2MKDA

Human jaz zf3 residues 168-227
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
STKVEALHQNREMIDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQETKLKLMARYGRLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Characterization of Interactions between the Double-Stranded RNA-Binding Zinc Finger Protein JAZ and Nucleic Acids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Zinc finger protein 346
total genus 13
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2014-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12874 zf-met Zinc-finger of C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2mkdA00
4R2EA 4R2AA 2EORA 2EM7A 2EOZA 5KL3A 2EMXA 4R2QA 2EMKA 1A1JA 2A25A 2DLKA 4R2PA 2EMWA 4F2JC 2WCC3 2GHFA 2LV2A 2EL6A 1Z1BA 4F6MA 2ELZA 4R2DA 2EOJA 2EQ3A 2YSPA 2WBTA 1ZU1A 2YRHA 4IS1C 2MDGA 4F6NA 2CTDA 2EM5A 2EL4A 2EOMA 3M99B 5KL7A 2EPAA 2MKNA 2EN6A 2YSOA 2CT1A 1G2DC 2EOEA 2YRMA 2EMYA 4R2CA 2YRKA 4FK5C 2JPAA 4X9JA 2EN1A 2EOQA 2EOIA 2YTPA 4WSGA 2EOSA 2EOYA 2EMLA 2EMAA 3EPLA 2EMGA 2EN3A 2EL5A 1BBOA 2LO3A 1P47A 1A1HA 5KL4A 2VRDA 5KL6A 2EOFA 1YUIA 2ENCA 2D9HA 1TF6A 2HGHA 5KL5A 2EQ0A 2ADRA 2EPUA 1JK1A 1X6HA 1AAYA 1A1LA 2EPZA 2YTFA 2DGCA 2LCEA 2EM4A 4R2SA 2WBSA 1YUJA 3EPHA 1ZAAC 2LT7A 4M9VC 1F2IG 2M9AA 2ENAA 1A1GA 2MKDA 1MEYC 2EPCA 2J7JA 3MHSC 2EPRA 2LVHA 2YU5A 2YTGA 2EN2A 2E72A 2GLIA 2YTOA 2EJ4A 2EOHA 3MHHC 1X5WA 1B69A 2YTIA 2ENHA 2YTJA 1A1FA 1X6FA 2DMIA 4R2RA 4IJDA 1G2FC 1YSAC 2EM3A 1JK2A 2WBUA 2EN4A 2EM9A 1TN9A 2DRPA 2YU8A 3VHTB 1NCSA 1KJKA 2RPCA 2EPPA 2EOOA 2YTEA 5KL2A 2BB8A 2ELYA 2RSIA 2EP3A 1X3CA 2CSHA 1DGCA 3EPJA 2I13A 2R1FA 2EMCA 1WJPA 4GZNC 2YTDA 2YTNA 3EPKA 2EM6A 1UN6B 1BB8A 2PRTA 2EMZA 2EOXA 1ZR9A 2EQ1A 2NABA 1A1KA 3UK3C 1RMDA 2EMIA 1UBDC 2EMBA 2EMFA 1A1IA 2EN7A 2EM8A 2EM2A 2YTQA 1LLMC 1TF3A 2EPXA 2EE8A 2EN8A 2EM0A 1X6EA 2DLQA 2JP9A 2EMHA
chains in the Genus database with same CATH superfamily
