2FTXB

Crystal structure of the yeast kinetochore spc24/spc25 globular domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
59
structure length
59
Chain Sequence
b'ANENILKLKLYRSLGVILDLENDQVLINRKNDGNIDILPLDNNLSDFYKTKYIWERLGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypothetical 25.2 kDa protein in AFG3-SEB2 intergenic region
publication title Atomic Structure of the kinetochore Spc24p/Spc25p globular domain reveals a novel fold
rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein, protein binding
total genus 15
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.430 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ftxB00
5T6JA 4GEQB 2FTXB 2FV4B
chains in the Genus database with same CATH superfamily
1XNRE 4DMIA 1X6EA 2MC6A 3HQ1A 1XMOE 4B3SE 2EL6A 2JWOA 2EPXA 4JV5E 2VRDA 2NA2A 4N4RB 3ADJA 4JI7E 4LFBE 1WHQA 4GEQB 2DLQA 2M9AA 2L2MA 2LT7A 1EH7A 4ZYGA 1BBOA 1RMDA 2EMKA 2YT4A 4R2CA 1IBKE 2ODRD 4TUGA 2V8QB 2EN4A 4YY3E 2EQ3A 3VYYA 2ODRC 2EM0A 1UILA 4BBYA 1X6FA 4X8WA 1MGTA 4DV6E 2L6MA 3VYXA 1G2FC 3C4TA 3MSWA 4R2SA 1X49A 2YTPA 4DV4E 1N32E 5KL2A 3J81C 5AE3A 2EL4A 4B3TE 4NZVA 1IQSA 2EL5A 2EMWA 2I9IA 2LO3A 4JI8E 3HXLA 2V88A 2EN2A 3HPSA 3P1XA 4M30A 2DSYA 5LMNE 4WX9A 2EMZA 3MHSC 1X47A 2RSIA 3LLHA 2GPIA 5KL7A 1WHNA 2UUBE 2EOXA 2EPLX 1PDAA 2ZM6E 3OTOE 4BS9A 2EM7A 1O0WA 2LBSB 2EPAA 3J7Yp 2EPKX 4JYAE 2D9HA 1RC7A 1GZ6A 4F2JC 3KWRA 2H36X 1ZU1A 2YRKA 2EMFA 4I8OA 4X9JA 2LJUA 3BF2A 3KZZA 2EWLA 1PJSA 2EOMA 2VE7C 1ZBQA 2LTSA 2EQ1A 1HNWE 4DR2E 2UXBE 2EOOA 2EPNA 4AQYE 2LVHA 3AUZA 1HNZE 4KWYA 2WBUA 1P47A 2J7JA 1A1LA 5IV8B 2EOZA 2WCC3 2EMIA 4OOGC 2JR1A 4LF9E 2EN7A 2LE2A 2MDRA 4F9CB 5IWAE 4O5GA 4L8NA 1YZ9A 2YTGA 2L2KB 2NUEA 4R2EA 2CPNA 5LLQA 1PKPA 2UXCE 4OX9E 2F4VE 2YTDA 2JPAA 4DV3E 4DR3E 4F6NA 2ELZA 3EPHA 4WXDA 2EOQA 5FLXC 1A1HA 4M9VC 2N3HA 3FIGA 4M2ZA 4BC9A 2EZ6A 2EJ4A 5AASA 2LTRA 4NHRA 1QU6A 2B3TB 1A1JA 2EM3A 2DMYA 1A1IA 1DI2A 2LUPB 2LMZA 2JOXA 3RMPA 2L2NA 3C4BA 5IXMB 2L3CA 5A6JA 2Q8UA 3T1YE 2EORA 4P7DA 2EOHA 4DR1E 1YYWA 5BR8E 4JI3E 2KHXA 2YWQA 1YPNA 2EOEA 4L5NC 1BBGA 2RTXA 3ADIA 3IWDA 