2FTXB

Crystal structure of the yeast kinetochore spc24/spc25 globular domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
59
structure length
59
Chain Sequence
ANENILKLKLYRSLGVILDLENDQVLINRKNDGNIDILPLDNNLSDFYKTKYIWERLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Atomic Structure of the kinetochore Spc24p/Spc25p globular domain reveals a novel fold
rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein, protein binding
molecule keywords Hypothetical 25.2 kDa protein in AFG3-SEB2 intergenic region
total genus 15
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.430 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ftxB00
2FTXB 4GEQB 5T6JA 2FV4B
chains in the Genus database with same CATH superfamily
2B7VA 2EPXA 2YU5A 2ODRD 1XNQE 4DR4E 2GLIA 1ZAAC 4R2QA 2EOIA 2EN7A 2JR1A 1GTKA 2GPIA 2N8XA 5KL5A 4GKKE 2RPCA 2M4IA 4KZSA 2EP3A 2RS7A 1UBDC 1YUIA 5AC4A 2EL6A 2YSPA 4R8OA 2F8BA 3K6QA 2B9DA 3J81C 1RC7A 3EPKA 4R2PA 4NXNE 2EPOA 1J5EE 4AQYE 4M0VA 2EJ4A 1XMQE 4KWYA 2B7TA 2L92A 1YPNA 2YRKA 2EPRA 2K7IA 2EMWA 5CFFE 1I94E 2EMIA 1HNXE 4DMIA 2UUBE 1EH7A 2EPZA 2VRDA 2EN4A 2YTEA 2EN8A 1T4NA 2MDGA 4P7DA 2NUFA 1YSAC 3T1YE 1HNZE 3J80C 2YRHA 2IHR1 1YZ9A 4X8WA 2EPLX 1LLMC 4JI2E 4X64E 2V88A 2DSYA 4X66E 4I8OA 2DMIA 4DUZE 1N36E 2YTJA 2JPAA 1KJKA 1QNTA 4L5NC 1X6FA 4DR1E 4OX9E 2HC5A 1P47A 4JYAE 2FGGA 2EOHA 3IWCA 3AV0A 3THNA 2FV4B 2BBGA 1STUA 2JY9A 2LTRA 4J8ZA 1Z1BA 4L8NA 4R2CA 2EOFA 3RMPA 2M1SA 2YZTA 3ZOQB 2WBTA 2KOUA 4DKKA 1GQEA 1GZ6A 2EWLA 4F9AB 1IBKE 4R2AA 3ADGA 1DI2A 1G2DC 2JXPA 2MC6A 2EOYA 2Q8UA 2EQ3A 1XMOE 2V8QB 2EMLA 5F3WA 4DR6E 1MGTA 1KYQA 4LFBE 4WXDA 2LVHA 4R2RA 4F6MA 4BS9A 2EMCA 1N34E 2ADRA 4R2EA 2DLQA 1QU6A 2CTDA 4ZYDA 2L33A 2YTFA 2YPNA 4LF6E 4LF8E 3C4TA 3ADIA 1ZR9A 4DUYE 2ELZA 1RMDA 2ENHA 3T1HE 4DV3E 2LJUA 4BHBA 2EMKA 2L8TA 5IXMB 2HHHE 2EORA 5KL3A 1A1LA 3EPJA 3MHHC 3C6KA 5LMUE 2EM9A 1G2FC 2G7HA 2JOXA 2K4VA 1FKAE 4B3ME 2WCC3 3IWDA 3ADJA 3TQMA 4F9CB 4NZVA 2EOJA 2RSIA 4WSPA 3HPZA 2J7JA 4JI8E 2EZ6A 4X62E 4RH8A 4R2DA 2YWQA 2YTPA 2ENCA 2RQLA 2EM3A 2YTQA 3IWBA 4DV0E 2YT4A 1EH8A 3DJWA 