2MKDA

Human jaz zf3 residues 168-227
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
b'STKVEALHQNREMIDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQETKLKLMARYGRLAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Zinc finger protein 346
publication title Structural Characterization of Interactions between the Double-Stranded RNA-Binding Zinc Finger Protein JAZ and Nucleic Acids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 13
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2014-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12874 zf-met Zinc-finger of C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2mkdA00
2D9HA 2CSHA 2EPXA 5KL6A 2LT7A 3EPJA 2EPZA 2EMXA 1A1KA 4R2RA 2YTNA 4FK5C 1ZU1A 1TF3A 1TF6A 2RSIA 2EMIA 1A1JA 1B69A 5KL5A 3EPLA 2WCC3 2EN6A 2EN1A 2EN7A 1DGCA 1MEYC 1JK2A 2RPCA 2EM5A 2EP3A 2MKNA 1F2IG 1UBDC 5KL4A 2A25A 2EOSA 2EOEA 2EQ1A 1BBOA 1TN9A 1X6HA 2EN8A 4IJDA 4IS1C 2ADRA 2PRTA 2EM4A 2EM6A 2EOHA 1A1FA 2EMBA 2EMFA 2LCEA 3EPHA 2EL6A 1X3CA 2ENHA 2J7JA 2EN2A 2EL5A 1A1HA 1UN6B 2WBTA 2EMKA 2EPUA 2EMWA 2M9AA 2EOFA 2LV2A 2EM7A 1YSAC 2ELYA 2EMZA 1RMDA 4F2JC 1NCSA 2EOMA 2EMYA 3M99B 2NABA 2DMIA 2EMGA 1WJPA 1A1LA 2YSOA 1YUJA 2DRPA 2EOIA 3MHSC 2LVHA 1BB8A 1ZAAC 2ELZA 2EQ3A 5KL2A 1YUIA 4R2SA 2EMCA 4R2DA 2EOXA 2WBUA 1JK1A 4R2QA 4M9VC 1AAYA 2EPPA 2YTIA 2CT1A 2YTPA 2YRMA 2LO3A 2MDGA 2GLIA 3EPKA 2YTFA 2EMAA 2EOJA 2EN4A 2EOZA 2EOOA 4WSGA 5KL3A 2JPAA 2EJ4A 4F6NA 2YTEA 2EM9A 2YTQA 4R2EA 1A1GA 1KJKA 2EM2A 4X9JA 1X6EA 2YTDA 1X5WA 1Z1BA 1LLMC 5KL7A 3VHTB 2WBSA 2EPCA 2GHFA 2EOYA 2YRKA 2EQ0A 4R2CA 2HGHA 2YU5A 2MKDA 2R1FA 4GZNC 2YTJA 2ENAA 2YSPA 2EPRA 2EPAA 2VRDA 2DGCA 2EN3A 1ZR9A 2BB8A 2EOQA 1P47A 1A1IA 2I13A 2ENCA 2CTDA 2EM0A 2EORA 2YU8A 2EM8A 4F6MA 1G2FC 2EMLA 3MHHC 2YTGA 1X6FA 2DLKA 2E72A 3UK3C 2EM3A 1G2DC 2YRHA 2DLQA 2EE8A 4R2PA 2YTOA 2JP9A 2EL4A 4R2AA 2EMHA
chains in the Genus database with same CATH superfamily
