2FTXB

Crystal structure of the yeast kinetochore spc24/spc25 globular domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
59
structure length
59
Chain Sequence
ANENILKLKLYRSLGVILDLENDQVLINRKNDGNIDILPLDNNLSDFYKTKYIWERLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypothetical 25.2 kDa protein in AFG3-SEB2 intergenic region
publication title Atomic Structure of the kinetochore Spc24p/Spc25p globular domain reveals a novel fold
rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein, protein binding
total genus 15
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.430 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ftxB00
4GEQB 2FTXB 2FV4B 5T6JA
chains in the Genus database with same CATH superfamily
4B3ME 2EWLA 2BB8A 2DLKA 2UXCE 1XMOE 4K0KE 1DI2A 4X8WA 2M1SA 2EOJA 3C6KA 1AAYA 2LCEA 4ZYDA 5TSEA 2VF1A 5KL5A 4J8ZA 1HNZE 2B3TB 1ZBQA 3BIDA 4WYQB 4DMIA 5FLXC 2NUGA 2EL5A 1MGTA 3HXLA 2EOEA 4KHPE 4X62E 4LF7E 4M0VA 4R2DA 4B3RE 1IBME 2R1FA 2EN7A 4JI6E 1FJGE 1HR0E 1N33E 5BR8E 2ELZA 2EMGA 4M2ZA 3K6QA 1ZU1A 3L00A 1YFHA 2ZM6E 2EMYA 5CFFE 2EP3A 4R2PA 2WBUA 5A69A 2ENAA 2V89A 1FKAE 2EZ6A 3M99B 2EPNA 2EQ3A 2MC5A 2EPZA 2N3GA 4O4KA 2CTDA 2B7VA 2YTQA 1X47A 4IJDA 2D9HA 2EMHA 3HQ1A 4DV2E 2UXDE 4GKJE 2EOYA 1ZAAC 4R2CA 2EOOA 2HGHA 1L4SA 2DIXA 3DJWA 2DMYA 2VRDA 2YTJA 2EMFA 4X64E 4N4RB 4AQYE 5A6AA 5KL2A 2YTNA 4LFAE 4LF4E 4DV7E 2EM6A 1PJQA 2GPIA 4F2JC 2NA2A 2YTDA 1IQOA 2V8QB 2EOZA 4B3SE 2MKNA 4WPYA 3KZZA 1UBDC 2KOUA 4M30A 1YZ9A 3MHHC 1NEIA 2G7HA 3HPZA 1WHQA 4IS1C 2LO3A 1TF6A 2DSYA 1EH6A 2JOXA 4LTYA 4OX9E 2JR1A 1QU6A 2EMIA 4O5GA 4R2RA 4LFCE 2HHHE 4L8NA 2L2NA 2LUQA 4NZVA 4P7DA 2UUCE 4ZYEA 4RHBB 2EPXA 2ENCA 1X3CA 2EOMA 1PJSA 2EORA 2GHFA 1YUIA 3BF2A 1G2FC 2V88A 4Q35B 1JK2A 2EMCA 4JI5E 2A25A 4BHCA 2HJJA 2ADRA 5LLQA 3VHTB 2CSHA 4NHRA 3JU0A 5A6BD 5DNYA 2LTRA 1ZR9A 2RPCA 4JI3E 3KWRA 2HC5A 3JTZA 1STUA 2KHXA 2MKDA 1RC7A 1GZ6A 2H36X 2L3JA 4X66E 2DRPA 4DV0E 2YU8A 4HEIA 2L33A 1EKZA 2EL4A 4RH8A 1A1IA 2EOIA 4O43A 5KL4A 5A2QC 2LT7A 1YPNA 2YTOA 3J7AG 2RS7A 2RS6A 4WSGA 4WSPA 2YZTA 1XMQE 4DV6E 2EOXA 3IWBA 