2HHHE 5KL4A 2HJJA 3DF6A 5AE1A 3HPZA 4ZYEA 3EPLA 2V86A 4LU9A 3EPJA 2UUCE 2EN8A 4M0VA 2YRMA 2ADRA 2V85A 2YTIA 2EM8A 3EPKA 1X5WA 2YU5A 2YRHA 5KL6A 5A6BA 5F3WA 4GZNC 4DV7E 1YYOA 4IS1C 2RSMA 3F6GA 4DKKA 4DR7E 1ZR9A 2EM9A 2N3GA 2MKDA 4X64E 3LMLA 2LJHA 2MC5A 2KOUA 2GLIA 5A6BD 2JP9A 4LF6E 2B9DA 4LTYA 2EE8A 2V87A 1WXRA 4RHBB 3J80C 2K7IA 3IWBA 1ZBTA 2EPRA 2JOBA 2EMLA 4J8ZA 1EKZA 2N8XA 2YTEA 4LF5E 2R76A 2MKNA 2WZOA 2JXPA 3H09A 2V89A 2FV4B 4LFAE 4LFCE 1IQOA 4O4KA 1JK2A 1STUA 4R2AA 1AH5A 2EPOA 3M99B 2M7QA 2KONA 1EH8A 2BBGA 2ENAA 2EPMX 4Q28A 2VF1A 2A25A 2JYAA 4R2DA 3OMLA 4X66E 2EMYA 4ZYDA 1X6HA 2EOIA 4YHHE 2RS7A 2CT1A 1B69A 4JI6E 2EN1A 1ZAAC 1YYKA 1A1GA 5KL5A 2JY9A 4IJDA 1KJKA 1IBLE 1XNQE 2LV2A 3T1HE 4DR5E 4BHBA 5AC4A 5KL3A 5LMUE 4HEIA 2UU9E 4GKKE 2LRSA 4NXNE 4BC7A 4LF7E 1J5EE 2EPUA 4O24A 3C6MA 2EQ0A 4DV2E 2EM6A 2L8TA 1JK1A 2B7VA 2EOFA 1IBME 1FJGE 3C6KA 1T4OA 2M4IA 4JI5E 4MLVA 2HC5A 4JI1E 1DGCA 4MLQA 5A6AA 1J26A 2EP3A 1N34E 4JI4E 4B3ME 2EMHA 4KZSA 4DUZE 1N36E 1PJTA 5A6KA 1LLMC 1GTKA 4TUIA 4WFTA 2E72A 2YPNA 1T4LB 2EOYA 1HNXE 1G2DC 2EMXA 2F8BA 3BGHA 2ELYA 5CFFE 4R2QA 3KZYA 2EOSA 5A69A 2JVAA 5AE2A 1X3CA 2YTQA 3DJWA 4KHPE 5IT9C 4FK5C 2CTDA 3F6HA 1XMQE 1TF3A 3JTZA 4X62E 2YTOA 1UHZA 2M1SA 4DV0E 2E5LE 4K0KE 2E1MA 3AV0A 1I94E 1AAYA 3ECRA 2WBSA 2EN3A 4R8OA 2MDGA 1FKAE 1YFHA 1TN9A 3K6QA 2CSHA 4F9BB 1YUJA 3HTXA 2ENCA 2DRPA 2B7TA 4R03A 1DQ3A 3THOB 2EPPA 2NUGA 3JU0A 2DLKA 4BHCA 3IWCA 5A2QC 2K4VA 4WSGA 4B3RE 4DR4E 2VQEE 4JI0E 4LF4E 2LCEA 4DR6E 4WSPA 2UXDE 4Q35B 3VHTB 2DB2A 2YSPA 4WXCA 1PJQA 4R2RA 2V83A 1A1FA 2EM5A 3BBGA 5TSEA 4F54A 4GKJE 1NCSA 2ENHA 2EM4A 3THNA 2DGCA 4WYQB 1WRJA 1L4SA 4F9AB 2WBTA 1N33E 2G7HA 1KYQA 1IMUA 3ADLA 3JAMC 2VQFE 1UN6B 3MHHC 1T4NA 4R2PA 2YSOA 2EOJA 4BMJA 1WJPA 5AC5A 2I13A 1GQEA 5LL6R 4X65E 5ADZA 3J7AG 4O43A 4HTGA 5DNYA 2DMIA 3L00A 2FTXB 2R1FA 2HGHA 2RPCA 1SFEA 2EN6A 2LUQA 4RH8A 2EM2A 1T38A 1RQ0A 2YTNA 2EPCA 2RS6A 3QG5C 2YZTA 2EMBA 1YUIA 1TF6A 2L33A 2YTFA 4BCAA 3BIDA 1BB8A 2EMCA 1EH6A 4WPYA 2UUAE 1NEIA 1A1KA 1HR0E 3ADGA 4ZYHA 1MEYC 3ZOQB 2EMAA 1QNTA 2BB8A 3UK3C 1UBDC 2GHFA 3TQMA 4F6MA 1N3GA 2YTJA 2DIXA 5T6JA 3VK6A 1T39A 4P78A 2L3JA 2IHR1 2NABA 4DV5E 2L92A 4NXME 4JI2E 2FGGA 4DUYE 4LF8E 2EPZA 1SR9A 2RQLA 1Z1BA 2NUFA 3EQ1A 2EMGA 2YU8A 2PRTA 1YSAC 4DV1E 1X48A 1F2IG