2DLKA 1EH6A 2EM2A 2CSHA 1ZU1A 4JI0E 4JI4E 3VHTB 1PJQA 1EKZA 4R2SA 2DGCA 1IQSA 5A6BA 1J26A 2EN6A 2ODRC 1X5WA 4GKJE 4KHPE 1BBOA 5AE2A 2KONA 5A6KA 1JK1A 2YU8A 4BHCA 2RS6A 3P1XA 4GEQB 2EMGA 2KHXA 2EL4A 2PRTA 4YHHE 5KL4A 5TSEA 4WYQB 2LCEA 1YUJA 1RQ0A 1DGCA 2L2NA 3JAMC 2YTGA 1T39A 4ZYGA 4HTGA 2LV2A 1B69A 4RHBB 2EOMA 2UXBE 1X3CA 4DV6E 2BB8A 4DV7E 4NHRA 2MC5A 4K0KE 3EPHA 4WXCA 1HNWE 2MKNA 2VE7C 5A2QC 4DR3E 3F6GA 2B3TB 2LTSA 3C4BA 1TF6A 4LF9E 4N4RB 4M9VC 2LO3A 2ENAA 5BR8E 4BC9A 1L4SA 2D9HA 4DR2E 2EQ0A 2EM0A 2EN2A 2ELYA 1NEIA 4TUIA 4HEIA 1ZBQA 3VYXA 1SR9A 1A1FA 4LF4E 3ECRA 5A6AA 5IWAE 3HTXA 2DMYA 4O4KA 2V86A 2DIXA 3DF6A 1SFEA 1WHNA 2V83A 5A6BD 3ADLA 3FIGA 5AASA 2V85A 2EMBA 2EMAA 2V87A 2UUAE 2ZM6E 1UN6B 2WBSA 1F2IG 1HR0E 1UILA 2YRMA 4LTYA 5AC5A 5KL2A 2EPNA 4O5GA 2EQ1A 2EMHA 2EPUA 2R1FA 2L2MA 2RSMA 4JV5E 1T4LB 2UXCE 2CPNA 4WX9A 1YFHA 2NUEA 2L2KB 3HQ1A 4X9JA 3HXLA 1YYWA 2EM7A 2EPAA 3J7AG 3JTZA 1N3GA 4BC7A 4R03A 2MDRA 3HPSA 3THOB 1BB8A 1WRJA 2LUPB 1NCSA 4F2JC 2N3GA 4GZNC 4FK5C 4DV4E 2EN1A 2GHFA 2L6MA 2H36X 2EOEA 4BCAA 2RTXA 2EMFA 3F6HA 2DB2A 4F54A 1T38A 2MKDA 2HGHA 2WBUA 3L00A 4B3TE 4MLVA 2VQFE 5LLQA 4O43A 2M9AA 1A1IA 2EOZA 1FJGE 1A1GA 4OOGC 2EOOA 2VQEE 2I13A 2E1MA 2EPPA 1A1HA 4LFCE 1PJSA 2EN3A 2UXDE 5LMNE 1PKPA 2EE8A 2EPMX 4Q35B 4X65E 4BBYA 2FTXB 4YY3E 1MEYC 1JK2A 1DQ3A 3EPLA 3OMLA 4LFAE 5AE1A 2UU9E 1N32E 5FLXC 4TUGA 2JWOA 1X6EA 4BMJA 2N3HA 2LBSB 1X49A 5T6JA 2JOBA 1UHZA 4P78A 2R76A 4IJDA 1BBGA 3LMLA 2LE2A 1IBME 2EMZA 2JP9A 1IBLE 4JI3E 3AUZA 4O24A 5A6JA 2CT1A 1X6HA 1ZBTA 3UK3C 1YYOA 2F4VE 3MSWA 1IQOA 4DR5E 4DV5E 2LJHA 2EL5A 5ADZA 1PJTA 1N33E 3BF2A 3J7Yp 1A1KA 3M99B 3BBGA 5IV8B 1AH5A 2NUGA 2YTIA 2EM6A 3KZYA 2E72A 2LRSA 2M7QA 2E5LE 3VYYA 2EMYA 2EOSA 2JVAA 4ZYEA 2EM8A 3EQ1A 2V89A 2LUQA 1XNRE 2YSOA 1TF3A 3C6MA 4Q28A 3MHSC 4ZYHA 5IT9C 4JI5E 4JI7E 5AE3A 4LF5E 4JI1E 1WJPA 3QG5C 2YTDA 1YYKA 2EPCA 1TN9A 5KL6A 2HJJA 1X48A 2L3CA 2LMZA 3JU0A 2L3JA 4WSGA 3KZZA 2VF1A 4MLQA 1X47A 3BGHA 4B3RE 1O0WA 1WHQA 2EPKX 1WXRA 1IMUA 5KL7A 2EMXA 5A69A 2I9IA 2LT7A 3OTOE 4M2ZA 2YTOA 4LU9A 4F9BB 4NXME 4IS1C 1AAYA 1PDAA 4B3SE 2EOXA 3VK6A 4WFTA 2WZOA 3BIDA 2NABA 5LL6R 4DV2E 2NA2A 1A1JA 3LLHA 2A25A 4LF7E 4M30A 4JI6E 3KWRA 4DR7E 4DV1E 5DNYA 3H09A 2YTNA 4F6NA 2JYAA 1T4OA 2EM4A 4WPYA 2DRPA 2EM5A 2EOQA 2UUCE