2IHR1 5AE2A 2LRSA 2WZOA 2EMLA 1YYOA 5LMNE 1A1FA 2YTGA 2EM9A 2L2MA 4LF9E 4F6MA 1JK1A 5A6BA 2EPUA 1T4NA 1WHNA 5AE3A 2UU9E 2EJ4A 1UN6B 1XNQE 1X48A 1A1JA 2EE8A 3EPJA 3C4TA 2MC6A 2K7IA 2B7TA 2L3CA 2L6MA 2EPRA 2EMKA 1AH5A 5AC5A 1P47A 2BBGA 2E72A 2WBTA 4BCAA 2JP9A 1J5EE 2EOFA 4X65E 2Q8UA 4LFBE 2ELYA 2V85A 4WFTA 4KZSA 4LF5E 2YWQA 2EPLX 4JI4E 2EM8A 4JI1E 2EMWA 5LL6R 1HNXE 3H09A 2EM5A 4R03A 1SR9A 5T6JA 3VYXA 1MEYC 3IWCA 2M9AA 1B69A 1HNWE 2EMBA 5AE1A 1YYWA 1BBOA 4P78A 2EL6A 2EPMX 4BMJA 3DF6A 3OMLA 4DUZE 1SFEA 1KJKA 2B9DA 2YU5A 5IV8B 4B3TE 3J81C 1YYKA 4ZYHA 3ECRA 4JI7E 4F9CB 4F6NA 2EQ1A 2LJUA 3LMLA 4R2EA 3BGHA 4DR2E 4DV3E 3OTOE 3C6MA 4R2QA 2V87A 4DV4E 2JVAA 1IBKE 2RQLA 4LF6E 1EH8A 2I9IA 5IWAE 4JI0E 2EPOA 2KONA 1GQEA 4DR3E 1Z1BA 4DR7E 3FIGA 3EPKA 1GTKA 2LJHA 2EN2A 1IQSA 2MDRA 1DGCA 3IWDA 4JI8E 2EN3A 2FGGA 5KL7A 2GLIA 2DB2A 1IBLE 4DKKA 3VYYA 4OOGC 4I8OA 2DMIA 2EM0A 2F8BA 5IT9C 5KL6A 1BBGA 5AASA 2EM2A 2EMAA 1EH7A 4MLQA 2YTEA 2ENHA 2LTSA 2NABA 5LMUE 1X6HA 1X6FA 2L2KB 3F6GA 1UHZA 2WBSA 3MSWA 2JY9A 2N8XA 1KYQA 2YTIA 2YSPA 1XNRE 1T4OA 2LV2A 2EN6A 4LU9A 1WJPA 2NUFA 3F6HA 2YSOA 1A1LA 1A1GA 2UXBE 4BC7A 2JPAA 2JOBA 1O0WA 2JYAA 4Q28A 2MDGA 2M7QA 1N32E 1N3GA 4L5NC 2EOHA 2I13A 1BB8A 4NXNE 4BHBA 2VQEE 2YRMA 1TF3A 1T39A 2LVHA 1WXRA 2EPPA 2CPNA 2CT1A 4GKKE 3P1XA 3TQMA 2EN4A 4DR4E 1F2IG 2EPAA 2RSIA 4R2SA 4TUGA 2EM7A 4X9JA 4WXCA 3J80C 2RTXA 2DLQA 1N36E 3J7Yp 2EM4A 3EPHA 2V83A 1DQ3A 2K4VA 3LLHA 3KZYA 2WCC3 1A1HA 2FTXB 3THOB 1I94E 2EOQA 4DV5E 1UILA 2VE7C 3RMPA 1A1KA 1X6EA 4HTGA 4DR1E 1X49A 4JV5E 4F9AB 2EN8A 3THNA 4GZNC 2L8TA 2ODRC 3BBGA 4KWYA 1QNTA 5ADZA 1NCSA 5F3WA 3MHSC 1YSAC 4F9BB 4R8OA 2YPNA 1PJTA 3HPSA 3AV0A 1J26A 4GEQB 2EQ0A 2LUPB 1IMUA 2M4IA 2YTFA 2J7JA 2YRHA 4M9VC 2LE2A 2LBSB 2VQFE 1G2DC 4JYAE 2N3HA 1X5WA 3ADGA 4DR5E 1RQ0A 4TUIA 2RSMA 2EPKX 1T4LB 2YTPA 1TN9A 2V86A 4DUYE 4MLVA 3ADJA 4F54A 2FV4B 4R2AA 3EPLA 4O24A 3EQ1A 4NXME 1WRJA 3QG5C 2E5LE 4WX9A 2EPCA 3UK3C 1T38A 4JI2E 2F4VE 4FK5C 5A6JA 2YRKA 4BBYA 2UUAE 4BC9A 1YUJA 1N34E 2EMXA 5AC4A 3HTXA 4DV1E 2ODRD 2JXPA 1PKPA 2EN1A 2YT4A 4YY3E 4WXDA 2UUBE 2LMZA 4DR6E 3T1HE 4YHHE 4ZYGA 3ADLA 2R76A 1ZBTA 3AUZA 2DGCA 2NUEA 3C4BA 5KL3A 2EOSA 2EMZA 2JWOA 1LLMC 2L92A 3JAMC 2PRTA 3T1YE 3VK6A 1PDAA 5IXMB 2EM3A 3ZOQB 2E1MA 3ADIA 4LF8E 5A6KA 1RMDA 4BS9A