2EOZA 2NUEA 2R76A 2EMKA 5DNYA 2DLKA 3J80C 2E5LE 2B7TA 5IXMB 4Q35B 2ELZA 2UXBE 3KZYA 1RC7A 5A6KA 3LMLA 1NEIA 4BMJA 1L4SA 2YSPA 4OX9E 1ZU1A 2YRHA 2L2NA 2K4VA 2M4IA 4F6NA 4GKJE 2UUBE 1N32E 2CT1A 4ZYEA 4LF8E 3J7Yp 4NXNE 2YRMA 2EMYA 5FLXC 4X64E 1WHQA 4FK5C 4O24A 3T1HE 2YTPA 2EWLA 4WSGA 1N36E 2L92A 2Q8UA 2EMGA 3OMLA 5LL6R 5LMNE 4YY3E 4JI5E 1A1HA 4O43A 2VRDA 2MC5A 2HGHA 4WXCA 2E1MA 4RH8A 2LTRA 4O5GA 5A6BA 3AUZA 4DR3E 4LF9E 1X6HA 1HNWE 4DMIA 3EQ1A 2YTFA 1AH5A 2DGCA 2EM4A 2UU9E 2V83A 4R2SA 1YUJA 4JV5E 1ZAAC 2LUQA 4HTGA 3BBGA 4F9AB 2M9AA 2ENAA 1A1GA 2L8TA 1UILA 2J7JA 5LLQA 1T4LB 4JI0E 3BIDA 2DSYA 4R8OA 1PJTA 1X5WA 2YTIA 4JI1E 2HC5A 4MLVA 2YT4A 1ZBTA 2YWQA 3C4BA 4IJDA 1G2FC 4HEIA 2RQLA 1YPNA 1FKAE 2V85A 5KL2A 3K6QA 2RSIA 4DR7E 2CSHA 2EPNA 2JVAA 4B3ME 2I9IA 1DGCA 4NZVA 2YTDA 2YTNA 4WYQB 2V89A 4JI7E 4LF7E 2NABA 2EMIA 2G7HA 2RSMA 2EN7A 5AC5A 2YTQA 2JOXA 3C6KA 1TF3A 5AE1A 2EE8A 2EN8A 4DV2E 2DLQA 2JP9A 3BGHA 4R2AA 3THNA 3ADIA 2EM7A 5A69A 4I8OA 1IBLE 1A1JA 4WSPA 2B9DA 2FTXB 2WCC3 3ADJA 3HXLA 2EL6A 1Z1BA 5A6JA 1DQ3A 4R2DA 4LF5E 3ECRA 4DV6E 2IHR1 1XMOE 2EPKX 3VYXA 2WBTA 1QNTA 1I94E 2CTDA 3M99B 2EPAA 5LMUE 2EN6A 4JI2E 3AV0A 4WX9A 3HQ1A 4TUIA 2YPNA 4DV7E 2EN1A 4YHHE 3OTOE 2UUCE 2KONA 5AE3A 2EOYA 2EMLA 2EMAA 3EPLA 3TQMA 1WRJA 2EN3A 1ZBQA 2WZOA 1BBOA 2N3GA 4DR4E 1YUIA 3ZOQB 5KL6A 4M0VA 2VQEE 1HNXE 3LLHA 1DI2A 2EQ0A 2EPUA 2EPMX 2V8QB 4K0KE 1A1LA 4DR5E 2HJJA 1X48A 5IV8B 2WBSA 3EPHA 2GPIA 2LT7A 4M9VC 1T4OA 3J81C 2MKDA 1MEYC 2DB2A 3HPSA 2LVHA 2L3CA 2E72A 2GLIA 3MHHC 2YTJA 2M7QA 3ADGA 1KYQA 1YSAC 1JK2A 2EN4A 2YU8A 1NCSA 4WFTA 2RPCA 2YTEA 4GEQB 2BB8A 3C6MA 4LFCE 4RHBB 2L2MA 2L33A 3IWBA 1BBGA 1IBME 3EPJA 1XMQE 2B3TB 4GZNC 3VYYA 1IMUA 2DMYA 3DF6A 2EM6A 1BB8A 4DV5E 1XNQE 3UK3C 1RMDA 1UBDC 2EMBA 2EM8A 4JI8E 3JTZA 2EPXA 1EKZA 2EM0A 2VQFE 4KHPE 1IBKE 3THOB 2EMHA 1GQEA 1N3GA 4ZYHA 1N33E 2EORA 4LFBE 5KL3A 2EMXA 4P78A 1RQ0A 4R2PA 4F2JC 2EMWA 4X62E 1PJSA 2LV2A 2LJHA 2EPOA 4BHBA 4L5NC 3MSWA 5A6BD 1WHNA 2RS6A 4X8WA 2LBSB 4DR1E 2JXPA 4BC7A 2MC6A 4IS1C 4LU9A 1EH7A 2EM5A 2EOMA 5KL7A 2MKNA 4LTYA 2KHXA 2JY9A 2EOEA 2RTXA 