4LFAE 2E5LE 2JYAA 5FLXC 4MLVA 3EPJA 1PKPA 2EMXA 1NEIA 5DNYA 2EMIA 1A1JA 3EPLA 2FV4B 2EN1A 2EN7A 1JK2A 2RPCA 2EM5A 3T1HE 2MKNA 1F2IG 1RC7A 5KL4A 5TSEA 3DJWA 2A25A 5T6JA 2L2MA 4JI2E 2PRTA 1FKAE 1PJQA 3K6QA 4JI0E 3BIDA 3EPHA 4F54A 1XMOE 2EN2A 2VQEE 1SR9A 1UN6B 2EMKA 1X49A 2LUPB 2JOBA 2EOFA 1YSAC 2ELYA 2JWOA 4B3ME 4GKKE 2EMYA 3MSWA 4OX9E 1L4SA 3M99B 2NABA 5A6BD 3BBGA 2LRSA 1EKZA 2N8XA 1YUIA 5CFFE 4JI1E 2RSMA 4L8NA 1JK1A 2EPPA 2UUBE 4BHCA 2CT1A 2YRMA 3AV0A 2L8TA 4R8OA 4DV0E 3RMPA 3EPKA 2L2NA 3KZZA 1IQOA 1PJTA 2DMYA 4O24A 1HNXE 2JPAA 4LF6E 2FGGA 4WYQB 3FIGA 1KJKA 1GTKA 2YTDA 2CPNA 3VYXA 5KL7A 3ADIA 3VHTB 1EH7A 2EPCA 2GHFA 3THOB 2EQ0A 2HGHA 2R1FA 1RQ0A 4GKJE 4KZSA 1FJGE 2YSPA 2DGCA 2WZOA 2EN3A 2KOUA 1A1IA 4LF7E 2CTDA 2EM0A 2M7QA 4F6MA 3JU0A 1T39A 1SFEA 2L6MA 3MHHC 5A6KA 1T4LB 2EPLX 2KONA 5IV8B 2YRHA 2EE8A 4R2PA 3THNA 4DV3E 2CSHA 2DIXA 4DR7E 2LMZA 3IWDA 2Q8UA 1ZBQA 4NZVA 5LMNE 2NUFA 2VE7C 4R2RA 1GQEA 4FK5C 4N4RB 1TF6A 5IXMB 2BBGA 4M30A 5AASA 1B69A 3DF6A 2R76A 5F3WA 2EN6A 4JI7E 1MEYC 3TQMA 2JY9A 3IWBA 2EP3A 4JI3E 1YYOA 2EOEA 2M1SA 1TN9A 5AE2A 4BC9A 4M0VA 3H09A 2UXDE 2EM6A 1HNWE 2V89A 1PJSA 4ZYHA 4DMIA 4K0KE 2JXPA 2M9AA 3ADGA 2B7VA 4YHHE 2RTXA 2EM7A 2JR1A 1IBLE 1HR0E 4DV6E 2EMZA 2HHHE 1NCSA 2EOMA 3C4BA 2LBSB 2YT4A 4X8WA 1WJPA 5IT9C 2DRPA 4BS9A 3HQ1A 1BB8A 3ECRA 4R2SA 2EMCA 4X64E 3ZOQB 2WBUA 4M9VC 4LU9A 2YTIA 4LFCE 3T1YE 2MDGA 1STUA 4DUYE 4BMJA 2LJUA 2EN4A 2EOZA 4WSGA 1O0WA 1IMUA 4JI6E 2EJ4A 4F6NA 4NXME 2YWQA 4R2EA 2EM2A 1UILA 1WHQA 1HNZE 3C6MA 3J7Yp 4LTYA 5AC5A 2YRKA 4R2CA 4J8ZA 2NUEA 1N34E 2GPIA 1XMQE 4DKKA 2ENAA 1MGTA 4RH8A 4O4KA 4X62E 2L3JA 1PDAA 2UUAE 2YPNA 2EPMX 1X47A 2YU8A 2EMLA 4X66E 2L33A 4B3SE 3IWCA 2DLKA 3UK3C 4HEIA 4DV1E 3KZYA 1G2DC 4I8OA 1X48A 4DV5E 2DLQA 3HXLA 2YTOA 2ZM6E 4R2AA 1T4NA 5KL6A 2LT7A 4DV7E 3F6GA 2EPZA 1J26A 1A1KA 1N3GA 5AE3A 1ZU1A 2V88A 4DV2E 2H36X 1YPNA 3QG5C 1DGCA 5LL6R 2V86A 4HTGA 4Q35B 2LUQA 1QNTA 4OOGC 1DQ3A 2EN8A 4LF4E 2FTXB 4P7DA 1DI2A 4IS1C 2RS7A 2ADRA 4F9CB 4GEQB 2EM4A 2EOHA 4TUGA 1A1FA 2EMBA 3OTOE 2EMFA 2B7TA 2LCEA 2EL6A 1X3CA 2ENHA 2EL5A 