chains in the Genus database with same CATH topology
4B3ME 4DR4E 1HNWE 2EWLA 2UXCE 5AE1A 1YYWA 4TUGA 4P78A 1XMOE 4K0KE 3J80C 3JU0A 4BMJA 3DF6A 3OMLA 4X8WA 2RTXA 4DUZE 1DI2A 2M1SA 5DNYA 1N36E 3J7Yp 2LTRA 4JI3E 2B9DA 1SR9A 2V83A 3KWRA 3J81C 4B3TE 1YYKA 1DQ3A 2VF1A 4J8ZA 3JTZA 2K4VA 1STUA 2B3TB 1ZBQA 2KHXA 3LLHA 4WYQB 2FTXB 4DMIA 5FLXC 1RC7A 2NUGA 4JI7E 4F9CB 1HNZE 3HXLA 1GZ6A 1I94E 4DV5E 3LMLA 2H36X 1UILA 2VE7C 4DR2E 4X62E 4DV3E 4LF7E 4M0VA 2L3JA 3OTOE 3RMPA 4X66E 4DV0E 4B3RE 1IBME 2V87A 4JI6E 2L33A 1FJGE 1EKZA 4DR1E 1HR0E 4DV4E 1N33E 5BR8E 1X49A 5A2QC 2JVAA 1IBKE 4M2ZA 4JV5E 4F9AB 3K6QA 3J7AG 2RS7A 2RS6A 4LF6E 2L8TA 2ODRC 5IWAE 4WSPA 2ZM6E 4JI0E 2KONA 1GQEA 5ADZA 5CFFE 4DR3E 2UXDE 5F3WA 4DR7E 3FIGA 4F9BB 4R8OA 2YZTA 2V89A 2LJHA 3HPSA 1FKAE 3AV0A 2EZ6A 1J26A 1XMQE 2MDRA 4GEQB 4DV6E 3IWDA 3IWBA 2IHR1 2MC5A 4JI8E 5AE2A 2LRSA 2WZOA 2LUPB 2N3GA 1YYOA 2FGGA 5LMNE 2B7VA 2M4IA 2DB2A 1IBLE 1X47A 4DKKA 3VYYA 4OOGC 4I8OA 3HQ1A 2F8BA 2LE2A 4DV2E 2VQFE 2LBSB 2L2MA 5IT9C 4LF9E 4JYAE 2N3HA 4GKJE 3ADGA 4DR5E 1RQ0A 5AASA 2RSMA 4TUIA 1T4LB 3DJWA 1T4NA 1WHNA 2DMYA 2V86A 4DUYE 3ADJA 5AE3A 4F54A 4X64E 4AQYE 2UU9E 2LTSA 4LFAE 2FV4B 5LMUE 4LF4E 4DV7E 4NXME 1XNQE 2E5LE 2L2KB 2NA2A 3F6GA 1X48A 2V8QB 4B3SE 1UHZA 4JI2E 2F4VE 4WPYA 4BBYA 2UUAE 3MSWA 4BC9A 3C4TA 2JY9A 2MC6A 2B7TA 2L3CA 1N34E 2KOUA 3HTXA 2L6MA 1T4OA 4DV1E 2ODRD 1XNRE 4M30A 1PKPA 1YZ9A 4YY3E 2YT4A 2G7HA 2UUBE 2LMZA 4LU9A 3HPZA 3T1HE 4YHHE 1WHQA 2NUFA 3ADLA 4DR6E 3F6HA 1ZBTA 3AUZA 2NUEA 2DSYA 3C4BA 2UXBE 4BC7A 2JOXA 4LTYA 4OX9E 2JWOA 2JOBA 2JR1A 4BCAA 1QU6A 1O0WA 4LFCE 2L92A 1J5EE 4X65E 2HHHE 4Q28A 3JAMC 2M7QA 4L8NA 1N32E 3T1YE 2L2NA 2LUQA 4P7DA 3VK6A 2UUCE 4L5NC 4LFBE 4NXNE 2V85A 3ZOQB 4WFTA 4KZSA 4LF5E 2VQEE 4JI4E 4JI1E 4KHPE 1WXRA 2E1MA 5LL6R 1HNXE 2V88A 2CPNA 3H09A 3ADIA 4LF8E 4GKKE 5T6JA 4R03A 2DIXA 3VYXA 3P1XA 4JI5E 3IWCA 4BS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GEQ B;  2FTX B;  2FV4 B;  5T6J A; 