chains in the Genus database with same CATH topology
1XNRE 4DMIA 2MC6A 3HQ1A 4F9CB 2B7TA 2FV4B 2V89A 4R03A 5IWAE 1XMOE 4B3SE 1DQ3A 2JWOA 4LFAE 4L8NA 1YZ9A 1STUA 2M7QA 2NUGA 2KONA 3JU0A 4JV5E 2L2KB 2NUEA 2CPNA 2NA2A 4LF9E 3IWCA 3ADJA 1PKPA 5A2QC 2UXCE 4JI7E 2K4VA 4OX9E 4Q28A 2F4VE 4B3RE 2VF1A 4DR4E 4LFBE 2VQEE 4DV3E 1WHQA 4JI0E 4LF4E 4DR3E 4GEQB 3OMLA 4X66E 4DR6E 2L2MA 4WSPA 2UXDE 5FLXC 2DB2A 2RS7A 4YHHE 4JI6E 2V83A 2YT4A 1IBKE 2N3HA 2ODRD 3FIGA 4TUGA 4M2ZA 2V8QB 4BC9A 1YYKA 2EZ6A 4F54A 4GKJE 2JY9A 4YY3E 3VYYA 5AASA 1IBLE 1XNQE 4WYQB 3T1HE 2ODRC 2LTRA 4F9AB 1QU6A 2B3TB 4DR5E 1UILA 2G7HA 1N33E 4BBYA 2DMYA 4X8WA 5LMUE 3ADLA 4DV6E 2LUPB 2L6MA 2JOXA 2LMZA 3RMPA 3JAMC 3VYXA 1DI2A 2VQFE 3C4TA 3MSWA 1X49A 1T4NA 2L2NA 3C4BA 4DV4E 2UU9E 1N32E 4GKKE 3J81C 5AE3A 2LRSA 4BMJA 2L3CA 2E5LE 4NXNE 4BC7A 3T1YE 4P7DA 4B3TE 4LF7E 4DR1E 1GQEA 1J5EE 5LL6R 4X65E 1YYWA 5BR8E 5ADZA 4JI8E 3HXLA 3J7AG 2V88A 3HPSA 3P1XA 4M30A 4DV2E 4JI3E 2DSYA 5DNYA 2L8TA 2KHXA 2FTXB 5LMNE 2B7VA 1IBME 2LUQA 1FJGE 1X47A 3LLHA 4L5NC 1T4OA 1RQ0A 1WHNA 2M4IA 4JI5E 2UUBE 2RTXA 3ADIA 4JI1E 3IWDA 2HHHE 2ZM6E 2RS6A 3DF6A 3HPZA 5AE1A 1N34E 4JI4E 1J26A 2V86A 4B3ME 4LU9A 4KZSA 4DUZE 2YZTA 4M0VA 2UUCE 1N36E 3H09A 3OTOE 4TUIA 2L33A 2V85A 4BS9A 4WFTA 1O0WA 4BCAA 2LBSB 1T4LB 4WPYA 3J7Yp 2UUAE 1HNXE 4JYAE 1RC7A 1HR0E 1GZ6A 2F8BA 3ADGA 3KWRA 4DV7E 2H36X 5F3WA 5CFFE 1YYOA 3ZOQB 4LFCE 4I8OA 2RSMA 2JVAA 3F6GA 4DKKA 5AE2A 4DR7E 2N3GA 2EWLA 4X64E 3LMLA 3DJWA 4K0KE 5IT9C 4KHPE 2LJHA 1ZBQA 2VE7C 2LTSA 2MC5A 2KOUA 2DIXA 3F6HA 5T6JA 1XMQE 1HNWE 3VK6A 4P78A 4DR2E 2UXBE 4LF6E 3JTZA 2B9DA 4X62E 1UHZA 2M1SA 2L3JA 2IHR1 4LTYA 4DV0E 2V87A 1WXRA 4DV5E 2L92A 3AUZA 2E1MA 3J80C 4AQYE 3AV0A 3IWBA 1I94E 1HNZE 4JI2E 1ZBTA 4NXME 2FGGA 4R8OA 2JOBA 4DUYE 4LF8E 1FKAE 4J8ZA 1SR9A 3K6QA 1EKZA 2NUFA 4F9BB 4LF5E 3HTXA 2WZOA 4OOGC 2JR1A 4DV1E 1X48A 2LE2A 2MDRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T6J A;  4GEQ B;  2FTX B;  2FV4 B; 
