2MKDA

Human jaz zf3 residues 168-227
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
STKVEALHQNREMIDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQETKLKLMARYGRLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Zinc finger protein 346
publication title Structural Characterization of Interactions between the Double-Stranded RNA-Binding Zinc Finger Protein JAZ and Nucleic Acids.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2014-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12874 zf-met Zinc-finger of C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2mkdA00
1G2FC 1G2DC 1JK2A 1TF3A 3EPHA 2EMFA 4R2SA 2CSHA 2JP9A 2EL4A 2EMWA 2EORA 2J7JA 2EM8A 2YRMA 5KL6A 2EOJA 2EPUA 2YTOA 3EPKA 5KL7A 1ZR9A 2EM4A 2LVHA 2EJ4A 2YTNA 2DMIA 2YTDA 2WBUA 4M9VC 2EM6A 2E72A 1BBOA 2EP3A 4R2EA 1A1FA 2CT1A 1X5WA 1X6HA 2MDGA 3MHSC 1AAYA 1YUJA 1A1LA 1MEYC 5KL2A 1UBDC 2EN4A 5KL3A 2YTGA 4R2PA 2EN2A 2EQ1A 2BB8A 1WJPA 3MHHC 2YSPA 2ADRA 2LCEA 4F6MA 1YUIA 2LT7A 2VRDA 2YTPA 1TF6A 2EN3A 2EMIA 4R2RA 4GZNC 2EL5A 1JK1A 1KJKA 2YU5A 2YRKA 4R2CA 2EMBA 2EM0A 2ENHA 2EQ0A 4FK5C 1B69A 1YSAC 2EE8A 2CTDA 2ELZA 2EOHA 1A1HA 2YTIA 2EMXA 2YRHA 2WCC3 2EMAA 2EPRA 2EQ3A 2EMZA 4R2QA 2EPZA 1ZAAC 2EM2A 3M99B 2DLQA 1DGCA 1A1IA 3EPJA 2EM3A 2RSIA 2MKDA 2EMLA 2EOYA 4R2DA 2I13A 2LV2A 2EPAA 2JPAA 2HGHA 2LO3A 2EOOA 1X3CA 2EOZA 2EM7A 1ZU1A 2GHFA 4F2JC 2NABA 2YTEA 5KL4A 1BB8A 3UK3C 2EMHA 2EN6A 2EPXA 4WSGA 2YU8A 4F6NA 2ENCA 2EN1A 2DLKA 2EPCA 2D9HA 2EOSA 1X6FA 1A1JA 1LLMC 2R1FA 2ENAA 5KL5A 1A1GA 2YTFA 2EMCA 2WBSA 1P47A 2RPCA 1Z1BA 2MKNA 1TN9A 2PRTA 2EMYA 1X6EA 1UN6B 2EPPA 2WBTA 4X9JA 2A25A 2M9AA 1RMDA 2EOQA 3VHTB 2EM9A 2DGCA 2EOMA 1A1KA 4IS1C 2EOFA 4R2AA 2EMGA 1F2IG 2EOEA 3EPLA 2EN8A 2EL6A 2YTQA 2YTJA 2EOIA 2YSOA 1NCSA 2EN7A 4IJDA 2DRPA 2EM5A 2ELYA 2EMKA 2GLIA 2EOXA
chains in the Genus database with same CATH superfamily
