4BHCA

Crystal structure of the m. tuberculosis o6-methylguanine methyltransferase r37l variant
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
165
structure length
165
Chain Sequence
MVHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSLTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALLELEKSRAPADLTLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLATED-DNA--PROTEIN-CYSTEINE METHYLTRANSFERASE
publication title Biochemical and Structural Studies on the M. Tuberculosis O6-Methylguanine Methyltransferase and Mutated Variants.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 40
structure length 165
sequence length 165
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4bhcA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4bhcA01
3VOEA 4CHUA 1ZARA 4LFUA 5DEQA 4KN7X 4PZJA 1J5YA 1OKRA 3SFZA 1UB9A 2UXXA 5ICFA 3F8BA 2A6EF 3LSTA 4U88A 1LVAA 1USSA 3HSFA 3T1BA 2DBBA 3K69A 3RYPA 1FBUA 4YIIA 4Z2YA 4YG2F 1LNWA 3F6VA 4CYDA 6PAXA 2VBZA 1W4MA 1FSEA 4JQFA 4L5IA 2L54A 4WF2A 2NNYA 3LQQA 3IRQA 4XSZF 2VONA 2DK5A 2XAFA 3MFKA 4B09A 3HRSA 3J80Z 2HYFA 4RB2C 1KU7A 5IT9Z 1DPRA 2R7DA 2IA1A 5HVQC 3MAJA 1I1GA 4ZZLA 1IXRC 5DUIA 2DO7A 3WTWC 1B59A 4XRFA 2A6HF 2KIMA 1FWZA 4S05A 3TDZC 2CO5A 2JRTA 1YLFA 2MH9A 2ZNYA 5AIQA 4UNOA 2OD5A 2EWNA 4A6DA 4UV8A 2RC4A 1H0MA 3F8NA 1PP7U 1SD4A 4N9HA 3JTGA 2J5PA 3CUQB 2J5OA 3I0TA 1R5GA 3CLOA 2IPQX 1T38A 5H20A 2EV6A 4M9ZA 5F6FA 3F8FA 1BI1A 2OAZA 3O6BB 2PG4A 3F8CA 2PEXA 1F4KA 1B9MA 2JT1A 1YQAA 4A6EA 1WQ2A 3RIRA 2C6YA 3E6CC 2VE8A 2UZKA 1SFXA 1Z91A 3IRRA 2OU2A 1ZRCA 1LEAA 4RGSA 3WGGA 2HS5A 1F9NA 1RUOA 4L9NA 4RGUA 4I0AA 2G9WA 1NHAA 1U5TA 1O7FA 4CICA 5LGNA 3EYIA 3BDDA 2VOPA 1I6XA 1FBSA 3G3ZA 2DPDA 5JHUA 3OV8A 3ZMSA 5D8LB 5BS6A 1YIOA 4M9XA 2DFIA 3BJOA 1O3SA 4Y13A 5FLXZ 4BHPA 3GFLA 1HQCA 3GFJA 5HLGA 1JGSA 2O8XA 3T8TA 3FXRA 1K79A 3EUHA 3D5LA 4ZZDA 3RI4A 3AAFA 4L9JA 2V79A 3DPLC 4OIPF 1BJAA 3PFIA 2HTJA 1H9TA 4PCQA 1UCRA 2M1BA 3T8RA 5ERIA 1P92A 3VEPA 5L3CA 2VT3A 4O6JA 2UXNA 2YSRA 4P9UA 2NYXA 2P6SA 4HYEA 1R36A 1RI7A 4G6QA 5HS7A 2RDPA 2Z99A 1ZLKA 1UFMA 1LEBA 4BNCA 1TQPA 4GYGA 4BHBA 2KJCA 1JHFA 1SD5A 1IN6A 5D8KB 1OMIA 2BEOA 2FBIA 2ZJ2A 1XB4A 3J7AO 1QPMA 1FX7A 3F22A 1TQMA 2STWA 2M87A 3CO7C 4RAZA 4ENNA 2ZNZA 2IVMA 1E17A 1IF1A 2PMUA 3H3UA 3E5UA 4Q48A 2RN7A 2K4BA 3C1DA 3R0AA 3I53A 1D3YA 4OOIA 1KYWA 2XRNA 3CTAA 4KIBA 2M5WA 1U6GA 4DQ2A 2EFPA 2Q8KA 1W5TA 1FYLA 1SMYF 2ZKZA 4GYIA 4L0ZB 4EM0B 1MKMA 5HS8A 5D5UB 4U0VA 1YW7A 5CVVA 3T5XA 4ENMA 1U3EM 1BN5A 3I54A 2MLKA 3H3ZA 1RZ4A 2VBWA 3W6KB 4IHTA 3HUGA 5J8CA 4I02A 4A2UA 1EH6A 1KQ0A 2YPRA 3ZPLA 1XD7A 2VC0A 1DP7P 1SFUA 3FZVA 4A0ZA 4KICA 2VOOA 3BOQA 2QQ9A 4R8HA 2A07F 1FBQA 4P96A 4MQVA 5CVUA 3E6DA 4A5NA 3ROUA 5L3DA 4OIOF 5LRSA 1B1BA 2YU3A 1FP2A 3L9FA 1J9IA 1YO5C 3V7RA 1S3JA 4RGXA 5FFXA 3GFIA 3LAJA 1KYZA 2V1XA 5AIPA 3DXJF 2COMA 2PFBA 4L0YB 2RQPA 1T39A 3DV8A 4GGGA 4NQWA 1D5VA 3L7WA 3WGHA 4HX7A 2P5VA 2GXGA 4LMYA 1ZGAA 1FNNA 4A0YA 2K7LA 4GCVA 4IXAA 3DEUA 5E17F 4UVAA 2Z5UA 4M73A 4WXCA 2BE5F 5E20A 4EVIA 5JVTA 1JHHA 1ZG3A 1AOYA 1MGTA 5DV5A 2A3SA 4I09A 1IW7F 3FX3A 3IKVA 1HKQA 1LDDA 4EGYA 5LGUA 5ILVA 4IF4A 5ED4A 4HDUA 5HDKA 1U8RA 1REPC 1IN8A 2FU4A 2OQRA 1K78B 3KCCA 4CZZA 1IRGA 2EV0A 3QOPA 4LK1F 1P6RA 2HDCA 4EJVA 3FMRA 1QZYA 4RB0A 4NHJA 5BPDA 4YFNF 5LRRA 3I64A 2LF7A 2CW0F 2H94A 3BPXA 4HW0A 3DPTA 1AWCA 2ZMEB 2MH2A 3KP4A 2X4HA 2VBXA 5CVJA 5D4RA 1SFEA 1ZRFA 1HKTA 2H27A 3TO6A 2ESNA 2NS0A 1XGOA 1USTA 1YTYA 2GIVA 3DQVC 5LLQA 3KZZA 2W24A 3ABUA 3ZN0A 4IHSA 2WWYA 2CFXA 3CJNA 4FHTA 1ZH5A 3KLOA 5BOXA 1J2XA 3KP7A 1MD0A 3LQRA 4ENKA 1DUXC 4A5MA 2DU9A 5AONA 3HSRA 2FMYA 2HEOA 3R60A 3LAPA 4OMYA 1WI9A 1LDKB 1K7AA 3CUQA 3BY6A 3E5XA 1HBXG 4KIGA 1FYMA 1UHMA 1B9NA 3OOPA 4P55A 3GYHX 2CGPA 3GW2A 3WGIA 4KFCA 1XGSA 1TW3A 3J81Z 4ESFA 1XGMA 2OZ6A 2XAGA 1RIOH 2WV0A 2DTRA 4B8XA 3L00A 4CGZA 4G7ZF 2FRHA 3WE3A 1X3UA 1I1SA 3GWZA 1R00A 3U9GA 2DW4A 4U0WA 5HDGA 1ZHFA 3RKYA 4MEXF 2QBYB 2KJBA 2L3DA 5CLSA 1FT9A 3RKWA 4LLNA 4HF1A 1W7PB 1GXQA 2GZWA 5HS9A 2NAZA 3ELKA 3WTZA 2IW5A 1ZLJA 3K1MA 4M6YA 4WK8F 2HGCA 3KZYA 3FM5A 3JSOA 1ULYA 4LG0B 3GX4X 1CF7B 3S2WA 1XN7A 2B0LA 1ZG1A 2DLLA 1RNLA 2M45A 3O3KA 4NB5A 4O3MA 4JBAA 1O3QA 1TQIA 4M74A 3FXUA 2VXZA 1SAXA 3P9IA 3QU3A 1XSVA 3HOTA 1P4WA 1XMKA 1ZAOA 5TRDA 4ZYDA 4UV9A 2A69F 2FNPA 3ZN1A 4P5OA 3JAMK 1KGSA 4ZYGA 3WTYC 4TV7A 1BIBA 5ICCA 3IKTA 1T6SA 2BYVE 1IZ1A 4YFXF 4CDGA 1QGPA 2L4AA 5HOOA 2F2EA 5DD4A 3GUDA 4AD9A 1HW5A 1P2FA 1STZA 5L3BA 3DKWA 3RJPA 3U2RA 2QM3A 2MLGA 2IJLA 3ULQB 4G6DA 2FSWA 3SXYA 4G9YA 2KIFA 3W6JB 1R58A 4XLPF 4G7OF 2MA3A 2JSCA 1E2XA 1J59A 2MBFA 3WTUC 1Z1DA 1TW2A 2JZYA 4HQEA 3REOA 3QP5A 4U7BA 2ZXJA 5D5VB 5A2QZ 1XCBA 1BIAA 3HOSA 2FA5A 2K27A 3CDHA 1V3FA 1I27A 1P4AA 3IWFA 2EJRA 4G8XA 4BAYA 1IUYA 3WU0A 5BQTA 2PI0A 3D0SA 1Z9CA 3C3WA 1HW1A 5ICEA 2Y75A 3V8KA 1MDMB 4HLXA 4M72A 4PDKA 4Q4ZF 2E1CA 4KIFA 3QRFF 5LEKA 2JPBA 3SHFA 3N97A 2Z3YA 1BC8C 2P4WA 3ERED 1YS6A 2HOEA 1KQ9A 4ON0A 2DPUA 1ON2A 4UHTA 2K4JA 3IL2A 3FWEA 2FE3A 3ECOA 1C0WA 2W57A 1LQ1A 2ELHA 3P7NA 3LA7A 1BM9A 2O03A 1A04A 2OQGA 3SZTA 3SZPA 2H09A 4HX8A 3KE2A 2QQAA 