2FTXB

Crystal structure of the yeast kinetochore spc24/spc25 globular domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
59
structure length
59
Chain Sequence
ANENILKLKLYRSLGVILDLENDQVLINRKNDGNIDILPLDNNLSDFYKTKYIWERLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Atomic Structure of the kinetochore Spc24p/Spc25p globular domain reveals a novel fold
rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein, protein binding
molecule keywords Hypothetical 25.2 kDa protein in AFG3-SEB2 intergenic region
total genus 15
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.430 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ftxB00
2FV4B 4GEQB 2FTXB 5T6JA
chains in the Genus database with same CATH superfamily
2D9HA 1WJPA 4X65E 4O43A 4ZYEA 3C4TA 2V87A 4WSPA 2WBSA 2J7JA 1UHZA 4F6MA 3VYYA 2EPRA 1F2IG 1A1IA 4O24A 4WXCA 5KL7A 1RMDA 2YTGA 3JU0A 2EPPA 2VF1A 4M9VC 4F9CB 3EPJA 2YTPA 2MC6A 1HNXE 2GLIA 1NEIA 4TUIA 2M7QA 2EPZA 2RS7A 3THOB 4FK5C 4DV7E 4LU9A 4LF4E 2HGHA 2EOJA 3C4BA 2N3GA 2LJUA 3K6QA 1T4OA 1STUA 4KWYA 4JI5E 2BB8A 5A6BD 2L3CA 4B3TE 2EPAA 4BCAA 2F8BA 2ADRA 3L00A 2DLKA 2B7VA 2L2NA 3ADJA 4X8WA 1L4SA 2RTXA 2L2KB 4DR5E 2YPNA 2JVAA 5ADZA 5F3WA 2A25A 1T38A 1PJTA 3HTXA 2EQ0A 4DV2E 2EMZA 3THNA 4DKKA 3P1XA 1KYQA 1KJKA 4N4RB 3JAMC 2LO3A 2ELZA 5KL3A 3MSWA 4MLVA 5IWAE 2EQ3A 4M0VA 1YYKA 2YTIA 1ZAAC 2LE2A 1A1LA 2YTFA 2VRDA 1HNWE 2CTDA 2V83A 2EN8A 2ZM6E 2EORA 3J80C 2UXBE 1X6FA 2EN3A 4DR1E 1GQEA 4MLQA 2YSOA 2YRHA 2EMAA 4I8OA 3BGHA 2EMLA 2EOZA 4JI6E 5FLXC 4KHPE 2UU9E 5IT9C 4DV3E 2BBGA 4JI1E 3C6MA 1YUJA 1HNZE 2EN1A 4DR4E 2MC5A 2V86A 3T1YE 4DV1E 2EM2A 5AE1A 4DR6E 2YTNA 4R2AA 1WHNA 2YT4A 2YRMA 5KL6A 2JPAA 2LCEA 4JI8E 2LUQA 1JK2A 4X64E 3EQ1A 4JI2E 2LT7A 2EPMX 2YTJA 2YTOA 2CSHA 4B3SE 2ENHA 2MKDA 4F2JC 1A1FA 2JOXA 4P7DA 4R2DA 2M4IA 2EPCA 4JYAE 2EM7A 2EL6A 3KZZA 5A6BA 2E5LE 4B3ME 1PKPA 1QU6A 3LLHA 4DMIA 5A6JA 3J7Yp 2WZOA 1J5EE 2EWLA 5KL4A 5IV8B 4F9BB 2DMYA 1EH8A 2EMGA 4LFAE 4K0KE 2FGGA 3VHTB 2WCC3 3J81C 1AAYA 2L92A 4P78A 4L5NC 3OMLA 3BIDA 4R2CA 3AUZA 2EM8A 2EOQA 1T4LB 2EL4A 3LMLA 3DF6A 3HPZA 