1A1HA 2DB2A 1YFHA 2WBTA 2JVAA 2L92A 4LF8E 3F6HA 3VK6A 4R03A 3J7AG 2EPUA 1EH8A 1EH6A 2LV2A 2EZ6A 4B3TE 4F2JC 5AC4A 4DV4E 2RS6A 2V87A 2DMIA 2M4IA 1A1LA 1T38A 2VF1A 2YSOA 2EOIA 3MHSC 4LF9E 2EQ3A 4WPYA 3J80C 4LFBE 4R2QA 5LLQA 2YTPA 2GLIA 2ODRC 5A6JA 2F4VE 3C4TA 2EOOA 5KL3A 2LTRA 2V8QB 4O5GA 1N33E 1XNRE 4WXDA 4BC7A 4X9JA 2YZTA 4KWYA 4O43A 4DR4E 2IHR1 1X6EA 1X5WA 2RQLA 1LLMC 4DR3E 2EOYA 4AQYE 2MDRA 2YU5A 4BCAA 2HC5A 5A6AA 3J81C 2L2KB 3LLHA 4WXCA 2EPAA 2VRDA 1ZR9A 1AH5A 2BB8A 2EOQA 4DUZE 1P47A 1N36E 1IBME 2EORA 3C6KA 2LE2A 2UXCE 2V83A 4YY3E 2YTGA 1WRJA 2HJJA 2MC5A 4JI8E 2EM3A 4WFTA 5ADZA 2UUCE 1YYKA 2JP9A 1WHNA 2EL4A 2EMHA 1IBKE 2D9HA 1WXRA 2EPXA 4ZYEA 4WX9A 4MLQA 2EPNA 2YTNA 1TF3A 1KYQA 4DR6E 3HPSA 2UXBE 2RSIA 3ADJA 2E1MA 5KL5A 1GZ6A 2WCC3 1J5EE 4JI5E 2I9IA 4WSPA 2NA2A 2K4VA 4B3RE 3EQ1A 1UBDC 4M2ZA 4F9BB 2EOSA 1ZBTA 2EQ1A 1BBOA 4F9AB 1X6HA 4IJDA 3KWRA 2V85A 1N32E 3OMLA 4P78A 1YYWA 2J7JA 1UHZA 2F8BA 2N3GA 5BR8E 4DR5E 4DR2E 3JTZA 3L00A 2EMWA 4KHPE 5IWAE 5A2QC 2ODRD 2K7IA 2KHXA 1I94E 5A69A 1RMDA 3AUZA 4NXNE 2B9DA 1QU6A 4RHBB 2EPKX 2DSYA 2EMGA 2N3HA 4ZYDA 1YUJA 2LVHA 3ADLA 1ZAAC 2ELZA 3LMLA 5KL2A 2G7HA 4X65E 4R2DA 2EOXA 3BF2A 2B3TB 2MC6A 1IQSA 1AAYA 4TUIA 3JAMC 4JV5E 1T4OA 2LO3A 2UU9E 4L5NC 5AE1A 1BBGA 3HPZA 4BHBA 2YTFA 2EMAA 2EOJA 2NUGA 2LTSA 2YTEA 2EM9A 4NHRA 1YZ9A 2VQFE 2YTQA 4JYAE 1A1GA 3P1XA 4ZYGA 1Z1BA 2WBSA 2EWLA 2L3CA 4BBYA 2MKDA 4GZNC 2YTJA 2JOXA 2EPRA 3HTXA 2I13A 2ENCA 2EPOA 2EM8A 1G2FC 3VYYA 5LMUE 1X6FA 2E72A 1XNQE 4LF5E 4JI4E 4DR1E 2LJHA 3BGHA 5A6BA 4Q28A
chains in the Genus database with same CATH topology
2D9HA 2CSHA 2EPXA 5KL6A 2LT7A 3EPJA 2EPZA 2EMXA 1A1KA 4R2RA 2YTNA 4FK5C 1ZU1A 1TF3A 1TF6A 2RSIA 2EMIA 1A1JA 1B69A 5KL5A 3EPLA 2WCC3 2EN6A 2EN1A 2EN7A 1DGCA 1MEYC 1JK2A 2RPCA 2EM5A 2EP3A 2MKNA 1F2IG 1UBDC 5KL4A 2A25A 2EOSA 2EOEA 2EQ1A 1BBOA 1TN9A 1X6HA 2EN8A 4IJDA 4IS1C 2ADRA 2PRTA 2EM4A 2EM6A 2EOHA 1A1FA 2EMBA 2EMFA 2LCEA 3EPHA 2EL6A 1X3CA 2ENHA 2J7JA 2EN2A 2EL5A 1A1HA 1UN6B 2WBTA 2EMKA 2EPUA 