2MKDA

Human jaz zf3 residues 168-227
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
STKVEALHQNREMIDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQETKLKLMARYGRLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Characterization of Interactions between the Double-Stranded RNA-Binding Zinc Finger Protein JAZ and Nucleic Acids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Zinc finger protein 346
total genus 13
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2014-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12874 zf-met Zinc-finger of C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2mkdA00
2EP3A 2MDGA 2YTGA 2EN4A 2EN6A 5KL6A 1WJPA 2EL5A 2EMZA 2WBSA 2DLQA 2EMBA 2ENHA 2EPAA 3EPKA 2EM0A 4IS1C 2EQ1A 2EORA 2EOJA 1A1HA 2YTIA 1P47A 3MHHC 4GZNC 1TF6A 1ZR9A 2DLKA 3EPHA 1X6FA 2EM2A 2YTPA 2EOMA 2EE8A 2ELZA 2RPCA 2YRHA 4F2JC 4R2AA 2HGHA 1UN6B 1BBOA 1AAYA 2EQ0A 5KL5A 1X5WA 2EMKA 2I13A 2EPRA 2EM3A 2EMCA 2YRKA 2EMFA 1A1KA 2DRPA 2EMLA 1MEYC 2EPZA 2EM7A 3M99B 2BB8A 2YTDA 2WBTA 1LLMC 2A25A 4R2QA 2J7JA 2MKNA 2R1FA 2EOEA 2LV2A 1F2IG 1BB8A 4WSGA 5KL2A 1X6EA 2EOQA 4R2PA 1YUIA 4F6MA 2ADRA 1JK1A 1G2FC 2EM9A 1A1LA 3MHSC 2GLIA 3UK3C 2YTJA 1RMDA 2DMIA 2EMYA 2EOXA 2LCEA 2EMGA 3EPJA 2EOZA 1NCSA 2JPAA 1TF3A 2EN2A 2YSOA 1ZU1A 2EM6A 1JK2A 5KL3A 2EL6A 2WCC3 1Z1BA 2YTEA 2EPUA 2EN1A 2NABA 1G2DC 1ZAAC 2EMAA 2GHFA 2CT1A 2YU8A 2EPPA 2YSPA 2YTFA 2EOYA 2PRTA 1B69A 4R2RA 2MKDA 2YTOA 4F6NA 2CSHA 2EJ4A 1YUJA 1YSAC 2JP9A 2E72A 2EOFA 4R2DA 1X3CA 2EMXA 2EOSA 2YRMA 2EM4A 2EL4A 2EPXA 2EMHA 2ELYA 5KL7A 1A1JA 5KL4A 1A1IA 2LVHA 2EPCA 2EMIA 2EN3A 2RSIA 2DGCA 2EM8A 2VRDA 1UBDC 2EN8A 2M9AA 4R2CA 2D9HA 1TN9A 2EOOA 1A1GA 2EQ3A 2EN7A 2CTDA 4FK5C 2ENAA 4X9JA 2EOIA 2YU5A 1X6HA 4IJDA 2WBUA 3VHTB 2EMWA 2YTQA 2LT7A 4M9VC 4R2EA 4R2SA 2ENCA 3EPLA 2YTNA 2EM5A 2EOHA 1KJKA 1DGCA 1A1FA 2LO3A
chains in the Genus database with same CATH superfamily