#chains in the Genus database with same CATH topology
 1XNR E;  4DMI A;  1X6E A;  2MC6 A;  3HQ1 A;  1XMO E;  4B3S E;  2EL6 A;  2JWO A;  2EPX A;  4JV5 E;  2VRD A;  2NA2 A;  4N4R B;  3ADJ A;  4JI7 E;  4LFB E;  1WHQ A;  4GEQ B;  2DLQ A;  2M9A A;  2L2M A;  2LT7 A;  1EH7 A;  4ZYG A;  1BBO A;  1RMD A;  2EMK A;  2YT4 A;  4R2C A;  1IBK E;  2ODR D;  4TUG A;  2V8Q B;  2EN4 A;  4YY3 E;  2EQ3 A;  3VYY A;  2ODR C;  2EM0 A;  1UIL A;  4BBY A;  1X6F A;  4X8W A;  1MGT A;  4DV6 E;  2L6M A;  3VYX A;  1G2F C;  3C4T A;  3MSW A;  4R2S A;  1X49 A;  2YTP A;  4DV4 E;  1N32 E;  5KL2 A;  3J81 C;  5AE3 A;  2EL4 A;  4B3T E;  4NZV A;  1IQS A;  2EL5 A;  2EMW A;  2I9I A;  2LO3 A;  4JI8 E;  3HXL A;  2V88 A;  2EN2 A;  3HPS A;  3P1X A;  4M30 A;  2DSY A;  5LMN E;  4WX9 A;  2EMZ A;  3MHS C;  1X47 A;  2RSI A;  3LLH A;  2GPI A;  5KL7 A;  1WHN A;  2UUB E;  2EOX A;  2EPL X;  1PDA A;  2ZM6 E;  3OTO E;  4BS9 A;  2EM7 A;  1O0W A;  2LBS B;  2EPA A;  3J7Y p;  2EPK X;  4JYA E;  2D9H A;  1RC7 A;  1GZ6 A;  4F2J C;  3KWR A;  2H36 X;  1ZU1 A;  2YRK A;  2EMF A;  4I8O A;  4X9J A;  2LJU A;  3BF2 A;  3KZZ A;  2EWL A;  1PJS A;  2EOM A;  2VE7 C;  1ZBQ A;  2LTS A;  2EQ1 A;  1HNW E;  4DR2 E;  2UXB E;  2EOO A;  2EPN A;  4AQY E;  2LVH A;  3AUZ A;  1HNZ E;  4KWY A;  2WBU A;  1P47 A;  2J7J A;  1A1L A;  5IV8 B;  2EOZ A;  2WCC 3;  2EMI A;  4OOG C;  2JR1 A;  4LF9 E;  2EN7 A;  2LE2 A;  2MDR A;  4F9C B;  5IWA E;  4O5G A;  4L8N A;  1YZ9 A;  2YTG A;  2L2K B;  2NUE A;  4R2E A;  2CPN A;  5LLQ A;  1PKP A;  2UXC E;  4OX9 E;  2F4V E;  2YTD A;  2JPA A;  4DV3 E;  4DR3 E;  4F6N A;  2ELZ A;  3EPH A;  4WXD A;  2EOQ A;  5FLX C;  1A1H A;  4M9V C;  2N3H A;  3FIG A;  4M2Z A;  4BC9 A;  2EZ6 A;  2EJ4 A;  5AAS A;  2LTR A;  4NHR A;  1QU6 A;  2B3T B;  1A1J A;  2EM3 A;  2DMY A;  1A1I A;  1DI2 A;  2LUP B;  2LMZ A;  2JOX A;  3RMP A;  2L2N A;  3C4B A;  5IXM B;  2L3C A;  5A6J A;  2Q8U A;  3T1Y E;  2EOR A;  4P7D A;  2EOH A;  4DR1 E;  1YYW A;  5BR8 E;  4JI3 E;  2KHX A;  2YWQ A;  1YPN A;  2EOE A;  4L5N C;  1BBG A;  2RTX