2FTXB

Crystal structure of the yeast kinetochore spc24/spc25 globular domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
59
structure length
59
Chain Sequence
ANENILKLKLYRSLGVILDLENDQVLINRKNDGNIDILPLDNNLSDFYKTKYIWERLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein, protein binding
molecule keywords Hypothetical 25.2 kDa protein in AFG3-SEB2 intergenic region
publication title Atomic Structure of the kinetochore Spc24p/Spc25p globular domain reveals a novel fold
rcsb
source organism Saccharomyces cerevisiae
total genus 15
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.430 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ftxB00
2FV4B 4GEQB 2FTXB 5T6JA
chains in the Genus database with same CATH superfamily
2CT1A 2RQLA 1X49A 2A25A 4TUGA 2JYAA 1IQOA 3JTZA 4B3TE 1IBKE 1KYQA 1J26A 2KOUA 1DGCA 2YRHA 2EOIA 3UK3C 1P47A 2EPKX 2ODRC 2EN6A 5CFFE 1IBME 1IQSA 4WSPA 2YRMA 4R2SA 4DR1E 4JI6E 1BB8A 2V87A 4BHCA 2WBTA 1FKAE 2PRTA 1J5EE 5KL6A 1PJQA 2J7JA 3JU0A 4X65E 4KWYA 4L8NA 1N36E 2EOSA 2NA2A 4R8OA 2EMAA 1YUJA 2DLQA 4LF5E 2LTRA 2EMKA 2ELYA 2DLKA 5AASA 4DV5E 3J81C 4Q35B 4R2EA 2K7IA 4WFTA 1NCSA 5AE3A 4F9BB 2ELZA 4RH8A 4R03A 5KL7A 5A6AA 2UXDE 4DUZE 4GKKE 1T4OA 2RSIA 3IWBA 3AUZA 3ADIA 3M99B 4R2RA 4YHHE 2EMYA 2R1FA 3ECRA 3HPZA 2MDGA 3HTXA 1BBGA 1JK1A 4HTGA 4LF6E 2NUEA 3THOB 4X9JA 2N8XA 4LFCE 2EMCA 1SR9A 4LF9E 2NABA 4BMJA 1EKZA 2F8BA 3C6MA 3LLHA 4LFBE 5AC5A 4JYAE 4F9CB 1T4NA 3T1YE 2KHXA 5AE2A 3HQ1A 4F2JC 3J80C 4JI3E 4LTYA 2VQEE 2EJ4A 5KL3A 1YSAC 3OMLA 2I9IA 4DV4E 2L8TA 5LLQA 2HJJA 4YY3E 2DSYA 1PDAA 4O43A 2EMZA 2NUGA 2M4IA 2M1SA 4WSGA 2EQ1A 1T39A 2ENCA 4JI4E 1YFHA 4LF7E 3IWDA 3BF2A 2EL6A 4JI5E 1LLMC 3MHSC 1FJGE 2V8QB 2EOXA 4GEQB 2YTEA 4X8WA 2EM8A 1TF6A 1Z1BA 1X5WA 1G2FC 2EPPA 2EOFA 2EPOA 1DI2A 5AE1A 2LVHA 1EH7A 2LMZA 1G2DC 2L92A 4DV0E 2G7HA 2YTJA 4TUIA 1WJPA 4P78A 1EH8A 2H36X 2KONA 4LU9A 3ADLA 2F4VE 2I13A 3DJWA 1ZBQA 4DR3E 2EN7A 2DB2A 1YYKA 1QNTA 2L3CA 1QU6A 4Q28A 1YYWA 2EN2A 2L3JA 1X6HA 3T1HE 2EORA 2EPRA 2ODRD 4WXCA 1HNZE 2IHR1 2VRDA 2JWOA 2HC5A 5ADZA 4M2ZA 2MKNA 3ADJA 1MEYC 