2EMWA 2M9AA 2EOFA 2LV2A 2EM7A 1YSAC 2ELYA 2EMZA 1RMDA 4F2JC 1NCSA 2EOMA 2EMYA 3M99B 2NABA 2DMIA 2EMGA 1WJPA 1A1LA 2YSOA 1YUJA 2DRPA 2EOIA 3MHSC 2LVHA 1BB8A 1ZAAC 2ELZA 2EQ3A 5KL2A 1YUIA 4R2SA 2EMCA 4R2DA 2EOXA 2WBUA 1JK1A 4R2QA 4M9VC 1AAYA 2EPPA 2YTIA 2CT1A 2YTPA 2YRMA 2LO3A 2MDGA 2GLIA 3EPKA 2YTFA 2EMAA 2EOJA 2EN4A 2EOZA 2EOOA 4WSGA 5KL3A 2JPAA 2EJ4A 4F6NA 2YTEA 2EM9A 2YTQA 4R2EA 1A1GA 1KJKA 2EM2A 4X9JA 1X6EA 2YTDA 1X5WA 1Z1BA 1LLMC 5KL7A 3VHTB 2WBSA 2EPCA 2GHFA 2EOYA 2YRKA 2EQ0A 4R2CA 2HGHA 2YU5A 2MKDA 2R1FA 4GZNC 2YTJA 2ENAA 2YSPA 2EPRA 2EPAA 2VRDA 2DGCA 2EN3A 1ZR9A 2BB8A 2EOQA 1P47A 1A1IA 2I13A 2ENCA 2CTDA 2EM0A 2EORA 2YU8A 2EM8A 4F6MA 1G2FC 2EMLA 3MHHC 2YTGA 1X6FA 2DLKA 2E72A 3UK3C 2EM3A 1G2DC 2YRHA 2DLQA 2EE8A 4R2PA 2YTOA 2JP9A 2EL4A 4R2AA 2EMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9H A;  2CSH A;  2EPX A;  5KL6 A;  2LT7 A;  3EPJ A;  2EPZ A;  2EMX A;  1A1K A;  4R2R A;  2YTN A;  4FK5 C;  1ZU1 A;  1TF3 A;  1TF6 A;  2RSI A;  2EMI A;  1A1J A;  1B69 A;  5KL5 A;  3EPL A;  2WCC 3;  2EN6 A;  2EN1 A;  2EN7 A;  1DGC A;  1MEY C;  1JK2 A;  2RPC A;  2EM5 A;  2EP3 A;  2MKN A;  1F2I G;  1UBD C;  5KL4 A;  2A25 A;  2EOS A;  2EOE A;  2EQ1 A;  1BBO A;  1TN9 A;  1X6H A;  2EN8 A;  4IJD A;  4IS1 C;  2ADR A;  2PRT A;  2EM4 A;  2EM6 A;  2EOH A;  1A1F A;  2EMB A;  2EMF A;  2LCE A;  3EPH A;  2EL6 A;  1X3C A;  2ENH A;  2J7J A;  2EN2 A;  2EL5 A;  1A1H A;  1UN6 B;  2WBT A;  2EMK A;  2EPU A;  2EMW A;  2M9A A;  2EOF A;  2LV2 A;  2EM7 A;  1YSA C;  2ELY A;  2EMZ A;  1RMD A;  4F2J C;  1NCS A;  2EOM A;  2EMY A;  3M99 B;  2NAB A;  2DMI A;  2EMG A;  1WJP A;  1A1L A;  2YSO A;  1YUJ A;  2DRP A;  2EOI A;  3MHS C;  2LVH A;  1BB8 A;  1ZAA C;  2ELZ A;  2EQ3 A;  5KL2 A;  1YUI A;  4R2S A;  2EMC A;  4R2D A;  2EOX A;  2WBU A;  1JK1 A;  4R2Q A;  4M9V C;  1AAY A;  2EPP A;  2YTI A;  2CT1 A;  2YTP A;  2YRM A;  2LO3 A;  2MDG A;  2GLI A;  3EPK A;  2YTF A;  2EMA A;  2EOJ A;  2EN4 A;  2EOZ A;  2EOO A;  4WSG A;  5KL3 A;  2JPA A;  2EJ4 