4DUYE 5AE2A 4ZYGA 2YRKA 2L3JA 2ODRD 2JPAA 4X9JA 2FGGA 1WXRA 4DUZE 1IQSA 2EOIA 1HR0E 2EOSA 4NHRA 3VK6A 2KOUA 3C4TA 4X66E 2F8BA 2LO3A 1P47A 4NXME 2ENCA 4KWYA 4ZYDA 2LUPB 4KZSA 4B3SE 4P7DA 1EH8A 4O4KA 1T38A 2LRSA 2B7VA 4L8NA 4F9CB 2BBGA 5AASA 2JR1A 4JI3E 3MHSC 2LE2A 2EPRA 2YU5A 4LFAE 3P1XA 3HPZA 4JYAE 4LF6E 5AC4A 4B3TE 5TSEA 1SFEA 2ENHA 1O0WA 2DMIA 2NUFA 4DV3E 2N8XA 3JU0A 2EM3A 2V88A 3JAMC 2WBUA 1FJGE 2EM9A 1TN9A 4B3RE 1KJKA 5A2QC 2LTSA 5IT9C 2EPPA 3KZZA 2K7IA 2UXCE 1PDAA 3F6GA 1MGTA 3L00A 2EZ6A 2NA2A 1YYKA 1UN6B 1ZR9A 3J7AG 2EMFA 1A1IA 2EM2A 1T39A 1LLMC 4F54A 1SR9A 5T6JA 3KWRA 3H09A 4R2EA 4DV4E 4X65E 3T1YE 4R2QA 2A25A 2GHFA 4J8ZA 1N34E 4F9BB 3F6HA 4F6MA 4BBYA 4M30A 5F3WA 3RMPA 2F4VE 2EOJA 4Q28A 3DJWA 4BHCA 4DR6E 2EQ3A 5CFFE 2MDGA 4N4RB 2JWOA 1PJQA 1GZ6A 2M1SA 2EL4A 4JI6E 2YSOA 1G2DC 4DR2E 2NUGA 4R2CA 1GTKA 1J5EE 2EOQA 2LJUA 2L2KB 1J26A 4TUGA 2H36X 2LMZA 2EL5A 4OOGC 4BCAA 5KL4A 2CPNA 2EOFA 1PKPA 1IQOA 2D9HA 4R03A 4WXDA 2RS7A 1TF6A 5KL5A 2ADRA 2N3HA 1JK1A 2V86A 1QU6A 4JI4E 5ADZA 5BR8E 2JYAA 1AAYA 2HHHE 2UXDE 2EPZA 1EH6A 2YZTA 5A6AA 2LCEA 3FIGA 4M2ZA 2JOBA 2ZM6E 1F2IG 2UUAE 1YYWA 3QG5C 2ODRC 2EPCA 1X47A 4AQYE 4GKKE 2YTGA 4BS9A 2EN2A 4DV1E 2YTOA 2EJ4A 2EOHA 4DV0E 1B69A 4BC9A 2MDRA 1A1FA 1X6FA 2DIXA 2VF1A 4R2RA 1HNZE 1XNRE 4MLQA 4WPYA 2DRPA 3IWDA 3VHTB 2EOOA 2ELYA 2EP3A 1X3CA 1UHZA 5IWAE 2FV4B 1YYOA 2I13A 2R1FA 2EMCA 1WJPA 1T4NA 4LF4E 3EPKA 2PRTA 2EMZA 2EOXA 2EQ1A 4DKKA 3IWCA 1A1KA 2V87A 2L6MA 1YFHA 3HTXA 3BF2A 1X49A 1YZ9A 1STUA 2EPLX 1X6EA 3ADLA 2VE7C
chains in the Genus database with same CATH topology
4R2EA 4R2AA 2EORA 2EM7A 2EOZA 5KL3A 2EMXA 4R2QA 2EMKA 1A1JA 2A25A 2DLKA 4R2PA 2EMWA 4F2JC 2WCC3 2GHFA 2LV2A 2EL6A 1Z1BA 4F6MA 2ELZA 4R2DA 2EOJA 2EQ3A 2YSPA 2WBTA 1ZU1A 2YRHA 4IS1C 2MDGA 4F6NA 2CTDA 2EM5A 2EL4A 2EOMA 3M99B 5KL7A 2EPAA 2MKNA 2EN6A 2YSOA 2CT1A 1G2DC 2EOEA 2YRMA 2EMYA 4R2CA 2YRKA 4FK5C 2JPAA 4X9JA 2EN1A 2EOQA 2EOIA 2YTPA 4WSGA 2EOSA 2EOYA 2EMLA 2EMAA 3EPLA 2EMGA 2EN3A 2EL5A 1BBOA 2LO3A 1P47A 