3F6GA 4DR2E 1F2IG 1HNWE 4DR5E 2RSMA 1RQ0A 4R2AA 2B7TA 1PJTA 4NZVA 2LT7A 5DNYA 2YSPA 4F6MA 2GHFA 5A2QC 4MLQA 1ZBTA 2EOEA 4DV3E 2MKDA 1WHNA 1T4LB 2D9HA 2LV2A 3HPSA 2UXBE 2EPNA 4B3ME 2JPAA 2VF1A 1WRJA 1PKPA 3VYXA 4BBYA 4R2DA 2FTXB 2ADRA 2EMXA 1IBLE 2YT4A 3MSWA 4JI2E 3RMPA 1YUIA 4IS1C 2JP9A 1N33E 2JOXA 2HHHE 2ENHA 4WX9A 1SFEA 4B3SE 1TF3A 2EQ3A 4HEIA 3P1XA 1A1KA 2CPNA 3TQMA 4B3RE 5A6BD 3KZYA 4AQYE 5KL4A 1X6FA 1O0WA 2YTIA 2EZ6A 2EMBA 3EPJA 2YSOA 4F6NA 4JI0E 2YTQA 2GLIA 2RS7A 2UUCE 1A1FA 2NUFA 1X3CA 4NXNE 1GTKA 2DMIA 2EMGA 2LCEA 2UUAE 2E72A 2EPMX 2RS6A 2DMYA 5KL5A 5BR8E 2EPUA 4ZYDA 2YPNA 1IMUA 4DR4E 2YRKA 2EM0A 2ENAA 2LO3A 2EPLX 2EM3A 4M9VC 2EPZA 3FIGA 2EL4A 2Q8UA 2YU5A 2EM9A 2L33A 1X6EA 1UILA 5A6JA 2WBUA 3KZZA 1ZU1A 1BBOA 1N3GA 1PJSA 5LMNE 2FGGA 2EPAA 4GZNC 3C6KA 4NHRA 4F54A 1A1GA 2YU8A 2EOYA 2EMFA 4DV7E 4GKJE 1AH5A 4OOGC 4KHPE 4ZYHA 2L2MA 2YZTA 4BHBA 1XMQE 2MDRA 3LMLA 4X66E 2WCC3 1WXRA 3HXLA 2L2NA 3F6HA 1A1HA 2M9AA 3H09A 2V83A 4R2PA 1N34E 1X47A 1ZR9A 5LMUE 2EQ0A 5A6KA 2JY9A 4RHBB 5TSEA 2EN8A 2BB8A 1YPNA 2B3TB 4BC7A 4LFAE 2N3HA 2EM5A 4DV6E 4OX9E 4P7DA 2B9DA 4FK5C 3EPLA 2E1MA 3BBGA 2EN1A 2YWQA 4M30A 2LUQA 4WXDA 4X62E 1RC7A 4DUYE 1YZ9A 2EMWA 4KZSA 2EM7A 1TN9A 4DR6E 2UUBE 2GPIA 4X64E 2MC6A 1WHQA 3JAMC 3VYYA 1UN6B 2JOBA 1XNQE 1A1LA 4JI8E 4M0VA 4DV2E 1X48A 2LTSA 2L2KB 3MHHC 2B7VA 1XMOE 4JI7E 2FV4B 3DF6A 2WZOA 2MC5A 1DQ3A 2V86A 2EE8A 2LBSB 2HGHA 1A1IA 5AC4A 2LE2A 5KL2A 5FLXC 2V88A 2EP3A 4BCAA 5IWAE 1STUA 4NXME 3ZOQB 1YYOA 2YTPA 4N4RB 2K4VA 2RTXA 2LJUA 1N32E 4JV5E 3C4BA 2LJHA 4K0KE 2EOJA 1EH6A 2EPXA 2YTGA 3EPHA 3K6QA 4I8OA 1AAYA 2DRPA 4O24A 2EMHA 4LF4E 3L00A 2JVAA 2EMIA 2BBGA 2EM6A 4WYQB 5IT9C 3IWCA 2N3GA 4F9AB 3VK6A 5A69A 1HNXE 1I94E 1GZ6A 3J7Yp 4ZYEA 1NEIA 2EN3A 4R2CA 2EOMA 4O5GA 2VQFE 2YTOA 2UU9E 4IJDA 3BIDA 2DGCA 1HR0E 1RMDA 5IV8B 4WPYA 1T38A 2EL5A 4DV1E 2L6MA 2RPCA 4L5NC 3EQ1A 3AV0A 2DIXA 4O4KA 4DR7E 4BC9A 3KWRA 2WBSA 4J8ZA 2YTDA 2M7QA 1A1JA 2LRSA 1KJKA 2CSHA 1MGTA 2LUPB 1XNRE 2EOQA 2JXPA 3BGHA 1GQEA 3OTOE 5T6JA 3THNA 5A6BA 4DKKA 2R76A 2JR1A 4DMIA 1UHZA 2EPCA 2ZM6E 5F3WA 2EOHA 1ZAAC 1JK2A 3ADGA 3QG5C 3VHTB 4LF8E 5LL6R 3J7AG 2V85A 2E5LE 3C4TA 4BS9A 4R2QA 2V89A 2VE7C 4MLVA 1L4SA 4ZYGA 2EOOA 2EMLA 2YTNA 2YTFA 1B69A 2EM2A 1UBDC 5IXMB 2CTDA 4JI1E 2EN4A 3EPKA 2UXCE 2EM4A 2EOZA 2EWLA