5AC4A 2NUGA 4DR2E 2EOFA 1JK1A 2HHHE 5LMNE 1ZR9A 1UILA 4NHRA 2CT1A 1WXRA 4TUGA 2DIXA 2I13A 2EQ1A 2L33A 1PJSA 1ZBTA 2EPLX 3BBGA 1DQ3A 4WFTA 4JV5E 4M30A 1X3CA 4WYQB 2L3JA 1ZBQA 1XNRE 4YHHE 4R2PA 4J8ZA 2EMXA 1PJQA 2YTDA 4IS1C 4BHCA 4DUZE 1G2DC 2NUFA 4WXDA 5KL2A 2EOIA 2E1MA 2EOXA 2JYAA 1N34E 2V85A 1XMOE 4DV0E 2NUEA 1X6HA 2EN2A 4BBYA 2ODRC 2M9AA 1BBOA 4LF9E 2V8QB 3J7AG 2ELYA 1X49A 3ADGA 1T39A 4AQYE 2WBTA 4F6NA 1IMUA 4X62E 1EKZA 2F4VE 2EM3A 2B7TA 3ECRA 2EOYA 1A1JA 2EMHA 2EZ6A 2MDRA 1N33E 2EL5A 1J26A 2LMZA 1QNTA 4F9AB 1TF6A 1N3GA 2YSPA 4GEQB 1IQOA 3C6KA 1YZ9A 2FTXB 2YU5A 2MKNA 2G7HA 2DRPA 4Q35B 1YYWA 1MEYC 2Q8UA 2KONA 2MDGA 2JOBA 2CPNA 2EMFA 4R8OA 4RH8A 5A6KA 4BMJA 3DJWA 2YZTA 2EOMA 2EM5A 2HC5A 2LUPB 1BB8A 1ZU1A 2DMIA 3HQ1A 2LRSA 2EE8A 2EOOA 1TN9A 2LV2A 1IBLE 2LTSA 5LLQA 4LF5E 3HPSA 2YRKA 1X48A 2YWQA 1UN6B 2B3TB 1TF3A 2EOEA 2EMBA 4X9JA 4R2SA 2EN4A 2YU8A 2YTEA 2R1FA 4GKKE 2YTQA 2DSYA 4HTGA 4LF7E 4OX9E 2JP9A 4L8NA 2EOHA 5LMUE 5AE2A 2JY9A 2EMIA 2R76A 4GZNC 2E72A 4DV6E 1A1GA 1X47A 1GZ6A 2EM4A 2EMYA 3KWRA 1DI2A 2L8TA 1EH7A 1YFHA 4NXNE 2UXDE 2RSIA 1DGCA 4BS9A 3OTOE 1A1HA 1WHQA 3EPLA 3RMPA 4HEIA 3MHHC 4DUYE 2JXPA 2ENAA 3IWDA 3BF2A 2LVHA 2EMKA 4B3RE 4WX9A 2K4VA 4DR3E 2UUAE 2UUCE 1BBGA 2H36X 2JWOA 3F6HA 5CFFE 1MGTA 2RSMA 4KZSA 2LBSB 2EN7A 2NA2A 2HJJA 1LLMC 2EOSA 5AASA 3JTZA 2VE7C 1XNQE 4JI7E 3EPHA 2VQFE 2DB2A 4Q28A 3HXLA 2I9IA 1SR9A 4M2ZA 1YSAC 2EP3A 2V89A 5AC5A 1PDAA 3IWBA 2L6MA 2UXCE 2EM9A 3KZYA 1P47A 1FJGE 3F6GA 2UUBE 1NCSA 5LL6R 3MHSC 2EM0A 4DV4E 2EPXA 2EPUA 2IHR1 2JR1A 2LTRA 1G2FC 1SFEA 4DV5E 4LFBE 4LF6E 3IWCA 2EPNA 3FIGA 5DNYA 5TSEA 4LTYA 5IXMB 2FV4B 2WBUA 1IBKE 2EMWA 2NABA 4BC9A 4R2RA 4R2EA 2DLQA 1UBDC 3UK3C 5AE3A 3VK6A 4F54A 3VYXA 3T1HE 4WSGA 4R03A 1RC7A 4O5GA 1WRJA 1FKAE 4OOGC 2EN6A 1RQ0A 3M99B 2PRTA 2ENCA 4GKJE 1YYOA 4BHBA 4NZVA 1Z1BA 2L2MA 1AH5A 4WPYA 2RS6A 1EH6A 5KL5A 4LF8E 4ZYGA 4ZYHA 2N8XA 2LJHA 5A2QC 4DR7E 2EPKX 2K7IA 2ODRD 1X6EA 2GHFA 1N36E 1YPNA 1GTKA 2RQLA 3QG5C 4JI0E 1O0WA 1XMQE 4R2QA 3ADIA 2EJ4A 4LFCE 4O4KA 1I94E 2M1SA 2KOUA 2KHXA 5BR8E 4X66E 2EPOA 1YUIA 1T4NA 1B69A 2EMCA 1N32E 4JI3E 2V88A 2B9DA 4IJDA 3ZOQB 1A1KA 1X5WA 5T6JA 4NXME 3TQMA 3AV0A 3H09A 2GPIA 2DGCA 1IQSA 2EM6A 4YY3E 2N3HA 4RHBB 4BC7A 3EPKA 1HR0E 2RPCA 4JI4E 4ZYDA 1IBME 5A6AA 2VQEE 3ADLA 5A69A