2KHXA 2RTXA 2M4IA 1YYKA 3F6GA 4TUIA 1HR0E 4LFBE 3TQMA 5IT9C 4DKKA 4B3ME 4X8WA 1N33E 2EMBA 5ADZA 1YYWA 2ENHA 3EPKA 3KZZA 4IS1C 2V83A 3VYXA 1GTKA 2V87A 2YTIA 5A6KA 5A6AA 2EOMA 2EE8A 1GQEA 4Q28A 4I8OA 1UN6B 1BBOA 4ZYGA 1AAYA 4WSPA 3VYYA 1X5WA 2EMKA 2EPNA 1SFEA 2L92A 2EM3A 2YRKA 5LMNE 2JXPA 3ADIA 2EPOA 2NA2A 1UHZA 2EM7A 2LTSA 2YTDA 1NEIA 4DR7E 4DUZE 5LMUE 3J7Yp 2HC5A 2BBGA 4X65E 4NZVA 5LL6R 4WSGA 1BB8A 1X6EA 3BBGA 4DV2E 3RMPA 4LF6E 4F54A 3THOB 2MC6A 2M1SA 2GPIA 1I94E 3EPJA 4B3RE 4Q35B 3HTXA 2ODRD 3C6KA 4WXCA 4O5GA 4YY3E 3H09A 5AE1A 4LF4E 4DR5E 1YPNA 2PRTA 4O24A 4NXME 2JOXA 2DB2A 2HHHE 2MKDA 2EJ4A 1FKAE 1YUJA 2DIXA 2EMXA 2YRMA 4GEQB 3C4TA 1XNRE 2EPXA 2K4VA 4L5NC 3C6MA 5KL7A 3THNA 1HNWE 1PDAA 2EPCA 2V86A 2RQLA 1UILA 4KHPE 4MLQA 2DGCA 2VRDA 4ZYEA 1UBDC 5A6JA 3J80C 2NUFA 2YT4A 2EN8A 3MSWA 4R2CA 2FGGA 4M2ZA 3J7AG 2B7VA 2RS7A 2EN7A 2JYAA 2I9IA 2JWOA 2L6MA 4WXDA 2HJJA 1T39A 4BMJA 3IWBA 1T4NA 4BCAA 1A1FA 4LF8E 1YZ9A 1WXRA 2LO3A 2EP3A 2MDGA 4ZYDA 1O0WA 1IMUA 1WHQA 2LJUA 3LLHA 2L2NA 3OMLA 5AE2A 1XMOE 2WBSA 3ADGA 1HNZE 2EPKX 1EH6A 3IWCA 1X48A 2EOJA 2F8BA 1ZR9A 3FIGA 2EM2A 4OOGC 2UUBE 4F2JC 4X66E 2YRHA 4BHBA 4R2AA 2NUGA 1IBME 2DSYA 2F4VE 2I13A 2V89A 2LRSA 2EMFA 1BBGA 1QU6A 1DQ3A 2L8TA 3M99B 4JI8E 3L00A 1IQOA 2BB8A 2YPNA 4R2QA 2R1FA 3HXLA 2K7IA 2E1MA 1ZBQA 4F6MA 4LFAE 1RC7A 2RS6A 1G2FC 2L33A 4M30A 1A1LA 3C4BA 2DMIA 2EMYA 4DMIA 2EMGA 1NCSA 4N4RB 2JPAA 1TF3A 2EN2A 2YSOA 3OTOE 4F9CB 5A6BA 1JK2A 1G2DC 2EL6A 2WCC3 1ZAAC 2YTEA 4NXNE 4ZYHA 4OX9E 5F3WA 5A2QC 2EMAA 4F9BB 5IXMB 2CT1A 5CFFE 4LF9E 4K0KE 2YSPA 2YTFA 2EOYA 3BIDA 1XNQE 3HQ1A 4X64E 4BC7A 2JP9A 4HTGA 4JI1E 4R2DA 1X3CA 5A6BD 1YFHA 2EL4A 4JV5E 2EMHA 2V8QB 1A1IA 5AC5A 2B9DA 3DJWA 4J8ZA 5LLQA 2UUAE 3VK6A 3EQ1A 3JAMC 1STUA 1TN9A 2EOOA 2MDRA 5A69A 2EOIA 3AUZA 3KZYA 4IJDA 4KWYA 3VHTB 2EMWA 3DF6A 4JI3E 2G7HA 3ADLA 2ODRC 1X49A 3ADJA 5AASA 4WYQB 2UU9E 4DV1E 5KL6A 1WJPA 1GZ6A 2EL5A 1YYOA 3LMLA 1KYQA 2DLQA 2JR1A 4R03A 4DR1E 2N8XA 4HEIA 2EQ1A 4DV5E 2CPNA 2EORA 1A1HA 5IV8B 1P47A 2B3TB 3MHHC 1TF6A 3EPHA 5TSEA 2L3CA 3F6HA 2RPCA 2M7QA 1DI2A 1WRJA 2EQ0A 4GKJE 