAA 4NXME 2E1OA 3B6AA 4JX6A 4CH7A 3JRAA 4CXFA 1BI1A 3JAMK 5BS6A 1LB2A 3LSIA 1I3AA 2PBIA 4BE0A 5TGTA 1BOBA 2FSWA 3PSFA 3MKYB 3OS2A 2CWEA 4EJWA 2H8RA 2FBHA 1W36C 1BN5A 3FM3A 1Y8QB 4RLQA 5HDGA 3HPSA 4I7HA 4JX5A 2HVRA 3GCMA 2MW8A 2Y0MA 3FWEA 2JPBA 4LIUA 2EOMA 3GTGJ 3EUAA 3O2PE 1YQAA 1Y1WJ 3J7ZI 1UJ8A 2M7QA 4L5EA 3EUHC 1JUPA 1TWAJ 4BE1A 2DA7A 3FXRA 3IHUA 1WI3A 2LT7A 2JSPA 2MLGA 4KITB 1HNWE 1JGSA 3WGIA 2DI3A 1K4TA 2XAJA 3FIGA 3ADIA 3BZCA 1ZG3A 2N8XA 2MA3A 1J75A 2EA4A 2A6TA 3GWZA 1SFKA 2WV0A 3E3VA 5CQEA 3CCEI 3KP5A 2UXNA 4XLPF 4R2SA 5JVTA 4IX7A 4OOGC 4G8XA 4MO7A 5EG0B 1AHDP 3C18A 5LMNE 2RTXA 4C2TA 3TBIA 2XV4S 3JW4A 3SZGA 3ADLA 4O3MA 2WBSA 3I4MJ 1BC7C 5DUKA 1KYZA 2CW0F 1KA8A 3HSFA 2BHZA 4FX0A 2IT0A 1UG2A 1OYWA 2RS7A 3OYFA 1ZREA 1X47A 1EH7A 2EIKH 2OJED 4M3BA 1D0YA 1VQ6I 4RAZA 4XLFA 4BMJA 3E6BA
chains in the Genus database with same CATH topology
1JHFA 2ZKZA 2ZMEA 1TLHB 2F5FA 5JHUA 3I58A 2XROA 5L3DA 3HRMA 2QBYA 2M87A 2DPUA 2L4AA 1G3TA 4KFCA 2RV8A 2H94A 3MEXA 3TDUC 1P4AA 1LEAA 1Z91A 3FMSA 1FP1D 4LG0A 5BPIA 2FE3A 1RNLA 2L4MA 3C1DA 3SQNA 1PUEE 3ZN0A 1HKSA 1IN7A 3G73A 4OOIA 3WU0A 4BXUA 2XKPA 4A0ZA 4N0BA 2Q0OA 3EETA 1BM9A 6PAXA 1KU3A 3H3ZA 3I53A 3JSOA 2FXAA 4N9IA 1R5GA 2NYXA 3ZMZA 4XLNF 3ECOA 4ZZDA 1FOKA 2DTRA 3MFKA 3QAHA 3HOSA 2D2WA 1H9TA 3LQQA 2BGCA 3WU1B 5L3CA 3E5XA 2IA0A 3TDZC 5BQTA 4UV8A 3R60A 3H3UA 1B9NA 4XSZF 4IPAA 4FHTA 4IXAA 2A68F 3F6VA 3IC7A 4B8XA 1IN4A 5F6FA 2RDPA 3R4KA 5AONA 4FX4A 2QQAA 5L3EA 5H6QA 1G3SA 1TNSA 4LB5A 4M74A 2IPQX 4ENMA 1P6RA 3V7CA 2KKOA 4G7HF 4R1HA 4KNYA 4OIPF 3BOQA 1FYKA 5ILSA 2V1DA 4KDPA 2J5PA 2X4HA 2AXLA 4LB6B 2QYOA 2EFQA 3WE3A 2V6CA 4ZYGA 1W7PA 2VT3A 1AWCA 2JRTA 4A2UA 1U2WA 2CQKA 3V7RA 3KP2A 1O3TA 1XN7A 4OMYA 2EJRA 4MNUA 5LHIA 1XD7A 4IRHA 5JFRA 1H0MA 4KN4X 1RZ4A 3KZZA 4YG2F 1XSXA 2ELHA 1I6XA 2ZXJA 1ZLJA 1Z05A 2HEOA 5D4SA 1HSTA 5LGUA 3RYPA 2PEXA 2OAZA 