A;  4F6N A;  2YTE A;  2EM9 A;  2YTQ A;  4R2E A;  1A1G A;  1KJK A;  2EM2 A;  4X9J A;  1X6E A;  2YTD A;  1X5W A;  1Z1B A;  1LLM C;  5KL7 A;  3VHT B;  2WBS A;  2EPC A;  2GHF A;  2EOY A;  2YRK A;  2EQ0 A;  4R2C A;  2HGH A;  2YU5 A;  2MKD A;  2R1F A;  4GZN C;  2YTJ A;  2ENA A;  2YSP A;  2EPR A;  2EPA A;  2VRD A;  2DGC A;  2EN3 A;  1ZR9 A;  2BB8 A;  2EOQ A;  1P47 A;  1A1I A;  2I13 A;  2ENC A;  2CTD A;  2EM0 A;  2EOR A;  2YU8 A;  2EM8 A;  4F6M A;  1G2F C;  2EML A;  3MHH C;  2YTG A;  1X6F A;  2DLK A;  2E72 A;  3UK3 C;  2EM3 A;  1G2D C;  2YRH A;  2DLQ A;  2EE8 A;  4R2P A;  2YTO A;  2JP9 A;  2EL4 A;  4R2A A;  2EMH A; 
#chains in the Genus database with same CATH topology
 4LFA E;  2E5L E;  2JYA A;  5FLX C;  4MLV A;  3EPJ A;  1PKP A;  2EMX A;  1NEI A;  5DNY A;  2EMI A;  1A1J A;  3EPL A;  2FV4 B;  2EN1 A;  2EN7 A;  1JK2 A;  2RPC A;  2EM5 A;  3T1H E;  2MKN A;  1F2I G;  1RC7 A;  5KL4 A;  5TSE A;  3DJW A;  2A25 A;  5T6J A;  2L2M A;  4JI2 E;  2PRT A;  1FKA E;  1PJQ A;  3K6Q A;  4JI0 E;  3BID A;  3EPH A;  4F54 A;  1XMO E;  2EN2 A;  2VQE E;  1SR9 A;  1UN6 B;  2EMK A;  1X49 A;  2LUP B;  2JOB A;  2EOF A;  1YSA C;  2ELY A;  2JWO A;  4B3M E;  4GKK E;  2EMY A;  3MSW A;  4OX9 E;  1L4S A;  3M99 B;  2NAB A;  5A6B D;  3BBG A;  2LRS A;  1EKZ A;  2N8X A;  1YUI A;  5CFF E;  4JI1 E;  2RSM A;  4L8N A;  1JK1 A;  2EPP A;  2UUB E;  4BHC A;  2CT1 A;  2YRM A;  3AV0 A;  2L8T A;  4R8O A;  4DV0 E;  3RMP A;  3EPK A;  2L2N A;  3KZZ A;  1IQO A;  1PJT A;  2DMY A;  4O24 A;  1HNX E;  2JPA A;  4LF6 E;  2FGG A;  4WYQ B;  3FIG A;  1KJK A;  1GTK A;  2YTD A;  2CPN A;  3VYX A;  5KL7 A;  3ADI A;  3VHT B;  1EH7 A;  2EPC A;  2GHF A;  3THO B;  2EQ0 A;  2HGH A;  2R1F A;  1RQ0 A;  4GKJ E;  4KZS A;  1FJG E;  2YSP A;  2DGC A;  2WZO A;  2EN3 A;  2KOU A;  1A1I A;  4LF7 E;  2CTD A;  2EM0 A;  2M7Q A;  4F6M A;  3JU0 A;  1T39 A;  1SFE A;  2L6M A;  3MHH C;  5A6K A;  1T4L B;  2EPL X;  2KON A;  5IV8 B;  2YRH A;  2EE8 A;  4R2P A;  3THN A;  4DV3 E;  2CSH A;  2DIX A;  4DR7 