1A1HA 5KL4A 2VRDA 5KL6A 2EOFA 1YUIA 2ENCA 2D9HA 1TF6A 2HGHA 5KL5A 2EQ0A 2ADRA 2EPUA 1JK1A 1X6HA 1AAYA 1A1LA 2EPZA 2YTFA 2DGCA 2LCEA 2EM4A 4R2SA 2WBSA 1YUJA 3EPHA 1ZAAC 2LT7A 4M9VC 1F2IG 2M9AA 2ENAA 1A1GA 2MKDA 1MEYC 2EPCA 2J7JA 3MHSC 2EPRA 2LVHA 2YU5A 2YTGA 2EN2A 2E72A 2GLIA 2YTOA 2EJ4A 2EOHA 3MHHC 1X5WA 1B69A 2YTIA 2ENHA 2YTJA 1A1FA 1X6FA 2DMIA 4R2RA 4IJDA 1G2FC 1YSAC 2EM3A 1JK2A 2WBUA 2EN4A 2EM9A 1TN9A 2DRPA 2YU8A 3VHTB 1NCSA 1KJKA 2RPCA 2EPPA 2EOOA 2YTEA 5KL2A 2BB8A 2ELYA 2RSIA 2EP3A 1X3CA 2CSHA 1DGCA 3EPJA 2I13A 2R1FA 2EMCA 1WJPA 4GZNC 2YTDA 2YTNA 3EPKA 2EM6A 1UN6B 1BB8A 2PRTA 2EMZA 2EOXA 1ZR9A 2EQ1A 2NABA 1A1KA 3UK3C 1RMDA 2EMIA 1UBDC 2EMBA 2EMFA 1A1IA 2EN7A 2EM8A 2EM2A 2YTQA 1LLMC 1TF3A 2EPXA 2EE8A 2EN8A 2EM0A 1X6EA 2DLQA 2JP9A 2EMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2E A;  4R2A A;  2EOR A;  2EM7 A;  2EOZ A;  5KL3 A;  2EMX A;  4R2Q A;  2EMK A;  1A1J A;  2A25 A;  2DLK A;  4R2P A;  2EMW A;  4F2J C;  2WCC 3;  2GHF A;  2LV2 A;  2EL6 A;  1Z1B A;  4F6M A;  2ELZ A;  4R2D A;  2EOJ A;  2EQ3 A;  2YSP A;  2WBT A;  1ZU1 A;  2YRH A;  4IS1 C;  2MDG A;  4F6N A;  2CTD A;  2EM5 A;  2EL4 A;  2EOM A;  3M99 B;  5KL7 A;  2EPA A;  2MKN A;  2EN6 A;  2YSO A;  2CT1 A;  1G2D C;  2EOE A;  2YRM A;  2EMY A;  4R2C A;  2YRK A;  4FK5 C;  2JPA A;  4X9J A;  2EN1 A;  2EOQ A;  2EOI A;  2YTP A;  4WSG A;  2EOS A;  2EOY A;  2EML A;  2EMA A;  3EPL A;  2EMG A;  2EN3 A;  2EL5 A;  1BBO A;  2LO3 A;  1P47 A;  1A1H A;  5KL4 A;  2VRD A;  5KL6 A;  2EOF A;  1YUI A;  2ENC A;  2D9H A;  1TF6 A;  2HGH A;  5KL5 A;  2EQ0 A;  2ADR A;  2EPU A;  1JK1 A;  1X6H A;  1AAY A;  1A1L A;  2EPZ A;  2YTF A;  2DGC A;  2LCE A;  2EM4 A;  4R2S A;  2WBS A;  1YUJ A;  3EPH A;  1ZAA C;  2LT7 A;  4M9V C;  1F2I G;  2M9A A;  2ENA A;  1A1G A;  2MKD A;  1MEY C;  2EPC A;  2J7J A;  3MHS C;  2EPR A;  2LVH A;  2YU5 A;  2YTG A;  2EN2 A;  2E72 A;  2GLI A;  2YTO A;  2EJ4 A;  2EOH A;  3MHH C;  1X5W A;  1B69 A;  2YTI A;  2ENH A;  2YTJ A;  1A1F A;  1X6F A;  2DMI A;  