2XASA 2QVOA 2XAHA 1S7OA 3M8FA 1V4RA 1IRFA 3FXQA 5DCMB 3EDPA 3U1DA 1FSHA 2RKHA 1ZYRF 4RGRA 1K78A 2DK8A 1KU2A 2R7FA 2Y48A 3J80K 2PJPA 3CO6C 5IT9K 3O2PE 5D4SA 2FMLA 1R7JA 1QBJA 3FMSA 4JK1X 3QPHA 4MGRA 2P8TA 2UWMA 1OYIA 1S7AA 3KETA 2ETHA 2ZMEA 1XMAA 4HOBA 3WTXC 4IRGA 5K1YA 4BXUA 3R4KA 4KA4A 1F5TA 1Z7UA 3QAHA 4R1HA 4RAYA 4WCGA 4L9VA 4XSXF 2XIGA 2P7VB 1Q1HA 4OINF 2KKOA 2YX7A 4GXOA 2F5DA 1YG2A 4MQ9F 3V7SA 3M8EA 1U78A 2EK5A 4RS8A 4KYWA 1OYYA 3BROA 2LDUA 2RNJA 1G3TA 3RPQA 2XAJA 1FPQA 5D6EA 3JW4A 2O6GE 2IRFG 3FHZA 3K1NA 5HLHA 4M9SA 5CJ9A 1K6OA 4A12A 2JPCA 2ISYA 3MEXA 5DD8A 4ZH4F 3WG9A 3RYRA 3VODA 2H6CA 3ZMVA 2EFOA 1QQIA 3K2ZA 1WRJA 5K5OA 4M71A 2HQRA 5FLXK 3ZP5A 1MJ9A 1R23A 1MJBA 4N0BA 1WWXA 3NEUA 1ZG5A 4UVBA 3T0YA 4HBLA 4AIJA 2Y0MA 3F23A 1BOAA 1O3TA 3M7GA 4HZFA 4ESJA 4EM2A 2QBYA 3JSPA 3FF5A 3VFZA 4BHCA 1YYVA 5FFZA 1W7PA 5E18F 2FEZA 3NQOA 5HDNA 1OYWA 3KLNA 4EJTA 2RV8A 4KMUX 3BJ6A 1TLHB 1XGNA 1R1VA 3V7CA 3M9AA 4LG0A 2EA4A 5HLIA 5DYMA 2YR2A 3EQLF 1GVJA 5LHIA 1CF7A 2EA2A 2JTVA 4EM1A 4XLNF 4HF2A 4AIHA 3GEZA 2FF4A 4FX4A 2ZCWA 1XSDA 4YFKF 1IAWA 1MZBA 2M30A 2WC2A 2DQRA 4ENJA 2QQBA 3I59B 2BV6A 2L02A 1XSXA 1PP8F 3FMQA 5EEHA 2P6TA 4WWCA 2PQ8A 1J7KA 3B02A 3ZQ7A 3GLXA 3E97A 5KVRA 4R79A 3JTHA 1F1ZA 4N9IA 3GZ6A 2QYOA 2P7CB 1U2WA 2FBKA 3P9CA 1G3SA 4K2EA 2TDXA 2WTEA 5L3EA 4I0BA 3TOAA 4UUVA 1O57A 2ZO4A 1ZRDA 1ZREA 3KP3A 4HQMA 4QLCU 1R1TA 4QWQA 2L01A 1O3RA 4IRHA 2DAOA 2CG4A 1KU3A 2XHKA 4MEYF 2G7UA 4ESBA 2HKOA 2D45A 2XROA 1YW8A 3F21A 4EV0A 1L0OC 2Z33A 4CXFA 1DDNA 3GF2A 2E7XA 3ZMZA 4HDVA 1Y0UA 2O61A 2W85A 3LA3A 5H6QA 4U7DA 1Z6TA 1LJ9A 3C7JA 5FGMA 2A61A 1KU9A 1U5TC 1G3WA 4AIKA 3MCZA 3K9TA 4EMSA 4BH9A 2OA4A 2ISZA 3L2CA 2EB7A 4AVPA 4UXNA 2XVCA 3ISPA 4HLYA 2P5KA 3HSEA 2EV5A 3NRVA 3WE2A 3ECHA 5E8IA 3CUOA 2GA1A 1HKSA 2ESHA 4I01A 2D2WA 2IP2A 1SD6A 3P9KA 2M8EA 3IC7A 1MDMA 5E1WA 5E1XA 1Z6RA 2YX4A 3LFKA 5CVRA 1TBXA 4PGGA 4ZYHA 3I4PA 4E70A 2HKXA 1YFHA 3TDUC 2GXBA 3GFMA 2QLZA 5DUKA 1WSUA 4ZYEA 3HYIA 2PLYA 1Z05A 3TQNA 1JE8A 4LGWA 1SMTA 4XBFA 3Q5FA 1P4XA 1XDUA 1EV7A 5L3GA 2XV4S 4EQQA 4H0EA 3ML6A 1ZGJA 2O0YA 3BP8A 5D6FA 3TO7A 5JR3A 3IHUA 1J75A 4ETSA 5E8GA 3GVAA 4G94A 3ZMTA 2XKPA 3MQ0A 2CYYA 4DNCA 3B73A 3LWFA 1O7LA 3HRUA 2NNNA 4S04A 3WTTC 3H92A 5DCMA 1GXPA 5TJJA 1PUEE 3DFGA 4MTEA 2EFWA 2FOKA 1TNSA 4MNUA 4L9TA 2BGCA 3L09A 1BBYA 1T98A 4KNYA 2QUFA 4EJWA 2ADUA 1QO0D 2O3FA 1UHWA 1HW2A 2GWRA 2Q2EA 2AS5F 2W25A 1D8JA 3IWZA 3EETA 2HR3A 2FXAA 4GO1A 1XCVA 1KA8A 3TKYA 3WODF 3MZHA 1YW9A 5J6XA 1FOKA 1TTYA 2CWEA 2RVCA 5IT3A 1DPUA 2XGXA 5DCFA 1B6AA 5F1RA 4MHGA 2BBYA 3BWGA 4IJAA 3BPVA 4IPAA 1S29A 4P9FA 2LNBA 4L18B 2QWWA 3SQNA 1FC3A 5FD5A 1H9GA 3WTVC 2F5FA 1FLIA 2HTSA 2E7WA 2VC1A 3J81K 1XDSA 3BZ6A 1R5HA 1QNTA 1G3YA 5CVIA 5FB2A 3COAC 2MC3A 3LA2A 2LKPA 1IXCA 1I5ZA 5BMZA 3KP2A 2VN2A 3I58A 4OMZA 4EJOA 4Y17A 1TNTA 1RUNA 3DP7A 2RGVA 5LEJA 3WTSC 5LHHA 5K5RA 3HIFA 4WX9A 3GO5A 1R1UA 4I98B 4HV6A 3K1PA 2V9VA 4M6XA 3F3XA 1FYKA 2HWVA 3M1EA 2XUBA 2OZUA 1PDNC 1G4DA 3QU6A 2AXLA 4L5JA 5BPIA 3GXOA 4RB1A 3TO9A 2ACJA 1FZPB 3RTRA 3FM3A 4EJUA 3KEOA 1G6NA 4LJZF 3HHGA 4IRIA 4Y15A 4PGHA 1GHCA 1WKMA 1U5TB 4Q5SF 1BI2A 1QZZA 3N4MA 1W7PD 5DDGA 3R61A 3V8JA 3HRTA 3C18A 2K86A 4KDPA 2IA0A 5H6RA 2EFQA 5LBQA 5D5WB 1ZN2A 4CO8A 2VODA 2ZFWA 2E1NA 4KUMA 3MWMA 2PBIA 1ONVA 2Q0OA 4LD5A 5K5QA 3HHHA 2V6CA 2D1HA 4YIFA 1D8KA 1T0FA 4OIRF 3E6MA 1IN4A 3PQJA 3RKXA 2A68F 3HRMA 4I7HA 4LK0F 1BI3A 3I59A 4LLGF 3BJAA 2QZ8A 2STTA 2GAUA 2V1DA 3QPTA 4IVNA 2D1VA 2FQ3A 3ABTA 3F8MA 2H6BA 4OIQF 2PMHA 4MTDA 1W5SA 5KK1A 1OR7A 1OPCA 5ICGA 2L4MA 2R3SA 4HF0A 4O5VA 4KMFA 1IXSB 2CSOA 4I2OA 3E6BA 4WXDA 1T2KA 4F7ZA 5D5XB 4LLLA 1MJAA 5LHGA 3R6SA 3CUQC 3RDIA 1KQ8A 4ASNA 2VBYA 3F6OA 2GA2A 2KRFA 4HA8A 5ILSA 2FBHA 2NRAC 3G73A 2LF8A 3QP6A 4G7HF 4LB6B 5E1ZB 5A2QK 2FNAA 2CQKA 3RPUA 1IN7A 1LDJA 2HFHA 3HTUA 4D0PA 4HV5A 3Q9SA 2F5CA 3PQKA 3R0JA 4BYYA 2IT0A 3JAMZ 2VE9A 2GQQA 3ZMUA 3WU1B 2XKOA 4FT8A 3KEQA 3E5QA 2DI3A 1EH8A 3TGNA 2EFNA 1HXDA 5LGTA 3I5UA 1BI0A 2OBPA 4KT5C 5L3FA 2PN6A 2W84A 2DQLA 3I71A 5EEGA 3Q9VA 1LB2A 3KFWX 2K02A 3KP6A 3V4GA 4FX0A 2V1UA 2MD5A 1YS7A 3GZ5A 1HSTA 1S6LA 2XAQA 2QENA 4UVCA 5JFRA 4EGZA 2IA2A 2HQNA 1BC7C 3K0LA 1ON1A 1EH7A 1L3LA 2ZBKA 4WXHA 2DT5A 2F5EA 4LB5A 1FY7A 1R22A 3EYYA 1B4AA 4BQAA 4HX4A 1IN5A 5ILUA 2P5LC 4A0XA 4HAMA 1ODDA 1SD7A 1J0RA 1HSJA 2LSOA 2A5YB 3VB2A 1S8NA 1FP1D 3TOBA 5CYVA 3MZYA 4KN4X 2HYGD 5FD6A 1CGPA 1JXSA 3V8LA 2G7HA 5F64A 3HTSB 4OU0A 3ZMDA 2KIUA 2HZTA 3DF8A 3F72A 4RB3C 5J8FA 3E3VA 4AWXB 4U0YA 5FO5A 2X0LA 2Z9OA 3KP5A 4Q47A 5JI6A 1VTNC 2VT2A
chains in the Genus database with same CATH superfamily