#chains in the Genus database with same CATH topology
 4B3M E;  2EWL A;  2BB8 A;  2DLK A;  2UXC E;  1XMO E;  4K0K E;  1DI2 A;  4X8W A;  2M1S A;  2EOJ A;  3C6K A;  1AAY A;  2LCE A;  4ZYD A;  5TSE A;  2VF1 A;  5KL5 A;  4J8Z A;  1HNZ E;  2B3T B;  1ZBQ A;  3BID A;  4WYQ B;  4DMI A;  5FLX C;  2NUG A;  2EL5 A;  1MGT A;  3HXL A;  2EOE A;  4KHP E;  4X62 E;  4LF7 E;  4M0V A;  4R2D A;  4B3R E;  1IBM E;  2R1F A;  2EN7 A;  4JI6 E;  1FJG E;  1HR0 E;  1N33 E;  5BR8 E;  2ELZ A;  2EMG A;  4M2Z A;  3K6Q A;  1ZU1 A;  3L00 A;  1YFH A;  2ZM6 E;  2EMY A;  5CFF E;  2EP3 A;  4R2P A;  2WBU A;  5A69 A;  2ENA A;  2V89 A;  1FKA E;  2EZ6 A;  3M99 B;  2EPN A;  2EQ3 A;  2MC5 A;  2EPZ A;  2N3G A;  4O4K A;  2CTD A;  2B7V A;  2YTQ A;  1X47 A;  4IJD A;  2D9H A;  2EMH A;  3HQ1 A;  4DV2 E;  2UXD E;  4GKJ E;  2EOY A;  1ZAA C;  4R2C A;  2EOO A;  2HGH A;  1L4S A;  2DIX A;  3DJW A;  2DMY A;  2VRD A;  2YTJ A;  2EMF A;  4X64 E;  4N4R B;  4AQY E;  5A6A A;  5KL2 A;  2YTN A;  4LFA E;  4LF4 E;  4DV7 E;  2EM6 A;  1PJQ A;  2GPI A;  4F2J C;  2NA2 A;  2YTD A;  1IQO A;  2V8Q B;  2EOZ A;  4B3S E;  2MKN A;  4WPY A;  3KZZ A;  1UBD C;  2KOU A;  4M30 A;  1YZ9 A;  3MHH C;  1NEI A;  2G7H A;  3HPZ A;  1WHQ A;  4IS1 C;  2LO3 A;  1TF6 A;  2DSY A;  1EH6 A;  2JOX A;  4LTY A;  4OX9 E;  2JR1 A;  1QU6 A;  2EMI A;  4O5G A;  4R2R A;  4LFC E;  2HHH E;  4L8N A;  2L2N A;  2LUQ A;  4NZV A;  4P7D A;  2UUC E;  4ZYE A;  4RHB B;  2EPX A;  2ENC A;  1X3C A;  2EOM A;  1PJS A;  2EOR A;  2GHF A;  1YUI A;  3BF2 A;  1G2F C;  2V88 A;  4Q35 B;  1JK2 A;  2EMC A;  4JI5 E;  2A25 A;  4BHC A;  2HJJ A;  2ADR A;  5LLQ A;  3VHT B;  2CSH A;  4NHR A;  3JU0 A;  5A6B D;  5DNY A;  2LTR A;  1ZR9 A;  2RPC A;  4JI3 E;  3KWR A;  2HC5 A;  3JTZ A;  1STU A;  2KHX A;  2MKD A;  1RC7 A;  1GZ6 A;  2H36 X;  2L3J A;  4X66 E;  2DRP A;  4DV0 E;  2YU8 A;  4HEI A;  2L33 A;  1EKZ A;  2EL4 A;  4RH8 A;  1A1I A;  2EOI A;  4O43 A;  5KL4 A;  5A2Q C;  2LT7 A;  1YPN A;  2YTO A;  3J7A G;  2RS7 A;  2RS6 A;  4WSG A;  4WSP A;  2YZT A;  1XMQ E;  4DV6 