E;  2LMZ A;  3IWD A;  2Q8U A;  1ZBQ A;  4NZV A;  5LMN E;  2NUF A;  2VE7 C;  4R2R A;  1GQE A;  4FK5 C;  4N4R B;  1TF6 A;  5IXM B;  2BBG A;  4M30 A;  5AAS A;  1B69 A;  3DF6 A;  2R76 A;  5F3W A;  2EN6 A;  4JI7 E;  1MEY C;  3TQM A;  2JY9 A;  3IWB A;  2EP3 A;  4JI3 E;  1YYO A;  2EOE A;  2M1S A;  1TN9 A;  5AE2 A;  4BC9 A;  4M0V A;  3H09 A;  2UXD E;  2EM6 A;  1HNW E;  2V89 A;  1PJS A;  4ZYH A;  4DMI A;  4K0K E;  2JXP A;  2M9A A;  3ADG A;  2B7V A;  4YHH E;  2RTX A;  2EM7 A;  2JR1 A;  1IBL E;  1HR0 E;  4DV6 E;  2EMZ A;  2HHH E;  1NCS A;  2EOM A;  3C4B A;  2LBS B;  2YT4 A;  4X8W A;  1WJP A;  5IT9 C;  2DRP A;  4BS9 A;  3HQ1 A;  1BB8 A;  3ECR A;  4R2S A;  2EMC A;  4X64 E;  3ZOQ B;  2WBU A;  4M9V C;  4LU9 A;  2YTI A;  4LFC E;  3T1Y E;  2MDG A;  1STU A;  4DUY E;  4BMJ A;  2LJU A;  2EN4 A;  2EOZ A;  4WSG A;  1O0W A;  1IMU A;  4JI6 E;  2EJ4 A;  4F6N A;  4NXM E;  2YWQ A;  4R2E A;  2EM2 A;  1UIL A;  1WHQ A;  1HNZ E;  3C6M A;  3J7Y p;  4LTY A;  5AC5 A;  2YRK A;  4R2C A;  4J8Z A;  2NUE A;  1N34 E;  2GPI A;  1XMQ E;  4DKK A;  2ENA A;  1MGT A;  4RH8 A;  4O4K A;  4X62 E;  2L3J A;  1PDA A;  2UUA E;  2YPN A;  2EPM X;  1X47 A;  2YU8 A;  2EML A;  4X66 E;  2L33 A;  4B3S E;  3IWC A;  2DLK A;  3UK3 C;  4HEI A;  4DV1 E;  3KZY A;  1G2D C;  4I8O A;  1X48 A;  4DV5 E;  2DLQ A;  3HXL A;  2YTO A;  2ZM6 E;  4R2A A;  1T4N A;  5KL6 A;  2LT7 A;  4DV7 E;  3F6G A;  2EPZ A;  1J26 A;  1A1K A;  1N3G A;  5AE3 A;  1ZU1 A;  2V88 A;  4DV2 E;  2H36 X;  1YPN A;  3QG5 C;  1DGC A;  5LL6 R;  2V86 A;  4HTG A;  4Q35 B;  2LUQ A;  1QNT A;  4OOG C;  1DQ3 A;  2EN8 A;  4LF4 E;  2FTX B;  4P7D A;  1DI2 A;  4IS1 C;  2RS7 A;  2ADR A;  4F9C B;  4GEQ B;  2EM4 A;  2EOH A;  4TUG A;  1A1F A;  2EMB A;  3OTO E;  2EMF A;  2B7T A;  2LCE A;  2EL6 A;  1X3C A;  2ENH A;  2EL5 A;  1A1H A;  2DB2 A;  1YFH A;  2WBT A;  2JVA A;  2L92 A;  4LF8 E;  3F6H A;  3VK6 A;  4R03 A;  3J7A G;  2EPU A;  1EH8 A;  1EH6 A;  2LV2 A;  2EZ6 A;  4B3T E;  4F2J C;  5AC4 A;  4DV4 E;  2RS6 A;  2V87 A;  