1E17A 3BWGA 1QPMA 1O3QA 2FRHA 3KP4A 4KIFA 2EK5A 3V7SA 3M1EA 2MLKA 5D4RA 3K2ZA 4Q4ZF 2EB7A 4L9NA 3WTWC 4GCVA 3BJOA 3M8FA 3JSPA 4LK0F 4UHTA 1F1ZA 1YLFA 2AS5F 1OR7A 5HOOA 1J59A 1K7AA 4BH9A 2E1NA 4Z2YA 4E70A 2ZFWA 4I0BA 2P4WA 3F72A 3QPTA 2M45A 2PJPA 4UXNA 4L5IA 1X3UA 3WTVC 1HKQA 3F23A 2HGCA 5CVRA 3Q5FA 1OMIA 3PFIA 4LLLA 5LGNA 4EM1A 4JBAA 2VBZA 1JHHA 2HZTA 2VC1A 3GLXA 1IN5A 1U5TC 1GVJA 4GYGA 2XASA 3E5UA 1ZRCA 2H09A 4OU0A 4ZYDA 3G3ZA 5FD6A 1A04A 1CF7A 4YFKF 2IP2A 4Q48A 4U7DA 4UVBA 1Z9CA 1QQIA 1QZZA 2HS5A 3IRRA 3FMQA 4I01A 3FF5A 1BOAA 4ESBA 2R3SA 5HLIA 5CJ9A 5JR3A 1RUOA 1BI0A 4RS8A 1J2XA 2QENA 3R6SA 4H0EA 1ZN2A 2KRFA 1U78A 5AIQA 4Q5SF 1FLIA 4EQQA 1TW3A 4AIJA 1YS6A 4LLGF 2MBFA 2YX4A 1ODDA 1I5ZA 3ABUA 1UCRA 2LF7A 2M30A 2O6GE 3R0AA 4UV9A 2R7DA 2LSOA 3L00A 2MH2A 2YR2A 5J8FA 3EYIA 2YPRA 3VEPA 1H9GA 2Z5UA 3M8EA 3C3WA 3JTGA 1KYWA 2O0YA 3R0JA 5CLSA 2XGXA 5E1WA 1ON2A 2PQ8A 1GHCA 4A6DA 4IJAA 4M73A 3IKVA 4LD5A 2HYFA 4U0YA 5HLGA 5D5XB 1B59A 3VODA 1XDUA 3CDHA 3SFZA 5LEJA 1NHAA 3F8CA 2EFPA 2GWRA 4BHCA 3DEUA 3RPUA 2Q8KA 3LA7A 3TKYA 4LMYA 2XHKA 1W7PB 2Z9OA 2FMYA 4QWQA 4EM2A 5CVJA 3PQJA 1B1BA 1MJ9A 1FBQA 2A3SA 1FX7A 2KJCA 2QWWA 5L3GA 4ZYHA 2VBWA 3E6CC 3ZN1A 3NQOA 5HLHA 3KETA 4MTEA 3K1NA 4XBFA 1O7FA 3ZQ7A 3BY6A 2GA1A 5BMZA 1QNTA 3E97A 4KMFA 2E7XA 3BJAA 3J80K 2DK8A 1USSA 3ZMUA 2XAFA 2A61A 1FNNA 4ETSA 3F6OA 3WTSC 4IRIA 2KIMA 1MZBA 2FBIA 1SD7A 1CF7B 4CGZA 1TQPA 3K69A 5DD8A 1XGMA 3ISPA 4O5VA 5E20A 4UNOA 1EH8A 5DCFA 4G9YA 5BPDA 5DCMB 2JPCA 3J81Z 1SFUA 4FT8A 3ULQB 1XGSA 5J6XA 2W85A 1R23A 5CYVA 2HQRA 3HHGA 2D45A 4A6EA 1ZRDA 4RGUA 4U7BA 2DU9A 2DAOA 3CUQC 1D8JA 1F9NA 1QZYA 3WTUC 4L0ZB 1J7KA 2OA4A 3WGGA 2XAQA 4I09A 3GFJA 3DPTA 5ERIA 4KMUX 5FD5A 3ML6A 3ELKA 5K5QA 2VE8A 2H6CA 2RGVA 3RPQA 2A07F 4NHJA 2Y75A 2EFOA 2K4JA 4EVIA 1CGPA 4HV6A 2XAHA 5LEKA 1FPQA 2FEZA 2MC3A 1C0WA 1UHWA 1U3EM 2A6EF 3CLOA 3PQKA 