chains in the Genus database with same CATH topology
1PKPA 2B7VA 4DV6E 4DV7E 2ODRD 4X65E 1XMOE 4BBYA 1XNQE 4DR4E 2FTXB 2MC5A 2V8QB 4YY3E 4K0KE 2JR1A 1DQ3A 5F3WA 1HNWE 4DR6E 4GKKE 2M4IA 3OMLA 4KZSA 2RS7A 4LFAE 5AE1A 2UU9E 4LFBE 2VE7C 5A2QC 1N32E 5FLXC 4DR3E 4BS9A 1N34E 4TUGA 3F6GA 2B3TB 1QU6A 2F8BA 2JWOA 2LTSA 3C4BA 4R8OA 4LF9E 2L33A 3K6QA 2B9DA 5BR8E 4BC9A 3C4TA 3J81C 4BMJA 1RC7A 4LF6E 4LF8E 3ADIA 4DR2E 2N3HA 2LBSB 4NXNE 1X49A 1J5EE 4DUYE 4AQYE 5T6JA 2JOBA 4M0VA 3T1HE 1UHZA 4DV3E 1XMQE 2L8TA 2B7TA 2L92A 4TUIA 2HHHE 4P78A 1ZBQA 5LMUE 3VYXA 3LMLA 2LE2A 1SR9A 5CFFE 1I94E 1IBLE 2G7HA 1HNXE 1IBME 4JI3E 2JOXA 2K4VA 1FKAE 3AUZA 4DMIA 4B3ME 3IWDA 4LF4E 3ADJA 5IWAE 2UUBE 1ZBTA 1YYOA 3HTXA 4F9CB 2DMYA 2F4VE 3MSWA 4DR5E 4DV5E 2LJHA 2V86A 5ADZA 2DIXA 3DF6A 1N33E 4WSPA 1WHNA 2V83A 3J7Yp 3ADLA 3HPZA 3FIGA 5AASA 2V85A 2NUGA 1T4NA 4JI8E 4X62E 2EZ6A 2V87A 2UUAE 2ZM6E 4P7DA 2NUFA 1HR0E 2LRSA 2M7QA 3T1YE 1HNZE 1UILA 3VYYA 2E5LE 4LTYA 3J80C 2JVAA 2IHR1 3IWBA 4DV0E 1YZ9A 2V89A 2LUQA 2YT4A 4X8WA 2L2MA 2RSMA 1XNRE 4JV5E 1T4LB 4JI2E 2CPNA 2UXCE 3DJWA 4Q28A 4X64E 2V88A 2L2KB 3HQ1A 2DSYA 4X66E 5IT9C 2NUEA 4JI5E 3HXLA 4JI7E 4I8OA 5AE3A 4LF5E 4JI0E 4JI1E 1YYWA 4JI4E 1YYKA 4DUZE 1N36E 3J7AG 3JTZA 4BC7A 1EKZA 4R03A 4L5NC 2MDRA 3HPSA 1X48A 4DR1E 4OX9E 4JYAE 1J26A 2L3CA 2ODRC 2LMZA 2FGGA 3JU0A 2L3JA 4GKJE 2LUPB 2VF1A 3IWCA 4KHPE 3AV0A 1X47A 4B3RE 1O0WA 5AE2A 1WHQA 1WXRA 2KONA 2N3GA 4DV4E 2RS6A 3P1XA 2FV4B 2JY9A 1STUA 2L6MA 3OTOE 4M2ZA 4F9BB 2H36X 4GEQB 4LU9A 4NXME 2LTRA 4B3SE 4J8ZA 2KHXA 3VK6A 4BCAA 4WFTA 2RTXA 2WZOA 4YHHE 4L8NA 3F6HA 2DB2A 4F54A 5LL6R 4DV2E 3RMPA 2M1SA 2NA2A 2YZTA 4WYQB 3LLHA 3ZOQB 2KOUA 4B3TE 4DKKA 1GQEA 4LF7E 4M30A 1RQ0A 1GZ6A 2EWLA 4F9AB 2VQFE 4JI6E 3KWRA 1IBKE 4DR7E 4DV1E 2L2NA 3ADGA 5DNYA 3H09A 1DI2A 1FJGE 3JAMC 4OOGC 1T4OA 2VQEE 2E1MA 2MC6A 4LFCE 4WPYA 2UUCE 2UXDE 2UXBE 5LMNE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FTX B;  4GEQ B;  5T6J A;  2FV4 B; 