chains in the Genus database with same CATH topology
3IWDA 2RS7A 1DQ3A 1X49A 2V86A 2LBSB 4TUGA 2NUFA 2UUCE 4NXNE 3JTZA 4B3TE 1IBKE 2UUAE 1J26A 2KOUA 4JI5E 2LE2A 5FLXC 2RS6A 1FJGE 2DMYA 2V8QB 2V88A 4GEQB 4BCAA 2ODRC 5BR8E 1STUA 5CFFE 5IWAE 4X8WA 4WSPA 1IBME 4NXME 3ZOQB 4DR1E 1YYOA 4JI6E 4DR4E 2V87A 1DI2A 5AE1A 1FKAE 2K4VA 2LMZA 2L92A 4DV0E 1J5EE 2G7HA 4TUIA 4P78A 2RTXA 1N32E 4JV5E 2H36X 2KONA 2LJHA 3C4BA 3JU0A 4LU9A 3ADLA 2F4VE 3FIGA 4K0KE 3K6QA 4I8OA 4X65E 4L8NA 1N36E 3DJWA 1ZBQA 2NA2A 2L33A 2DB2A 4R8OA 4DR3E 2L3CA 4LF4E 1QU6A 1YYKA 2JVAA 4LF5E 4Q28A 2LTRA 1YYWA 5IT9C 4WYQB 1UILA 3IWCA 5AASA 2L3JA 2N3GA 4F9AB 3T1HE 4DV5E 3VK6A 3J81C 2ODRD 1HNZE 2IHR1 4WFTA 2JWOA 1HNXE 5AE3A 4M2ZA 5ADZA 1I94E 1GZ6A 3ADJA 3F6GA 4F9BB 3J7Yp 2FGGA 5LMNE 4DR2E 4R03A 1HNWE 4DR5E 2RSMA 1RQ0A 4F54A 2UXDE 4DUZE 2VQFE 4GKKE 1T4OA 2UU9E 2B7TA 4DV7E 3IWBA 1HR0E 4GKJE 4OOGC 4KHPE 3AUZA 5DNYA 4WPYA 2L2MA 2YZTA 3ADIA 4DV1E 2L6MA 1XMQE 2MDRA 5A2QC 4L5NC 4YHHE 3LMLA 4X66E 1ZBTA 3AV0A 1WXRA 4DV3E 1WHNA 2DIXA 3HXLA 2L2NA 3F6HA 3HPZA 3HPSA 1T4LB 3HTXA 4DR7E 2UXCE 3H09A 4BC9A 2V83A 1N34E 3KWRA 4B3ME 1X47A 2VF1A 4LF6E 4J8ZA 2NUEA 2UXBE 2M7QA 5LMUE 4LFCE 1PKPA 2LRSA 3VYXA 1SR9A 2JY9A 4BBYA 4LF9E 4BMJA 2LUPB 1XNRE 1EKZA 1GQEA 2F8BA 3LLHA 4LFBE 3OTOE 5T6JA 2B3TB 4BC7A 4LFAE 4JYAE 3DF6A 2FTXB 4DKKA 2N3HA 2JR1A 4DMIA 1UHZA 1IBLE 4DV6E 4OX9E 4F9CB 1T4NA 2YT4A 3MSWA 4P7DA 3RMPA 2ZM6E 2B9DA 3T1YE 4JI2E 2KHXA 5F3WA 5AE2A 2E1MA 3HQ1A 3ADGA 3J80C 4JI3E 4LTYA 4M30A 2LUQA 4X62E 1RC7A 1N33E 2JOXA 2VQEE 4DUYE 2HHHE 4KZSA 4LF8E 4B3SE 1YZ9A 5LL6R 3P1XA 3OMLA 4LF7E 2CPNA 4DV4E 2V85A 3J7AG 4DR6E 2E5LE 2L8TA 4YY3E 4B3RE 3C4TA 4BS9A 2UUBE 2DSYA 4AQYE 2V89A 2VE7C 4X64E 2NUGA 2MC6A 1WHQA 2M4IA 3JAMC 1O0WA 2M1SA 3VYYA 2EZ6A 4JI0E 2JOBA 1XNQE 4JI4E 4JI8E 4M0VA 4DV2E 1X48A 2LTSA 4JI1E 2L2KB 2B7VA 1XMOE 4JI7E 2FV4B 2WZOA 2MC5A 2EWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FV4 B;  4GEQ B;  2FTX B;  5T6J A; 