E;  2EOX A;  3IWB A;  2IHR 1;  5AE2 A;  2LRS A;  2WZO A;  2EML A;  1YYO A;  5LMN E;  1A1F A;  2YTG A;  2EM9 A;  2L2M A;  4LF9 E;  4F6M A;  1JK1 A;  5A6B A;  2EPU A;  1T4N A;  1WHN A;  5AE3 A;  2UU9 E;  2EJ4 A;  1UN6 B;  1XNQ E;  1X48 A;  1A1J A;  2EE8 A;  3EPJ A;  3C4T A;  2MC6 A;  2K7I A;  2B7T A;  2L3C A;  2L6M A;  2EPR A;  2EMK A;  1AH5 A;  5AC5 A;  1P47 A;  2BBG A;  2E72 A;  2WBT A;  4BCA A;  2JP9 A;  1J5E E;  2EOF A;  4X65 E;  2Q8U A;  4LFB E;  2ELY A;  2V85 A;  4WFT A;  4KZS A;  4LF5 E;  2YWQ A;  2EPL X;  4JI4 E;  2EM8 A;  4JI1 E;  2EMW A;  5LL6 R;  1HNX E;  3H09 A;  2EM5 A;  4R03 A;  1SR9 A;  5T6J A;  3VYX A;  1MEY C;  3IWC A;  2M9A A;  1B69 A;  1HNW E;  2EMB A;  5AE1 A;  1YYW A;  1BBO A;  4P78 A;  2EL6 A;  2EPM X;  4BMJ A;  3DF6 A;  3OML A;  4DUZ E;  1SFE A;  1KJK A;  2B9D A;  2YU5 A;  5IV8 B;  4B3T E;  3J81 C;  1YYK A;  4ZYH A;  3ECR A;  4JI7 E;  4F9C B;  4F6N A;  2EQ1 A;  2LJU A;  3LML A;  4R2E A;  3BGH A;  4DR2 E;  4DV3 E;  3OTO E;  3C6M A;  4R2Q A;  2V87 A;  4DV4 E;  2JVA A;  1IBK E;  2RQL A;  4LF6 E;  1EH8 A;  2I9I A;  5IWA E;  4JI0 E;  2EPO A;  2KON A;  1GQE A;  4DR3 E;  1Z1B A;  4DR7 E;  3FIG A;  3EPK A;  1GTK A;  2LJH A;  2EN2 A;  1IQS A;  2MDR A;  1DGC A;  3IWD A;  4JI8 E;  2EN3 A;  2FGG A;  5KL7 A;  2GLI A;  2DB2 A;  1IBL E;  4DKK A;  3VYY A;  4OOG C;  4I8O A;  2DMI A;  2EM0 A;  2F8B A;  5IT9 C;  5KL6 A;  1BBG A;  5AAS A;  2EM2 A;  2EMA A;  1EH7 A;  4MLQ A;  2YTE A;  2ENH A;  2LTS A;  2NAB A;  5LMU E;  1X6H A;  1X6F A;  2L2K B;  3F6G A;  1UHZ A;  2WBS A;  3MSW A;  2JY9 A;  2N8X A;  1KYQ A;  2YTI A;  2YSP A;  1XNR E;  1T4O A;  2LV2 A;  2EN6 A;  4LU9 A;  1WJP A;  2NUF A;  3F6H A;  2YSO A;  1A1L A;  1A1G A;  2UXB E;  4BC7 A;  2JPA A;  2JOB A;  1O0W A;  2JYA A;  4Q28 A;  2MDG A;  2M7Q A;  1N32 E;  1N3G A;  4L5N C;  2EOH A;  2I13 A;  1BB8 A;  4NXN E;  4BHB A;  2VQE E;  2YRM A;  1TF3 A;  1T39 A;  2LVH A;  1WXR A;  2EPP A;  2CPN A;  2CT1 A;  4GKK E;  3P1X A;  3TQM A;  2EN4 A;  4DR4 E;  1F2I G;  2EPA A;  2RSI A;  4R2S A;  4TUG A;  2EM7 A;  4X9J A;  4WXC A;  3J80 C;  2RTX