5KL5A 1PJQA 1X47A 4RH8A 4NHRA 2FV4B 2EMCA 4KZSA 2LJHA 2VF1A 4X62E 1MEYC 2EPZA 2WBTA 1LLMC 2UXBE 2J7JA 2N3GA 1IBKE 2MKNA 2L2MA 3P1XA 1N32E 4WPYA 4R2PA 1YUIA 1WHNA 2MC5A 1RMDA 2EOXA 1J5EE 2LCEA 4DV0E 1ZU1A 2EM6A 4O43A 5KL3A 1Z1BA 1PKPA 2JOBA 4RHBB 5AC4A 5DNYA 2EPPA 3KWRA 2YWQA 4JYAE 4R2RA 2VE7C 4O4KA 4F6NA 3JU0A 4DR2E 4BHCA 2N3HA 4BBYA 2EM4A 4YHHE 5KL4A 2UUCE 2NUEA 4DR6E 3QG5C 2EM8A 4L8NA 2D9HA 4LF7E 1A1GA 2R76A 2CTDA 2ENAA 2YU5A 1X6HA 2WBUA 1HNXE 1QNTA 1PJTA 2YTQA 4M9VC 4B3TE 4R2EA 5FLXC 2ENCA 3J81C 2Q8UA 3EPLA 4LF5E 1IBLE 3HPSA 1DGCA 2EZ6A 2YTGA 4JI7E 2EN4A 4LU9A 2EN6A 2EWLA 1J26A 4DV7E 2EMZA 5AE3A 3K6QA 4DV3E 1T38A 2LUQA 2EPAA 2EM0A 2JY9A 4GZNC 2DLKA 4R8OA 4WX9A 1X6FA 1L4SA 2ZM6E 2YTPA 1KJKA 2ELZA 2HGHA 1MGTA 4LTYA 4P78A 2EPRA 3JTZA 4JI5E 1A1KA 2LUPB 2DRPA 2LMZA 2EMLA 2UXCE 1T4OA 4MLVA 5IWAE 2H36X 3HPZA 1EKZA 1IQSA 2A25A 2JVAA 2EOEA 2LV2A 4GKKE 2VQEE 1AH5A 4WFTA 3ECRA 2L3JA 1RQ0A 1F2IG 5KL2A 2VQFE 2E5LE 1N3GA 2YZTA 2EOQA 2LE2A 1JK1A 2ADRA 2EM9A 4JI2E 3MHSC 4LFCE 2GLIA 3UK3C 2YTJA 4F9AB 3AV0A 3BGHA 4DR3E 4JI0E 4DUYE 2EOZA 4DV4E 2IHR1 2V88A 2LTRA 2EPUA 2EN1A 2NABA 2RSMA 3ZOQB 2GHFA 4TUGA 2YU8A 2WZOA 4BC9A 1FJGE 1B69A 2YTOA 2CSHA 2B7TA 1YSAC 4DR4E 2E72A 2EOFA 4P7DA 3T1HE 1N34E 2EOSA 4JI6E 2UXDE 2V85A 2ELYA 1A1JA 3BF2A 1XMQE 2LBSB 2LVHA 3T1YE 2EMIA 2L2KB 2EN3A 2RSIA 2DMYA 1N36E 4BS9A 2KONA 2KOUA 1EH8A 2M9AA 2EPMX 4DV6E 1EH7A 5T6JA 4B3SE 1PJSA 3IWDA 2EQ3A 4FK5C 4X9JA 2EPLX 5BR8E 4JI4E 1ZBTA 2FTXB 1T4LB 2LT7A 4R2SA 2YTNA 2EM5A 2EOHA 1SR9A 4AQYE 4M0VA
chains in the Genus database with same CATH topology
2EP3A 2MDGA 2YTGA 2EN4A 2EN6A 5KL6A 1WJPA 2EL5A 2EMZA 2WBSA 2DLQA 2EMBA 2ENHA 2EPAA 3EPKA 2EM0A 4IS1C 2EQ1A 2EORA 2EOJA 1A1HA 2YTIA 1P47A 3MHHC 4GZNC 1TF6A 1ZR9A 2DLKA 3EPHA 1X6FA 2EM2A 2YTPA 2EOMA 2EE8A 2ELZA 2RPCA 2YRHA 4F2JC 4R2AA 2HGHA 1UN6B 1BBOA 1AAYA 2EQ0A 5KL5A 1X5WA 2EMKA 2I13A 2EPRA 2EM3A 2EMCA 2YRKA 2EMFA 1A1KA 2DRPA 2EMLA 1MEYC 2EPZA 2EM7A 3M99B 2BB8A 2YTDA 2WBTA 1LLMC 2A25A 4R2QA 2J7JA 2MKNA 