#chains in the Genus database with same CATH topology
 2CT1 A;  2RQL A;  1X49 A;  2A25 A;  4TUG A;  2JYA A;  1IQO A;  3JTZ A;  4B3T E;  1IBK E;  1KYQ A;  1J26 A;  2KOU A;  1DGC A;  2YRH A;  2EOI A;  3UK3 C;  1P47 A;  2EPK X;  2ODR C;  2EN6 A;  5CFF E;  1IBM E;  1IQS A;  4WSP A;  2YRM A;  4R2S A;  4DR1 E;  4JI6 E;  1BB8 A;  2V87 A;  4BHC A;  2WBT A;  1FKA E;  2PRT A;  1J5E E;  5KL6 A;  1PJQ A;  2J7J A;  3JU0 A;  4X65 E;  4KWY A;  4L8N A;  1N36 E;  2EOS A;  2NA2 A;  4R8O A;  2EMA A;  1YUJ A;  2DLQ A;  4LF5 E;  2LTR A;  2EMK A;  2ELY A;  2DLK A;  5AAS A;  4DV5 E;  3J81 C;  4Q35 B;  4R2E A;  2K7I A;  4WFT A;  1NCS A;  5AE3 A;  4F9B B;  2ELZ A;  4RH8 A;  4R03 A;  5KL7 A;  5A6A A;  2UXD E;  4DUZ E;  4GKK E;  1T4O A;  2RSI A;  3IWB A;  3AUZ A;  3ADI A;  3M99 B;  4R2R A;  4YHH E;  2EMY A;  2R1F A;  3ECR A;  3HPZ A;  2MDG A;  3HTX A;  1BBG A;  1JK1 A;  4HTG A;  4LF6 E;  2NUE A;  3THO B;  4X9J A;  2N8X A;  4LFC E;  2EMC A;  1SR9 A;  4LF9 E;  2NAB A;  4BMJ A;  1EKZ A;  2F8B A;  3C6M A;  3LLH A;  4LFB E;  5AC5 A;  4JYA E;  4F9C B;  1T4N A;  3T1Y E;  2KHX A;  5AE2 A;  3HQ1 A;  4F2J C;  3J80 C;  4JI3 E;  4LTY A;  2VQE E;  2EJ4 A;  5KL3 A;  1YSA C;  3OML A;  2I9I A;  4DV4 E;  2L8T A;  5LLQ A;  2HJJ A;  4YY3 E;  2DSY A;  1PDA A;  4O43 A;  2EMZ A;  2NUG A;  2M4I A;  2M1S A;  4WSG A;  2EQ1 A;  1T39 A;  2ENC A;  4JI4 E;  1YFH A;  4LF7 E;  3IWD A;  3BF2 A;  2EL6 A;  4JI5 E;  1LLM C;  3MHS C;  1FJG E;  2V8Q B;  2EOX A;  4GEQ B;  2YTE A;  4X8W A;  2EM8 A;  1TF6 A;  1Z1B A;  1X5W A;  1G2F C;  2EPP A;  2EOF A;  2EPO A;  1DI2 A;  5AE1 A;  2LVH A;  1EH7 A;  2LMZ A;  1G2D C;  2L92 A;  4DV0 E;  2G7H A;  2YTJ A;  4TUI A;  1WJP A;  4P78 A;  1EH8 A;  2H36 X;  2KON A;  4LU9 A;  3ADL A;  2F4V E;  2I13 A;  3DJW A;  1ZBQ A;  4DR3 E;  2EN7 A;  2DB2 A;  1YYK A;  1QNT A;  2L3C A;  1QU6 A;  4Q28 A;  1YYW A;  2EN2 A;  2L3J A;  1X6H A;  3T1H E;  2EOR A;  2EPR A;  2ODR D;  4WXC A;  1HNZ E;  2IHR 1;  2VRD A;  2JWO A;  2HC5 A;  5ADZ A;  4M2Z A;  2MKN A;  3ADJ A;  