1E3HA 5KAIC 3VOEA 1JKOC 4CHUA 1ZARA 3HZJA 4BE2A 1OCZH 2DN0A 4AM3A 4LFUA 5DEQA 4KN7X 4PZJA 1JJ8C 2LTSA 3M99B 1OJLA 1J5YA 3G4SI 4BJ6C 3CMEI 5A69A 1OKRA 3SFZA 2L2OA 5H2FC 1BW6A 2VPRA 3IWCA 4BY7J 1UB9A 2UXXA 5ICFA 2EMCA 3F8BA 1TP4A 2A6EF 3LSTA 4U88A 1LVAA 1S9HA 1Y1VJ 2LO3A 3QOEA 4JI8E 4RH8A 1USSA 5IP6A 4G6TB 3A01A 1TC3C 3HSFA 3T1BA 2DBBA 2YTFA 3K69A 4KZSA 3RYPA 2Y9ZA 1FBUA 4YIIA 2V6EA 3RKQA 1TWGJ 2QQ8A 4Z2YA 2V9KA 2VE7C 2UUAE 2M9AA 3G1LA 4YG2F 1LNWA 3F6VA 4F6MA 1BB8A 4CYDA 6PAXA 2VBZA 1W4MA 1PKPA 4DV4E 1FSEA 4JQFA 4L5IA 2L54A 3Q0UA 4WF2A 4RDUA 4Y4RA 3O8GA 3J7YJ 2YRKA 2NNYA 1WVRA 3LQQA 1N78A 3IRQA 1TF3A 4XSZF 2VONA 1FIAA 2NUEA 2DK5A 2XAFA 3LSGA 2JJ7A 2LBFA 3MFKA 4B09A 3HRSA 2N8GA 2F4MB 3J80Z 4EATA 2HYFA 2M4GA 4RB2C 4HRIA 1KU7A 2VPLA 2E5NA 3BTCA 2FD5A 2KLOA 5JLWA 2EL5A 5IT9Z 4DJAA 2MD0A 1X1CA 2JP9A 1DPRA 2R7DA 2IA1A 4RBOA 5HVQC 3MAJA 3ZQCA 4RLQA 1I1GA 4ZZLA 2KRHA 2ENHA 1JK1A 1IXRC 4X65E 4C3HJ 2DO7A 1WH5A 5DUIA 2CT1A 3FXLA 3WTWC 1B59A 2WB1A 4XRFA 2A6HF 4HEA2 1JUPA 3BTLA 4HTGA 2KIMA 2QCOA 2EN2A 3SDGA 3LMMA 4F2JC 1FWZA 4S05A 3TDZC 2CO5A 2MW8A 1MBEA 2JRTA 4P1WA 4R03A 1YLFA 2MH9A 2ZNYA 1LFUP 4JI0E 1MMAA 2EPCA 4XLFA 5AIQA 1SVLA 4UNOA 2ZXIA 2OD5A 1FIPA 2EWNA 3WHCA 1QVTA 4A6DA 4UV8A 1J09A 3GTPJ 2RC4A 4FQGA 4DBQA 1H0MA 2WB1N 3F8NA 2GOMA 5KL7A 1PP7U 3EPJA 1U9NA 1SD4A 4JI6E 4N9HA 3JTGA 2LRSA 2J5PA 3CUQB 2J5OA 2DMPA 2CV2A 3I0TA 2CV0A 1R5GA 3CLOA 2IPQX 1T38A 2XGDA 5H20A 1HA8A 3MKYB 2HVQA 5KNLA 2EV6A 1ZBTA 4M9ZA 5F6FA 1NG6A 3F8FA 4LF7E 1BI1A 2EN6A 1LFBA 5IOZA 2OAZA 4C2TA 3K4JA 2KDZA 1ZR9A 4AU7A 1PJRA 3O6BB 1WHNA 2QEXI 2PG4A 3F8CA 2PEXA 3L1PA 1F4KA 2V83A 2TCTA 4M3FA 5C4XJ 2K9MA 1B9MA 2JT1A 3CCUI 4WFTA 3UKGA 4CA0A 2IGNA 4X8WA 1YQAA 2M1SA 3IWDA 4A6EA 1IV8A 4GZNC 1WQ2A 3RIRA 2C6YA 1DU6A 4LITA 3E6CC 2VE8A 2YTOA 4E7LA 2UZKA 1SFXA 1Z91A 4ZC3A 5C4JJ 3IRRA 2OU2A 1ZRCA 2R7ZJ 3EPKA 1Q1VA 1LEAA 1RESA 2XC7A 4A3JJ 2JN6A 4RGSA 3WGGA 3OR1C 1WI3A 5GAEJ 3C2HA 2F8BA 4F54A 2HPIA 2HS5A 1F9NA 1RUOA 4L9NA 3MD2A 4RGUA 4BU2A 3TL4X 4I0AA 3A02A 4A3IJ 1D0XA 3S93A 3FISA 3IWBA 2G9WA 1IBKE 1D0YA 4HNTA 2HDDA 2NS7A 3DPUA 1NHAA 1U5TA 4NZVA 1O7FA 4CICA 5LGNA 3EYIA 3BDDA 3K7AJ 2VOPA 4F9CB 3QWLA 4IX7A 3SJMA 3BR5A 3FK7A 2L5QA 1I6XA 1MMGA 1A6IA 1FBSA 3G3ZA 3H9QA 2DPDA 5EZGA 5JHUA 3S14J 3OV8A 3ZMSA 5D8LB 3E0JB 2EM5A 4X9JA 5BS6A 1YIOA 2BOLA 1MMNA 4M9XA 5EYRA 2EPOA 4CCOA 2DFIA 1JK2A 1A1LA 3BJOA 3GTOJ 2EIKH 1O3SA 1W1WE 1J26A 4Y13A 2LOOA 3HC7A 4AUXA 5FLXZ 4BHPA 4R2DA 5LMUE 1SVOA 1BOBA 3GFLA 3E1SA 1HQCA 4F91B 3TEDA 3GFJA 4R2RA 2JMWA 5HLGA 1JGSA 4BE0A 2O8XA 2RQQA 3T8TA 3FXRA 1K79A 2ZMEC 3EUHA 3DLLF 1X6FA 1CQTA 3CD6I 2B3TB 2M2EA 3D5LA 1R5ID 2BY3A 4TUIA 5J1YA 4ZZDA 3CMMA 2ZJRF 3RI4A 1WXRA 3AAFA 4L9JA 2V79A 2JSPA 3DPLC 3FBNB 2NVXJ 4OIPF 1BJAA 2OV7A 1LKXA 2HTJA 3PFIA 1H9TA 4PCQA 1UCRA 4M0VA 5E3OA 2LUPB 5KL4A 2EQ3A 1VQPI 2M1BA 1HR0E 3T8RA 4CCKA 4DR6E 2X1CA 5ERIA 1P92A 4E7JA 4W97A 1OCTC 3VEPA 2EZ6A 5L3CA 2VT3A 1YPNA 4O6JA 1MBHA 2UXNA 2YSRA 4P9UA 1D5YA 3S15J 1Z1BA 2NYXA 2P6SA 3Q0WA 1T0FC 4EEFG 4HYEA 2K85A 1R36A 1RI7A 2QSGX 1YYWA 2BY0A 1P7IA 3CQZJ 2R5YA 4G6QA 5HS7A 2HU9A 1DQUA 2RDPA 2Z99A 1ZLKA 2CSHA 1UFMA 2EM7A 2YTPA 5FLMJ 1LEBA 4BNCA 1TQPA 3RZOJ 3ZRGA 4XOTA 3HOXJ 4J8ZA 3TP0A 4GYGA 4B4CA 3OYGA 2UU9E 3KYCB 4BHBA 3CLQA 2KJCA 1JHFA 4IZZA 1SD5A 1IN6A 5D8KB 3K4MA 1OMIA 2BEOA 2FBIA 2ZJ2A 1XB4A 3J7AO 4A3EJ 3H35A 1BBOA 5GP9A 1MMDA 4KITB 4A3FJ 3EUKL 2A5WA 1QPMA 1FX7A 3F22A 1TQMA 2STWA 4YHHE 2M87A 3CO7C 4RAZA 4ENNA 2CTDA 3H0DA 4A3KJ 2ZNZA 2IVMA 4XMYA 1E17A 1IF1A 1T4OA 3J7Yp 1TT5B 2E60A 2PMUA 4M3DA 1UBDC 3H3UA 4BQNA 1LE8B 5TGTA 3E5UA 2FTXB 2X6YA 4RA2A 4Q48A 1Z67A 2RN7A 3HJEA 3OYMA 1VI0A 2K4BA 3C1DA 3R0AA 2EPXA 3ASNH 3BQYA 4QPQA 3I53A 2W7NA 1D3YA 5J1UA 4DV7E 4OOIA 1KYWA 4Z6YA 2K7IA 2XRNA 3FK6A 3CTAA 1W36C 2E2HJ 4KIBA 1IQOA 2M5WA 1U6GA 3RPUD 4DQ2A 2EFPA 2Q8KA 1W5TA 1FYLA 5EEAA 1SMYF 1Z77A 5EJCA 1H89C 2LP0A 3HTXA 5LFAA 3IAS2 2ZKZA 4GYIA 1EKEA 4L0ZB 2CS3A 4EM0B 1YHQI 2L9NA 3RQIA 2OTLI 1MKMA 2CJJA 5HS8A 2DA6A 5D5UB 4U0VA 1YW7A 5A6JA 5CVVA 1Z7LA 1TZLA 2FV4B 3T5XA 4ENMA 3ABMH 5M5XJ 1OCOH 2EE8A 2XGCA 2XGEA 2EOJA 1RC7A 1K83J 1U3EM 2V88A 1BN5A 3I54A 1FOWA 2MLKA 4I6ZA 3H3ZA 1RZ4A 1GVDA 2GPIA 4RLFA 2QKMB 2VBWA 1Z0XA 5M5YJ 3W6KB 4UUSB 3HUGA 5J8CA 4I02A 4IHTA 1VQ6I 4A2UA 1EH6A 1TF6A 2YTNA 1KQ0A 1WJAA 3V42A 1DGWY 2YPRA 1YIJI 2GHFA 1B72A 3DCFA 2DFFA 3ZPLA 2JA7J 2EOQA 1D1CA 1XD7A 2WBMA 2GLOA 2VC0A 3OS1A 2IBDA 1DP7P 2ELZA 2CUFA 4B3SE 2EOFA 1SFUA 3FHNA 3QYBA 3FZVA 1TWHJ 3CCYA 4A0ZA 3DEEA 4KICA 5EF6A 2VOOA 2MKDA 3BOQA 2QQ9A 4R8HA 5IV8B 2ELKA 4AQYE 5E3MA 5FRMA 1RC9A 2A07F 1APLC 4Q28A 2JA8J 1FBQA 2EOEA 4P96A 4MQVA 5CVUA 1H88C 2V26A 3E6DA 3MKLA 1A31A 4A5NA 2KZGA 2IAIA 2Y2ZA 3A03A 3ROUA 2F6CA 5L3DA 4OIOF 5LRSA 3DKYA 1B1BA 2P81A 2YU3A 2JOXA 1FP2A 1BR4A 3L9FA 5F1JA 3LSRA 1J9IA 1NK2P 2EM0A 1YO5C 3V7RA 4BXFA 1S3JA 3HKZN 4RGXA 1UAAA 4XRMA 5FFXA 1XTAA 1Z21A 5FRNA 3OL3A 3GFIA 2DRPA 3LAJA 4B3ME 4B44A 1KYZA 2I8DA 2V1XA 2JVAA 5AIPA 3FXKA 2DT7B 3DXJF 1A1IA 2COMA 2PFBA 3L2VA 3I9V2 4L0YB 3M8JA 2RQPA 1T39A 2V7FA 2FUG2 3DV8A 2ME0A 4A93J 2HYJA 2JUGA 3DEWA 4GGGA 4NQWA 1P47A 1D5VA 1WJCA 3L7WA 3A1YA 3WGHA 5EGOA 4HX7A 5IYCJ 4IHWA 2P5VA 4DGWB 2DLQA 2ZXWH 4L8NA 2GXGA 4LMYA 1ZGAA 1SFOJ 1FNNA 3CCRI 3OYFA 4XK4A 4A0YA 5IY5H 3L2QA 2AQFA 2K7LA 2VJIA 4GCVA 4IXAA 2BZTA 5GTHC 3DEUA 5E17F 4UVAA 2Z5UA 4M73A 3VPRA 4XORA 4WXCA 2BE5F 5E20A 4DYQA 2DOAA 4EVIA 2M0CA 1YSAC 3QG5C 2Y0SA 4JYKA 4C2MJ 5JVTA 3K6GA 1BJZA 1JHHA 1V54H 2AQEA 1ZG3A 3OWTA 3HGGA 3SYTA 4BBSJ 1GV2A 1AOYA 4O24A 1MGTA 5DM6F 5DV5A 2L0KA 2A3SA 4I09A 2L92A 4QSHA 2KONA 2VJ4A 1IW7F 2R5ZB 2A25A 4ZDLA 4V2GA 