chains in the Genus database with same CATH topology
3JTZA 1X49A 4X65E 2VE7C 4DV3E 5IT9C 3C4TA 1XNQE 4JI7E 2VQFE 3ADGA 2V87A 2DB2A 4Q28A 4WSPA 3HXLA 4AQYE 4JI1E 1SR9A 4M2ZA 1UHZA 1HNZE 4DR4E 4X62E 1EKZA 2F4VE 2MC5A 2V86A 2V89A 3VYYA 3ADLA 3T1YE 4DV1E 2B7TA 5AE1A 3IWBA 2L6MA 4DR6E 2UXCE 1WHNA 1FJGE 2EZ6A 3F6GA 2UUBE 2YT4A 2MDRA 1N33E 5LL6R 3JU0A 3J7AG 1J26A 4JI8E 2LUQA 2VF1A 2LMZA 4DV4E 4F9AB 2IHR1 2JR1A 2LTRA 4F9CB 4X64E 2MC6A 4DV5E 1HNXE 4GEQB 1YZ9A 4JI2E 4LFBE 4TUIA 2FTXB 4B3SE 2M7QA 4LF6E 3IWCA 2G7HA 2RS7A 3FIGA 5DNYA 4LTYA 1YYWA 4DV7E 2FV4B 1IBKE 2KONA 2JOXA 2JOBA 2CPNA 4LU9A 4P7DA 4R8OA 2M4IA 4BC9A 4LF4E 4JYAE 4BMJA 3C4BA 3DJWA 2VQEE 2YZTA 2N3GA 2LUPB 3K6QA 1T4OA 1STUA 2E5LE 5AE3A 4B3ME 1PKPA 3VK6A 4F54A 3HQ1A 1QU6A 4JI5E 2LRSA 3VYXA 3LLHA 4DMIA 3T1HE 2LTSA 4R03A 1IBLE 3J7Yp 2L3CA 1RC7A 4LF5E 3HPSA 4B3TE 1FKAE 2WZOA 4OOGC 1J5EE 2EWLA 4BCAA 1RQ0A 2F8BA 1X48A 4F9BB 2DMYA 2B3TB 4LFAE 2B7VA 4GKJE 1YYOA 2L2NA 4K0KE 3ADJA 4X8WA 2L2MA 2FGGA 2RTXA 2L2KB 4DR5E 4WPYA 2JVAA 2RS6A 3J81C 5ADZA 2L92A 4P78A 5F3WA 4LF8E 4L5NC 3OMLA 4GKKE 2LJHA 5A2QC 4DR7E 2DSYA 3AUZA 4LF7E 3HTXA 4DV2E 1T4LB 4OX9E 2ODRD 3LMLA 4DKKA 4L8NA 1N36E 3DF6A 3P1XA 5LMUE 3HPZA 5AE2A 2JY9A 2NUGA 4JI0E 4DR2E 1O0WA 1XMQE 3ADIA 2HHHE 4DV6E 5LMNE 1X47A 1GZ6A 3JAMC 4LFCE 1UILA 3KWRA 1WXRA 2L8TA 1I94E 4TUGA 1DI2A 2DIXA 3MSWA 2M1SA 2KOUA 2KHXA 5IWAE 4NXNE 5BR8E 4X66E 2UXDE 2L33A 1ZBTA 4BS9A 1DQ3A 3OTOE 1T4NA 4WFTA 4JV5E 1WHQA 4M30A 1N32E 3RMPA 4M0VA 4WYQB 2L3JA 1ZBQA 4DUYE 2V88A 4JI3E 2B9DA 1XNRE 1YYKA 3IWDA 2LE2A 4YHHE 4B3RE 2K4VA 4J8ZA 3ZOQB 4DR3E 2UUAE 1HNWE 5T6JA 4NXME 4DUZE 2V83A 3AV0A 3H09A 2NUFA 2UUCE 2JWOA 2H36X 3F6HA 3J80C 2ZM6E 2UXBE 4YY3E 2N3HA 5CFFE 4DR1E 4BC7A 2E1MA 1GQEA 2RSMA 4KZSA 2V85A 2LBSB 1N34E 1HR0E 1XMOE 4DV0E 4JI4E 2NUEA 4I8OA 2NA2A 1IBME 4JI6E 5FLXC 4BBYA 2ODRC 4KHPE 5AASA 4LF9E 2V8QB 2UU9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FV4 B;  4GEQ B;  2FTX B;  5T6J A; 