1MEY C;  3F6G A;  4DR2 E;  1F2I G;  1HNW E;  4DR5 E;  2RSM A;  1RQ0 A;  4R2A A;  2B7T A;  1PJT A;  4NZV A;  2LT7 A;  5DNY A;  2YSP A;  4F6M A;  2GHF A;  5A2Q C;  4MLQ A;  1ZBT A;  2EOE A;  4DV3 E;  2MKD A;  1WHN A;  1T4L B;  2D9H A;  2LV2 A;  3HPS A;  2UXB E;  2EPN A;  4B3M E;  2JPA A;  2VF1 A;  1WRJ A;  1PKP A;  3VYX A;  4BBY A;  4R2D A;  2FTX B;  2ADR A;  2EMX A;  1IBL E;  2YT4 A;  3MSW A;  4JI2 E;  3RMP A;  1YUI A;  4IS1 C;  2JP9 A;  1N33 E;  2JOX A;  2HHH E;  2ENH A;  4WX9 A;  1SFE A;  4B3S E;  1TF3 A;  2EQ3 A;  4HEI A;  3P1X A;  1A1K A;  2CPN A;  3TQM A;  4B3R E;  5A6B D;  3KZY A;  4AQY E;  5KL4 A;  1X6F A;  1O0W A;  2YTI A;  2EZ6 A;  2EMB A;  3EPJ A;  2YSO A;  4F6N A;  4JI0 E;  2YTQ A;  2GLI A;  2RS7 A;  2UUC E;  1A1F A;  2NUF A;  1X3C A;  4NXN E;  1GTK A;  2DMI A;  2EMG A;  2LCE A;  2UUA E;  2E72 A;  2EPM X;  2RS6 A;  2DMY A;  5KL5 A;  5BR8 E;  2EPU A;  4ZYD A;  2YPN A;  1IMU A;  4DR4 E;  2YRK A;  2EM0 A;  2ENA A;  2LO3 A;  2EPL X;  2EM3 A;  4M9V C;  2EPZ A;  3FIG A;  2EL4 A;  2Q8U A;  2YU5 A;  2EM9 A;  2L33 A;  1X6E A;  1UIL A;  5A6J A;  2WBU A;  3KZZ A;  1ZU1 A;  1BBO A;  1N3G A;  1PJS A;  5LMN E;  2FGG A;  2EPA A;  4GZN C;  3C6K A;  4NHR A;  4F54 A;  1A1G A;  2YU8 A;  2EOY A;  2EMF A;  4DV7 E;  4GKJ E;  1AH5 A;  4OOG C;  4KHP E;  4ZYH A;  2L2M A;  2YZT A;  4BHB A;  1XMQ E;  2MDR A;  3LML A;  4X66 E;  2WCC 3;  1WXR A;  3HXL A;  2L2N A;  3F6H A;  1A1H A;  2M9A A;  3H09 A;  2V83 A;  4R2P A;  1N34 E;  1X47 A;  1ZR9 A;  5LMU E;  2EQ0 A;  5A6K A;  2JY9 A;  4RHB B;  5TSE A;  2EN8 A;  2BB8 A;  1YPN A;  2B3T B;  4BC7 A;  4LFA E;  2N3H A;  2EM5 A;  4DV6 E;  4OX9 E;  4P7D A;  2B9D A;  4FK5 C;  3EPL A;  2E1M A;  3BBG A;  2EN1 A;  2YWQ A;  4M30 A;  2LUQ A;  4WXD A;  4X62 E;  1RC7 A;  4DUY E;  1YZ9 A;  2EMW A;  4KZS A;  2EM7 A;  1TN9 A;  4DR6 E;  2UUB E;  2GPI A;  4X64 E;  2MC6 A;  1WHQ A;  3JAM C;  3VYY A;  1UN6 B;  2JOB A;  1XNQ E;  1A1L A;  4JI8 E;  4M0V A;  4DV2 E;  1X48 A;  2LTS A;  2L2K B;  3MHH C;  2B7V A;  1XMO E;  4JI7 E;  2FV4 B;  3DF6 A;  2WZO A;  2MC5 A;  1DQ3 A;  2V86 A;  