4R2R A;  4IJD A;  1G2F C;  1YSA C;  2EM3 A;  1JK2 A;  2WBU A;  2EN4 A;  2EM9 A;  1TN9 A;  2DRP A;  2YU8 A;  3VHT B;  1NCS A;  1KJK A;  2RPC A;  2EPP A;  2EOO A;  2YTE A;  5KL2 A;  2BB8 A;  2ELY A;  2RSI A;  2EP3 A;  1X3C A;  2CSH A;  1DGC A;  3EPJ A;  2I13 A;  2R1F A;  2EMC A;  1WJP A;  4GZN C;  2YTD A;  2YTN A;  3EPK A;  2EM6 A;  1UN6 B;  1BB8 A;  2PRT A;  2EMZ A;  2EOX A;  1ZR9 A;  2EQ1 A;  2NAB A;  1A1K A;  3UK3 C;  1RMD A;  2EMI A;  1UBD C;  2EMB A;  2EMF A;  1A1I A;  2EN7 A;  2EM8 A;  2EM2 A;  2YTQ A;  1LLM C;  1TF3 A;  2EPX A;  2EE8 A;  2EN8 A;  2EM0 A;  1X6E A;  2DLQ A;  2JP9 A;  2EMH A; 
#chains in the Genus database with same CATH topology
 2EOZ A;  2NUE A;  2R76 A;  2EMK A;  5DNY A;  2DLK A;  3J80 C;  2E5L E;  2B7T A;  5IXM B;  4Q35 B;  2ELZ A;  2UXB E;  3KZY A;  1RC7 A;  5A6K A;  3LML A;  1NEI A;  4BMJ A;  1L4S A;  2YSP A;  4OX9 E;  1ZU1 A;  2YRH A;  2L2N A;  2K4V A;  2M4I A;  4F6N A;  4GKJ E;  2UUB E;  1N32 E;  2CT1 A;  4ZYE A;  4LF8 E;  3J7Y p;  4NXN E;  2YRM A;  2EMY A;  5FLX C;  4X64 E;  1WHQ A;  4FK5 C;  4O24 A;  3T1H E;  2YTP A;  2EWL A;  4WSG A;  1N36 E;  2L92 A;  2Q8U A;  2EMG A;  3OML A;  5LL6 R;  5LMN E;  4YY3 E;  4JI5 E;  1A1H A;  4O43 A;  2VRD A;  2MC5 A;  2HGH A;  4WXC A;  2E1M A;  4RH8 A;  2LTR A;  4O5G A;  5A6B A;  3AUZ A;  4DR3 E;  4LF9 E;  1X6H A;  1HNW E;  4DMI A;  3EQ1 A;  2YTF A;  1AH5 A;  2DGC A;  2EM4 A;  2UU9 E;  2V83 A;  4R2S A;  1YUJ A;  4JV5 E;  1ZAA C;  2LUQ A;  4HTG A;  3BBG A;  4F9A B;  2M9A A;  2ENA A;  1A1G A;  2L8T A;  1UIL A;  2J7J A;  5LLQ A;  1T4L B;  4JI0 E;  3BID A;  2DSY A;  4R8O A;  1PJT A;  1X5W A;  2YTI A;  4JI1 E;  2HC5 A;  4MLV A;  2YT4 A;  1ZBT A;  2YWQ A;  3C4B A;  4IJD A;  1G2F C;  4HEI A;  2RQL A;  1YPN A;  1FKA E;  2V85 A;  5KL2 A;  3K6Q A;  2RSI A;  4DR7 E;  2CSH A;  2EPN A;  2JVA A;  4B3M E;  2I9I A;  1DGC A;  4NZV A;  2YTD A;  2YTN A;  4WYQ B;  2V89 A;  4JI7 E;  4LF7 E;  2NAB A;  2EMI A;  2G7H A;  2RSM A;  2EN7 A;  5AC5 A;  2YTQ A;  2JOX