A;  3ADI A;  3IWD A;  2HHH E;  5KL4 A;  2HJJ A;  3DF6 A;  5AE1 A;  3HPZ A;  4ZYE A;  3EPL A;  2V86 A;  4LU9 A;  3EPJ A;  2UUC E;  2EN8 A;  4M0V A;  2YRM A;  2ADR A;  2V85 A;  2YTI A;  2EM8 A;  3EPK A;  1X5W A;  2YU5 A;  2YRH A;  5KL6 A;  5A6B A;  5F3W A;  4GZN C;  4DV7 E;  1YYO A;  4IS1 C;  2RSM A;  3F6G A;  4DKK A;  4DR7 E;  1ZR9 A;  2EM9 A;  2N3G A;  2MKD A;  4X64 E;  3LML A;  2LJH A;  2MC5 A;  2KOU A;  2GLI A;  5A6B D;  2JP9 A;  4LF6 E;  2B9D A;  4LTY A;  2EE8 A;  2V87 A;  1WXR A;  4RHB B;  3J80 C;  2K7I A;  3IWB A;  1ZBT A;  2EPR A;  2JOB A;  2EML A;  4J8Z A;  1EKZ A;  2N8X A;  2YTE A;  4LF5 E;  2R76 A;  2MKN A;  2WZO A;  2JXP A;  3H09 A;  2V89 A;  2FV4 B;  4LFA E;  4LFC E;  1IQO A;  4O4K A;  1JK2 A;  1STU A;  4R2A A;  1AH5 A;  2EPO A;  3M99 B;  2M7Q A;  2KON A;  1EH8 A;  2BBG A;  2ENA A;  2EPM X;  4Q28 A;  2VF1 A;  2A25 A;  2JYA A;  4R2D A;  3OML A;  4X66 E;  2EMY A;  4ZYD A;  1X6H A;  2EOI A;  4YHH E;  2RS7 A;  2CT1 A;  1B69 A;  4JI6 E;  2EN1 A;  1ZAA C;  1YYK A;  1A1G A;  5KL5 A;  2JY9 A;  4IJD A;  1KJK A;  1IBL E;  1XNQ E;  2LV2 A;  3T1H E;  4DR5 E;  4BHB A;  5AC4 A;  5KL3 A;  5LMU E;  4HEI A;  2UU9 E;  4GKK E;  2LRS A;  4NXN E;  4BC7 A;  4LF7 E;  1J5E E;  2EPU A;  4O24 A;  3C6M A;  2EQ0 A;  4DV2 E;  2EM6 A;  2L8T A;  1JK1 A;  2B7V A;  2EOF A;  1IBM E;  1FJG E;  3C6K A;  1T4O A;  2M4I A;  4JI5 E;  4MLV A;  2HC5 A;  4JI1 E;  1DGC A;  4MLQ A;  5A6A A;  1J26 A;  2EP3 A;  1N34 E;  4JI4 E;  4B3M E;  2EMH A;  4KZS A;  4DUZ E;  1N36 E;  1PJT A;  5A6K A;  1LLM C;  1GTK A;  4TUI A;  4WFT A;  2E72 A;  2YPN A;  1T4L B;  2EOY A;  1HNX E;  1G2D C;  2EMX A;  2F8B A;  3BGH A;  2ELY A;  5CFF E;  4R2Q A;  3KZY A;  2EOS A;  5A69 A;  2JVA A;  5AE2 A;  1X3C A;  2YTQ A;  3DJW A;  4KHP E;  5IT9 C;  4FK5 C;  2CTD A;  3F6H A;  1XMQ E;  1TF3 A;  3JTZ A;  4X62 E;  2YTO A;  1UHZ A;  2M1S A;  4DV0 E;  2E5L E;  4K0K E;  2E1M A;  3AV0 A;  1I94 E;  1AAY A;  3ECR A;  2WBS A;  2EN3 A;  4R8O A;  2MDG A;  1FKA E;  1YFH A;  1TN9 A;  3K6Q A;  2CSH A;  4F9B B;  1YUJ A;  3HTX A;  2ENC A;  2DRP A;  2B7T A;  