2EE8 A;  2LBS B;  2HGH A;  1A1I A;  5AC4 A;  2LE2 A;  5KL2 A;  5FLX C;  2V88 A;  2EP3 A;  4BCA A;  5IWA E;  1STU A;  4NXM E;  3ZOQ B;  1YYO A;  2YTP A;  4N4R B;  2K4V A;  2RTX A;  2LJU A;  1N32 E;  4JV5 E;  3C4B A;  2LJH A;  4K0K E;  2EOJ A;  1EH6 A;  2EPX A;  2YTG A;  3EPH A;  3K6Q A;  4I8O A;  1AAY A;  2DRP A;  4O24 A;  2EMH A;  4LF4 E;  3L00 A;  2JVA A;  2EMI A;  2BBG A;  2EM6 A;  4WYQ B;  5IT9 C;  3IWC A;  2N3G A;  4F9A B;  3VK6 A;  5A69 A;  1HNX E;  1I94 E;  1GZ6 A;  3J7Y p;  4ZYE A;  1NEI A;  2EN3 A;  4R2C A;  2EOM A;  4O5G A;  2VQF E;  2YTO A;  2UU9 E;  4IJD A;  3BID A;  2DGC A;  1HR0 E;  1RMD A;  5IV8 B;  4WPY A;  1T38 A;  2EL5 A;  4DV1 E;  2L6M A;  2RPC A;  4L5N C;  3EQ1 A;  3AV0 A;  2DIX A;  4O4K A;  4DR7 E;  4BC9 A;  3KWR A;  2WBS A;  4J8Z A;  2YTD A;  2M7Q A;  1A1J A;  2LRS A;  1KJK A;  2CSH A;  1MGT A;  2LUP B;  1XNR E;  2EOQ A;  2JXP A;  3BGH A;  1GQE A;  3OTO E;  5T6J A;  3THN A;  5A6B A;  4DKK A;  2R76 A;  2JR1 A;  4DMI A;  1UHZ A;  2EPC A;  2ZM6 E;  5F3W A;  2EOH A;  1ZAA C;  1JK2 A;  3ADG A;  3QG5 C;  3VHT B;  4LF8 E;  5LL6 R;  3J7A G;  2V85 A;  2E5L E;  3C4T A;  4BS9 A;  4R2Q A;  2V89 A;  2VE7 C;  4MLV A;  1L4S A;  4ZYG A;  2EOO A;  2EML A;  2YTN A;  2YTF A;  1B69 A;  2EM2 A;  1UBD C;  5IXM B;  2CTD A;  4JI1 E;  2EN4 A;  3EPK A;  2UXC E;  2EM4 A;  2EOZ A;  2EWL A; 
#chains in the Genus database with same CATH homology
 3IWD A;  2RS7 A;  1DQ3 A;  1X49 A;  2V86 A;  2LBS B;  4TUG A;  2NUF A;  2UUC E;  4NXN E;  3JTZ A;  4B3T E;  1IBK E;  2UUA E;  1J26 A;  2KOU A;  4JI5 E;  2LE2 A;  5FLX C;  2RS6 A;  1FJG E;  2DMY A;  2V8Q B;  2V88 A;  4GEQ B;  4BCA A;  2ODR C;  5BR8 E;  1STU A;  5CFF E;  5IWA E;  4X8W A;  4WSP A;  1IBM E;  4NXM E;  3ZOQ B;  4DR1 E;  1YYO A;  4JI6 E;  4DR4 E;  2V87 A;  1DI2 A;  5AE1 A;  1FKA E;  2K4V A;  2LMZ A;  2L92 A;  4DV0 E;  1J5E E;  2G7H A;  4TUI A;  4P78 A;  2RTX A;  1N32 E;  4JV5 E;  2H36 X;  2KON A;  2LJH A;  3C4B A;  3JU0 A;  4LU9 A;  3ADL A;  2F4V E;  3FIG A;  4K0K E;  3K6Q A;  4I8O A;  4X65 E;  4L8N A;  1N36 E;  3DJW A;  1ZBQ A;  2NA2 