A;  3C6K A;  1TF3 A;  5AE1 A;  2EE8 A;  2EN8 A;  4DV2 E;  2DLQ A;  2JP9 A;  3BGH A;  4R2A A;  3THN A;  3ADI A;  2EM7 A;  5A69 A;  4I8O A;  1IBL E;  1A1J A;  4WSP A;  2B9D A;  2FTX B;  2WCC 3;  3ADJ A;  3HXL A;  2EL6 A;  1Z1B A;  5A6J A;  1DQ3 A;  4R2D A;  4LF5 E;  3ECR A;  4DV6 E;  2IHR 1;  1XMO E;  2EPK X;  3VYX A;  2WBT A;  1QNT A;  1I94 E;  2CTD A;  3M99 B;  2EPA A;  5LMU E;  2EN6 A;  4JI2 E;  3AV0 A;  4WX9 A;  3HQ1 A;  4TUI A;  2YPN A;  4DV7 E;  2EN1 A;  4YHH E;  3OTO E;  2UUC E;  2KON A;  5AE3 A;  2EOY A;  2EML A;  2EMA A;  3EPL A;  3TQM A;  1WRJ A;  2EN3 A;  1ZBQ A;  2WZO A;  1BBO A;  2N3G A;  4DR4 E;  1YUI A;  3ZOQ B;  5KL6 A;  4M0V A;  2VQE E;  1HNX E;  3LLH A;  1DI2 A;  2EQ0 A;  2EPU A;  2EPM X;  2V8Q B;  4K0K E;  1A1L A;  4DR5 E;  2HJJ A;  1X48 A;  5IV8 B;  2WBS A;  3EPH A;  2GPI A;  2LT7 A;  4M9V C;  1T4O A;  3J81 C;  2MKD A;  1MEY C;  2DB2 A;  3HPS A;  2LVH A;  2L3C A;  2E72 A;  2GLI A;  3MHH C;  2YTJ A;  2M7Q A;  3ADG A;  1KYQ A;  1YSA C;  1JK2 A;  2EN4 A;  2YU8 A;  1NCS A;  4WFT A;  2RPC A;  2YTE A;  4GEQ B;  2BB8 A;  3C6M A;  4LFC E;  4RHB B;  2L2M A;  2L33 A;  3IWB A;  1BBG A;  1IBM E;  3EPJ A;  1XMQ E;  2B3T B;  4GZN C;  3VYY A;  1IMU A;  2DMY A;  3DF6 A;  2EM6 A;  1BB8 A;  4DV5 E;  1XNQ E;  3UK3 C;  1RMD A;  1UBD C;  2EMB A;  2EM8 A;  4JI8 E;  3JTZ A;  2EPX A;  1EKZ A;  2EM0 A;  2VQF E;  4KHP E;  1IBK E;  3THO B;  2EMH A;  1GQE A;  1N3G A;  4ZYH A;  1N33 E;  2EOR A;  4LFB E;  5KL3 A;  2EMX A;  4P78 A;  1RQ0 A;  4R2P A;  4F2J C;  2EMW A;  4X62 E;  1PJS A;  2LV2 A;  2LJH A;  2EPO A;  4BHB A;  4L5N C;  3MSW A;  5A6B D;  1WHN A;  2RS6 A;  4X8W A;  2LBS B;  4DR1 E;  2JXP A;  4BC7 A;  2MC6 A;  4IS1 C;  4LU9 A;  1EH7 A;  2EM5 A;  2EOM A;  5KL7 A;  2MKN A;  4LTY A;  2KHX A;  2JY9 A;  2EOE A;  2RTX A;  4DUY E;  5AE2 A;  4ZYG A;  2YRK A;  2L3J A;  2ODR D;  2JPA A;  4X9J A;  2FGG A;  1WXR A;  4DUZ E;  1IQS A;  2EOI A;  1HR0 E;  2EOS A;  4NHR A;  3VK6 A;  2KOU A;  3C4T A;  4X66 E;  2F8B