3KZYA 2LTSA 3EPHA 2EMFA 4O5GA 1XNRE 2RTXA 4LU9A 2EM8A 4DR4E 4KHPE 4DV2E 4ZYHA 4B3TE 4GKJE 3L00A 2L3CA 1KYQA 2YT4A 1T4LB 2F4VE 5AC4A 1IBME 5CFFE 4BBYA 1UILA 5A6AA 4NXME 1YUJA 3DJWA 2V83A 1MEYC 1YFHA 2I9IA 1N3GA 2YTGA 4DV1E 2HC5A 2B9DA 5LL6R 4R2PA 2EN2A 2V86A 3MHHC 4BHCA 4WX9A 4B3ME 1DQ3A 5LMNE 2YTPA 1TF6A 2EN3A 1KJKA 3IWDA 4JI4E 4JI6E 4R2CA 2EMBA 4FK5C 1B69A 1YSAC 2EMXA 2JY9A 4WYQB 2VE7C 5T6JA 4TUGA 3VK6A 1ZAAC 1FJGE 1AH5A 2DLQA 3J7Yp 2V88A 2F8BA 2VQFE 2JR1A 3EPJA 5AASA 2EM3A 2IHR1 5A6BA 2EOYA 4DV6E 5LLQA 1IMUA 2EPAA 2HGHA 3C6KA 2EOOA 1X3CA 2DIXA 3JU0A 5FLXC 1ZU1A 5A2QC 3UK3C 2EMHA 3FIGA 4NZVA 2LUQA 4L5NC 4LF9E 2VF1A 2LMZA 3ADIA 1STUA 2D9HA 3HPZA 1YYOA 1WHNA 2ENAA 1BBGA 4BC9A 4LFAE 1A1GA 1IQOA 1WRJA 3THOB 4AQYE 4DV7E 4ZYGA 1Z1BA 4JI2E 3BIDA 1PJSA 4JI5E 4DR6E 1UN6B 5A69A 2A25A 2M9AA 3VHTB 2NA2A 4WXDA 3J80C 4JYAE 2EOFA 2EMGA 4P7DA 2EL6A 2YTQA 3KWRA 2YTJA 2EOIA 2L92A 4LFBE 2B7TA 1G2FC 1X47A 5A6JA 1WHQA 2CSHA 4X8WA 2JVAA 2EL4A 2YRMA 2ODRC 5IV8B 5A6KA 1ZR9A 2EM4A 3MSWA 2LVHA 1QNTA 2YTNA 2DMIA 2ZM6E 3RMPA 1HR0E 2EM6A 3BF2A 2KONA 4JI0E 4JI7E 1PJQA 2DMYA 1X6HA 2MDGA 2LJHA 4LFCE 2YPNA 2EN4A 5KL3A 5ADZA 4DMIA 4DR3E 2YSPA 2ADRA 4X64E 4LF6E 3ADGA 1RQ0A 2LCEA 1YUIA 4NHRA 1DI2A 2VRDA 2UUBE 2H36X 3F6GA 4F9AB 4GZNC 1JK1A 4DKKA 2LJUA 2YU5A 1YZ9A 4M30A 1RC7A 2EQ0A 2EOHA 1A1HA 1X48A 2LE2A 2YTIA 3HPSA 5AE2A 3OTOE 4M0VA 5IWAE 4YHHE 1NEIA 2ODRD 4NXNE 2EM2A 3AV0A 1A1IA 1UHZA 3H09A 1X49A 1XNQE 2LRSA 4GEQB 2YWQA 2GHFA 2EM7A 2KHXA 2Q8UA 4F2JC 2K4VA 5IT9C 1ZBTA 4WSGA 2E5LE 1HNWE 2EN1A 4JV5E 2EPCA 2EOSA 1X6FA 2V87A 2R1FA 1EH7A 1N33E 2RPCA 2V89A 2MC6A 3T1YE 2E1MA 2HJJA 2MDRA 3P1XA 2NUGA 4BCAA 3IWCA 2RSMA 2EOQA 4OOGC 2EOEA 2LTRA 4Q28A 3TQMA 4WXCA 1NCSA 4IJDA 5AE3A 2EM5A 2UUCE 2N3GA 2EMKA 2ELYA 2CPNA 1SR9A 1G2DC 1JK2A 1TF3A 4HTGA 2FTXB 4GKKE 2EORA 5KL6A 4BHBA 4HEIA 2EPUA 2YTOA 3EPKA 2NUEA 5KL7A 2M4IA 4MLVA 1EH6A 2RQLA 3ECRA 2EJ4A 4O43A 2YTDA 2WBUA 1BBOA 2GPIA 4R2EA 3J81C 2B3TB 3K6QA 4X66E 1UBDC 5DNYA 4DUZE 2EPOA 3LLHA 3QG5C 1N34E 2EQ1A 3VYXA 2BB8A 1WJPA 2N3HA 3JAMC 2UU9E 4TUIA 4F6MA 1YYWA 2LT7A 3HTXA 2EPMX 2EMIA 2L2MA 4LF5E 4X65E 2EZ6A 