2DMI A;  2M4I A;  1A1L A;  1T38 A;  2VF1 A;  2YSO A;  2EOI A;  3MHS C;  4LF9 E;  2EQ3 A;  4WPY A;  3J80 C;  4LFB E;  4R2Q A;  5LLQ A;  2YTP A;  2GLI A;  2ODR C;  5A6J A;  2F4V E;  3C4T A;  2EOO A;  5KL3 A;  2LTR A;  2V8Q B;  4O5G A;  1N33 E;  1XNR E;  4WXD A;  4BC7 A;  4X9J A;  2YZT A;  4KWY A;  4O43 A;  4DR4 E;  2IHR 1;  1X6E A;  1X5W A;  2RQL A;  1LLM C;  4DR3 E;  2EOY A;  4AQY E;  2MDR A;  2YU5 A;  4BCA A;  2HC5 A;  5A6A A;  3J81 C;  2L2K B;  3LLH A;  4WXC A;  2EPA A;  2VRD A;  1ZR9 A;  1AH5 A;  2BB8 A;  2EOQ A;  4DUZ E;  1P47 A;  1N36 E;  1IBM E;  2EOR A;  3C6K A;  2LE2 A;  2UXC E;  2V83 A;  4YY3 E;  2YTG A;  1WRJ A;  2HJJ A;  2MC5 A;  4JI8 E;  2EM3 A;  4WFT A;  5ADZ A;  2UUC E;  1YYK A;  2JP9 A;  1WHN A;  2EL4 A;  2EMH A;  1IBK E;  2D9H A;  1WXR A;  2EPX A;  4ZYE A;  4WX9 A;  4MLQ A;  2EPN A;  2YTN A;  1TF3 A;  1KYQ A;  4DR6 E;  3HPS A;  2UXB E;  2RSI A;  3ADJ A;  2E1M A;  5KL5 A;  1GZ6 A;  2WCC 3;  1J5E E;  4JI5 E;  2I9I A;  4WSP A;  2NA2 A;  2K4V A;  4B3R E;  3EQ1 A;  1UBD C;  4M2Z A;  4F9B B;  2EOS A;  1ZBT A;  2EQ1 A;  1BBO A;  4F9A B;  1X6H A;  4IJD A;  3KWR A;  2V85 A;  1N32 E;  3OML A;  4P78 A;  1YYW A;  2J7J A;  1UHZ A;  2F8B A;  2N3G A;  5BR8 E;  4DR5 E;  4DR2 E;  3JTZ A;  3L00 A;  2EMW A;  4KHP E;  5IWA E;  5A2Q C;  2ODR D;  2K7I A;  2KHX A;  1I94 E;  5A69 A;  1RMD A;  3AUZ A;  4NXN E;  2B9D A;  1QU6 A;  4RHB B;  2EPK X;  2DSY A;  2EMG A;  2N3H A;  4ZYD A;  1YUJ A;  2LVH A;  3ADL A;  1ZAA C;  2ELZ A;  3LML A;  5KL2 A;  2G7H A;  4X65 E;  4R2D A;  2EOX A;  3BF2 A;  2B3T B;  2MC6 A;  1IQS A;  1AAY A;  4TUI A;  3JAM C;  4JV5 E;  1T4O A;  2LO3 A;  2UU9 E;  4L5N C;  5AE1 A;  1BBG A;  3HPZ A;  4BHB A;  2YTF A;  2EMA A;  2EOJ A;  2NUG A;  2LTS A;  2YTE A;  2EM9 A;  4NHR A;  1YZ9 A;  2VQF E;  2YTQ A;  4JYA E;  1A1G A;  3P1X A;  4ZYG A;  1Z1B A;  2WBS A;  2EWL A;  2L3C A;  4BBY A;  2MKD A;  4GZN C;  2YTJ A;  2JOX A;  2EPR A;  3HTX A;  2I13 A;  2ENC A;  2EPO A;  2EM8 A;  1G2F C;  3VYY A;  5LMU E;  1X6F A;  2E72 A;  1XNQ E;  4LF5 E;  4JI4 E;  4DR1 E;  2LJH A;  3BGH A;  5A6B A;  4Q28 A; 