4R03 A;  1DQ3 A;  3THO B;  2EPP A;  2NUG A;  3JU0 A;  2DLK A;  4BHC A;  3IWC A;  5A2Q C;  2K4V A;  4WSG A;  4B3R E;  4DR4 E;  2VQE E;  4JI0 E;  4LF4 E;  2LCE A;  4DR6 E;  4WSP A;  2UXD E;  4Q35 B;  3VHT B;  2DB2 A;  2YSP A;  4WXC A;  1PJQ A;  4R2R A;  2V83 A;  1A1F A;  2EM5 A;  3BBG A;  5TSE A;  4F54 A;  4GKJ E;  1NCS A;  2ENH A;  2EM4 A;  3THN A;  2DGC A;  4WYQ B;  1WRJ A;  1L4S A;  4F9A B;  2WBT A;  1N33 E;  2G7H A;  1KYQ A;  1IMU A;  3ADL A;  3JAM C;  2VQF E;  1UN6 B;  3MHH C;  1T4N A;  4R2P A;  2YSO A;  2EOJ A;  4BMJ A;  1WJP A;  5AC5 A;  2I13 A;  1GQE A;  5LL6 R;  4X65 E;  5ADZ A;  3J7A G;  4O43 A;  4HTG A;  5DNY A;  2DMI A;  3L00 A;  2FTX B;  2R1F A;  2HGH A;  2RPC A;  1SFE A;  2EN6 A;  2LUQ A;  4RH8 A;  2EM2 A;  1T38 A;  1RQ0 A;  2YTN A;  2EPC A;  2RS6 A;  3QG5 C;  2YZT A;  2EMB A;  1YUI A;  1TF6 A;  2L33 A;  2YTF A;  4BCA A;  3BID A;  1BB8 A;  2EMC A;  1EH6 A;  4WPY A;  2UUA E;  1NEI A;  1A1K A;  1HR0 E;  3ADG A;  4ZYH A;  1MEY C;  3ZOQ B;  2EMA A;  1QNT A;  2BB8 A;  3UK3 C;  1UBD C;  2GHF A;  3TQM A;  4F6M A;  1N3G A;  2YTJ A;  2DIX A;  5T6J A;  3VK6 A;  1T39 A;  4P78 A;  2L3J A;  2IHR 1;  2NAB A;  4DV5 E;  2L92 A;  4NXM E;  4JI2 E;  2FGG A;  4DUY E;  4LF8 E;  2EPZ A;  1SR9 A;  2RQL A;  1Z1B A;  2NUF A;  3EQ1 A;  2EMG A;  2YU8 A;  2PRT A;  1YSA C;  4DV1 E;  1X48 A;  1F2I G; 
#chains in the Genus database with same CATH homology
 1XNR E;  4DMI A;  2MC6 A;  3HQ1 A;  4F9C B;  2B7T A;  2FV4 B;  2V89 A;  4R03 A;  5IWA E;  1XMO E;  4B3S E;  1DQ3 A;  2JWO A;  4LFA E;  4L8N A;  1YZ9 A;  1STU A;  2M7Q A;  2NUG A;  2KON A;  3JU0 A;  4JV5 E;  2L2K B;  2NUE A;  2CPN A;  2NA2 A;  4LF9 E;  3IWC A;  3ADJ A;  1PKP A;  5A2Q C;  2UXC E;  4JI7 E;  2K4V A;  4OX9 E;  4Q28 A;  2F4V E;  4B3R E;  2VF1 A;  4DR4 E;  4LFB E;  2VQE E;  4DV3 E;  1WHQ A;  4JI0 E;  4LF4 E;  4DR3 E;  4GEQ B;  3OML A;  4X66 E;  4DR6 E;  2L2M A;  4WSP A;  2UXD E;  5FLX C;  2DB2 A;  2RS7 A;  4YHH E;  4JI6 E;  2V83 A;  2YT4 A;  1IBK E;  2N3H A;  2ODR D;  3FIG A;  4TUG A;  4M2Z A;  2V8Q B;  4BC9 A;  1YYK A;  2EZ6 A;  4F54 A;  