2R1FA 2EOEA 2LV2A 1F2IG 1BB8A 4WSGA 5KL2A 1X6EA 2EOQA 4R2PA 1YUIA 4F6MA 2ADRA 1JK1A 1G2FC 2EM9A 1A1LA 3MHSC 2GLIA 3UK3C 2YTJA 1RMDA 2DMIA 2EMYA 2EOXA 2LCEA 2EMGA 3EPJA 2EOZA 1NCSA 2JPAA 1TF3A 2EN2A 2YSOA 1ZU1A 2EM6A 1JK2A 5KL3A 2EL6A 2WCC3 1Z1BA 2YTEA 2EPUA 2EN1A 2NABA 1G2DC 1ZAAC 2EMAA 2GHFA 2CT1A 2YU8A 2EPPA 2YSPA 2YTFA 2EOYA 2PRTA 1B69A 4R2RA 2MKDA 2YTOA 4F6NA 2CSHA 2EJ4A 1YUJA 1YSAC 2JP9A 2E72A 2EOFA 4R2DA 1X3CA 2EMXA 2EOSA 2YRMA 2EM4A 2EL4A 2EPXA 2EMHA 2ELYA 5KL7A 1A1JA 5KL4A 1A1IA 2LVHA 2EPCA 2EMIA 2EN3A 2RSIA 2DGCA 2EM8A 2VRDA 1UBDC 2EN8A 2M9AA 4R2CA 2D9HA 1TN9A 2EOOA 1A1GA 2EQ3A 2EN7A 2CTDA 4FK5C 2ENAA 4X9JA 2EOIA 2YU5A 1X6HA 4IJDA 2WBUA 3VHTB 2EMWA 2YTQA 2LT7A 4M9VC 4R2EA 4R2SA 2ENCA 3EPLA 2YTNA 2EM5A 2EOHA 1KJKA 1DGCA 1A1FA 2LO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EP3 A;  2MDG A;  2YTG A;  2EN4 A;  2EN6 A;  5KL6 A;  1WJP A;  2EL5 A;  2EMZ A;  2WBS A;  2DLQ A;  2EMB A;  2ENH A;  2EPA A;  3EPK A;  2EM0 A;  4IS1 C;  2EQ1 A;  2EOR A;  2EOJ A;  1A1H A;  2YTI A;  1P47 A;  3MHH C;  4GZN C;  1TF6 A;  1ZR9 A;  2DLK A;  3EPH A;  1X6F A;  2EM2 A;  2YTP A;  2EOM A;  2EE8 A;  2ELZ A;  2RPC A;  2YRH A;  4F2J C;  4R2A A;  2HGH A;  1UN6 B;  1BBO A;  1AAY A;  2EQ0 A;  5KL5 A;  1X5W A;  2EMK A;  2I13 A;  2EPR A;  2EM3 A;  2EMC A;  2YRK A;  2EMF A;  1A1K A;  2DRP A;  2EML A;  1MEY C;  2EPZ A;  2EM7 A;  3M99 B;  2BB8 A;  2YTD A;  2WBT A;  1LLM C;  2A25 A;  4R2Q A;  2J7J A;  2MKN A;  2R1F A;  2EOE A;  2LV2 A;  1F2I G;  1BB8 A;  4WSG A;  5KL2 A;  1X6E A;  2EOQ A;  4R2P A;  1YUI A;  4F6M A;  2ADR A;  1JK1 A;  1G2F C;  2EM9 A;  1A1L A;  3MHS C;  2GLI A;  3UK3 C;  2YTJ A;  1RMD A;  2DMI A;  2EMY A;  2EOX A;  2LCE A;  2EMG A;  3EPJ A;  2EOZ A;  1NCS A;  2JPA A;  1TF3 A;  2EN2 A;  2YSO A;  1ZU1 A;  2EM6 A;  1JK2 A;  5KL3 A;  2EL6 A;  2WCC 3;  1Z1B A;  2YTE A;  2EPU A;  2EN1 A;  2NAB A;  1G2D C;  1ZAA C;  2EMA A;  2GHF A;  2CT1 A;  2YU8 A;  2EPP A;  2YSP A;  2YTF A;  2EOY A;  2PRT A;  1B69 A;  4R2R A;  