#chains in the Genus database with same CATH homology
 2D9H A;  2CSH A;  2EPX A;  5KL6 A;  2LT7 A;  3EPJ A;  2EPZ A;  2EMX A;  1A1K A;  4R2R A;  2YTN A;  4FK5 C;  1ZU1 A;  1TF3 A;  1TF6 A;  2RSI A;  2EMI A;  1A1J A;  1B69 A;  5KL5 A;  3EPL A;  2WCC 3;  2EN6 A;  2EN1 A;  2EN7 A;  1DGC A;  1MEY C;  1JK2 A;  2RPC A;  2EM5 A;  2EP3 A;  2MKN A;  1F2I G;  1UBD C;  5KL4 A;  2A25 A;  2EOS A;  2EOE A;  2EQ1 A;  1BBO A;  1TN9 A;  1X6H A;  2EN8 A;  4IJD A;  4IS1 C;  2ADR A;  2PRT A;  2EM4 A;  2EM6 A;  2EOH A;  1A1F A;  2EMB A;  2EMF A;  2LCE A;  3EPH A;  2EL6 A;  1X3C A;  2ENH A;  2J7J A;  2EN2 A;  2EL5 A;  1A1H A;  1UN6 B;  2WBT A;  2EMK A;  2EPU A;  2EMW A;  2M9A A;  2EOF A;  2LV2 A;  2EM7 A;  1YSA C;  2ELY A;  2EMZ A;  1RMD A;  4F2J C;  1NCS A;  2EOM A;  2EMY A;  3M99 B;  2NAB A;  2DMI A;  2EMG A;  1WJP A;  1A1L A;  2YSO A;  1YUJ A;  2DRP A;  2EOI A;  3MHS C;  2LVH A;  1BB8 A;  1ZAA C;  2ELZ A;  2EQ3 A;  5KL2 A;  1YUI A;  4R2S A;  2EMC A;  4R2D A;  2EOX A;  2WBU A;  1JK1 A;  4R2Q A;  4M9V C;  1AAY A;  2EPP A;  2YTI A;  2CT1 A;  2YTP A;  2YRM A;  2LO3 A;  2MDG A;  2GLI A;  3EPK A;  2YTF A;  2EMA A;  2EOJ A;  2EN4 A;  2EOZ A;  2EOO A;  4WSG A;  5KL3 A;  2JPA A;  2EJ4 A;  4F6N A;  2YTE A;  2EM9 A;  2YTQ A;  4R2E A;  1A1G A;  1KJK A;  2EM2 A;  4X9J A;  1X6E A;  2YTD A;  1X5W A;  1Z1B A;  1LLM C;  5KL7 A;  3VHT B;  2WBS A;  2EPC A;  2GHF A;  2EOY A;  2YRK A;  2EQ0 A;  4R2C A;  2HGH A;  2YU5 A;  2MKD A;  2R1F A;  4GZN C;  2YTJ A;  2ENA A;  2YSP A;  2EPR A;  2EPA A;  2VRD A;  2DGC A;  2EN3 A;  1ZR9 A;  2BB8 A;  2EOQ A;  1P47 A;  1A1I A;  2I13 A;  2ENC A;  2CTD A;  2EM0 A;  2EOR A;  2YU8 A;  2EM8 A;  4F6M A;  1G2F C;  2EML A;  3MHH C;  2YTG A;  1X6F A;  2DLK A;  2E72 A;  3UK3 C;  2EM3 A;  1G2D C;  2YRH A;  2DLQ A;  2EE8 A;  4R2P A;  2YTO A;  2JP9 A;  2EL4 A;  4R2A A;  2EMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...