A;  2L33 A;  2DB2 A;  4R8O A;  4DR3 E;  2L3C A;  4LF4 E;  1QU6 A;  1YYK A;  2JVA A;  4LF5 E;  4Q28 A;  2LTR A;  1YYW A;  5IT9 C;  4WYQ B;  1UIL A;  3IWC A;  5AAS A;  2L3J A;  2N3G A;  4F9A B;  3T1H E;  4DV5 E;  3VK6 A;  3J81 C;  2ODR D;  1HNZ E;  2IHR 1;  4WFT A;  2JWO A;  1HNX E;  5AE3 A;  4M2Z A;  5ADZ A;  1I94 E;  1GZ6 A;  3ADJ A;  3F6G A;  4F9B B;  3J7Y p;  2FGG A;  5LMN E;  4DR2 E;  4R03 A;  1HNW E;  4DR5 E;  2RSM A;  1RQ0 A;  4F54 A;  2UXD E;  4DUZ E;  2VQF E;  4GKK E;  1T4O A;  2UU9 E;  2B7T A;  4DV7 E;  3IWB A;  1HR0 E;  4GKJ E;  4OOG C;  4KHP E;  3AUZ A;  5DNY A;  4WPY A;  2L2M A;  2YZT A;  3ADI A;  4DV1 E;  2L6M A;  1XMQ E;  2MDR A;  5A2Q C;  4L5N C;  4YHH E;  3LML A;  4X66 E;  1ZBT A;  3AV0 A;  1WXR A;  4DV3 E;  1WHN A;  2DIX A;  3HXL A;  2L2N A;  3F6H A;  3HPZ A;  3HPS A;  1T4L B;  3HTX A;  4DR7 E;  2UXC E;  3H09 A;  4BC9 A;  2V83 A;  1N34 E;  3KWR A;  4B3M E;  1X47 A;  2VF1 A;  4LF6 E;  4J8Z A;  2NUE A;  2UXB E;  2M7Q A;  5LMU E;  4LFC E;  1PKP A;  2LRS A;  3VYX A;  1SR9 A;  2JY9 A;  4BBY A;  4LF9 E;  4BMJ A;  2LUP B;  1XNR E;  1EKZ A;  1GQE A;  2F8B A;  3LLH A;  4LFB E;  3OTO E;  5T6J A;  2B3T B;  4BC7 A;  4LFA E;  4JYA E;  3DF6 A;  2FTX B;  4DKK A;  2N3H A;  2JR1 A;  4DMI A;  1UHZ A;  1IBL E;  4DV6 E;  4OX9 E;  4F9C B;  1T4N A;  2YT4 A;  3MSW A;  4P7D A;  3RMP A;  2ZM6 E;  2B9D A;  3T1Y E;  4JI2 E;  2KHX A;  5F3W A;  5AE2 A;  2E1M A;  3HQ1 A;  3ADG A;  3J80 C;  4JI3 E;  4LTY A;  4M30 A;  2LUQ A;  4X62 E;  1RC7 A;  1N33 E;  2JOX A;  2VQE E;  4DUY E;  2HHH E;  4KZS A;  4LF8 E;  4B3S E;  1YZ9 A;  5LL6 R;  3P1X A;  3OML A;  4LF7 E;  2CPN A;  4DV4 E;  2V85 A;  3J7A G;  4DR6 E;  2E5L E;  2L8T A;  4YY3 E;  4B3R E;  3C4T A;  4BS9 A;  2UUB E;  2DSY A;  4AQY E;  2V89 A;  2VE7 C;  4X64 E;  2NUG A;  2MC6 A;  1WHQ A;  2M4I A;  3JAM C;  1O0W A;  2M1S A;  3VYY A;  2EZ6 A;  4JI0 E;  2JOB A;  1XNQ E;  4JI4 E;  4JI8 E;  4M0V A;  4DV2 E;  1X48 A;  2LTS A;  4JI1 E;  2L2K B;  2B7V A;  1XMO E;  4JI7 E;  2FV4 B;  2WZO A;  2MC5 A;  2EWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...