A;  2DLQ A;  1N36 E;  3J7Y p;  2EM4 A;  3EPH A;  2V83 A;  1DQ3 A;  2K4V A;  3LLH A;  3KZY A;  2WCC 3;  1A1H A;  2FTX B;  3THO B;  1I94 E;  2EOQ A;  4DV5 E;  1UIL A;  2VE7 C;  3RMP A;  1A1K A;  1X6E A;  4HTG A;  4DR1 E;  1X49 A;  4JV5 E;  4F9A B;  2EN8 A;  3THN A;  4GZN C;  2L8T A;  2ODR C;  3BBG A;  4KWY A;  1QNT A;  5ADZ A;  1NCS A;  5F3W A;  3MHS C;  1YSA C;  4F9B B;  4R8O A;  2YPN A;  1PJT A;  3HPS A;  3AV0 A;  1J26 A;  4GEQ B;  2EQ0 A;  2LUP B;  1IMU A;  2M4I A;  2YTF A;  2J7J A;  2YRH A;  4M9V C;  2LE2 A;  2LBS B;  2VQF E;  1G2D C;  4JYA E;  2N3H A;  1X5W A;  3ADG A;  4DR5 E;  1RQ0 A;  4TUI A;  2RSM A;  2EPK X;  1T4L B;  2YTP A;  1TN9 A;  2V86 A;  4DUY E;  4MLV A;  3ADJ A;  4F54 A;  2FV4 B;  4R2A A;  3EPL A;  4O24 A;  3EQ1 A;  4NXM E;  1WRJ A;  3QG5 C;  2E5L E;  4WX9 A;  2EPC A;  3UK3 C;  1T38 A;  4JI2 E;  2F4V E;  4FK5 C;  5A6J A;  2YRK A;  4BBY A;  2UUA E;  4BC9 A;  1YUJ A;  1N34 E;  2EMX A;  5AC4 A;  3HTX A;  4DV1 E;  2ODR D;  2JXP A;  1PKP A;  2EN1 A;  2YT4 A;  4YY3 E;  4WXD A;  2UUB E;  2LMZ A;  4DR6 E;  3T1H E;  4YHH E;  4ZYG A;  3ADL A;  2R76 A;  1ZBT A;  3AUZ A;  2DGC A;  2NUE A;  3C4B A;  5KL3 A;  2EOS A;  2EMZ A;  2JWO A;  1LLM C;  2L92 A;  3JAM C;  2PRT A;  3T1Y E;  3VK6 A;  1PDA A;  5IXM B;  2EM3 A;  3ZOQ B;  2E1M A;  3ADI A;  4LF8 E;  5A6K A;  1RMD A;  4BS9 A; 
#chains in the Genus database with same CATH homology
 4B3M E;  4DR4 E;  1HNW E;  2EWL A;  2UXC E;  5AE1 A;  1YYW A;  4TUG A;  4P78 A;  1XMO E;  4K0K E;  3J80 C;  3JU0 A;  4BMJ A;  3DF6 A;  3OML A;  4X8W A;  2RTX A;  4DUZ E;  1DI2 A;  2M1S A;  5DNY A;  1N36 E;  3J7Y p;  2LTR A;  4JI3 E;  2B9D A;  1SR9 A;  2V83 A;  3KWR A;  3J81 C;  4B3T E;  1YYK A;  1DQ3 A;  2VF1 A;  4J8Z A;  3JTZ A;  2K4V A;  1STU A;  2B3T B;  1ZBQ A;  2KHX A;  3LLH A;  4WYQ B;  2FTX B;  4DMI A;  5FLX C;  1RC7 A;  2NUG A;  4JI7 E;  4F9C B;  1HNZ E;  3HXL A;  1GZ6 A;  1I94 E;  4DV5 E;  3LML A;  2H36 X;  1UIL A;  2VE7 C;  4DR2 E;  4X62 E;  4DV3 E;  4LF7 E;  4M0V A;  2L3J A;  3OTO E;  3RMP A;  4X66 E;  4DV0 E;  4B3R E;  1IBM E;  2V87 A;  