A;  2LO3 A;  1P47 A;  4NXM E;  2ENC A;  4KWY A;  4ZYD A;  2LUP B;  4KZS A;  4B3S E;  4P7D A;  1EH8 A;  4O4K A;  1T38 A;  2LRS A;  2B7V A;  4L8N A;  4F9C B;  2BBG A;  5AAS A;  2JR1 A;  4JI3 E;  3MHS C;  2LE2 A;  2EPR A;  2YU5 A;  4LFA E;  3P1X A;  3HPZ A;  4JYA E;  4LF6 E;  5AC4 A;  4B3T E;  5TSE A;  1SFE A;  2ENH A;  1O0W A;  2DMI A;  2NUF A;  4DV3 E;  2N8X A;  3JU0 A;  2EM3 A;  2V88 A;  3JAM C;  2WBU A;  1FJG E;  2EM9 A;  1TN9 A;  4B3R E;  1KJK A;  5A2Q C;  2LTS A;  5IT9 C;  2EPP A;  3KZZ A;  2K7I A;  2UXC E;  1PDA A;  3F6G A;  1MGT A;  3L00 A;  2EZ6 A;  2NA2 A;  1YYK A;  1UN6 B;  1ZR9 A;  3J7A G;  2EMF A;  1A1I A;  2EM2 A;  1T39 A;  1LLM C;  4F54 A;  1SR9 A;  5T6J A;  3KWR A;  3H09 A;  4R2E A;  4DV4 E;  4X65 E;  3T1Y E;  4R2Q A;  2A25 A;  2GHF A;  4J8Z A;  1N34 E;  4F9B B;  3F6H A;  4F6M A;  4BBY A;  4M30 A;  5F3W A;  3RMP A;  2F4V E;  2EOJ A;  4Q28 A;  3DJW A;  4BHC A;  4DR6 E;  2EQ3 A;  5CFF E;  2MDG A;  4N4R B;  2JWO A;  1PJQ A;  1GZ6 A;  2M1S A;  2EL4 A;  4JI6 E;  2YSO A;  1G2D C;  4DR2 E;  2NUG A;  4R2C A;  1GTK A;  1J5E E;  2EOQ A;  2LJU A;  2L2K B;  1J26 A;  4TUG A;  2H36 X;  2LMZ A;  2EL5 A;  4OOG C;  4BCA A;  5KL4 A;  2CPN A;  2EOF A;  1PKP A;  1IQO A;  2D9H A;  4R03 A;  4WXD A;  2RS7 A;  1TF6 A;  5KL5 A;  2ADR A;  2N3H A;  1JK1 A;  2V86 A;  1QU6 A;  4JI4 E;  5ADZ A;  5BR8 E;  2JYA A;  1AAY A;  2HHH E;  2UXD E;  2EPZ A;  1EH6 A;  2YZT A;  5A6A A;  2LCE A;  3FIG A;  4M2Z A;  2JOB A;  2ZM6 E;  1F2I G;  2UUA E;  1YYW A;  3QG5 C;  2ODR C;  2EPC A;  1X47 A;  4AQY E;  4GKK E;  2YTG A;  4BS9 A;  2EN2 A;  4DV1 E;  2YTO A;  2EJ4 A;  2EOH A;  4DV0 E;  1B69 A;  4BC9 A;  2MDR A;  1A1F A;  1X6F A;  2DIX A;  2VF1 A;  4R2R A;  1HNZ E;  1XNR E;  4MLQ A;  4WPY A;  2DRP A;  3IWD A;  3VHT B;  2EOO A;  2ELY A;  2EP3 A;  1X3C A;  1UHZ A;  5IWA E;  2FV4 B;  1YYO A;  2I13 A;  2R1F A;  2EMC A;  1WJP A;  1T4N A;  4LF4 E;  3EPK A;  2PRT A;  2EMZ A;  2EOX A;  2EQ1 A;  4DKK A;  3IWC A;  1A1K A;  2V87 A;  2L6M A;  1YFH A;  3HTX A;  3BF2 A;  1X49 A;  1YZ9 A;  1STU A;  2EPL X;  1X6E A;  3ADL A;  2VE7 C; 