1DDNA 4HBLA 1IRFA 5D8LB 5FO5A 4K2EA 4MGRA 1R7JA 3ZP5A 1T98A 2WTEA 4HLXA 1YTYA 5KK1A 3FXQA 2OD5A 1T38A 2W84A 1T6SA 1QGPA 1T0FA 3K1MA 4OMZA 3FZVA 3JAMZ 4CZZA 3RYRA 2L54A 2GIVA 2QBYB 3LAPA 1R1UA 4ZH4F 3WTXC 1WRJA 4PCQA 1Z7UA 4BHPA 2ZNYA 3C7JA 3SZPA 2RC4A 3ECHA 1UFMA 5K1YA 3KEOA 2G7UA 3P9CA 4TV7A 2H27A 3J7AO 3T8RA 2P8TA 1XGOA 2HYGD 4HF1A 3F3XA 1QBJA 2RQPA 3L09A 1LJ9A 4OIRF 3K1PA 3DXJF 3IL2A 1B9MA 1HQCA 3VFZA 3TGNA 1L3LA 2QM3A 5J8CA 3BJ6A 5E18F 3FMRA 4MQ9F 4NQWA 1W5TA 2FOKA 2BYVE 1ONVA 5H20A 4IHTA 2M5WA 2PMUA 3P9KA 3FX3A 1G3WA 1G3YA 1UHMA 1Q1HA 2GA2A 1MD0A 2HR3A 2NAZA 4RB0A 2OBPA 2XKOA 1B6AA 1REPC 3TOBA 4WXCA 4BNCA 2K02A 2FQ3A 2CSOA 4I02A 1DPRA 2CG4A 1RI7A 4HOBA 4BAYA 2V79A 2E1CA 4I98B 4UVCA 2P5VA 5E8GA 3MZYA 1IUYA 3QP6A 3QU6A 3REOA 2DBBA 2XUBA 1SD6A 2FU4A 2PN6A 2O8XA 2IA2A 1GXQA 4PGHA 5D6FA 1BBYA 1TNTA 1S3JA 1QO0D 2EV5A 1SD4A 3TO9A 5AIPA 4QLCU 5HS7A 1S8NA 1S6LA 1MDMA 2L02A 2RKHA 1RIOH 2HTJA 3ZMDA 1ZARA 4ZZLA 3M7GA 1VTNC 3Q9SA 4EGYA 5ICGA 5LLQA 3P9IA 4BHBA 1SMTA 1P2FA 1U5TB 2YSRA 1R1VA 3WTZA 2EFWA 3FM5A 2FBKA 2QUFA 4B09A 2ZO4A 1OPCA 2EV0A 3DPLC 3LAJA 3CO7C 1J0RA 4L9TA 1WQ2A 4WWCA 1FZPB 1SMYF 2ADUA 1KQ8A 2GXBA 1KGSA 4HQEA 4L9VA 4UVAA 2MD5A 2W57A 2Z3YA 1HW5A 4G7OF 5LRRA 4U88A 2JZYA 4G94A 1XCBA 2VT2A 4Y15A 1U6GA 4OIQF 5ICEA 3BP8A 1R00A 3MAJA 2DK5A 1EV7A 3NRVA 3HRUA 2JSCA 2NNNA 2HTSA 2DW4A 3WGHA 1MGTA 3R61A 3H92A 1LDDA 1ZRFA 3O3KA 1J5YA 1Z1DA 5FLXK 3T5XA 2CGPA 1ZGAA 2VBXA 4L18B 5D5WB 5CVIA 2ISZA 3FXUA 1LDJA 2B0LA 2ZMEB 2QLZA 1F5TA 3I5UA 1DUXC 5E17F 2STTA 3L7WA 4M72A 1V3FA 3ZMTA 1SD5A 5IT3A 3QPHA 4HF2A 1HW1A 2HQNA 4YIIA 2BE5F 4BQAA 4LK1F 3SXYA 1D3YA 3LQRA 5F64A 3MQ0A 4M9ZA 4I2OA 2V1XA 4WXHA 1TQMA 4LFUA 2DQLA 2JT1A 2DT5A 2V9VA 3K9TA 4HV5A 3VOEA 5FB2A 2L01A 3DFGA 1O7LA 3OV8A 5LBQA 5L3FA 3T1BA 1P92A 2FNAA 1XMAA 2Q2EA 3HYIA 5IT9K 3I64A 2OU2A 5DEQA 3P7NA 4GYIA 4RAYA 3ZPLA 2A69F 