3FX3A 2RS7A 1B8IB 3CF5F 2L3JA 3IKVA 1HKQA 1LDDA 2DOFA 1MBFA 4EGYA 4BDZA 1ZBQA 4XKBA 2HPMA 5LGUA 1W0TA 5ILVA 2R0QC 4IF4A 2Y0SN 5E3NA 5ED4A 1PJTA 1EA3A 4HDUA 5HDKA 1U8RA 1REPC 4HNVA 4RHBB 1IN8A 2FU4A 5KHDA 4PSXA 1YUIA 2OQRA 1K78B 3IP4B 2O8KA 3KCCA 4CZZA 1IRGA 2EV0A 3QOPA 4LK1F 1P6RA 2OCCH 2KHXA 2HDCA 4EJVA 3FMRA 1QZYA 4RB0A 4C3IJ 2X6XA 4CCNA 4C2UA 4NHJA 5BPDA 3NAUA 4FCYA 3WG7H 1X3ZB 4YFNF 4FTHA 5LD2C 3CDLA 5LMNE 5LRRA 2R7TA 3I64A 3C4BA 2LF7A 3BCAA 2CW0F 2EM2A 2H94A 1YYKA 3BPXA 3OS2A 4HW0A 3DPTA 3WU2C 3I4NJ 1AWCA 4F9BB 4D5FA 2ZMEB 4NUBA 2MH2A 3KP4A 1UJ8A 2X4HA 2VBXA 5CVJA 3MKWB 3OYEA 4OAZA 3K2AA 2A05A 1U0JA 3OYJA 1RPWA 5J3LA 5D4RA 3RQ4A 9ANTA 1WZ2A 1R49A 1SFEA 2LKSA 1ZRFA 3OYHA 1PYVA 4BBRJ 1HKTA 1FMWA 2H27A 2Y30A 1UN6B 3FXMA 3CMAI 3TO6A 4XLCA 3DWLE 4DOZA 2ESNA 2NS0A 1XGOA 1USTA 5CPRB 2EOOA 4OX9E 1YTYA 4FISA 5AASA 2E2JJ 2IS1A 3F9KA 2GIVA 3DQVC 3OL4A 1ERDA 2EQ0A 5LLQA 5KCMA 3GTKJ 4E7ZA 2DYRH 2J7JA 2EMIA 3TP3A 3KZZA 4PFOA 2W24A 3ABUA 2YTEA 3ZN0A 1GT0C 4IHSA 3OIQA 2WWYA 2CFXA 3PNYA 1A1HA 2ZFUA 3CJNA 4FHTA 4PFPA 4Q35B 3K70D 1ZH5A 3KLOA 4B47A 5BOXA 4HPQA 1J2XA 2WBUA 2DFEA 4IQ4A 4B3AA 1UMQA 3KP7A 1MD0A 2JXPA 3LQRA 2O5RA 3Q0VA 1M1EB 4ENKA 1PUFB 2HVSA 1SAUA 2MYSA 1DUXC 2PJRB 3BF2A 4A5MA 2HJJA 4NC8A 5DNYA 2DU9A 3HGYA 3KPHA 5AONA 4PUSA 3HSRA 3ZXSA 2FMYA 2HEOA 4OOGC 3R60A 3LAPA 1A6QA 2HC5A 3UK3C 4ZTJA 4OMYA 1WI9A 1LDKB 2CQQA 1K7AA 4I76A 1UG0A 3CUQA 5EG0B 2R7RA 1TWFJ 5M3MJ 1HDDC 3BY6A 3E5XA 4XRSG 1HBXG 3QQAA 5IYDJ 2LY9A 4KIGA 2XF6A 3D5SC 4B48A 1UHMA 1FYMA 2UXCE 2MC4A 1MBKA 2EM3A 4D1QA 3UR3C 3OTOE 1B9NA 2LR8A 4D7NA 3OOPA 4P55A 4W1UA 3SDBA 3GYHX 2CGPA 3EPHA 3BLYA 3GW2A 2BHZA 2NVYJ 3WGIA 4KFCA 2CUZA 1B69A 1XGSA 2BBGA 1TW3A 3J81Z 1KJKA 3SZGA 4ZTFA 2RREA 1IO2A 2MGQA 4XOPA 3S3MA 2B7TA 1WJEA 4ESFA 3THOB 1XGMA 1T4NA 2OZ6A 2XAGA 2ZC2A 1RIOH 2BY1A 2ZB9A 2WV0A 2DTRA 2EOYA 1JKPC 3A2KA 4B8XA 2QA4I 3L00A 4A3CJ 2HNHA 4CGZA 2DMUA 4D9JA 4JI5E 4G7ZF 1W0UA 2FRHA 5EDNA 4XIDA 3H09A 3WE3A 1X3UA 2V8QB 5F0HA 5KAFC 3QODA 1I1SA 3GWZA 1YOVB 1R00A 4BJTA 1WJBA 4IKFA 3U9GA 2LJHA 2CQ7A 1LFPA 2DW4A 4U0WA 5J47A 1YX5A 5HDGA 2B63J 4X62E 1ZHFA 3BR2A 3M4OJ 3RKYA 4XKVA 4MEXF 2QBYB 2KJBA 3KX2A 2L3DA 2EN1A 2DA3A 3IAM2 5CLSA 5AE1A 2HOAA 3OSFA 1FT9A 5BNGA 2BXZA 3RKWA 4YRVA 2I10A 4LLNA 4HF1A 2JY9A 3VDXA 2EPRA 1W7PB 1GXQA 2EQRA 3PJRA 2GZWA 5HS9A 2NAZA 2KRCA 3H0GJ 3ELKA 4FE4A 3WTZA 1UILA 2IW5A 1ZLJA 3K1MA 5BR8E 3LSPA 4M6YA 4WK8F 2Y69H 4R2QA 2HGCA 3KZYA 3FM5A 2L9SA 3JSOA 2LT7A 1ULYA 4LG0B 2H1KA 5DTDA 3CCMI 4MIMA 2L8TA 3IUOA 4V19K 3BR0A 2CW8A 1XNQE 1T8IA 3J81C 3BG5A 2L6MA 2F5VA 4BDYA 2D5VA 3NARA 3GX4X 1CF7B 1U8BA 2K9NA 3S2WA 5HODA 2YTDA 1XN7A 2B0LA 1ZG1A 2CFOA 4AIDA 3LFUA 1ENHA 2VKEA 2HOTA 2BW3B 1VQ7I 4WSPA 2DLLA 3H9JA 2G0EA 4I99C 2E5LE 1HNXE 1RNLA 3PFYA 2M45A 4ZJZA 1XPXA 4BMJA 2MKNA 3O3KA 4NB5A 2NOJB 4O3MA 3AL0C 2EIJH 2ADRA 2K3FA 2ZXHA 4JBAA 2R7UA 1O3QA 2EM4A 1TQIA 4M74A 3FXUA 5GADJ 3HOYJ 4C9YA 1K4TA 2KP6A 2VXZA 2X6WA 3P9IA 1SAXA 4IL6C 3QU3A 2R7WA 3W2VA 1XSVA 4JX6A 5CKTA 3HOTA 2BVMA 3HOUJ 2LMZA 1P4WA 3SEQA 1RMDA 4PJNA 1XMKA 1ZAOA 1WGXA 1DGCA 1VFCA 2V4JC 4CCMA 4N4RB 2X51A 3EPZA 3EPLA 2L7MP 5TRDA 4ZYDA 2KT0A 4UV9A 2A69F 3CCLI 2FNPA 4ITVA 4X66E 3ZN1A 3OYAA 1JT6A 5F08A 2EZKA 2VF1A 2IHR1 1K6YA 1Y1WJ 4P5OA 4O5GA 1WJDA 2Y9YA 3JAMK 2HQAA 2XPWA 1TT0A 1G2HA 1KGSA 2R7QA 4ZYGA 3WTYC 3G1MA 1N34E 1AU7A 3G71I 1XMXA 4TV7A 1F43A 3LL7A 2GXAA 2EOIA 1BIBA 3J80C 1JKRC 4JX4A 5ICCA 5AC4A 5FLVA 3IKTA 2LKXA 1T08B 1T6SA 2BYVE 2ID6A 1IZ1A 4YFXF 1LE8A 4CDGA 1QGPA 2HHHE 3OMLA 5IT9C 2L4AA 3CESA 4JX5A 1SEUA 1N77A 5HOOA 1HLVA 2DMTA 2F2EA 5DD4A 3GUDA 4XLHA 3AV0A 4AD9A 1HW5A 2XSDC 1P2FA 1STZA 2WAFA 4LF4E 5L3BA 2KIQA 3DKWA 3RJPA 2RSMA 3U2RA 4GKJE 2H8RA 4BGDA 2QM3A 2XF5A 3VYXA 2MLGA 2IJLA 3ULQB 4MO7A 1N75A 1UHZA 4G6DA 2DA4A 2FSWA 3OR2C 3SXYA 4G9YA 4M9VC 2KIFA 2QF7A 3W6JB 1R58A 4XLPF 4G7OF 5TSEA 2MA3A 2JSCA 3UNGC 2E1MC 1E2XA 1J59A 3IH3A 1Z3YA 3T1YE 1LLMC 2UUBE 4UUSA 2MBFA 3WTUC 1Z1DA 3VSLA 2EMFA 4DV3E 2K4VA 1TW2A 2ECBA 5F04A 2BVLA 2JZYA 1MBGA 4HQEA 3S1RJ 2QSFX 1MSEC 3REOA 1YZ9A 3QP5A 2Z2SB 4BC9A 3ABLH 3S8PA 3VYUB 1D1AA 4U7BA 3A01B 1FMVA 2ZXJA 1LPQA 2DMYA 5D5VB 2VQHA 1SC7A 5A2QZ 4XICA 2L7KA 2V89A 1JUSA 1XCBA 5M3FJ 3BT9A 2R7XA 2EJ4A 4DR4E 1BIAA 1N36E 2M8GX 2WADA 1NTCA 3HOSA 2FA5A 2HVRA 2K27A 3CDHA 3ESWB 4GEQB 1V3FA 2AO9A 3FIWA 1I27A 4IJDA 1JGGA 1P4AA 3IWFA 2LD5A 3LSKA 1ETWA 1IDYA 3K4NA 3CJRB 4LF5E 4OWRB 2EJRA 2B9SA 4G8XA 1UELB 4BAYA 1IUYA 1MNEA 3GBGA 3OIOA 4NC6A 3WU0A 3KIOA 5BQTA 2PI0A 3D0SA 3HG9A 3N05A 5A6KA 2PRTA 1Z9CA 2W4SA 3C3WA 3K4CA 5AE3A 3D1NI 3CJTB 1HW1A 4MLOA 3PL8A 5ICEA 2OC6A 3LSJA 2ZJQF 4BBYA 2Y75A 2YPNA 3DTIA 3V8KA 3OY9A 1MDMB 4HLXA 4M72A 4PDKA 4Q4ZF 3S3OA 1MH4A 4KIFA 2E1CA 5K7ZA 1MEYC 3QRFF 4V2FA 3BTIA 4GFBA 5LEKA 3ZR8X 2JPBA 3MMYB 3SHFA 3JRCA 3N97A 2EOSA 2Z3YA 1BC8C 2DIXA 4IEJA 3ZOQB 4F9AB 2P4WA 3ERED 1YS6A 2LK2A 3SEZA 1JT0A 4IHXA 5FLXC 5IPAA 2IS6A 1OR7C 2EZIA 3GTLJ 4QPOA 2HOEA 1KQ9A 2KISA 4ON0A 2JYAA 1ORKA 2DPUA 1XMOE 1ON2A 3GTJJ 5A2QC 2B7EA 1YI2I 3QPLA 1QZEA 4UHTA 2K4JA 4GDFA 2EN4A 4UB6C 3IL2A 3QYFA 3FWEA 1O0WA 2YSOA 2FE3A 4BC7A 3ECOA 5FJ8J 