2CTDA 4M2ZA 4O24A 1GTKA 1IBLE 2YRHA 2WCC3 2EMAA 2EQ3A 4RHBB 4BMJA 2EMZA 2EPKX 4R2QA 2EPZA 2JXPA 3M99B 1DGCA 2UXCE 1I94E 2RSIA 2EMLA 2JOXA 2I13A 2LV2A 3KZZA 2JPAA 4LTYA 2LO3A 2YZTA 2EOZA 4I8OA 4DR7E 1BB8A 2YTEA 2YU8A 2FV4B 5IXMB 2UUAE 4WFTA 1A1JA 4DR2E 2JWOA 2YTFA 3JTZA 4BC7A 4B3SE 1WXRA 1P47A 2WZOA 1TN9A 2PRTA 2EMYA 3AUZA 3ADLA 1X6EA 1YPNA 4WPYA 4JI3E 3C6MA 3BBGA 2LBSB 4DV3E 2EOMA 1A1KA 3HQ1A 4F54A 4R2AA 5AC5A 4DR5E 1F2IG 2DSYA 4O4KA 3EQ1A 2YSOA 5F3WA 2EN7A 2DRPA 2DB2A 1HNXE 1N36E 5AE1A 4F6NA 1T4NA 2L2KB 1J5EE 3HXLA 3C4TA 4LF4E 4R2SA 4KZSA 2JP9A 4DR1E 2VQEE 2EMWA 4JI8E 2J7JA 1ZBQA 1O0WA 2EOJA 4JI1E 1QU6A 5LMUE 1SFEA 2M7QA 4M9VC 2E72A 2EP3A 1A1FA 2CT1A 1X5WA 2UXBE 2UXDE 5TSEA 4ZYDA 3MHSC 1AAYA 1A1LA 2V85A 1GQEA 2L3JA 2RS7A 2RS6A 5KL2A 2L2NA 4BS9A 2JOBA 2NUFA 4DV0E 1T39A 4DUYE 4LF7E 3DF6A 3ADJA 4WSPA 1MGTA 1PJTA 2V8QB 4R2RA 4X62E 2EL5A 4OX9E 4R8OA 4KWYA 4DV5E 2G7HA 2YRKA 2B7VA 2EM0A 2ENHA 4L8NA 2EPLX 1IQSA 2EE8A 2EPNA 1PKPA 2ELZA 2JYAA 1YYKA 3C4BA 1PDAA 3ZOQB 2EPRA 2M1SA 2L33A 2LUPB 1L4SA 4B3RE 1EKZA 3LMLA 4RH8A 2MKDA 1N32E 1T4OA 2R76A 1EH8A 3J7AG 4YY3E 4R2DA 1GZ6A 2L6MA 2MC5A 2NABA 5KL4A 1IBKE 4N4RB 2EN6A 2EPXA 4LF8E 1J26A 2ENCA 2DLKA 4F9CB 1LLMC 4J8ZA 4K0KE 4R03A 2L8TA 3THNA 4MLQA 5KL5A 3OMLA 2EMCA 2WBSA 1FKAE 2MKNA 2HHHE 2KOUA 1XMQE 2EWLA 2EPPA 2WBTA 4Q35B 4X9JA 1RMDA 3IWBA 2BBGA 2EM9A 3T1HE 2DGCA 3BGHA 2N8XA 4P78A 4IS1C 4ZYEA 4F9BB 3EPLA 2EN8A 4DV4E 2FGGA 5BR8E 5A6BD 3VYYA 3F6HA 2K7IA 1T38A 1HNZE 1XMOE 2GLIA 2EOXA
chains in the Genus database with same CATH topology
1G2FC 1G2DC 1JK2A 1TF3A 3EPHA 2EMFA 4R2SA 2CSHA 2JP9A 2EL4A 2EMWA 2EORA 2J7JA 2EM8A 2YRMA 5KL6A 2EOJA 2EPUA 2YTOA 3EPKA 5KL7A 1ZR9A 2EM4A 2LVHA 2EJ4A 2YTNA 2DMIA 2YTDA 2WBUA 4M9VC 2EM6A 2E72A 1BBOA 2EP3A 4R2EA 1A1FA 2CT1A 1X5WA 1X6HA 2MDGA 3MHSC 1AAYA 1YUJA 1A1LA 1MEYC 5KL2A 1UBDC 2EN4A 5KL3A 2YTGA 4R2PA 2EN2A 2EQ1A 2BB8A 1WJPA 3MHHC 2YSPA 2ADRA 2LCEA 4F6MA 1YUIA 2LT7A 2VRDA 2YTPA 1TF6A 2EN3A 2EMIA 4R2RA 4GZNC 2EL5A 1JK1A 1KJKA 