2MKD A;  2YTO A;  4F6N A;  2CSH A;  2EJ4 A;  1YUJ A;  1YSA C;  2JP9 A;  2E72 A;  2EOF A;  4R2D A;  1X3C A;  2EMX A;  2EOS A;  2YRM A;  2EM4 A;  2EL4 A;  2EPX A;  2EMH A;  2ELY A;  5KL7 A;  1A1J A;  5KL4 A;  1A1I A;  2LVH A;  2EPC A;  2EMI A;  2EN3 A;  2RSI A;  2DGC A;  2EM8 A;  2VRD A;  1UBD C;  2EN8 A;  2M9A A;  4R2C A;  2D9H A;  1TN9 A;  2EOO A;  1A1G A;  2EQ3 A;  2EN7 A;  2CTD A;  4FK5 C;  2ENA A;  4X9J A;  2EOI A;  2YU5 A;  1X6H A;  4IJD A;  2WBU A;  3VHT B;  2EMW A;  2YTQ A;  2LT7 A;  4M9V C;  4R2E A;  4R2S A;  2ENC A;  3EPL A;  2YTN A;  2EM5 A;  2EOH A;  1KJK A;  1DGC A;  1A1F A;  2LO3 A; 
#chains in the Genus database with same CATH topology
 2KHX A;  2RTX A;  2M4I A;  1YYK A;  3F6G A;  4TUI A;  1HR0 E;  4LFB E;  3TQM A;  5IT9 C;  4DKK A;  4B3M E;  4X8W A;  1N33 E;  2EMB A;  5ADZ A;  1YYW A;  2ENH A;  3EPK A;  3KZZ A;  4IS1 C;  2V83 A;  3VYX A;  1GTK A;  2V87 A;  2YTI A;  5A6K A;  5A6A A;  2EOM A;  2EE8 A;  1GQE A;  4Q28 A;  4I8O A;  1UN6 B;  1BBO A;  4ZYG A;  1AAY A;  4WSP A;  3VYY A;  1X5W A;  2EMK A;  2EPN A;  1SFE A;  2L92 A;  2EM3 A;  2YRK A;  5LMN E;  2JXP A;  3ADI A;  2EPO A;  2NA2 A;  1UHZ A;  2EM7 A;  2LTS A;  2YTD A;  1NEI A;  4DR7 E;  4DUZ E;  5LMU E;  3J7Y p;  2HC5 A;  2BBG A;  4X65 E;  4NZV A;  5LL6 R;  4WSG A;  1BB8 A;  1X6E A;  3BBG A;  4DV2 E;  3RMP A;  4LF6 E;  4F54 A;  3THO B;  2MC6 A;  2M1S A;  2GPI A;  1I94 E;  3EPJ A;  4B3R E;  4Q35 B;  3HTX A;  2ODR D;  3C6K A;  4WXC A;  4O5G A;  4YY3 E;  3H09 A;  5AE1 A;  4LF4 E;  4DR5 E;  1YPN A;  2PRT A;  4O24 A;  4NXM E;  2JOX A;  2DB2 A;  2HHH E;  2MKD A;  2EJ4 A;  1FKA E;  1YUJ A;  2DIX A;  2EMX A;  2YRM A;  4GEQ B;  3C4T A;  1XNR E;  2EPX A;  2K4V A;  4L5N C;  3C6M A;  5KL7 A;  3THN A;  1HNW E;  1PDA A;  2EPC A;  2V86 A;  2RQL A;  1UIL A;  4KHP E;  4MLQ A;  2DGC A;  2VRD A;  4ZYE A;  1UBD C;  5A6J A;  3J80 C;  2NUF A;  2YT4 A;  2EN8 A;  3MSW A;  4R2C A;  2FGG A;  4M2Z A;  3J7A G;  2B7V A;  2RS7 A;  2EN7 A;  2JYA A;  2I9I A;  