2WAEA 3FDYA 5A6AA 2GLIA 2Q1ZB 3S3NA 2JA6J 1C0WA 2W57A 4BE1A 3W3CA 4O4KA 1LQ1A 2ELHA 5IP9J 2ZSHB 3LA7A 3P7NA 1JJ6C 3PNTA 1BM9A 2R5ZA 2O03A 2EOHA 1A04A 2OQGA 1B8IA 3VK6A 3SZTA 3SZPA 2H09A 1XC5A 4HX8A 3KE2A 2WY8Q 2QQAA 2XASA 2QVOA 2XAHA 1S7OA 5GPCA 2BY2A 3M8FA 1Y8RB 4R2SA 1V4RA 2ENCA 1IRFA 3FXQA 5DCMB 4NXNE 3EDPA 1I94E 3U1DA 2JQ7A 1OCCH 1FSHA 3I4MJ 3AFHA 2RKHA 1X3WB 2I9IA 4DV0E 4UB8C 1ZYRF 4RGRA 1K78A 2CW7A 2DK8A 1KU2A 2M7BA 2R7FA 2Y48A 3J80K 1T33A 2JVHA 2PJPA 3HPHA 2DDAA 1ZGWA 4BJ5C 5B66C 3CO6C 4CCJA 1STUA 3TMOA 1JKQC 5IT9K 3C2GA 2YRHA 1MNDA 3O2PE 5D4SA 2FMLA 1R7JA 3ADIA 4XQFA 1QBJA 2EBIA 4DMIA 3JRGA 5GAHJ 3FMSA 3CCQI 1R9TJ 1NG7A 2VQFE 4JK1X 2ICWG 1IV6A 3QPHA 4MGRA 5FKMA 2P8TA 2CQXA 4L5EA 2Q2EB 2UWMA 1U9OA 1OYIA 1S7AA 1V5FA 5B5EC 2M0MA 2K9QA 3KETA 2ETHA 1W5CC 2ZMEA 1XMAA 2E71A 1QPIA 4HOBA 3WTXC 4IRGA 3LNQA 3PSFA 1D0ZA 2OF7A 2NVUB 5K1YA 3DBHB 1FJLA 5HLTA 4BXUA 1WFXA 4R2EA 2I13A 4F93B 4MFEA 3HKZA 3R4KA 2IGMA 4KA4A 1F5TA 1Z7UA 3QAHA 4R1HA 4RAYA 5IWAE 3HPGA 2GOXB 4WCGA 2KFDA 4LIUA 4YEJA 4L9VA 2EPPA 2VXDA 4XSXF 2EM8A 1AKHA 3W6VA 3AG4H 4JI4E 2XIGA 2V85A 2MG4A 3ZQQA 2P7VB 1Q1HA 3S32A 4M3EA 2EL4A 4M30A 2IEKA 3FKJA 2DXIA 1X47A 2ODRD 4XONA 4NNJA 4OINF 1YYOA 2X85A 2KKOA 3PNVA 1V55H 2M3AA 5J1RA 3AL0B 1A5JA 4BACA 1FOYA 3KEYA 2YX7A 4GXOA 4YIRX 1TL8A 4XKWA 4JYAE 3ZOBA 2RNGA 2F5DA 2LMDA 1YG2A 3GTQJ 2E19A 1OCPA 1UG2A 4MQ9F 3QPSA 2R7VA 3OS0A 1N25A 3PIOF 2BHYA 5DS9A 1KONA 3V7SA 4F55A 2PMZA 1ZELA 3M8EA 3HDDA 2L9VA 1U78A 3HBLA 1NCSA 2EK5A 1JI8A 1PUFA 4PJ0C 4LFBE 2KQRA 2EOMA 2PJRA 4X6AJ 3NWTA 4RS8A 2EMWA 4BUPA 4KYWA 1OYYA 3BROA 2LDUA 2RNJA 2WZOA 1GZ6A 1QU3A 4XRSA 1G3TA 1IGNA 3RPQA 2XAJA 5EG0A 2KOUA 1FPQA 2DJIA 3JW4A 4LG3A 5D6EA 2O6GE 2IRFG 3FHZA 1I3QJ 2PMZN 2FX0A 2QKLB 3KYDB 4D7MA 5JLXA 4GKKE 4Y33A 1J5EE 3K1NA 5HLHA 4M9SA 5CJ9A 1K6OA 4A12A 5IOYA 4ABZA 4E7SA 4DR2E 4DUYE 2JPCA 2ECCA 2AHQA 2EPFA 2CU7A 2ISYA 2LC2A 4XN3A 4PK4A 3MEXA 5DD8A 4ZH4F 3DLAA 3WG9A 3M1CA 3RYRA 2L3CA 3VODA 2H6CA 3ZMVA 1F36A 3OSGA 5KL2A 2EFOA 1QQIA 3K2ZA 1WRJA 5K5OA 1YX3A 4M71A 1WHQA 5EZHA 4RM3A 4QTRA 3M3YJ 2NXNB 5J4VA 4YELA 2HQRA 1DP3A 5FLXK 2LUQA 2EWLA 3TQMA 4HSRA 2RTXA 4DR1E 4LF8E 3ZP5A 2BXYA 3O8HA 1MJ9A 2YU9J 2VKVA 2DDBA 3ADGA 1R23A 3MVPA 2JA2A 2YTJA 1MJBA 4N0BA 2CH0A 1WWXA 1S72I 2R7OA 3NEUA 1ZG5A 1ZAAC 4UVBA 3T0YA 1WCMJ 4HBLA 1F2IG 4PJLA 1TN9A 2W00A 1E3OC 2WV1A 3RCOA 4AIJA 3JRAA 2E1MB 2Y0MA 3F23A 1BOAA 1A36A 1O3TA 3M7GA 4HZFA 4ESJA 4B1RA 2YZTA 4EM2A 2QBYA 3WHBA 3JSPA 1YJWI 3HQ1A 2L7FP 2L9RA 4B43A 4CUGA 4QIWN 1WHUA 3LSIA 3ABKH 3FF5A 1K61A 2MC6A 3BG3A 3VFZA 2EH3A 4BHCA 3W2AA 1YYVA 1BBGA 2JVGA 2DMNA 2XPUA 2RQLA 5FFZA 1EJ9A 1W7PA 2NVQJ 2EOZA 5E18F 1XMQE 2DB2A 2FEZA 2V86A 3NQOA 1ETKA 5HDNA 1OYWA 2LCEA 2K40A 3AG3H 3KLNA 4EJTA 2R1FA 4RMNA 2RV8A 3LSHA 5B1AH 4KMUX 3BJ6A 2BB8A 3HUGB 2M34A 3A0BC 3H1CA 3S1MJ 5CQEA 3VHTB 1T56A 2EMAA 1TLHB 4OAYA 2R93J 1XGNA 3CDIA 4X1EA 3MHHC 1R1VA 3V7CA 3M9AA 3AUZA 4FASD 4LG0A 1RR8C 4BQQA 2EA4A 2Z1DA 1ZTRA 5HLIA 2OCEA 4WPYA 1G59A 4WSGA 5DYMA 2YR2A 4DR5E 3BQZA 3EQLF 4XNFA 4J01A 4A3BJ 1GVJA 5LHIA 1CF7A 2EA2A 2KDOA 2JTVA 5JVGF 2EN7A 4EM1A 4XLNF 4C3JJ 1X4PA 4HF2A 4AIHA 3GEZA 2FF4A 4FX4A 2ZCWA 4BEHB 4C30A 3OYIA 1YITI 1XSDA 4YFKF 2XB0X 2DA7A 2VQEE 3MHSC 1IAWA 1MZBA 2M30A 2WC2A 2XPVA 2DA5A 3U21A 2DJNA 2DQRA 2X48A 3BG6A 4ENJA 2QQBA 3THNA 3I59B 4CSWA 2R4GA 2BV6A 2L02A 1XSXA 1Y8QB 1PP8F 3FMQA 5EEHA 2EPLX 2P6TA 4WWCA 1QHGA 2IGKA 2IXSA 4I8OA 2PQ8A 2YWQA 3KYLA 4FK5C 5TISC 1J7KA 3B02A 3ZQ7A 3GLXA 3E97A 4FE7A 5KVRA 4R79A 3JTHA 1F1ZA 1K4SA 2H1LA 4N9IA 3GZ6A 4CYCB 2QYOA 5IXMB 4JOMA 3K70C 4DKKA 1V5EA 2XDVA 1ETYA 2KPMA 2DOEA 1X3CA 2P7CB 1YRNB 1JUMA 1U2WA 4UUTA 1FJGE 4E7KA 3ECRA 4F3QA 1T4LB 2FBKA 3FXJA 1G3SA 3P9CA 4HSTA 2TDXA 4K2EA 3EUAA 4NQWB 2WTEA 3ZCOA 5L3EA 4I0BA 3TOAA 3D5RC 2CRGA 4UUVA 2EMYA 1O57A 1X49A 2V87A 1TWAJ 2ZO4A 2DFHA 2R92J 1ZRDA 3OYDA 1ZREA 2V9PA 3KP3A 3LLHA 1OLTA 4HQMA 4QLCU 1R1TA 2OPTA 4AVZA 4QWQA 2GBYA 4DZPA 2L01A 2EMHA 2MDGA 4LF9E 1O3RA 4IRHA 2DAOA 4X64E 3C2BA 4Y52J 2CG4A 3P5JA 1XS9A 4RM2A 1DI2A 3H3VK 1KU3A 1MNMC 2HZDA 1YJ9I 1I3AA 2XHKA 3HOVJ 2MC5A 4E4HA 1FOXA 4MEYF 2G7UA 4ESBA 2HKOA 4CH7A 3OYCA 2EL6A 3LMLA 2UUZA 4BQOA 2XROA 1YW8A 3F21A 3CCEI 2D45A 1G2FC 5FROA 3B6AA 2JRMA 3DBLB 4EV0A 1L0OC 1BR1A 2Z33A 2ID3A 3F0CA 4NC7A 5GTIC 4CXFA 4AYBA 2LTPA 2XRLA 3GF2A 1H8AC 1DDNA 2E7XA 2KZVA 5FKOA 2VJJA 3ADJA 1ZKGA 3ZMZA 4HDVA 1POGA 3DF6A 2E5ZA 1A1GA 1Y0UA 2O7OA 1QHHD 1QVUA 3A0HC 2O61A 2W85A 3LA3A 5H6QA 1ITYA 4U7DA 1P7JA 3J7AY 1N32E 1Z6TA 4BY1J 1LJ9A 4NHRA 3C7JA 3GZNB 3CMYA 5FGMA 2WBSA 4AYBN 2A61A 3DU6A 1KU9A 1U5TC 1G3WA 4AIKA 3MCZA 1VF9A 2EILH 1SANA 3K9TA 3PUBA 5IP7J 3I55I 1A1KA 4EMSA 2FQ4A 4DR3E 2CUEA 3OYBA 1X1BA 4NDLA 1GLNA 4KJZA 4BH9A 3VWBA 5A6BA 2HXIA 2OA4A 2ISZA 1AHDP 3L2CA 2LLKA 3ZQLA 2EB7A 4AVPA 4Y7NJ 4UXNA 4II2A 2XVCA 1RETA 3ISPA 2EPKX 4HLYA 4JI2E 4R2PA 1VNDA 2P5KA 2YTIA 3KZIC 4JI7E 3HSEA 2COBA 3OMYA 2EV5A 3NRVA 3WE2A 3ECHA 5E8IA 3CUOA 1FTZA 4LF6E 4ANJA 1HOMA 3EUHC 2EP3A 2K5CA 2GA1A 1HKSA 2ESHA 3BR3A 5K7HA 1MMSA 4B3RE 2LTRA 4F6NA 1NH3A 4I01A 2D2WA 2HI3A 2N3HA 1P9QC 2IP2A 3F6GA 5AE2A 1FEXA 1SD6A 