2YU5A 2YRKA 4R2CA 2EMBA 2EM0A 2ENHA 2EQ0A 4FK5C 1B69A 1YSAC 2EE8A 2CTDA 2ELZA 2EOHA 1A1HA 2YTIA 2EMXA 2YRHA 2WCC3 2EMAA 2EPRA 2EQ3A 2EMZA 4R2QA 2EPZA 1ZAAC 2EM2A 3M99B 2DLQA 1DGCA 1A1IA 3EPJA 2EM3A 2RSIA 2MKDA 2EMLA 2EOYA 4R2DA 2I13A 2LV2A 2EPAA 2JPAA 2HGHA 2LO3A 2EOOA 1X3CA 2EOZA 2EM7A 1ZU1A 2GHFA 4F2JC 2NABA 2YTEA 5KL4A 1BB8A 3UK3C 2EMHA 2EN6A 2EPXA 4WSGA 2YU8A 4F6NA 2ENCA 2EN1A 2DLKA 2EPCA 2D9HA 2EOSA 1X6FA 1A1JA 1LLMC 2R1FA 2ENAA 5KL5A 1A1GA 2YTFA 2EMCA 2WBSA 1P47A 2RPCA 1Z1BA 2MKNA 1TN9A 2PRTA 2EMYA 1X6EA 1UN6B 2EPPA 2WBTA 4X9JA 2A25A 2M9AA 1RMDA 2EOQA 3VHTB 2EM9A 2DGCA 2EOMA 1A1KA 4IS1C 2EOFA 4R2AA 2EMGA 1F2IG 2EOEA 3EPLA 2EN8A 2EL6A 2YTQA 2YTJA 2EOIA 2YSOA 1NCSA 2EN7A 4IJDA 2DRPA 2EM5A 2ELYA 2EMKA 2GLIA 2EOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2F C;  1G2D C;  1JK2 A;  1TF3 A;  3EPH A;  2EMF A;  4R2S A;  2CSH A;  2JP9 A;  2EL4 A;  2EMW A;  2EOR A;  2J7J A;  2EM8 A;  2YRM A;  5KL6 A;  2EOJ A;  2EPU A;  2YTO A;  3EPK A;  5KL7 A;  1ZR9 A;  2EM4 A;  2LVH A;  2EJ4 A;  2YTN A;  2DMI A;  2YTD A;  2WBU A;  4M9V C;  2EM6 A;  2E72 A;  1BBO A;  2EP3 A;  4R2E A;  1A1F A;  2CT1 A;  1X5W A;  1X6H A;  2MDG A;  3MHS C;  1AAY A;  1YUJ A;  1A1L A;  1MEY C;  5KL2 A;  1UBD C;  2EN4 A;  5KL3 A;  2YTG A;  4R2P A;  2EN2 A;  2EQ1 A;  2BB8 A;  1WJP A;  3MHH C;  2YSP A;  2ADR A;  2LCE A;  4F6M A;  1YUI A;  2LT7 A;  2VRD A;  2YTP A;  1TF6 A;  2EN3 A;  2EMI A;  4R2R A;  4GZN C;  2EL5 A;  1JK1 A;  1KJK A;  2YU5 A;  2YRK A;  4R2C A;  2EMB A;  2EM0 A;  2ENH A;  2EQ0 A;  4FK5 C;  1B69 A;  1YSA C;  2EE8 A;  2CTD A;  2ELZ A;  2EOH A;  1A1H A;  2YTI A;  2EMX A;  2YRH A;  2WCC 3;  2EMA A;  2EPR A;  2EQ3 A;  2EMZ A;  4R2Q A;  2EPZ A;  1ZAA C;  2EM2 A;  3M99 B;  2DLQ A;  1DGC A;  1A1I A;  3EPJ A;  2EM3 A;  2RSI A;  2MKD A;  2EML A;  2EOY A;  4R2D A;  2I13 A;  2LV2 A;  2EPA A;  2JPA A;  2HGH A;  2LO3 A;  2EOO A;  1X3C A;  2EOZ A;  2EM7 A;  1ZU1 A;  2GHF A;  4F2J C;  2NAB A;  2YTE A;  5KL4 A;  1BB8 A;  3UK3 C;  