5D8KB 5ICCA 4GXOA 3CUOA 1PDNC 3AAFA 3E6MA 1R5HA 4RGXA 2F5CA 1ZYRF 2VE9A 3B73A 2D1HA 2VOPA 1KU9A 1ZGJA 1BC8C 2OZUA 5LHHA 3F22A 5E1XA 1BJAA 3RKXA 4CDGA 3VB2A 4S05A 2EV6A 1OKRA 4P9FA 4S04A 2Z99A 2HKOA 5F1RA 3COAC 4EGZA 4AVPA 2K4BA 4WXDA 2X0LA 1YW7A 1YS7A 3DF8A 4A12A 1WSUA 3ZMVA 4HAMA 5DV5A 2O03A 2EFNA 3GVAA 1HW2A 3E5QA 2XVCA 1OYIA 4R8HA 1J9IA 3KEQA 1O3RA 1FT9A 3RKYA 4YIFA 1P4XA 3GW2A 1FY7A 3CUQB 1U5TA 4WK8F 3GFIA 2FNPA 1IXRC 2J5OA 3TOAA 1UB9A 3KFWX 1K6OA 5DYMA 5A2QZ 3EYYA 2P6TA 2P7CB 1W5SA 2OZ6A 4PDKA 4MHGA 2V1UA 5K5RA 2G9WA 3RKWA 4EJUA 4ENJA 3BDDA 3I59A 4IHSA 4CYDA 5DUIA 3RJPA 4NB5A 3QOPA 3TO6A 2P6SA 2G7HA 3EUHA 3CUQA 4P55A 3RDIA 3TQNA 2JTVA 4HF0A 3Q9VA 1ULYA 5HDNA 3GFLA 1GXPA 3E6DA 2WC2A 2HDCA 1Y0UA 2FF4A 2QQ9A 4PZJA 2WWYA 1FSHA 3EDPA 1T2KA 5IT9Z 5HDKA 1LEBA 4KIGA 1XSVA 3I0TA 1FBSA 3M9AA 3GO5A 4AWXB 3F8NA 2VXZA 2STWA 3T0YA 1O3SA 1IF1A 3QU3A 4KIBA 4RB3C 1AOYA 3HIFA 4MTDA 1TQIA 3V8LA 4KA4A 2UXXA 4YFNF 2PMHA 4ENNA 3EQLF 3WTTC 5LHGA 1FC3A 1ZHFA 3BZ6A 2RN7A 1SFXA 3KP7A 3GUDA 3HSRA 2GQQA 5L3BA 5HVQC 3OOPA 1D5VA 2DFIA 2DO7A 4HX7A 4EMSA 3WODF 3KLOA 3HHHA 5LRSA 4LJZF 4ASNA 1MJBA 1R1TA 3BROA 2HFHA 1B4AA 2PI0A 1YYVA 3U2RA 1BIAA 1I27A 3HTUA 3KCCA 4KT5C 5FLXZ 1XMKA 4IVNA 4MQVA 5EEHA 1IZ1A 1ZAOA 5DDGA 3LWFA 4M9SA 1BI2A 3F8MA 1P4WA 4OIOF 3HRTA 1XDSA 3MCZA 2ACJA 4RGRA 1U8RA 3NEUA 1LNWA 2VONA 2ZNZA 3RTRA 3CO6C 1LVAA 4ESFA 1O57A 4D0PA 4G6DA 4M9XA 1F4KA 3KP6A 5ILUA 5CVVA 3U9GA 5FGMA 2EWNA 2IA1A 2NNYA 2LNBA 4G6QA 1IAWA 1IN6A 3L2CA 4EJOA 1I1SA 4CICA 3TO7A 5D5VB 4L0YB 2R7FA 4HX8A 3RIRA 1IRGA 1G4DA 3QP5A 2KIUA 2EA2A 3ZMSA 4P5OA 4JK1X 2VBYA 1KQ0A 1FSEA 4N9HA 1TBXA 1EH6A 4KICA 1PP7U 1L0OC 2QQBA 2RNJA 3IRQA 4XRFA 1W7PD 2FA5A 2W24A 3LA3A 3I54A 4ESJA 4HDVA 4U0WA 1FBUA 2VC0A 1MJAA 3HSEA 5ED4A 3CTAA 2H6BA 1RUNA 1G6NA 2O61A 4MEYF 2LF8A 1ZH5A 2F2EA 5D5UB 2TDXA 1SFEA 1FWZA 1WKMA 3MWMA 5H6RA 5E8IA 4L5JA 