#chains in the Genus database with same CATH topology
 2D9H A;  1WJP A;  4X65 E;  4O43 A;  4ZYE A;  3C4T A;  2V87 A;  4WSP A;  2WBS A;  2J7J A;  1UHZ A;  4F6M A;  3VYY A;  2EPR A;  1F2I G;  1A1I A;  4O24 A;  4WXC A;  5KL7 A;  1RMD A;  2YTG A;  3JU0 A;  2EPP A;  2VF1 A;  4M9V C;  4F9C B;  3EPJ A;  2YTP A;  2MC6 A;  1HNX E;  2GLI A;  1NEI A;  4TUI A;  2M7Q A;  2EPZ A;  2RS7 A;  3THO B;  4FK5 C;  4DV7 E;  4LU9 A;  4LF4 E;  2HGH A;  2EOJ A;  3C4B A;  2N3G A;  2LJU A;  3K6Q A;  1T4O A;  1STU A;  4KWY A;  4JI5 E;  2BB8 A;  5A6B D;  2L3C A;  4B3T E;  2EPA A;  4BCA A;  2F8B A;  2ADR A;  3L00 A;  2DLK A;  2B7V A;  2L2N A;  3ADJ A;  4X8W A;  1L4S A;  2RTX A;  2L2K B;  4DR5 E;  2YPN A;  2JVA A;  5ADZ A;  5F3W A;  2A25 A;  1T38 A;  1PJT A;  3HTX A;  2EQ0 A;  4DV2 E;  2EMZ A;  3THN A;  4DKK A;  3P1X A;  1KYQ A;  1KJK A;  4N4R B;  3JAM C;  2LO3 A;  2ELZ A;  5KL3 A;  3MSW A;  4MLV A;  5IWA E;  2EQ3 A;  4M0V A;  1YYK A;  2YTI A;  1ZAA C;  2LE2 A;  1A1L A;  2YTF A;  2VRD A;  1HNW E;  2CTD A;  2V83 A;  2EN8 A;  2ZM6 E;  2EOR A;  3J80 C;  2UXB E;  1X6F A;  2EN3 A;  4DR1 E;  1GQE A;  4MLQ A;  2YSO A;  2YRH A;  2EMA A;  4I8O A;  3BGH A;  2EML A;  2EOZ A;  4JI6 E;  5FLX C;  4KHP E;  2UU9 E;  5IT9 C;  4DV3 E;  2BBG A;  4JI1 E;  3C6M A;  1YUJ A;  1HNZ E;  2EN1 A;  4DR4 E;  2MC5 A;  2V86 A;  3T1Y E;  4DV1 E;  2EM2 A;  5AE1 A;  4DR6 E;  2YTN A;  4R2A A;  1WHN A;  2YT4 A;  2YRM A;  5KL6 A;  2JPA A;  2LCE A;  4JI8 E;  2LUQ A;  1JK2 A;  4X64 E;  3EQ1 A;  4JI2 E;  2LT7 A;  2EPM X;  2YTJ A;  2YTO A;  2CSH A;  4B3S E;  2ENH A;  2MKD A;  4F2J C;  1A1F A;  2JOX A;  4P7D A;  4R2D A;  2M4I A;  2EPC A;  4JYA E;  2EM7 A;  2EL6 A;  3KZZ A;  5A6B A;  2E5L E;  4B3M E;  1PKP A;  1QU6 A;  3LLH A;  4DMI A;  5A6J A;  3J7Y p;  2WZO A;  1J5E E;  2EWL A;  5KL4 A;  5IV8 B;  4F9B B;  2DMY A;  1EH8 A;  2EMG A;  4LFA E;  4K0K E;  2FGG A;  3VHT B;  2WCC 3;  3J81 C;  1AAY A;  2L92 A;  4P78 A;  4L5N C;  3OML A;  3BID A;  4R2C A;  3AUZ A;  2EM8 A;  2EOQ A;  1T4L B;  2EL4 A;  3LML