2EMH A;  2EN6 A;  2EPX A;  4WSG A;  2YU8 A;  4F6N A;  2ENC A;  2EN1 A;  2DLK A;  2EPC A;  2D9H A;  2EOS A;  1X6F A;  1A1J A;  1LLM C;  2R1F A;  2ENA A;  5KL5 A;  1A1G A;  2YTF A;  2EMC A;  2WBS A;  1P47 A;  2RPC A;  1Z1B A;  2MKN A;  1TN9 A;  2PRT A;  2EMY A;  1X6E A;  1UN6 B;  2EPP A;  2WBT A;  4X9J A;  2A25 A;  2M9A A;  1RMD A;  2EOQ A;  3VHT B;  2EM9 A;  2DGC A;  2EOM A;  1A1K A;  4IS1 C;  2EOF A;  4R2A A;  2EMG A;  1F2I G;  2EOE A;  3EPL A;  2EN8 A;  2EL6 A;  2YTQ A;  2YTJ A;  2EOI A;  2YSO A;  1NCS A;  2EN7 A;  4IJD A;  2DRP A;  2EM5 A;  2ELY A;  2EMK A;  2GLI A;  2EOX A; 
#chains in the Genus database with same CATH topology
 3KZY A;  2LTS A;  3EPH A;  2EMF A;  4O5G A;  1XNR E;  2RTX A;  4LU9 A;  2EM8 A;  4DR4 E;  4KHP E;  4DV2 E;  4ZYH A;  4B3T E;  4GKJ E;  3L00 A;  2L3C A;  1KYQ A;  2YT4 A;  1T4L B;  2F4V E;  5AC4 A;  1IBM E;  5CFF E;  4BBY A;  1UIL A;  5A6A A;  4NXM E;  1YUJ A;  3DJW A;  2V83 A;  1MEY C;  1YFH A;  2I9I A;  1N3G A;  2YTG A;  4DV1 E;  2HC5 A;  2B9D A;  5LL6 R;  4R2P A;  2EN2 A;  2V86 A;  3MHH C;  4BHC A;  4WX9 A;  4B3M E;  1DQ3 A;  5LMN E;  2YTP A;  1TF6 A;  2EN3 A;  1KJK A;  3IWD A;  4JI4 E;  4JI6 E;  4R2C A;  2EMB A;  4FK5 C;  1B69 A;  1YSA C;  2EMX A;  2JY9 A;  4WYQ B;  2VE7 C;  5T6J A;  4TUG A;  3VK6 A;  1ZAA C;  1FJG E;  1AH5 A;  2DLQ A;  3J7Y p;  2V88 A;  2F8B A;  2VQF E;  2JR1 A;  3EPJ A;  5AAS A;  2EM3 A;  2IHR 1;  5A6B A;  2EOY A;  4DV6 E;  5LLQ A;  1IMU A;  2EPA A;  2HGH A;  3C6K A;  2EOO A;  1X3C A;  2DIX A;  3JU0 A;  5FLX C;  1ZU1 A;  5A2Q C;  3UK3 C;  2EMH A;  3FIG A;  4NZV A;  2LUQ A;  4L5N C;  4LF9 E;  2VF1 A;  2LMZ A;  3ADI A;  1STU A;  2D9H A;  3HPZ A;  1YYO A;  1WHN A;  2ENA A;  1BBG A;  4BC9 A;  4LFA E;  1A1G A;  1IQO A;  1WRJ A;  3THO B;  4AQY E;  4DV7 E;  4ZYG A;  1Z1B A;  4JI2 E;  3BID A;  1PJS A;  4JI5 E;  4DR6 E;  1UN6 B;  5A69 A;  2A25 A;  2M9A A;  3VHT B;  2NA2 A;  4WXD A;  3J80 C;  4JYA E;  2EOF A;  2EMG A;  4P7D A;  2EL6 A;  2YTQ A;  3KWR A;  