#chains in the Genus database with same CATH topology
 2B7V A;  2EPX A;  2YU5 A;  2ODR D;  1XNQ E;  4DR4 E;  2GLI A;  1ZAA C;  4R2Q A;  2EOI A;  2EN7 A;  2JR1 A;  1GTK A;  2GPI A;  2N8X A;  5KL5 A;  4GKK E;  2RPC A;  2M4I A;  4KZS A;  2EP3 A;  2RS7 A;  1UBD C;  1YUI A;  5AC4 A;  2EL6 A;  2YSP A;  4R8O A;  2F8B A;  3K6Q A;  2B9D A;  3J81 C;  1RC7 A;  3EPK A;  4R2P A;  4NXN E;  2EPO A;  1J5E E;  4AQY E;  4M0V A;  2EJ4 A;  1XMQ E;  4KWY A;  2B7T A;  2L92 A;  1YPN A;  2YRK A;  2EPR A;  2K7I A;  2EMW A;  5CFF E;  1I94 E;  2EMI A;  1HNX E;  4DMI A;  2UUB E;  1EH7 A;  2EPZ A;  2VRD A;  2EN4 A;  2YTE A;  2EN8 A;  1T4N A;  2MDG A;  4P7D A;  2NUF A;  1YSA C;  3T1Y E;  1HNZ E;  3J80 C;  2YRH A;  2IHR 1;  1YZ9 A;  4X8W A;  2EPL X;  1LLM C;  4JI2 E;  4X64 E;  2V88 A;  2DSY A;  4X66 E;  4I8O A;  2DMI A;  4DUZ E;  1N36 E;  2YTJ A;  2JPA A;  1KJK A;  1QNT A;  4L5N C;  1X6F A;  4DR1 E;  4OX9 E;  2HC5 A;  1P47 A;  4JYA E;  2FGG A;  2EOH A;  3IWC A;  3AV0 A;  3THN A;  2FV4 B;  2BBG A;  1STU A;  2JY9 A;  2LTR A;  4J8Z A;  1Z1B A;  4L8N A;  4R2C A;  2EOF A;  3RMP A;  2M1S A;  2YZT A;  3ZOQ B;  2WBT A;  2KOU A;  4DKK A;  1GQE A;  1GZ6 A;  2EWL A;  4F9A B;  1IBK E;  4R2A A;  3ADG A;  1DI2 A;  1G2D C;  2JXP A;  2MC6 A;  2EOY A;  2Q8U A;  2EQ3 A;  1XMO E;  2V8Q B;  2EML A;  5F3W A;  4DR6 E;  1MGT A;  1KYQ A;  4LFB E;  4WXD A;  2LVH A;  4R2R A;  4F6M A;  4BS9 A;  2EMC A;  1N34 E;  2ADR A;  4R2E A;  2DLQ A;  1QU6 A;  2CTD A;  4ZYD A;  2L33 A;  2YTF A;  2YPN A;  4LF6 E;  4LF8 E;  3C4T A;  3ADI A;  1ZR9 A;  4DUY E;  2ELZ A;  1RMD A;  2ENH A;  3T1H E;  4DV3 E;  2LJU A;  4BHB A;  2EMK A;  2L8T A;  5IXM B;  2HHH E;  2EOR A;  5KL3 A;  1A1L A;  3EPJ A;  3MHH C;  3C6K A;  5LMU E;  2EM9 A;  1G2F C;  2G7H A;  2JOX A;  2K4V A;  1FKA E;  4B3M E;  2WCC 3;  3IWD A;  3ADJ A;  3TQM A;  4F9C B;  4NZV A;  2EOJ A;  2RSI A;  4WSP A;  3HPZ A;  2J7J A;  4JI8 E;  2EZ6 A;  4X62 E;  4RH8 A;  4R2D A;  2YWQ A;  2YTP A;  2ENC A;  2RQL A;  2EM3 A;  2YTQ A;  3IWB A;  4DV0 E;  2YT4 