A;  3DF6 A;  3HPZ A;  5AC4 A;  2NUG A;  4DR2 E;  2EOF A;  1JK1 A;  2HHH E;  5LMN E;  1ZR9 A;  1UIL A;  4NHR A;  2CT1 A;  1WXR A;  4TUG A;  2DIX A;  2I13 A;  2EQ1 A;  2L33 A;  1PJS A;  1ZBT A;  2EPL X;  3BBG A;  1DQ3 A;  4WFT A;  4JV5 E;  4M30 A;  1X3C A;  4WYQ B;  2L3J A;  1ZBQ A;  1XNR E;  4YHH E;  4R2P A;  4J8Z A;  2EMX A;  1PJQ A;  2YTD A;  4IS1 C;  4BHC A;  4DUZ E;  1G2D C;  2NUF A;  4WXD A;  5KL2 A;  2EOI A;  2E1M A;  2EOX A;  2JYA A;  1N34 E;  2V85 A;  1XMO E;  4DV0 E;  2NUE A;  1X6H A;  2EN2 A;  4BBY A;  2ODR C;  2M9A A;  1BBO A;  4LF9 E;  2V8Q B;  3J7A G;  2ELY A;  1X49 A;  3ADG A;  1T39 A;  4AQY E;  2WBT A;  4F6N A;  1IMU A;  4X62 E;  1EKZ A;  2F4V E;  2EM3 A;  2B7T A;  3ECR A;  2EOY A;  1A1J A;  2EMH A;  2EZ6 A;  2MDR A;  1N33 E;  2EL5 A;  1J26 A;  2LMZ A;  1QNT A;  4F9A B;  1TF6 A;  1N3G A;  2YSP A;  4GEQ B;  1IQO A;  3C6K A;  1YZ9 A;  2FTX B;  2YU5 A;  2MKN A;  2G7H A;  2DRP A;  4Q35 B;  1YYW A;  1MEY C;  2Q8U A;  2KON A;  2MDG A;  2JOB A;  2CPN A;  2EMF A;  4R8O A;  4RH8 A;  5A6K A;  4BMJ A;  3DJW A;  2YZT A;  2EOM A;  2EM5 A;  2HC5 A;  2LUP B;  1BB8 A;  1ZU1 A;  2DMI A;  3HQ1 A;  2LRS A;  2EE8 A;  2EOO A;  1TN9 A;  2LV2 A;  1IBL E;  2LTS A;  5LLQ A;  4LF5 E;  3HPS A;  2YRK A;  1X48 A;  2YWQ A;  1UN6 B;  2B3T B;  1TF3 A;  2EOE A;  2EMB A;  4X9J A;  4R2S A;  2EN4 A;  2YU8 A;  2YTE A;  2R1F A;  4GKK E;  2YTQ A;  2DSY A;  4HTG A;  4LF7 E;  4OX9 E;  2JP9 A;  4L8N A;  2EOH A;  5LMU E;  5AE2 A;  2JY9 A;  2EMI A;  2R76 A;  4GZN C;  2E72 A;  4DV6 E;  1A1G A;  1X47 A;  1GZ6 A;  2EM4 A;  2EMY A;  3KWR A;  1DI2 A;  2L8T A;  1EH7 A;  1YFH A;  4NXN E;  2UXD E;  2RSI A;  1DGC A;  4BS9 A;  3OTO E;  1A1H A;  1WHQ A;  3EPL A;  3RMP A;  4HEI A;  3MHH C;  4DUY E;  2JXP A;  2ENA A;  3IWD A;  3BF2 A;  2LVH A;  2EMK A;  4B3R E;  4WX9 A;  2K4V A;  4DR3 E;  2UUA E;  2UUC E;  1BBG A;  2H36 X;  2JWO A;  3F6H A;  5CFF E;  1MGT A;  2RSM A;  4KZS A;  2LBS B;  2EN7 A;  2NA2 A;  2HJJ A;  1LLM C;  2EOS A;  5AAS A;  3JTZ A;  2VE7 C;  1XNQ E;  4JI7 E;  3EPH A;  2VQF E;  2DB2 A;  4Q28 A;  3HXL A;  2I9I