2YTJ A;  2EOI A;  2L92 A;  4LFB E;  2B7T A;  1G2F C;  1X47 A;  5A6J A;  1WHQ A;  2CSH A;  4X8W A;  2JVA A;  2EL4 A;  2YRM A;  2ODR C;  5IV8 B;  5A6K A;  1ZR9 A;  2EM4 A;  3MSW A;  2LVH A;  1QNT A;  2YTN A;  2DMI A;  2ZM6 E;  3RMP A;  1HR0 E;  2EM6 A;  3BF2 A;  2KON A;  4JI0 E;  4JI7 E;  1PJQ A;  2DMY A;  1X6H A;  2MDG A;  2LJH A;  4LFC E;  2YPN A;  2EN4 A;  5KL3 A;  5ADZ A;  4DMI A;  4DR3 E;  2YSP A;  2ADR A;  4X64 E;  4LF6 E;  3ADG A;  1RQ0 A;  2LCE A;  1YUI A;  4NHR A;  1DI2 A;  2VRD A;  2UUB E;  2H36 X;  3F6G A;  4F9A B;  4GZN C;  1JK1 A;  4DKK A;  2LJU A;  2YU5 A;  1YZ9 A;  4M30 A;  1RC7 A;  2EQ0 A;  2EOH A;  1A1H A;  1X48 A;  2LE2 A;  2YTI A;  3HPS A;  5AE2 A;  3OTO E;  4M0V A;  5IWA E;  4YHH E;  1NEI A;  2ODR D;  4NXN E;  2EM2 A;  3AV0 A;  1A1I A;  1UHZ A;  3H09 A;  1X49 A;  1XNQ E;  2LRS A;  4GEQ B;  2YWQ A;  2GHF A;  2EM7 A;  2KHX A;  2Q8U A;  4F2J C;  2K4V A;  5IT9 C;  1ZBT A;  4WSG A;  2E5L E;  1HNW E;  2EN1 A;  4JV5 E;  2EPC A;  2EOS A;  1X6F A;  2V87 A;  2R1F A;  1EH7 A;  1N33 E;  2RPC A;  2V89 A;  2MC6 A;  3T1Y E;  2E1M A;  2HJJ A;  2MDR A;  3P1X A;  2NUG A;  4BCA A;  3IWC A;  2RSM A;  2EOQ A;  4OOG C;  2EOE A;  2LTR A;  4Q28 A;  3TQM A;  4WXC A;  1NCS A;  4IJD A;  5AE3 A;  2EM5 A;  2UUC E;  2N3G A;  2EMK A;  2ELY A;  2CPN A;  1SR9 A;  1G2D C;  1JK2 A;  1TF3 A;  4HTG A;  2FTX B;  4GKK E;  2EOR A;  5KL6 A;  4BHB A;  4HEI A;  2EPU A;  2YTO A;  3EPK A;  2NUE A;  5KL7 A;  2M4I A;  4MLV A;  1EH6 A;  2RQL A;  3ECR A;  2EJ4 A;  4O43 A;  2YTD A;  2WBU A;  1BBO A;  2GPI A;  4R2E A;  3J81 C;  2B3T B;  3K6Q A;  4X66 E;  1UBD C;  5DNY A;  4DUZ E;  2EPO A;  3LLH A;  3QG5 C;  1N34 E;  2EQ1 A;  3VYX A;  2BB8 A;  1WJP A;  2N3H A;  3JAM C;  2UU9 E;  4TUI A;  4F6M A;  1YYW A;  2LT7 A;  3HTX A;  2EPM X;  2EMI A;  2L2M A;  4LF5 E;  4X65 E;  2EZ6 A;  2CTD A;  4M2Z A;  4O24 A;  1GTK A;  1IBL E;  2YRH A;  2WCC 3;  2EMA A;  2EQ3 A;  4RHB B;  4BMJ A;  2EMZ A;  2EPK X;  4R2Q A;  2EPZ A;  2JXP A;  3M99 B;  