2LVSA 1OCRH 1IMUA 3ERMA 3IH2A 2JOBA 3P9KA 1I39A 3TW7A 4M3BA 3BTJA 3DTKA 3C4TA 3LOCA 2NA2A 2M8EA 3IC7A 2E34A 2DLKA 1MDMA 5E1WA 4R8OA 2EIMH 5E1XA 3MN2A 1Z6RA 3BBGA 2YX4A 3S2DJ 4U87A 3LFKA 2M9HA 4P78A 5CVRA 1TBXA 4PGGA 4ZYHA 1IJWC 2JPAA 3I4PA 4E70A 1RKWA 2HKXA 2H8WA 1YFHA 3TDUC 2GXBA 2PX9A 3GFMA 2CPNA 2VL8A 5AC5A 1S5LC 4DUZE 2LBSB 2QLZA 3H36A 4NXME 5DUKA 2L7ZA 1WSUA 3K4LA 4ZYEA 1JTYA 3HYIA 2PLYA 1Z05A 3TQNA 1IBME 1JE8A 4LGWA 3FKIJ 2EM6A 1SMTA 4XBFA 3AG1H 3P1XA 1ETXA 1Y6IA 3Q5FA 1WJPA 2LG4A 3TW6A 4M2ZA 2EORA 1DGRM 1P4XA 2LYCA 1XDUA 1EV7A 5L3GA 2EOXA 2XV4S 4EQQA 3HPSA 4H0EA 4DV6E 3ML6A 1ZGJA 5CFFE 2O0YA 2ZJPF 5FKLA 3BP8A 5ADZA 5D6FA 3TO7A 2VLAA 1PVEA 5JR3A 4XR6A 2XB5A 3IHUA 3CC7I 4ZDPA 4GRIA 4M6VA 5F27A 1JTXA 2JA5J 3VYTB 2RSIA 3JRHA 2EZLA 1IUFA 1J75A 3PO3J 4ETSA 2EINH 5E8GA 3GVAA 4G94A 3ZMTA 2XKPA 2HDWA 3MQ0A 2CYYA 4RAFA 4DNCA 3B73A 2EZHA 4DBRA 3LWFA 1O7LA 5KL6A 3HRUA 1WH7A 2FJ1A 2NNNA 4PSWA 3GTGJ 4S04A 2O9LA 3G1OA 3HB9A 1RQ0A 2E72A 3WTTC 3H92A 5DCMA 5T6JA 1GXPA 5TJJA 1PUEE 4MLVA 3DFGA 1IRZA 1GTKA 4JI3E 4MTEA 1VQKI 2EFWA 2FOKA 5J40A 1TNSA 4MNUA 4L9TA 5FKNA 2BGCA 3L09A 1BBYA 3FIGA 1T98A 4KNYA 2OTJI 2QUFA 4EJWA 2RS6A 2ADUA 1QO0D 2OJED 1VQLI 2O3FA 1UHWA 3DTEA 1LVKA 4A69C 1HW2A 4IQJA 3C6KA 1VQOI 4HG2A 1HF0A 1ZQ3P 4DZJA 3K10A 2GWRA 2Q2EA 3H5RA 2CQNA 2AS5F 2W25A 2VQGA 3ASOH 3IWZA 3SFIA 1D8JA 1X6EA 3EETA 2HR3A 2FXAA 3JR9A 2NUFA 4XL9A 4D5CA 5E3LA 4GO1A 1XCVA 3MSWA 3VYYA 2ELJA 1KA8A 2IGOA 2KL4A 2EPMX 2DA2A 3HOWJ 3TKYA 3WODF 3GCMA 3MZHA 1VQMI 1X6HA 1YW9A 1WJ5A 5J6XA 1MIJA 1FOKA 1TTYA 2CWEA 2RVCA 5IT3A 1DPUA 2EN8A 2XGXA 5DCFA 1R71A 1A1FA 1B6AA 1OQYA 4F52A 2RAEA 1E0EA 5F1RA 2L2NA 2LBFB 2CV1A 2DGCA 5K7FA 4MHGA 5F0CA 1IBLE 1ACIA 5LL6R 2BBYA 1OFCX 4BL0B 2X1DA 3BWGA 4IJAA 3BPVA 4IPAA 1S29A 4P9FA 4KWYA 2LNBA 2P0WA 4L18B 2QWWA 3SQNA 1FC3A 2EPAA 4BKXA 5FD5A 4LIVA 4B3XA 4KISA 1H9GA 3ZQHA 3WTVC 2F5FA 1FLIA 2EPZA 2L2KB 3CZ6A 1KYQA 2HTSA 2E7WA 4E7HA 3CCJI 4BCAA 2VC1A 3J81K 1IRXA 3BR1A 2CUJA 4DV5E 2M7QA 1XDSA 2WBTA 3BZ6A 2V1NA 1R5HA 1QNTA 2CMPA 2IS2A 1G3YA 3F6HA 2LY1A 5CVIA 1IQSA 5FB2A 1ETQA 3RZDJ 3COAC 1D1BA 4A3GJ 2TRTA 2XF7A 4IHYA 2VKHA 4BS9A 1PJSA 3K4KA 2MC3A 4A3MJ 1X4OA 3A4CA 3LA2A 4YY3E 3PSIA 2LKPA 1IXCA 5HNFA 4LU9A 3HEFA 1I5ZA 4NBQA 5BMZA 3KP2A 3BR6A 5F3WA 2VN2A 3I58A 3G2BA 4OMZA 3H5AA 4EJOA 4Y17A 4E6KG 1IC8A 1TNTA 2Y31A 1RUNA 5KL5A 3DP7A 2RGVA 3LSMA 5LEJA 3WTSC 5LHHA 5K5RA 3HIFA 1FTTA 2EN3A 4WX9A 2LJUA 3GO5A 1YJNI 4K0KE 1X19A 1R1UA 4I98B 3CC4I 4HV6A 3K1PA 5B1BH 2V9VA 4M6XA 2XSJC 3F3XA 1S7EA 4X0GA 4E7IA 3IH4A 2HWVA 4H4KC 3M1EA 1W36D 2XUBA 4ZYAA 1MBJA 3K6QA 2MFZA 2OZUA 3J7AG 2K9SA 1PDNC 1UHSA 1VZ0A 2R76A 3K4BA 5B3SH 1T95A 3QU6A 2AXLA 1G4DA 2DSYA 2DMQA 3Q3SA 2F4OB 4L5JA 5BPIA 1PDAA 1GUUA 3GXOA 2YS9A 4RB1A 2EPUA 1X2NA 1ETOA 2NVTJ 3TO9A 2EPNA 3I3LA 2F48A 2ACJA 1FZPB 1QA6A 2ZM6E 3RTRA 3AKZA 3FM3A 4EJUA 3KEOA 2IS4A 1G6NA 3BG9A 4LJZF 3HHGA 4P7DA 5C3EJ 3ZQFA 3CC2I 4Y15A 4IRIA 2E1MA 4PGHA 1GHCA 1VQ5I 1WKMA 2LE2A 1HDPA 4M3GA 3ZQIA 2F4VE 3CCSI 4WYQB 1U5TB 4Q5SF 1BI2A 3H5NA 2M7AA 1MH3A 2VIXA 5KL3A 2UUCE 1WJFA 4IO9F 1QZZA 3JRBA 2EMGA 3BC8A 2HGHA 1XX5A 4MFDA 4G12A 3N4MA 3S1QJ 1W7PD 3CJQB 3DKXA 5DDGA 2H36X 4R2CA 3R61A 3V8JA 3HRTA 3GLLA 2XAUA 2LH9A 5HNHA 3J7ZI 3QYEA 3L2RA 1ETVA 2K86A 3C18A 4KDPA 3PO2J 1VQ9I 2IA0A 5H6RA 2E1OA 2EFQA 3OYNA 2E35A 5GAGJ 4A3LJ 3BZCA 5LBQA 5D5WB 3EQ1A 1ZN2A 1DU0A 3ONQA 4CO8A 3PM1A 2DT6A 3PUFA 3BZKA 2VODA 2M4IA 1R6RA 2Q8UA 2ZFWA 2E1NA 4KUMA 3MWMA 2X6OA 4AC0A 2PBIA 4CZCA 2L2MA 1ZR4A 2YTQA 1ONVA 2MSYA 1NEIA 1HNWE 1HCRA 2Q0OA 3MKZA 4LD5A 3AG2H 5K5QA 4DYCA 1EKZA 3HHHA 2V6CA 3TBIA 4JV5E 4N4OB 2D1HA 3CCVI 3CP8A 2EM9A 4YIFA 2Z16A 4JI1E 4TUGA 5FKKA 1D8KA 1BW5A 3RSNA 3ZQGA 4BEHA 4LFCE 1T0FA 2YTGA 1EF4A 2WCC3 4OIRF 3E6MA 1IN4A 3PQJA 3RKXA 3CF2A 2A68F 3HRMA 4I7HA 2B7VA 1QRYA 4DR7E 3VSKA 1MSFC 3VYSB 4LK0F 1YUJA 4PJMA 1BI3A 3I59A 4LLGF 3HM5A 1IG7A 1XG1A 2KHMA 2QZ8A 3BJAA 2STTA 2GAUA 1SFKA 3L2UA 2V1DA 3JRFA 2ODRC 3QPTA 1ZR2A 3BGHA 1Y0NA 4IVNA 2D1VA 2FQ3A 3HOZJ 1OISA 1MW7A 3ZGKA 2UV1A 3ABTA 4IHVA 3F8MA 2AXTC 1Y39A 4R2AA 2H6BA 2NOGA 4OIQF 2PMHA 1X1AA 4MTDA 2WA0A 4CCLA 4IOAF 1W5SA 5KK1A 2R5YB 4MLQA 1OR7A 1OPCA 3HXLA 5ICGA 4CYCA 1SR9A 1VQNI 2L4MA 2VUMJ 4XLEA 2I5UA 2R3SA 3BCBA 3PIPF 3OYLA 2LY2A 4HF0A 1YRNA 4O5VA 1HNZE 3DU5A 1XNRE 3JTZA 1UZCA 1GQEA 1PJQA 1Y56A 3CP2A 1VQ8I 4KMFA 4II3A 1TWCJ 1IXSB 2CSOA 5DM7F 4BXXJ 4I2OA 3E6BA 3FXOA 2QSHX 4WXDA 1T2KA 1G8XA 4F7ZA 5D5XB 4LLLA 4J19A 1RR7A 4DV2E 1MJAA 2DCEA 5LHGA 3R6SA 3CUQC 3RDIA 2LREA 1X1PA 3RMPA 1KQ8A 1VQ4I 2E36A 2KMUA 4ASNA 3JU0A 2A6TA 1E3PA 2QGUA 2VBYA 3F6OA 4XN0A 4XLAA 2VASA 4ZDOA 2GA2A 3G6EI 2KRFA 2N3GA 1N33E 4HA8A 2YU8A 1ZK8A 1X58A 5ILSA 2FBHA 2NRAC 3G73A 2LF8A 3QP6A 4G7HF 2NS8A 1I50J 1BL0A 4LB6B 5E1ZB 2VQLA 3NWSA 2FNAA 5A2QK 2JWOA 2CQKA 2YRMA 1KZHA 2ZSIB 3BG7A 3RPUA 1IN7A 1LDJA 4Y3OA 2HFHA 3HTUA 2ENAA 4JP0A 3HPZA 4D0PA 3OYKA 4B3TE 2VJ5A 4HV5A 4L5NC 1GV5A 3Q9SA 2F5CA 3PQKA 2LV2A 1X5WA 3R0JA 4N4NB 2ME6A 4XKCA 4BYYA 3JRDA 3JAMZ 4J00A 2LRDA 2IT0A 2MABA 2VE9A 2GQQA 3ZMUA 3WU1B 2WAQA 3OOUA 2XKOA 4FT8A 3B6CA 3KEQA 2DYSH 3E5QA 2WY7Q 3BIDA 1RKTA 