A;  1SR9 A;  4M2Z A;  1YSA C;  2EP3 A;  2V89 A;  5AC5 A;  1PDA A;  3IWB A;  2L6M A;  2UXC E;  2EM9 A;  3KZY A;  1P47 A;  1FJG E;  3F6G A;  2UUB E;  1NCS A;  5LL6 R;  3MHS C;  2EM0 A;  4DV4 E;  2EPX A;  2EPU A;  2IHR 1;  2JR1 A;  2LTR A;  1G2F C;  1SFE A;  4DV5 E;  4LFB E;  4LF6 E;  3IWC A;  2EPN A;  3FIG A;  5DNY A;  5TSE A;  4LTY A;  5IXM B;  2FV4 B;  2WBU A;  1IBK E;  2EMW A;  2NAB A;  4BC9 A;  4R2R A;  4R2E A;  2DLQ A;  1UBD C;  3UK3 C;  5AE3 A;  3VK6 A;  4F54 A;  3VYX A;  3T1H E;  4WSG A;  4R03 A;  1RC7 A;  4O5G A;  1WRJ A;  1FKA E;  4OOG C;  2EN6 A;  1RQ0 A;  3M99 B;  2PRT A;  2ENC A;  4GKJ E;  1YYO A;  4BHB A;  4NZV A;  1Z1B A;  2L2M A;  1AH5 A;  4WPY A;  2RS6 A;  1EH6 A;  5KL5 A;  4LF8 E;  4ZYG A;  4ZYH A;  2N8X A;  2LJH A;  5A2Q C;  4DR7 E;  2EPK X;  2K7I A;  2ODR D;  1X6E A;  2GHF A;  1N36 E;  1YPN A;  1GTK A;  2RQL A;  3QG5 C;  4JI0 E;  1O0W A;  1XMQ E;  4R2Q A;  3ADI A;  2EJ4 A;  4LFC E;  4O4K A;  1I94 E;  2M1S A;  2KOU A;  2KHX A;  5BR8 E;  4X66 E;  2EPO A;  1YUI A;  1T4N A;  1B69 A;  2EMC A;  1N32 E;  4JI3 E;  2V88 A;  2B9D A;  4IJD A;  3ZOQ B;  1A1K A;  1X5W A;  5T6J A;  4NXM E;  3TQM A;  3AV0 A;  3H09 A;  2GPI A;  2DGC A;  1IQS A;  2EM6 A;  4YY3 E;  2N3H A;  4RHB B;  4BC7 A;  3EPK A;  1HR0 E;  2RPC A;  4JI4 E;  4ZYD A;  1IBM E;  5A6A A;  2VQE E;  3ADL A;  5A69 A; 
#chains in the Genus database with same CATH homology
 3JTZ A;  1X49 A;  4X65 E;  2VE7 C;  4DV3 E;  5IT9 C;  3C4T A;  1XNQ E;  4JI7 E;  2VQF E;  3ADG A;  2V87 A;  2DB2 A;  4Q28 A;  4WSP A;  3HXL A;  4AQY E;  4JI1 E;  1SR9 A;  4M2Z A;  1UHZ A;  1HNZ E;  4DR4 E;  4X62 E;  1EKZ A;  2F4V E;  2MC5 A;  2V86 A;  2V89 A;  3VYY A;  3ADL A;  3T1Y E;  4DV1 E;  2B7T A;  5AE1 A;  3IWB A;  2L6M A;  4DR6 E;  2UXC E;  1WHN A;  1FJG E;  2EZ6 A;  3F6G A;  2UUB E;  2YT4 A;  2MDR A;  1N33 E;  5LL6 R;  3JU0 A;  3J7A G;  1J26 A;  4JI8 E;  2LUQ A;  2VF1 A;  2LMZ A;  4DV4 E;  4F9A B;  2IHR 1;  2JR1 A;  2LTR A;  4F9C B;  4X64 E;  2MC6 A;  4DV5 E;  1HNX E;  4GEQ B;  1YZ9 A;  4JI2 E;  4LFB E;  4TUI A;  2FTX B;  4B3S E;  2M7Q A;  