1DGC A;  2UXC E;  1I94 E;  2RSI A;  2EML A;  2JOX A;  2I13 A;  2LV2 A;  3KZZ A;  2JPA A;  4LTY A;  2LO3 A;  2YZT A;  2EOZ A;  4I8O A;  4DR7 E;  1BB8 A;  2YTE A;  2YU8 A;  2FV4 B;  5IXM B;  2UUA E;  4WFT A;  1A1J A;  4DR2 E;  2JWO A;  2YTF A;  3JTZ A;  4BC7 A;  4B3S E;  1WXR A;  1P47 A;  2WZO A;  1TN9 A;  2PRT A;  2EMY A;  3AUZ A;  3ADL A;  1X6E A;  1YPN A;  4WPY A;  4JI3 E;  3C6M A;  3BBG A;  2LBS B;  4DV3 E;  2EOM A;  1A1K A;  3HQ1 A;  4F54 A;  4R2A A;  5AC5 A;  4DR5 E;  1F2I G;  2DSY A;  4O4K A;  3EQ1 A;  2YSO A;  5F3W A;  2EN7 A;  2DRP A;  2DB2 A;  1HNX E;  1N36 E;  5AE1 A;  4F6N A;  1T4N A;  2L2K B;  1J5E E;  3HXL A;  3C4T A;  4LF4 E;  4R2S A;  4KZS A;  2JP9 A;  4DR1 E;  2VQE E;  2EMW A;  4JI8 E;  2J7J A;  1ZBQ A;  1O0W A;  2EOJ A;  4JI1 E;  1QU6 A;  5LMU E;  1SFE A;  2M7Q A;  4M9V C;  2E72 A;  2EP3 A;  1A1F A;  2CT1 A;  1X5W A;  2UXB E;  2UXD E;  5TSE A;  4ZYD A;  3MHS C;  1AAY A;  1A1L A;  2V85 A;  1GQE A;  2L3J A;  2RS7 A;  2RS6 A;  5KL2 A;  2L2N A;  4BS9 A;  2JOB A;  2NUF A;  4DV0 E;  1T39 A;  4DUY E;  4LF7 E;  3DF6 A;  3ADJ A;  4WSP A;  1MGT A;  1PJT A;  2V8Q B;  4R2R A;  4X62 E;  2EL5 A;  4OX9 E;  4R8O A;  4KWY A;  4DV5 E;  2G7H A;  2YRK A;  2B7V A;  2EM0 A;  2ENH A;  4L8N A;  2EPL X;  1IQS A;  2EE8 A;  2EPN A;  1PKP A;  2ELZ A;  2JYA A;  1YYK A;  3C4B A;  1PDA A;  3ZOQ B;  2EPR A;  2M1S A;  2L33 A;  2LUP B;  1L4S A;  4B3R E;  1EKZ A;  3LML A;  4RH8 A;  2MKD A;  1N32 E;  1T4O A;  2R76 A;  1EH8 A;  3J7A G;  4YY3 E;  4R2D A;  1GZ6 A;  2L6M A;  2MC5 A;  2NAB A;  5KL4 A;  1IBK E;  4N4R B;  2EN6 A;  2EPX A;  4LF8 E;  1J26 A;  2ENC A;  2DLK A;  4F9C B;  1LLM C;  4J8Z A;  4K0K E;  4R03 A;  2L8T A;  3THN A;  4MLQ A;  5KL5 A;  3OML A;  2EMC A;  2WBS A;  1FKA E;  2MKN A;  2HHH E;  2KOU A;  1XMQ E;  2EWL A;  2EPP A;  2WBT A;  4Q35 B;  4X9J A;  1RMD A;  3IWB A;  2BBG A;  2EM9 A;  3T1H E;  2DGC A;  3BGH A;  2N8X A;  4P78 A;  4IS1 C;  4ZYE A;  4F9B B;  3EPL A;  2EN8 A;  4DV4 E;  2FGG A;  5BR8 E;  5A6B D;  3VYY A;  3F6H A;  2K7I A;  1T38 A;  1HNZ E;  1XMO E;  2GLI A;  2EOX A; 