#chains in the Genus database with same CATH homology
 4R2E A;  4R2A A;  2EOR A;  2EM7 A;  2EOZ A;  5KL3 A;  2EMX A;  4R2Q A;  2EMK A;  1A1J A;  2A25 A;  2DLK A;  4R2P A;  2EMW A;  4F2J C;  2WCC 3;  2GHF A;  2LV2 A;  2EL6 A;  1Z1B A;  4F6M A;  2ELZ A;  4R2D A;  2EOJ A;  2EQ3 A;  2YSP A;  2WBT A;  1ZU1 A;  2YRH A;  4IS1 C;  2MDG A;  4F6N A;  2CTD A;  2EM5 A;  2EL4 A;  2EOM A;  3M99 B;  5KL7 A;  2EPA A;  2MKN A;  2EN6 A;  2YSO A;  2CT1 A;  1G2D C;  2EOE A;  2YRM A;  2EMY A;  4R2C A;  2YRK A;  4FK5 C;  2JPA A;  4X9J A;  2EN1 A;  2EOQ A;  2EOI A;  2YTP A;  4WSG A;  2EOS A;  2EOY A;  2EML A;  2EMA A;  3EPL A;  2EMG A;  2EN3 A;  2EL5 A;  1BBO A;  2LO3 A;  1P47 A;  1A1H A;  5KL4 A;  2VRD A;  5KL6 A;  2EOF A;  1YUI A;  2ENC A;  2D9H A;  1TF6 A;  2HGH A;  5KL5 A;  2EQ0 A;  2ADR A;  2EPU A;  1JK1 A;  1X6H A;  1AAY A;  1A1L A;  2EPZ A;  2YTF A;  2DGC A;  2LCE A;  2EM4 A;  4R2S A;  2WBS A;  1YUJ A;  3EPH A;  1ZAA C;  2LT7 A;  4M9V C;  1F2I G;  2M9A A;  2ENA A;  1A1G A;  2MKD A;  1MEY C;  2EPC A;  2J7J A;  3MHS C;  2EPR A;  2LVH A;  2YU5 A;  2YTG A;  2EN2 A;  2E72 A;  2GLI A;  2YTO A;  2EJ4 A;  2EOH A;  3MHH C;  1X5W A;  1B69 A;  2YTI A;  2ENH A;  2YTJ A;  1A1F A;  1X6F A;  2DMI A;  4R2R A;  4IJD A;  1G2F C;  1YSA C;  2EM3 A;  1JK2 A;  2WBU A;  2EN4 A;  2EM9 A;  1TN9 A;  2DRP A;  2YU8 A;  3VHT B;  1NCS A;  1KJK A;  2RPC A;  2EPP A;  2EOO A;  2YTE A;  5KL2 A;  2BB8 A;  2ELY A;  2RSI A;  2EP3 A;  1X3C A;  2CSH A;  1DGC A;  3EPJ A;  2I13 A;  2R1F A;  2EMC A;  1WJP A;  4GZN C;  2YTD A;  2YTN A;  3EPK A;  2EM6 A;  1UN6 B;  1BB8 A;  2PRT A;  2EMZ A;  2EOX A;  1ZR9 A;  2EQ1 A;  2NAB A;  1A1K A;  3UK3 C;  1RMD A;  2EMI A;  1UBD C;  2EMB A;  2EMF A;  1A1I A;  2EN7 A;  2EM8 A;  2EM2 A;  2YTQ A;  1LLM C;  1TF3 A;  2EPX A;  2EE8 A;  2EN8 A;  2EM0 A;  1X6E A;  2DLQ A;  2JP9 A;  2EMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...