4LF6 E;  3IWC A;  2G7H A;  2RS7 A;  3FIG A;  5DNY A;  4LTY A;  1YYW A;  4DV7 E;  2FV4 B;  1IBK E;  2KON A;  2JOX A;  2JOB A;  2CPN A;  4LU9 A;  4P7D A;  4R8O A;  2M4I A;  4BC9 A;  4LF4 E;  4JYA E;  4BMJ A;  3C4B A;  3DJW A;  2VQE E;  2YZT A;  2N3G A;  2LUP B;  3K6Q A;  1T4O A;  1STU A;  2E5L E;  5AE3 A;  4B3M E;  1PKP A;  3VK6 A;  4F54 A;  3HQ1 A;  1QU6 A;  4JI5 E;  2LRS A;  3VYX A;  3LLH A;  4DMI A;  3T1H E;  2LTS A;  4R03 A;  1IBL E;  3J7Y p;  2L3C A;  1RC7 A;  4LF5 E;  3HPS A;  4B3T E;  1FKA E;  2WZO A;  4OOG C;  1J5E E;  2EWL A;  4BCA A;  1RQ0 A;  2F8B A;  1X48 A;  4F9B B;  2DMY A;  2B3T B;  4LFA E;  2B7V A;  4GKJ E;  1YYO A;  2L2N A;  4K0K E;  3ADJ A;  4X8W A;  2L2M A;  2FGG A;  2RTX A;  2L2K B;  4DR5 E;  4WPY A;  2JVA A;  2RS6 A;  3J81 C;  5ADZ A;  2L92 A;  4P78 A;  5F3W A;  4LF8 E;  4L5N C;  3OML A;  4GKK E;  2LJH A;  5A2Q C;  4DR7 E;  2DSY A;  3AUZ A;  4LF7 E;  3HTX A;  4DV2 E;  1T4L B;  4OX9 E;  2ODR D;  3LML A;  4DKK A;  4L8N A;  1N36 E;  3DF6 A;  3P1X A;  5LMU E;  3HPZ A;  5AE2 A;  2JY9 A;  2NUG A;  4JI0 E;  4DR2 E;  1O0W A;  1XMQ E;  3ADI A;  2HHH E;  4DV6 E;  5LMN E;  1X47 A;  1GZ6 A;  3JAM C;  4LFC E;  1UIL A;  3KWR A;  1WXR A;  2L8T A;  1I94 E;  4TUG A;  1DI2 A;  2DIX A;  3MSW A;  2M1S A;  2KOU A;  2KHX A;  5IWA E;  4NXN E;  5BR8 E;  4X66 E;  2UXD E;  2L33 A;  1ZBT A;  4BS9 A;  1DQ3 A;  3OTO E;  1T4N A;  4WFT A;  4JV5 E;  1WHQ A;  4M30 A;  1N32 E;  3RMP A;  4M0V A;  4WYQ B;  2L3J A;  1ZBQ A;  4DUY E;  2V88 A;  4JI3 E;  2B9D A;  1XNR E;  1YYK A;  3IWD A;  2LE2 A;  4YHH E;  4B3R E;  2K4V A;  4J8Z A;  3ZOQ B;  4DR3 E;  2UUA E;  1HNW E;  5T6J A;  4NXM E;  4DUZ E;  2V83 A;  3AV0 A;  3H09 A;  2NUF A;  2UUC E;  2JWO A;  2H36 X;  3F6H A;  3J80 C;  2ZM6 E;  2UXB E;  4YY3 E;  2N3H A;  5CFF E;  4DR1 E;  4BC7 A;  2E1M A;  1GQE A;  2RSM A;  4KZS A;  2V85 A;  2LBS B;  1N34 E;  1HR0 E;  1XMO E;  4DV0 E;  4JI4 E;  2NUE A;  4I8O A;  2NA2 A;  1IBM E;  4JI6 E;  5FLX C;  4BBY A;  2ODR C;  4KHP E;  5AAS A;  4LF9 E;  2V8Q B;  2UU9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...