4JI6 E;  2L33 A;  1FJG E;  1EKZ A;  4DR1 E;  1HR0 E;  4DV4 E;  1N33 E;  5BR8 E;  1X49 A;  5A2Q C;  2JVA A;  1IBK E;  4M2Z A;  4JV5 E;  4F9A B;  3K6Q A;  3J7A G;  2RS7 A;  2RS6 A;  4LF6 E;  2L8T A;  2ODR C;  5IWA E;  4WSP A;  2ZM6 E;  4JI0 E;  2KON A;  1GQE A;  5ADZ A;  5CFF E;  4DR3 E;  2UXD E;  5F3W A;  4DR7 E;  3FIG A;  4F9B B;  4R8O A;  2YZT A;  2V89 A;  2LJH A;  3HPS A;  1FKA E;  3AV0 A;  2EZ6 A;  1J26 A;  1XMQ E;  2MDR A;  4GEQ B;  4DV6 E;  3IWD A;  3IWB A;  2IHR 1;  2MC5 A;  4JI8 E;  5AE2 A;  2LRS A;  2WZO A;  2LUP B;  2N3G A;  1YYO A;  2FGG A;  5LMN E;  2B7V A;  2M4I A;  2DB2 A;  1IBL E;  1X47 A;  4DKK A;  3VYY A;  4OOG C;  4I8O A;  3HQ1 A;  2F8B A;  2LE2 A;  4DV2 E;  2VQF E;  2LBS B;  2L2M A;  5IT9 C;  4LF9 E;  4JYA E;  2N3H A;  4GKJ E;  3ADG A;  4DR5 E;  1RQ0 A;  5AAS A;  2RSM A;  4TUI A;  1T4L B;  3DJW A;  1T4N A;  1WHN A;  2DMY A;  2V86 A;  4DUY E;  3ADJ A;  5AE3 A;  4F54 A;  4X64 E;  4AQY E;  2UU9 E;  2LTS A;  4LFA E;  2FV4 B;  5LMU E;  4LF4 E;  4DV7 E;  4NXM E;  1XNQ E;  2E5L E;  2L2K B;  2NA2 A;  3F6G A;  1X48 A;  2V8Q B;  4B3S E;  1UHZ A;  4JI2 E;  2F4V E;  4WPY A;  4BBY A;  2UUA E;  3MSW A;  4BC9 A;  3C4T A;  2JY9 A;  2MC6 A;  2B7T A;  2L3C A;  1N34 E;  2KOU A;  3HTX A;  2L6M A;  1T4O A;  4DV1 E;  2ODR D;  1XNR E;  4M30 A;  1PKP A;  1YZ9 A;  4YY3 E;  2YT4 A;  2G7H A;  2UUB E;  2LMZ A;  4LU9 A;  3HPZ A;  3T1H E;  4YHH E;  1WHQ A;  2NUF A;  3ADL A;  4DR6 E;  3F6H A;  1ZBT A;  3AUZ A;  2NUE A;  2DSY A;  3C4B A;  2UXB E;  4BC7 A;  2JOX A;  4LTY A;  4OX9 E;  2JWO A;  2JOB A;  2JR1 A;  4BCA A;  1QU6 A;  1O0W A;  4LFC E;  2L92 A;  1J5E E;  4X65 E;  2HHH E;  4Q28 A;  3JAM C;  2M7Q A;  4L8N A;  1N32 E;  3T1Y E;  2L2N A;  2LUQ A;  4P7D A;  3VK6 A;  2UUC E;  4L5N C;  4LFB E;  4NXN E;  2V85 A;  3ZOQ B;  4WFT A;  4KZS A;  4LF5 E;  2VQE E;  4JI4 E;  4JI1 E;  4KHP E;  1WXR A;  2E1M A;  5LL6 R;  1HNX E;  2V88 A;  2CPN A;  3H09 A;  3ADI A;  4LF8 E;  4GKK E;  5T6J A;  4R03 A;  2DIX A;  3VYX A;  3P1X A;  4JI5 E;  3IWC A;  4BS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...