4GKJ E;  2JY9 A;  4YY3 E;  3VYY A;  5AAS A;  1IBL E;  1XNQ E;  4WYQ B;  3T1H E;  2ODR C;  2LTR A;  4F9A B;  1QU6 A;  2B3T B;  4DR5 E;  1UIL A;  2G7H A;  1N33 E;  4BBY A;  2DMY A;  4X8W A;  5LMU E;  3ADL A;  4DV6 E;  2LUP B;  2L6M A;  2JOX A;  2LMZ A;  3RMP A;  3JAM C;  3VYX A;  1DI2 A;  2VQF E;  3C4T A;  3MSW A;  1X49 A;  1T4N A;  2L2N A;  3C4B A;  4DV4 E;  2UU9 E;  1N32 E;  4GKK E;  3J81 C;  5AE3 A;  2LRS A;  4BMJ A;  2L3C A;  2E5L E;  4NXN E;  4BC7 A;  3T1Y E;  4P7D A;  4B3T E;  4LF7 E;  4DR1 E;  1GQE A;  1J5E E;  5LL6 R;  4X65 E;  1YYW A;  5BR8 E;  5ADZ A;  4JI8 E;  3HXL A;  3J7A G;  2V88 A;  3HPS A;  3P1X A;  4M30 A;  4DV2 E;  4JI3 E;  2DSY A;  5DNY A;  2L8T A;  2KHX A;  2FTX B;  5LMN E;  2B7V A;  1IBM E;  2LUQ A;  1FJG E;  1X47 A;  3LLH A;  4L5N C;  1T4O A;  1RQ0 A;  1WHN A;  2M4I A;  4JI5 E;  2UUB E;  2RTX A;  3ADI A;  4JI1 E;  3IWD A;  2HHH E;  2ZM6 E;  2RS6 A;  3DF6 A;  3HPZ A;  5AE1 A;  1N34 E;  4JI4 E;  1J26 A;  2V86 A;  4B3M E;  4LU9 A;  4KZS A;  4DUZ E;  2YZT A;  4M0V A;  2UUC E;  1N36 E;  3H09 A;  3OTO E;  4TUI A;  2L33 A;  2V85 A;  4BS9 A;  4WFT A;  1O0W A;  4BCA A;  2LBS B;  1T4L B;  4WPY A;  3J7Y p;  2UUA E;  1HNX E;  4JYA E;  1RC7 A;  1HR0 E;  1GZ6 A;  2F8B A;  3ADG A;  3KWR A;  4DV7 E;  2H36 X;  5F3W A;  5CFF E;  1YYO A;  3ZOQ B;  4LFC E;  4I8O A;  2RSM A;  2JVA A;  3F6G A;  4DKK A;  5AE2 A;  4DR7 E;  2N3G A;  2EWL A;  4X64 E;  3LML A;  3DJW A;  4K0K E;  5IT9 C;  4KHP E;  2LJH A;  1ZBQ A;  2VE7 C;  2LTS A;  2MC5 A;  2KOU A;  2DIX A;  3F6H A;  5T6J A;  1XMQ E;  1HNW E;  3VK6 A;  4P78 A;  4DR2 E;  2UXB E;  4LF6 E;  3JTZ A;  2B9D A;  4X62 E;  1UHZ A;  2M1S A;  2L3J A;  2IHR 1;  4LTY A;  4DV0 E;  2V87 A;  1WXR A;  4DV5 E;  2L92 A;  3AUZ A;  2E1M A;  3J80 C;  4AQY E;  3AV0 A;  3IWB A;  1I94 E;  1HNZ E;  4JI2 E;  1ZBT A;  4NXM E;  2FGG A;  4R8O A;  2JOB A;  4DUY E;  4LF8 E;  1FKA E;  4J8Z A;  1SR9 A;  3K6Q A;  1EKZ A;  2NUF A;  4F9B B;  4LF5 E;  3HTX A;  2WZO A;  4OOG C;  2JR1 A;  4DV1 E;  1X48 A;  2LE2 A;  2MDR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...