2JWO A;  2L6M A;  4WXD A;  2HJJ A;  1T39 A;  4BMJ A;  3IWB A;  1T4N A;  4BCA A;  1A1F A;  4LF8 E;  1YZ9 A;  1WXR A;  2LO3 A;  2EP3 A;  2MDG A;  4ZYD A;  1O0W A;  1IMU A;  1WHQ A;  2LJU A;  3LLH A;  2L2N A;  3OML A;  5AE2 A;  1XMO E;  2WBS A;  3ADG A;  1HNZ E;  2EPK X;  1EH6 A;  3IWC A;  1X48 A;  2EOJ A;  2F8B A;  1ZR9 A;  3FIG A;  2EM2 A;  4OOG C;  2UUB E;  4F2J C;  4X66 E;  2YRH A;  4BHB A;  4R2A A;  2NUG A;  1IBM E;  2DSY A;  2F4V E;  2I13 A;  2V89 A;  2LRS A;  2EMF A;  1BBG A;  1QU6 A;  1DQ3 A;  2L8T A;  3M99 B;  4JI8 E;  3L00 A;  1IQO A;  2BB8 A;  2YPN A;  4R2Q A;  2R1F A;  3HXL A;  2K7I A;  2E1M A;  1ZBQ A;  4F6M A;  4LFA E;  1RC7 A;  2RS6 A;  1G2F C;  2L33 A;  4M30 A;  1A1L A;  3C4B A;  2DMI A;  2EMY A;  4DMI A;  2EMG A;  1NCS A;  4N4R B;  2JPA A;  1TF3 A;  2EN2 A;  2YSO A;  3OTO E;  4F9C B;  5A6B A;  1JK2 A;  1G2D C;  2EL6 A;  2WCC 3;  1ZAA C;  2YTE A;  4NXN E;  4ZYH A;  4OX9 E;  5F3W A;  5A2Q C;  2EMA A;  4F9B B;  5IXM B;  2CT1 A;  5CFF E;  4LF9 E;  4K0K E;  2YSP A;  2YTF A;  2EOY A;  3BID A;  1XNQ E;  3HQ1 A;  4X64 E;  4BC7 A;  2JP9 A;  4HTG A;  4JI1 E;  4R2D A;  1X3C A;  5A6B D;  1YFH A;  2EL4 A;  4JV5 E;  2EMH A;  2V8Q B;  1A1I A;  5AC5 A;  2B9D A;  3DJW A;  4J8Z A;  5LLQ A;  2UUA E;  3VK6 A;  3EQ1 A;  3JAM C;  1STU A;  1TN9 A;  2EOO A;  2MDR A;  5A69 A;  2EOI A;  3AUZ A;  3KZY A;  4IJD A;  4KWY A;  3VHT B;  2EMW A;  3DF6 A;  4JI3 E;  2G7H A;  3ADL A;  2ODR C;  1X49 A;  3ADJ A;  5AAS A;  4WYQ B;  2UU9 E;  4DV1 E;  5KL6 A;  1WJP A;  1GZ6 A;  2EL5 A;  1YYO A;  3LML A;  1KYQ A;  2DLQ A;  2JR1 A;  4R03 A;  4DR1 E;  2N8X A;  4HEI A;  2EQ1 A;  4DV5 E;  2CPN A;  2EOR A;  1A1H A;  5IV8 B;  1P47 A;  2B3T B;  3MHH C;  1TF6 A;  3EPH A;  5TSE A;  2L3C A;  3F6H A;  2RPC A;  2M7Q A;  1DI2 A;  1WRJ A;  2EQ0 A;  4GKJ E;  5KL5 A;  1PJQ A;  1X47 A;  4RH8 A;  4NHR A;  2FV4 B;  2EMC A;  4KZS A;  2LJH A;  2VF1 A;  4X62 E;  1MEY C;  2EPZ A;  2WBT A;  1LLM C;  2UXB E;  2J7J A;  2N3G A;  1IBK E;  2MKN A;  2L2M