#chains in the Genus database with same CATH homology
 1G2F C;  1G2D C;  1JK2 A;  1TF3 A;  3EPH A;  2EMF A;  4R2S A;  2CSH A;  2JP9 A;  2EL4 A;  2EMW A;  2EOR A;  2J7J A;  2EM8 A;  2YRM A;  5KL6 A;  2EOJ A;  2EPU A;  2YTO A;  3EPK A;  5KL7 A;  1ZR9 A;  2EM4 A;  2LVH A;  2EJ4 A;  2YTN A;  2DMI A;  2YTD A;  2WBU A;  4M9V C;  2EM6 A;  2E72 A;  1BBO A;  2EP3 A;  4R2E A;  1A1F A;  2CT1 A;  1X5W A;  1X6H A;  2MDG A;  3MHS C;  1AAY A;  1YUJ A;  1A1L A;  1MEY C;  5KL2 A;  1UBD C;  2EN4 A;  5KL3 A;  2YTG A;  4R2P A;  2EN2 A;  2EQ1 A;  2BB8 A;  1WJP A;  3MHH C;  2YSP A;  2ADR A;  2LCE A;  4F6M A;  1YUI A;  2LT7 A;  2VRD A;  2YTP A;  1TF6 A;  2EN3 A;  2EMI A;  4R2R A;  4GZN C;  2EL5 A;  1JK1 A;  1KJK A;  2YU5 A;  2YRK A;  4R2C A;  2EMB A;  2EM0 A;  2ENH A;  2EQ0 A;  4FK5 C;  1B69 A;  1YSA C;  2EE8 A;  2CTD A;  2ELZ A;  2EOH A;  1A1H A;  2YTI A;  2EMX A;  2YRH A;  2WCC 3;  2EMA A;  2EPR A;  2EQ3 A;  2EMZ A;  4R2Q A;  2EPZ A;  1ZAA C;  2EM2 A;  3M99 B;  2DLQ A;  1DGC A;  1A1I A;  3EPJ A;  2EM3 A;  2RSI A;  2MKD A;  2EML A;  2EOY A;  4R2D A;  2I13 A;  2LV2 A;  2EPA A;  2JPA A;  2HGH A;  2LO3 A;  2EOO A;  1X3C A;  2EOZ A;  2EM7 A;  1ZU1 A;  2GHF A;  4F2J C;  2NAB A;  2YTE A;  5KL4 A;  1BB8 A;  3UK3 C;  2EMH A;  2EN6 A;  2EPX A;  4WSG A;  2YU8 A;  4F6N A;  2ENC A;  2EN1 A;  2DLK A;  2EPC A;  2D9H A;  2EOS A;  1X6F A;  1A1J A;  1LLM C;  2R1F A;  2ENA A;  5KL5 A;  1A1G A;  2YTF A;  2EMC A;  2WBS A;  1P47 A;  2RPC A;  1Z1B A;  2MKN A;  1TN9 A;  2PRT A;  2EMY A;  1X6E A;  1UN6 B;  2EPP A;  2WBT A;  4X9J A;  2A25 A;  2M9A A;  1RMD A;  2EOQ A;  3VHT B;  2EM9 A;  2DGC A;  2EOM A;  1A1K A;  4IS1 C;  2EOF A;  4R2A A;  2EMG A;  1F2I G;  2EOE A;  3EPL A;  2EN8 A;  2EL6 A;  2YTQ A;  2YTJ A;  2EOI A;  2YSO A;  1NCS A;  2EN7 A;  4IJD A;  2DRP A;  2EM5 A;  2ELY A;  2EMK A;  2GLI A;  2EOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...