2DI3A 1EH8A 1HC8A 1YE9A 2W82A 3TGNA 2JUCA 2EFNA 4PJJA 2X1EA 1BR2A 1HXDA 3HL2A 2M4KA 3GMEA 4F92B 5LGTA 2EMZA 3FBIB 3I5UA 1BI0A 2OBPA 4KT5C 5L3FA 2GM4A 2PN6A 2W84A 2YSPA 2DQLA 3I71A 5EEGA 3JREA 3S2HJ 1GDTA 1B72B 3Q9VA 1LB2A 3KFWX 4LTYA 2K02A 2EMXA 2FOWA 3KP6A 3V4GA 4FX0A 2NABA 2VKDA 2V1UA 4A3DJ 2MD5A 2WAQN 5A6BD 1G2DC 1YS7A 3GZ5A 2UXDE 2VI6A 1HSTA 2GIZA 1S6LA 2W1OA 2XAQA 3IV5A 2QENA 1SVMA 4UVCA 5JFRA 2DMIA 2HQ5A 4EGZA 2IA2A 5CQGA 2HQNA 3ADLA 3L2WA 4DW6A 1Z3XA 3DBRB 1BC7C 3U1KA 2R7SA 3K0LA 2L33A 1ON1A 1EH7A 3VYRB 4KT6A 1L3LA 3I56I 2ZBKA 3JRIA 2W48A 4WXHA 2DT5A 1X1DA 2BW3A 2F5EA 1IDZA 4LFAE 4LB5A 1DQ3A 1FY7A 3E7LA 4IOCF 4FETA 2K9LA 3C6MA 1R22A 3EYYA 1LUJB 3X2QH 2VB6A 3M07A 3W2WA 4S0HB 2K3PA 1AKHB 2HOSA 1B4AA 3KWRA 4BQAA 4HX4A 2D9HA 1FYKA 1V5GA 3H9GA 2EQ1A 5JHFA 1L4SA 2DTZA 2FGGA 1IN5A 5M5WJ 5IYBJ 1AA7A 5ILUA 1I6HJ 1A1JA 4O43A 2JR1A 2P5LC 2MDRA 1R4MB 2HXOA 1WPKA 2YU5A 2JWTA 3JAMC 4DIQA 5F0FA 4A0XA 3MZ8A 4XM3A 1AH5A 4HAMA 4DYRA 1ODDA 1SD7A 2OUMA 1X2MA 2YUSA 1J0RA 2VRDA 1HSJA 2YT4A 1QU6A 2LSOA 1AAYA 2A5YB 2RPCA 1FKAE 3VB2A 1S8NA 5C44J 1FP1D 3TOBA 5CYVA 3T1HE 2EMLA 3MZYA 2X9DA 4KN4X 2DA1A 2HYGD 5EGOB 5FD6A 1R4NB 2NUGA 3S16J 1CGPA 3OIPA 2EMBA 4HEIA 2F4IA 1JXSA 3V8LA 4DV1E 4HNUA 2DODA 2G7HA 5F64A 3HTSB 4RAGA 2ELYA 4OU0A 2EMKA 3ZMDA 3S17J 2KIUA 4UY8I 1ZU1A 2HZTA 1A35A 2N8XA 3DF8A 3DJWA 3F72A 5J4YA 4RB3C 2LFBA 2UXBE 5J8FA 3E3VA 2E2IJ 1RRJA 4AWXB 4U0YA 5FO5A 1NK3P 2X0LA 1N3GA 2Z9OA 3KP5A 5E79C 3GTMJ 4Q47A 4LOCA 1O4XA 5JI6A 2B9DA 3S1NJ 2JK3A 4KHPE 1BA5A 1VTNC 5GPAA 3JCUC 4IS1C 1X48A 2VQCA 2LVHA 2VT2A
chains in the Genus database with same CATH topology
3VOEA 4CHUA 1ZARA 4LFUA 5DEQA 4KN7X 4PZJA 1J5YA 1OKRA 3SFZA 1UB9A 2UXXA 5ICFA 3F8BA 2A6EF 3LSTA 4U88A 1LVAA 1USSA 3HSFA 3T1BA 2DBBA 3K69A 3RYPA 1FBUA 4YIIA 4Z2YA 4YG2F 1LNWA 3F6VA 4CYDA 6PAXA 2VBZA 1W4MA 1FSEA 4JQFA 4L5IA 2L54A 4WF2A 2NNYA 3LQQA 3IRQA 4XSZF 2VONA 2DK5A 2XAFA 3MFKA 4B09A 3HRSA 3J80Z 2HYFA 4RB2C 1KU7A 5IT9Z 1DPRA 2R7DA 2IA1A 5HVQC 3MAJA 1I1GA 4ZZLA 1IXRC 5DUIA 2DO7A 3WTWC 1B59A 4XRFA 2A6HF 2KIMA 1FWZA 4S05A 3TDZC 2CO5A 2JRTA 1YLFA 2MH9A 2ZNYA 5AIQA 4UNOA 2OD5A 2EWNA 4A6DA 4UV8A 2RC4A 1H0MA 3F8NA 1PP7U 1SD4A 4N9HA 3JTGA 2J5PA 3CUQB 2J5OA 3I0TA 1R5GA 3CLOA 2IPQX 1T38A 5H20A 2EV6A 4M9ZA 5F6FA 3F8FA 1BI1A 2OAZA 3O6BB 2PG4A 3F8CA 2PEXA 1F4KA 1B9MA 2JT1A 1YQAA 4A6EA 1WQ2A 3RIRA 2C6YA 3E6CC 2VE8A 2UZKA 1SFXA 1Z91A 3IRRA 2OU2A 1ZRCA 1LEAA 4RGSA 3WGGA 2HS5A 1F9NA 1RUOA 4L9NA 4RGUA 4I0AA 2G9WA 1NHAA 1U5TA 1O7FA 4CICA 5LGNA 3EYIA 3BDDA 2VOPA 1I6XA 1FBSA 3G3ZA 2DPDA 5JHUA 3OV8A 3ZMSA 5D8LB 5BS6A 1YIOA 4M9XA 2DFIA 3BJOA 1O3SA 4Y13A 5FLXZ 4BHPA 3GFLA 1HQCA 3GFJA 5HLGA 1JGSA 2O8XA 3T8TA 3FXRA 1K79A 3EUHA 3D5LA 4ZZDA 3RI4A 3AAFA 4L9JA 2V79A 3DPLC 4OIPF 1BJAA 3PFIA 2HTJA 1H9TA 4PCQA 1UCRA 2M1BA 3T8RA 5ERIA 1P92A 3VEPA 5L3CA 2VT3A 4O6JA 2UXNA 2YSRA 4P9UA 2NYXA 2P6SA 4HYEA 1R36A 1RI7A 4G6QA 5HS7A 2RDPA 2Z99A 1ZLKA 1UFMA 1LEBA 4BNCA 1TQPA 4GYGA 4BHBA 2KJCA 1JHFA 1SD5A 1IN6A 5D8KB 1OMIA 2BEOA 2FBIA 2ZJ2A 1XB4A 3J7AO 1QPMA 1FX7A 3F22A 1TQMA 2STWA 2M87A 3CO7C 4RAZA 4ENNA 2ZNZA 2IVMA 1E17A 1IF1A 2PMUA 3H3UA 3E5UA 4Q48A 2RN7A 2K4BA 3C1DA 3R0AA 3I53A 1D3YA 4OOIA 1KYWA 2XRNA 3CTAA 4KIBA 2M5WA 1U6GA 4DQ2A 2EFPA 2Q8KA 1W5TA 1FYLA 1SMYF 2ZKZA 4GYIA 4L0ZB 4EM0B 1MKMA 5HS8A 5D5UB 4U0VA 1YW7A 5CVVA 3T5XA 4ENMA 1U3EM 1BN5A 3I54A 2MLKA 3H3ZA 1RZ4A 2VBWA 3W6KB 4IHTA 3HUGA 5J8CA 4I02A 4A2UA 1EH6A 1KQ0A 2YPRA 3ZPLA 1XD7A 2VC0A 1DP7P 1SFUA 3FZVA 4A0ZA 4KICA 2VOOA 3BOQA 2QQ9A 4R8HA 2A07F 1FBQA 4P96A 4MQVA 5CVUA 3E6DA 4A5NA 3ROUA 5L3DA 4OIOF 5LRSA 1B1BA 2YU3A 1FP2A 3L9FA 1J9IA 1YO5C 3V7RA 1S3JA 4RGXA 5FFXA 3GFIA 3LAJA 1KYZA 2V1XA 5AIPA 3DXJF 2COMA 2PFBA 4L0YB 2RQPA 1T39A 3DV8A 4GGGA 4NQWA 1D5VA 3L7WA 3WGHA 4HX7A 2P5VA 2GXGA 4LMYA 1ZGAA 1FNNA 4A0YA 2K7LA 4GCVA 4IXAA 3DEUA 5E17F 4UVAA 2Z5UA 4M73A 4WXCA 2BE5F 5E20A 4EVIA 5JVTA 1JHHA 1ZG3A 1AOYA 1MGTA 5DV5A 2A3SA 4I09A 1IW7F 3FX3A 3IKVA 1HKQA 1LDDA 4EGYA 5LGUA 5ILVA 4IF4A 5ED4A 4HDUA 5HDKA 1U8RA 1REPC 1IN8A 2FU4A 2OQRA 1K78B 3KCCA 4CZZA 1IRGA 2EV0A 3QOPA 4LK1F 1P6RA 2HDCA 4EJVA 3FMRA 1QZYA 4RB0A 4NHJA 5BPDA 4YFNF 5LRRA 3I64A 2LF7A 2CW0F 2H94A 3BPXA 4HW0A 3DPTA 1AWCA 2ZMEB 2MH2A 3KP4A 2X4HA 2VBXA 5CVJA 5D4RA 1SFEA 1ZRFA 1HKTA 2H27A 3TO6A 2ESNA 2NS0A 1XGOA 1USTA 1YTYA 2GIVA 3DQVC 5LLQA 3KZZA 2W24A 3ABUA 3ZN0A 4IHSA 2WWYA 2CFXA 3CJNA 4FHTA 1ZH5A 3KLOA 5BOXA 1J2XA 3KP7A 1MD0A 3LQRA 4ENKA 1DUXC 4A5MA 2DU9A 5AONA 3HSRA 2FMYA 2HEOA 3R60A 3LAPA 4OMYA 1WI9A 1LDKB 1K7AA 3CUQA 3BY6A 3E5XA 1HBXG 4KIGA 1FYMA 1UHMA 1B9NA 3OOPA 4P55A 3GYHX 2CGPA 3GW2A 3WGIA 4KFCA 1XGSA 1TW3A 3J81Z 4ESFA 1XGMA 2OZ6A 2XAGA 1RIOH 2WV0A 2DTRA 4B8XA 3L00A 4CGZA 4G7ZF 2FRHA 3WE3A 1X3UA 1I1SA 3GWZA 1R00A 3U9GA 2DW4A 4U0WA 5HDGA 1ZHFA 3RKYA 4MEXF 2QBYB 2KJBA 2L3DA 5CLSA 1FT9A 3RKWA 4LLNA 4HF1A 1W7PB 1GXQA 2GZWA 5HS9A 2NAZA 3ELKA 3WTZA 2IW5A 1ZLJA 3K1MA 4M6YA 4WK8F 2HGCA 3KZYA 3FM5A 3JSOA 1ULYA 4LG0B 3GX4X 1CF7B 3S2WA 1XN7A 2B0LA 1ZG1A 2DLLA 1RNLA 2M45A 3O3KA 4NB5A 4O3MA 4JBAA 1O3QA 1TQIA 4M74A 3FXUA 2VXZA 1SAXA 3P9IA 3QU3A 1XSVA 3HOTA 1P4WA 