A;  1EH8 A;  3DJW A;  2DLK A;  1EH6 A;  2EM2 A;  2CSH A;  1ZU1 A;  4JI0 E;  4JI4 E;  3VHT B;  1PJQ A;  1EKZ A;  4R2S A;  2DGC A;  1IQS A;  5A6B A;  1J26 A;  2EN6 A;  2ODR C;  1X5W A;  4GKJ E;  4KHP E;  1BBO A;  5AE2 A;  2KON A;  5A6K A;  1JK1 A;  2YU8 A;  4BHC A;  2RS6 A;  3P1X A;  4GEQ B;  2EMG A;  2KHX A;  2EL4 A;  2PRT A;  4YHH E;  5KL4 A;  5TSE A;  4WYQ B;  2LCE A;  1YUJ A;  1RQ0 A;  1DGC A;  2L2N A;  3JAM C;  2YTG A;  1T39 A;  4ZYG A;  4HTG A;  2LV2 A;  1B69 A;  4RHB B;  2EOM A;  2UXB E;  1X3C A;  4DV6 E;  2BB8 A;  4DV7 E;  4NHR A;  2MC5 A;  4K0K E;  3EPH A;  4WXC A;  1HNW E;  2MKN A;  2VE7 C;  5A2Q C;  4DR3 E;  3F6G A;  2B3T B;  2LTS A;  3C4B A;  1TF6 A;  4LF9 E;  4N4R B;  4M9V C;  2LO3 A;  2ENA A;  5BR8 E;  4BC9 A;  1L4S A;  2D9H A;  4DR2 E;  2EQ0 A;  2EM0 A;  2EN2 A;  2ELY A;  1NEI A;  4TUI A;  4HEI A;  1ZBQ A;  3VYX A;  1SR9 A;  1A1F A;  4LF4 E;  3ECR A;  5A6A A;  5IWA E;  3HTX A;  2DMY A;  4O4K A;  2V86 A;  2DIX A;  3DF6 A;  1SFE A;  1WHN A;  2V83 A;  5A6B D;  3ADL A;  3FIG A;  5AAS A;  2V85 A;  2EMB A;  2EMA A;  2V87 A;  2UUA E;  2ZM6 E;  1UN6 B;  2WBS A;  1F2I G;  1HR0 E;  1UIL A;  2YRM A;  4LTY A;  5AC5 A;  5KL2 A;  2EPN A;  4O5G A;  2EQ1 A;  2EMH A;  2EPU A;  2R1F A;  2L2M A;  2RSM A;  4JV5 E;  1T4L B;  2UXC E;  2CPN A;  4WX9 A;  1YFH A;  2NUE A;  2L2K B;  3HQ1 A;  4X9J A;  3HXL A;  1YYW A;  2EM7 A;  2EPA A;  3J7A G;  3JTZ A;  1N3G A;  4BC7 A;  4R03 A;  2MDR A;  3HPS A;  3THO B;  1BB8 A;  1WRJ A;  2LUP B;  1NCS A;  4F2J C;  2N3G A;  4GZN C;  4FK5 C;  4DV4 E;  2EN1 A;  2GHF A;  2L6M A;  2H36 X;  2EOE A;  4BCA A;  2RTX A;  2EMF A;  3F6H A;  2DB2 A;  4F54 A;  1T38 A;  2MKD A;  2HGH A;  2WBU A;  3L00 A;  4B3T E;  4MLV A;  2VQF E;  5LLQ A;  4O43 A;  2M9A A;  1A1I A;  2EOZ A;  1FJG E;  1A1G A;  4OOG C;  2EOO A;  2VQE E;  2I13 A;  2E1M A;  2EPP A;  1A1H A;  4LFC E;  1PJS A;  2EN3 A;  2UXD E;  5LMN E;  1PKP A;  2EE8 A;  2EPM X;  4Q35 B;  4X65 E;  4BBY A;  2FTX B;  4YY3 E;  1MEY C;  1JK2 A;  1DQ3 A;  3EPL A;  3OML A;  4LFA E;  5AE1 A;  2UU9 E;  1N32 E;  5FLX C;  4TUG A;  2JWO