A;  3P1X A;  1N32 E;  4WPY A;  4R2P A;  1YUI A;  1WHN A;  2MC5 A;  1RMD A;  2EOX A;  1J5E E;  2LCE A;  4DV0 E;  1ZU1 A;  2EM6 A;  4O43 A;  5KL3 A;  1Z1B A;  1PKP A;  2JOB A;  4RHB B;  5AC4 A;  5DNY A;  2EPP A;  3KWR A;  2YWQ A;  4JYA E;  4R2R A;  2VE7 C;  4O4K A;  4F6N A;  3JU0 A;  4DR2 E;  4BHC A;  2N3H A;  4BBY A;  2EM4 A;  4YHH E;  5KL4 A;  2UUC E;  2NUE A;  4DR6 E;  3QG5 C;  2EM8 A;  4L8N A;  2D9H A;  4LF7 E;  1A1G A;  2R76 A;  2CTD A;  2ENA A;  2YU5 A;  1X6H A;  2WBU A;  1HNX E;  1QNT A;  1PJT A;  2YTQ A;  4M9V C;  4B3T E;  4R2E A;  5FLX C;  2ENC A;  3J81 C;  2Q8U A;  3EPL A;  4LF5 E;  1IBL E;  3HPS A;  1DGC A;  2EZ6 A;  2YTG A;  4JI7 E;  2EN4 A;  4LU9 A;  2EN6 A;  2EWL A;  1J26 A;  4DV7 E;  2EMZ A;  5AE3 A;  3K6Q A;  4DV3 E;  1T38 A;  2LUQ A;  2EPA A;  2EM0 A;  2JY9 A;  4GZN C;  2DLK A;  4R8O A;  4WX9 A;  1X6F A;  1L4S A;  2ZM6 E;  2YTP A;  1KJK A;  2ELZ A;  2HGH A;  1MGT A;  4LTY A;  4P78 A;  2EPR A;  3JTZ A;  4JI5 E;  1A1K A;  2LUP B;  2DRP A;  2LMZ A;  2EML A;  2UXC E;  1T4O A;  4MLV A;  5IWA E;  2H36 X;  3HPZ A;  1EKZ A;  1IQS A;  2A25 A;  2JVA A;  2EOE A;  2LV2 A;  4GKK E;  2VQE E;  1AH5 A;  4WFT A;  3ECR A;  2L3J A;  1RQ0 A;  1F2I G;  5KL2 A;  2VQF E;  2E5L E;  1N3G A;  2YZT A;  2EOQ A;  2LE2 A;  1JK1 A;  2ADR A;  2EM9 A;  4JI2 E;  3MHS C;  4LFC E;  2GLI A;  3UK3 C;  2YTJ A;  4F9A B;  3AV0 A;  3BGH A;  4DR3 E;  4JI0 E;  4DUY E;  2EOZ A;  4DV4 E;  2IHR 1;  2V88 A;  2LTR A;  2EPU A;  2EN1 A;  2NAB A;  2RSM A;  3ZOQ B;  2GHF A;  4TUG A;  2YU8 A;  2WZO A;  4BC9 A;  1FJG E;  1B69 A;  2YTO A;  2CSH A;  2B7T A;  1YSA C;  4DR4 E;  2E72 A;  2EOF A;  4P7D A;  3T1H E;  1N34 E;  2EOS A;  4JI6 E;  2UXD E;  2V85 A;  2ELY A;  1A1J A;  3BF2 A;  1XMQ E;  2LBS B;  2LVH A;  3T1Y E;  2EMI A;  2L2K B;  2EN3 A;  2RSI A;  2DMY A;  1N36 E;  4BS9 A;  2KON A;  2KOU A;  1EH8 A;  2M9A A;  2EPM X;  4DV6 E;  1EH7 A;  5T6J A;  4B3S E;  1PJS A;  3IWD A;  2EQ3 A;  4FK5 C;  4X9J A;  2EPL X;  5BR8 E;  4JI4 E;  1ZBT A;  2FTX B;  1T4L B;  2LT7 A;  4R2S A;  2YTN A;  2EM5 A;  2EOH A;  1SR9 A;  4AQY E;  4M0V A; 