1XMKA 1ZAOA 5TRDA 4ZYDA 4UV9A 2A69F 2FNPA 3ZN1A 4P5OA 3JAMK 1KGSA 4ZYGA 3WTYC 4TV7A 1BIBA 5ICCA 3IKTA 1T6SA 2BYVE 1IZ1A 4YFXF 4CDGA 1QGPA 2L4AA 5HOOA 2F2EA 5DD4A 3GUDA 4AD9A 1HW5A 1P2FA 1STZA 5L3BA 3DKWA 3RJPA 3U2RA 2QM3A 2MLGA 2IJLA 3ULQB 4G6DA 2FSWA 3SXYA 4G9YA 2KIFA 3W6JB 1R58A 4XLPF 4G7OF 2MA3A 2JSCA 1E2XA 1J59A 2MBFA 3WTUC 1Z1DA 1TW2A 2JZYA 4HQEA 3REOA 3QP5A 4U7BA 2ZXJA 5D5VB 5A2QZ 1XCBA 1BIAA 3HOSA 2FA5A 2K27A 3CDHA 1V3FA 1I27A 1P4AA 3IWFA 2EJRA 4G8XA 4BAYA 1IUYA 3WU0A 5BQTA 2PI0A 3D0SA 1Z9CA 3C3WA 1HW1A 5ICEA 2Y75A 3V8KA 1MDMB 4HLXA 4M72A 4PDKA 4Q4ZF 2E1CA 4KIFA 3QRFF 5LEKA 2JPBA 3SHFA 3N97A 2Z3YA 1BC8C 2P4WA 3ERED 1YS6A 2HOEA 1KQ9A 4ON0A 2DPUA 1ON2A 4UHTA 2K4JA 3IL2A 3FWEA 2FE3A 3ECOA 1C0WA 2W57A 1LQ1A 2ELHA 3P7NA 3LA7A 1BM9A 2O03A 1A04A 2OQGA 3SZTA 3SZPA 2H09A 4HX8A 3KE2A 2QQAA 2XASA 2QVOA 2XAHA 1S7OA 3M8FA 1V4RA 1IRFA 3FXQA 5DCMB 3EDPA 3U1DA 1FSHA 2RKHA 1ZYRF 4RGRA 1K78A 2DK8A 1KU2A 2R7FA 2Y48A 3J80K 2PJPA 3CO6C 5IT9K 3O2PE 5D4SA 2FMLA 1R7JA 1QBJA 3FMSA 4JK1X 3QPHA 4MGRA 2P8TA 2UWMA 1OYIA 1S7AA 3KETA 2ETHA 2ZMEA 1XMAA 4HOBA 3WTXC 4IRGA 5K1YA 4BXUA 3R4KA 4KA4A 1F5TA 1Z7UA 3QAHA 4R1HA 4RAYA 4WCGA 4L9VA 4XSXF 2XIGA 2P7VB 1Q1HA 4OINF 2KKOA 2YX7A 4GXOA 2F5DA 1YG2A 4MQ9F 3V7SA 3M8EA 1U78A 2EK5A 4RS8A 4KYWA 1OYYA 3BROA 2LDUA 2RNJA 1G3TA 3RPQA 2XAJA 1FPQA 5D6EA 3JW4A 2O6GE 2IRFG 3FHZA 3K1NA 5HLHA 4M9SA 5CJ9A 1K6OA 4A12A 2JPCA 2ISYA 3MEXA 5DD8A 4ZH4F 3WG9A 3RYRA 3VODA 2H6CA 3ZMVA 2EFOA 1QQIA 3K2ZA 1WRJA 5K5OA 4M71A 2HQRA 5FLXK 3ZP5A 1MJ9A 1R23A 1MJBA 4N0BA 1WWXA 3NEUA 1ZG5A 4UVBA 3T0YA 4HBLA 4AIJA 2Y0MA 3F23A 1BOAA 1O3TA 3M7GA 4HZFA 4ESJA 4EM2A 2QBYA 3JSPA 3FF5A 3VFZA 4BHCA 1YYVA 5FFZA 1W7PA 5E18F 2FEZA 3NQOA 5HDNA 1OYWA 3KLNA 4EJTA 2RV8A 4KMUX 3BJ6A 1TLHB 1XGNA 1R1VA 3V7CA 3M9AA 4LG0A 2EA4A 5HLIA 5DYMA 2YR2A 3EQLF 1GVJA 5LHIA 1CF7A 2EA2A 2JTVA 4EM1A 4XLNF 4HF2A 4AIHA 3GEZA 2FF4A 4FX4A 2ZCWA 1XSDA 4YFKF 1IAWA 1MZBA 2M30A 2WC2A 2DQRA 4ENJA 2QQBA 3I59B 2BV6A 2L02A 1XSXA 1PP8F 3FMQA 5EEHA 2P6TA 4WWCA 2PQ8A 1J7KA 3B02A 3ZQ7A 3GLXA 3E97A 5KVRA 4R79A 3JTHA 1F1ZA 4N9IA 3GZ6A 2QYOA 2P7CB 1U2WA 2FBKA 3P9CA 1G3SA 4K2EA 2TDXA 2WTEA 5L3EA 4I0BA 3TOAA 4UUVA 1O57A 2ZO4A 1ZRDA 1ZREA 3KP3A 4HQMA 4QLCU 1R1TA 4QWQA 2L01A 1O3RA 4IRHA 2DAOA 2CG4A 1KU3A 2XHKA 4MEYF 2G7UA 4ESBA 2HKOA 2D45A 2XROA 1YW8A 3F21A 4EV0A 1L0OC 2Z33A 4CXFA 1DDNA 3GF2A 2E7XA 3ZMZA 4HDVA 1Y0UA 2O61A 2W85A 3LA3A 5H6QA 4U7DA 1Z6TA 1LJ9A 3C7JA 5FGMA 2A61A 1KU9A 1U5TC 1G3WA 4AIKA 3MCZA 3K9TA 4EMSA 4BH9A 2OA4A 2ISZA 3L2CA 2EB7A 4AVPA 4UXNA 2XVCA 3ISPA 4HLYA 2P5KA 3HSEA 2EV5A 3NRVA 3WE2A 3ECHA 5E8IA 3CUOA 2GA1A 1HKSA 2ESHA 4I01A 2D2WA 2IP2A 1SD6A 3P9KA 2M8EA 3IC7A 1MDMA 5E1WA 5E1XA 1Z6RA 2YX4A 3LFKA 5CVRA 1TBXA 4PGGA 4ZYHA 3I4PA 4E70A 2HKXA 1YFHA 3TDUC 2GXBA 3GFMA 2QLZA 5DUKA 1WSUA 4ZYEA 3HYIA 2PLYA 1Z05A 3TQNA 1JE8A 4LGWA 1SMTA 4XBFA 3Q5FA 1P4XA 1XDUA 1EV7A 5L3GA 2XV4S 4EQQA 4H0EA 3ML6A 1ZGJA 2O0YA 3BP8A 5D6FA 3TO7A 5JR3A 3IHUA 1J75A 4ETSA 5E8GA 3GVAA 4G94A 3ZMTA 2XKPA 3MQ0A 2CYYA 4DNCA 3B73A 3LWFA 1O7LA 3HRUA 2NNNA 4S04A 3WTTC 3H92A 5DCMA 1GXPA 5TJJA 1PUEE 3DFGA 4MTEA 2EFWA 2FOKA 1TNSA 4MNUA 4L9TA 2BGCA 3L09A 1BBYA 1T98A 4KNYA 2QUFA 4EJWA 2ADUA 1QO0D 2O3FA 1UHWA 1HW2A 2GWRA 2Q2EA 2AS5F 2W25A 1D8JA 3IWZA 3EETA 2HR3A 2FXAA 4GO1A 1XCVA 1KA8A 3TKYA 3WODF 3MZHA 1YW9A 5J6XA 1FOKA 1TTYA 2CWEA 2RVCA 5IT3A 1DPUA 2XGXA 5DCFA 1B6AA 5F1RA 4MHGA 2BBYA 3BWGA 4IJAA 3BPVA 4IPAA 1S29A 4P9FA 2LNBA 4L18B 2QWWA 3SQNA 1FC3A 5FD5A 1H9GA 3WTVC 2F5FA 1FLIA 2HTSA 2E7WA 2VC1A 3J81K 1XDSA 3BZ6A 1R5HA 1QNTA 1G3YA 5CVIA 5FB2A 3COAC 2MC3A 3LA2A 2LKPA 1IXCA 1I5ZA 5BMZA 3KP2A 2VN2A 3I58A 4OMZA 4EJOA 4Y17A 1TNTA 1RUNA 3DP7A 2RGVA 5LEJA 3WTSC 5LHHA 5K5RA 3HIFA 4WX9A 3GO5A 1R1UA 4I98B 4HV6A 3K1PA 2V9VA 4M6XA 3F3XA 1FYKA 2HWVA 3M1EA 2XUBA 2OZUA 1PDNC 1G4DA 3QU6A 2AXLA 4L5JA 5BPIA 3GXOA 4RB1A 3TO9A 2ACJA 1FZPB 3RTRA 3FM3A 4EJUA 3KEOA 1G6NA 4LJZF 3HHGA 4IRIA 4Y15A 4PGHA 1GHCA 1WKMA 1U5TB 4Q5SF 1BI2A 1QZZA 3N4MA 1W7PD 5DDGA 3R61A 3V8JA 3HRTA 3C18A 2K86A 4KDPA 2IA0A 5H6RA 2EFQA 5LBQA 5D5WB 1ZN2A 4CO8A 2VODA 2ZFWA 2E1NA 4KUMA 3MWMA 2PBIA 1ONVA 2Q0OA 4LD5A 5K5QA 3HHHA 2V6CA 2D1HA 4YIFA 1D8KA 1T0FA 4OIRF 3E6MA 1IN4A 3PQJA 3RKXA 2A68F 3HRMA 4I7HA 4LK0F 1BI3A 3I59A 4LLGF 3BJAA 2QZ8A 2STTA 2GAUA 2V1DA 3QPTA 4IVNA 2D1VA 2FQ3A 3ABTA 3F8MA 2H6BA 4OIQF 2PMHA 4MTDA 1W5SA 5KK1A 1OR7A 1OPCA 5ICGA 2L4MA 2R3SA 4HF0A 4O5VA 4KMFA 1IXSB 2CSOA 4I2OA 3E6BA 4WXDA 1T2KA 4F7ZA 5D5XB 4LLLA 1MJAA 5LHGA 3R6SA 3CUQC 3RDIA 1KQ8A 4ASNA 2VBYA 3F6OA 2GA2A 2KRFA 4HA8A 5ILSA 2FBHA 2NRAC 3G73A 2LF8A 3QP6A 4G7HF 4LB6B 5E1ZB 5A2QK 2FNAA 2CQKA 3RPUA 1IN7A 1LDJA 2HFHA 3HTUA 4D0PA 4HV5A 3Q9SA 2F5CA 3PQKA 3R0JA 4BYYA 2IT0A 3JAMZ 2VE9A 2GQQA 3ZMUA 3WU1B 2XKOA 4FT8A 3KEQA 3E5QA 2DI3A 1EH8A 3TGNA 2EFNA 1HXDA 5LGTA 3I5UA 1BI0A 2OBPA 4KT5C 5L3FA 2PN6A 2W84A 2DQLA 3I71A 5EEGA 3Q9VA 1LB2A 3KFWX 2K02A 3KP6A 3V4GA 4FX0A 2V1UA 2MD5A 1YS7A 3GZ5A 1HSTA 1S6LA 2XAQA 2QENA 4UVCA 5JFRA 4EGZA 2IA2A 2HQNA 1BC7C 3K0LA 1ON1A 1EH7A 1L3LA 2ZBKA 4WXHA 2DT5A 2F5EA 4LB5A 1FY7A 1R22A 3EYYA 1B4AA 4BQAA 4HX4A 1IN5