A;  1X6E A;  4BMJ A;  2N3H A;  2LBS B;  1X49 A;  5T6J A;  2JOB A;  1UHZ A;  4P78 A;  2R76 A;  4IJD A;  1BBG A;  3LML A;  2LE2 A;  1IBM E;  2EMZ A;  2JP9 A;  1IBL E;  4JI3 E;  3AUZ A;  4O24 A;  5A6J A;  2CT1 A;  1X6H A;  1ZBT A;  3UK3 C;  1YYO A;  2F4V E;  3MSW A;  1IQO A;  4DR5 E;  4DV5 E;  2LJH A;  2EL5 A;  5ADZ A;  1PJT A;  1N33 E;  3BF2 A;  3J7Y p;  1A1K A;  3M99 B;  3BBG A;  5IV8 B;  1AH5 A;  2NUG A;  2YTI A;  2EM6 A;  3KZY A;  2E72 A;  2LRS A;  2M7Q A;  2E5L E;  3VYY A;  2EMY A;  2EOS A;  2JVA A;  4ZYE A;  2EM8 A;  3EQ1 A;  2V89 A;  2LUQ A;  1XNR E;  2YSO A;  1TF3 A;  3C6M A;  4Q28 A;  3MHS C;  4ZYH A;  5IT9 C;  4JI5 E;  4JI7 E;  5AE3 A;  4LF5 E;  4JI1 E;  1WJP A;  3QG5 C;  2YTD A;  1YYK A;  2EPC A;  1TN9 A;  5KL6 A;  2HJJ A;  1X48 A;  2L3C A;  2LMZ A;  3JU0 A;  2L3J A;  4WSG A;  3KZZ A;  2VF1 A;  4MLQ A;  1X47 A;  3BGH A;  4B3R E;  1O0W A;  1WHQ A;  2EPK X;  1WXR A;  1IMU A;  5KL7 A;  2EMX A;  5A69 A;  2I9I A;  2LT7 A;  3OTO E;  4M2Z A;  2YTO A;  4LU9 A;  4F9B B;  4NXM E;  4IS1 C;  1AAY A;  1PDA A;  4B3S E;  2EOX A;  3VK6 A;  4WFT A;  2WZO A;  3BID A;  2NAB A;  5LL6 R;  4DV2 E;  2NA2 A;  1A1J A;  3LLH A;  2A25 A;  4LF7 E;  4M30 A;  4JI6 E;  3KWR A;  4DR7 E;  4DV1 E;  5DNY A;  3H09 A;  2YTN A;  4F6N A;  2JYA A;  1T4O A;  2EM4 A;  4WPY A;  2DRP A;  2EM5 A;  2EOQ A;  2UUC E; 
#chains in the Genus database with same CATH homology
 1PKP A;  2B7V A;  4DV6 E;  4DV7 E;  2ODR D;  4X65 E;  1XMO E;  4BBY A;  1XNQ E;  4DR4 E;  2FTX B;  2MC5 A;  2V8Q B;  4YY3 E;  4K0K E;  2JR1 A;  1DQ3 A;  5F3W A;  1HNW E;  4DR6 E;  4GKK E;  2M4I A;  3OML A;  4KZS A;  2RS7 A;  4LFA E;  5AE1 A;  2UU9 E;  4LFB E;  2VE7 C;  5A2Q C;  1N32 E;  5FLX C;  4DR3 E;  4BS9 A;  1N34 E;  4TUG A;  3F6G A;  2B3T B;  1QU6 A;  2F8B A;  2JWO A;  2LTS A;  3C4B A;  4R8O A;  4LF9 E;  2L33 A;  3K6Q A;  2B9D A;  5BR8 E;  4BC9 A;  3C4T A;  3J81 C;  4BMJ A;  1RC7 A;  4LF6 E;  4LF8 E;  3ADI A;  4DR2 E;  2N3H A;  2LBS B;  4NXN E;  1X49 A;  1J5E E;  4DUY E;  4AQY E;  5T6J A;  2JOB A;  4M0V A;  3T1H E;  1UHZ A;  4DV3 E;  1XMQ E;  