3V8JA 3V4GA 1KU7A 4A0XA 5DD4A 4UUVA 2W25A 4I0AA 3DP7A 2ETHA 4M6YA 1WWXA 2XRNA 5CVUA 2OQRA 1BIBA 1FYMA 5HS8A 3GZ5A 4A5NA 2NRAC 4RB1A 4F7ZA 2IVMA 2GXGA 1YIOA 4R79A 4IRGA 4Y17A 5FFXA 4HA8A 4BYYA 3K0LA 4P96A 3HRSA 4EM0B 2BV6A 4Q47A 3GEZA 3J81K 3QRFF 3T8TA 1JE8A 4M6XA 2P7VB 1ZLKA 4HX4A 2UZKA 2PFBA 4Y13A 3FHZA 4WCGA 3IKTA 2ESHA 3I4PA 3GZ6A 2E7WA 3DKWA 4HLYA 3GYHX 3W6JB 1HSJA 1YW9A 2QVOA 2K27A 3N97A 1SAXA 1IXSB 3I59B 4AD9A 1TW2A 1LQ1A 2P5LC 4HYEA 3DV8A 3F8FA 1R36A 4JQFA 3SHFA 4EV0A 1D8KA 3BPVA 4M71A 1ZG5A 2GZWA 3GXOA 4O6JA 2LDUA 5HS9A 1XCVA 1KQ9A 5A2QK 4EJVA 2C6YA 1W4MA 2ZJ2A 2KJBA 1YG2A 2BEOA 2M1BA 4AIHA 1MDMB 1OYYA 2IRFG 4DNCA 2A5YB 4A0YA 4A5MA 1KU2A 2HOEA 1IXCA 1IN8A 1DP7P 1K79A 3GFMA 3L9FA 1DPUA 5LGTA 2ZBKA 2UWMA 5DCMA 2IW5A 4HZFA 4PGGA 2O3FA 3WE2A 3F21A 3ABTA 2P5KA 4L9JA 2ISYA 1S7AA 5KVRA 4G7ZF 4LGWA 1Z6TA 5K5OA 2CO5A 2YX7A 2ZCWA 1ON1A 2PG4A 4CO8A 4HQMA 3SZTA 2NS0A 3O6BB 1Z6RA 4GO1A 3W6KB 3IWZA 4IF4A 1TTYA 3HOTA 5TJJA 3LA2A 1YO5C 2Z33A 3D0SA 1K78A 3LFKA 2DQRA 2F5EA 4EJTA 1S7OA 2FMLA 2RVCA 3RI4A 2OQGA 3KZYA 4XSXF 1E2XA 2DPDA 2BBYA 3IWFA 4RB2C 2HWVA 5TRDA 3S2WA 1S29A 2KIFA 5FFZA 3J80Z 1I1GA 3KP3A 1MKMA 2HKXA 3U1DA 3V8KA 3HTSB 4KUMA 5ILVA 1R22A 5EEGA 2LKPA 2CFXA 3D5LA 2QZ8A 1T39A 1HKTA 1K78B 1WI9A 2XAGA 2K86A 3MZHA 3ROUA 1HXDA 1YW8A 4HDUA 1JXSA 1BI3A 4ENKA 3I71A 2COMA 3KE2A 4U0VA 3HUGA 3F8BA 4DQ2A 2IJLA 3B02A 4OINF 1USTA 2CYYA 5JI6A 3WTYC 5ICFA 2XIGA 4WX9A 1ZG1A 3N4MA 3DQVC 1PP8F 4MEXF 2A6HF 3JTHA 3ERED 4P9UA 1IW7F 4CHUA 4HW0A 2ESNA 5BOXA 1FP2A 4AIKA 4ZYEA 3CJNA 5D6EA 1HBXG 3GF2A 4WF2A 5E1ZB 2DLLA 1R58A 1XGNA 2YU3A 1XSDA 4KYWA 4LG0B 3GX4X 4RGSA 2M8EA 1LDKB 1V4RA 3LSTA 1STZA 4ON0A 2VOOA 1YFHA 2PLYA 4KN7X 4YFXF 3WG9A 2GAUA 2D1VA 2F5DA 1FYLA 3KLNA 1XB4A 2K7LA 4GGGA 2L3DA 2VN2A 4LLNA 2MH9A 3BPXA 2VODA 2Y48A 4CXFA 1BI1A 3JAMK 5BS6A 1LB2A 2PBIA 2FSWA 2CWEA 4EJWA 2FBHA 1BN5A