#chains in the Genus database with same CATH homology
 2EP3 A;  2MDG A;  2YTG A;  2EN4 A;  2EN6 A;  5KL6 A;  1WJP A;  2EL5 A;  2EMZ A;  2WBS A;  2DLQ A;  2EMB A;  2ENH A;  2EPA A;  3EPK A;  2EM0 A;  4IS1 C;  2EQ1 A;  2EOR A;  2EOJ A;  1A1H A;  2YTI A;  1P47 A;  3MHH C;  4GZN C;  1TF6 A;  1ZR9 A;  2DLK A;  3EPH A;  1X6F A;  2EM2 A;  2YTP A;  2EOM A;  2EE8 A;  2ELZ A;  2RPC A;  2YRH A;  4F2J C;  4R2A A;  2HGH A;  1UN6 B;  1BBO A;  1AAY A;  2EQ0 A;  5KL5 A;  1X5W A;  2EMK A;  2I13 A;  2EPR A;  2EM3 A;  2EMC A;  2YRK A;  2EMF A;  1A1K A;  2DRP A;  2EML A;  1MEY C;  2EPZ A;  2EM7 A;  3M99 B;  2BB8 A;  2YTD A;  2WBT A;  1LLM C;  2A25 A;  4R2Q A;  2J7J A;  2MKN A;  2R1F A;  2EOE A;  2LV2 A;  1F2I G;  1BB8 A;  4WSG A;  5KL2 A;  1X6E A;  2EOQ A;  4R2P A;  1YUI A;  4F6M A;  2ADR A;  1JK1 A;  1G2F C;  2EM9 A;  1A1L A;  3MHS C;  2GLI A;  3UK3 C;  2YTJ A;  1RMD A;  2DMI A;  2EMY A;  2EOX A;  2LCE A;  2EMG A;  3EPJ A;  2EOZ A;  1NCS A;  2JPA A;  1TF3 A;  2EN2 A;  2YSO A;  1ZU1 A;  2EM6 A;  1JK2 A;  5KL3 A;  2EL6 A;  2WCC 3;  1Z1B A;  2YTE A;  2EPU A;  2EN1 A;  2NAB A;  1G2D C;  1ZAA C;  2EMA A;  2GHF A;  2CT1 A;  2YU8 A;  2EPP A;  2YSP A;  2YTF A;  2EOY A;  2PRT A;  1B69 A;  4R2R A;  2MKD A;  2YTO A;  4F6N A;  2CSH A;  2EJ4 A;  1YUJ A;  1YSA C;  2JP9 A;  2E72 A;  2EOF A;  4R2D A;  1X3C A;  2EMX A;  2EOS A;  2YRM A;  2EM4 A;  2EL4 A;  2EPX A;  2EMH A;  2ELY A;  5KL7 A;  1A1J A;  5KL4 A;  1A1I A;  2LVH A;  2EPC A;  2EMI A;  2EN3 A;  2RSI A;  2DGC A;  2EM8 A;  2VRD A;  1UBD C;  2EN8 A;  2M9A A;  4R2C A;  2D9H A;  1TN9 A;  2EOO A;  1A1G A;  2EQ3 A;  2EN7 A;  2CTD A;  4FK5 C;  2ENA A;  4X9J A;  2EOI A;  2YU5 A;  1X6H A;  4IJD A;  2WBU A;  3VHT B;  2EMW A;  2YTQ A;  2LT7 A;  4M9V C;  4R2E A;  4R2S A;  2ENC A;  3EPL A;  2YTN A;  2EM5 A;  2EOH A;  1KJK A;  1DGC A;  1A1F A;  2LO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...