2L8T A;  2B7T A;  2L92 A;  4TUI A;  2HHH E;  4P78 A;  1ZBQ A;  5LMU E;  3VYX A;  3LML A;  2LE2 A;  1SR9 A;  5CFF E;  1I94 E;  1IBL E;  2G7H A;  1HNX E;  1IBM E;  4JI3 E;  2JOX A;  2K4V A;  1FKA E;  3AUZ A;  4DMI A;  4B3M E;  3IWD A;  4LF4 E;  3ADJ A;  5IWA E;  2UUB E;  1ZBT A;  1YYO A;  3HTX A;  4F9C B;  2DMY A;  2F4V E;  3MSW A;  4DR5 E;  4DV5 E;  2LJH A;  2V86 A;  5ADZ A;  2DIX A;  3DF6 A;  1N33 E;  4WSP A;  1WHN A;  2V83 A;  3J7Y p;  3ADL A;  3HPZ A;  3FIG A;  5AAS A;  2V85 A;  2NUG A;  1T4N A;  4JI8 E;  4X62 E;  2EZ6 A;  2V87 A;  2UUA E;  2ZM6 E;  4P7D A;  2NUF A;  1HR0 E;  2LRS A;  2M7Q A;  3T1Y E;  1HNZ E;  1UIL A;  3VYY A;  2E5L E;  4LTY A;  3J80 C;  2JVA A;  2IHR 1;  3IWB A;  4DV0 E;  1YZ9 A;  2V89 A;  2LUQ A;  2YT4 A;  4X8W A;  2L2M A;  2RSM A;  1XNR E;  4JV5 E;  1T4L B;  4JI2 E;  2CPN A;  2UXC E;  3DJW A;  4Q28 A;  4X64 E;  2V88 A;  2L2K B;  3HQ1 A;  2DSY A;  4X66 E;  5IT9 C;  2NUE A;  4JI5 E;  3HXL A;  4JI7 E;  4I8O A;  5AE3 A;  4LF5 E;  4JI0 E;  4JI1 E;  1YYW A;  4JI4 E;  1YYK A;  4DUZ E;  1N36 E;  3J7A G;  3JTZ A;  4BC7 A;  1EKZ A;  4R03 A;  4L5N C;  2MDR A;  3HPS A;  1X48 A;  4DR1 E;  4OX9 E;  4JYA E;  1J26 A;  2L3C A;  2ODR C;  2LMZ A;  2FGG A;  3JU0 A;  2L3J A;  4GKJ E;  2LUP B;  2VF1 A;  3IWC A;  4KHP E;  3AV0 A;  1X47 A;  4B3R E;  1O0W A;  5AE2 A;  1WHQ A;  1WXR A;  2KON A;  2N3G A;  4DV4 E;  2RS6 A;  3P1X A;  2FV4 B;  2JY9 A;  1STU A;  2L6M A;  3OTO E;  4M2Z A;  4F9B B;  2H36 X;  4GEQ B;  4LU9 A;  4NXM E;  2LTR A;  4B3S E;  4J8Z A;  2KHX A;  3VK6 A;  4BCA A;  4WFT A;  2RTX A;  2WZO A;  4YHH E;  4L8N A;  3F6H A;  2DB2 A;  4F54 A;  5LL6 R;  4DV2 E;  3RMP A;  2M1S A;  2NA2 A;  2YZT A;  4WYQ B;  3LLH A;  3ZOQ B;  2KOU A;  4B3T E;  4DKK A;  1GQE A;  4LF7 E;  4M30 A;  1RQ0 A;  1GZ6 A;  2EWL A;  4F9A B;  2VQF E;  4JI6 E;  3KWR A;  1IBK E;  4DR7 E;  4DV1 E;  2L2N A;  3ADG A;  5DNY A;  3H09 A;  1DI2 A;  1FJG E;  3JAM C;  4OOG C;  1T4O A;  2VQE E;  2E1M A;  2MC6 A;  4LFC E;  4WPY A;  2UUC E;  2UXD E;  2UXB E;  5LMN E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...