2FTXB

Crystal structure of the yeast kinetochore spc24/spc25 globular domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
59
structure length
59
Chain Sequence
ANENILKLKLYRSLGVILDLENDQVLINRKNDGNIDILPLDNNLSDFYKTKYIWERLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypothetical 25.2 kDa protein in AFG3-SEB2 intergenic region
publication title Atomic Structure of the kinetochore Spc24p/Spc25p globular domain reveals a novel fold
rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein, protein binding
total genus 15
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.430 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ftxB00
2FV4B 2FTXB 5T6JA 4GEQB
chains in the Genus database with same CATH superfamily
4GKJE 2EN7A 2RTXA 4L5NC 2L3CA 2H36X 4F9BB 1RQ0A 2EMCA 1PJTA 2DB2A 2K7IA 2EMLA 4DV6E 3ADIA 2JR1A 2ENAA 2YTDA 5FLXC 3T1YE 1BBGA 2EZ6A 2WZOA 2K4VA 4LF6E 3HQ1A 2EP3A 3UK3C 1DQ3A 2EOIA 4M30A 1X6EA 1I94E 5IV8B 4P78A 4YHHE 2L33A 3OMLA 5LLQA 2YRMA 2EE8A 4FK5C 2ENCA 1TF6A 2YTNA 2EMYA 2YTGA 2EQ0A 2NUGA 2EMZA 1GTKA 2JOBA 4HEIA 4LFCE 2I9IA 2LCEA 2LTSA 2KOUA 1RMDA 3BIDA 3THNA 4X8WA 2EM3A 2EM9A 1IBME 2LJUA 2LV2A 1KYQA 2V88A 4WPYA 4M2ZA 2FGGA 3TQMA 4DV0E 4BCAA 2DMYA 2ADRA 2A25A 5CFFE 4JI2E 5A6KA 3EPLA 3LMLA 2EPUA 1N3GA 2EN2A 4B3RE 4R2QA 3ADJA 3KZYA 2BB8A 2EOFA 2VQEE 2HJJA 1L4SA 3T1HE 3AUZA 3IWBA 1YUIA 2UU9E 4WX9A 2ZM6E 1G2FC 2EMIA 1X3CA 1BB8A 2EOSA 2M1SA 1N34E 4R8OA 4LF9E 4WXDA 3EPKA 1O0WA 2EPNA 1IBLE 1ZAAC 1PKPA 1IQSA 4KHPE 4F54A 2EN3A 5TSEA 5KL5A 4O43A 4X9JA 4BC9A 2GHFA 5KL7A 3KWRA 2L2MA 1MEYC 1IQOA 1YYWA 2IHR1 2DGCA 4M9VC 3F6GA 1A1HA 5F3WA 2YRHA 5ADZA 4J8ZA 3J7AG 2DIXA 4DV7E 2EQ1A 1AH5A 3C6MA 2LBSB 3JU0A 2EPLX 2UUAE 1T4LB 2YU8A 3KZZA 4X62E 1PDAA 1GZ6A 4WFTA 2EPMX 4DV4E 2LRSA 2JXPA 2CTDA 3M99B 5T6JA 1T4OA 4OX9E 4R2DA 3H09A 2EPOA 1XMQE 4RH8A 1FJGE 1TN9A 5A6BA 4F9AB 2EMBA 1EH7A 2LVHA 4I8OA 3BGHA 5AE1A 2WCC3 2JYAA 4WYQB 4OOGC 1N36E 2M4IA 1T38A 2V83A 5DNYA 2B7TA 2J7JA 4NXNE 1WXRA 3JAMC 5KL4A 2EOEA 2EN4A 2YTEA 1XNQE 4JI5E 2LUQA 4DR1E 2DSYA 2MC5A 2HC5A 4R2CA 5AE2A 2EN8A 1N33E 4JI7E 5A6JA 2EOJA 4DR2E 1F2IG 5LL6R 1PJQA 2DMIA 2L2NA 2V85A 4BBYA 4DV1E 2EL5A 1A1IA 2D9HA 3QG5C 5IT9C 2EL4A 2L6MA 2BBGA 1AAYA 1LLMC 4IS1C 4JV5E 1J26A 2PRTA 4L8NA 2M9AA 2UXBE 2YPNA 2R1FA 2EORA 1IBKE 4GEQB 1A1KA 2ELZA 1X49A 1TF3A 4JI0E 3VYXA 2EOZA 1WHNA 4DKKA 4DV5E 1X47A 2YTOA 2G7HA 2EPKX 2VQFE 3J81C 2RSMA 4DUZE 4NZVA 3ZOQB 4DV3E 1YSAC 4WSGA 1EKZA 2NABA 4WSPA 3THOB 2ENHA 1XMOE 1A1GA 4BS9A 2N8XA 2MDRA 2UXDE 1YYOA 2EL6A 2YTQA 4JYAE 3BBGA 2YTPA 2JP9A 2NA2A 4ZYGA 4ZYEA 1ZBQA 4P7DA 2DLQA 1HR0E 4N4RB 2VE7C 1HNXE 2EN1A 2ODRC 1EH6A 1DGCA 2YU5A 1T39A 2M7QA 2JVAA 4X65E 2KONA 2MKDA 4TUGA 2EOQA 2EN6A 2MDGA 4YY3E 2EOHA 4F6MA 4JI3E 2V87A 2EPCA 1STUA 3HPSA 5BR8E 4DR3E 1JK1A 5AASA 2HHHE 2EMHA 4BC7A 4R2PA 5IWAE 1WHQA 2MKNA 5KL3A 2E1MA 3FIGA 4KZSA 4AQYE 1UN6B 2DRPA 2L8TA 3C4BA 1G2DC 4R2RA 1JK2A 4DMIA 2EOOA 1FKAE 4MLQA 1EH8A 2V89A 4RHBB 2FV4B 2JY9A 2EPXA 1YYKA 1QNTA 2V86A 2JPAA 3P1XA 2EOXA 2CT1A 1J5EE 3EPJA 2CSHA 4TUIA 2FTXB 2YTFA 4B3ME 2JOXA 4JI8E 4DR6E 1X6HA 2VF1A 4F6NA 4LFAE 2RS6A 4K0KE 2VRDA 5A6BD 2B3TB 2LMZA 3IWDA 2N3GA 1UILA 2EM8A 2MC6A 1A1LA 2EM5A 3DJWA 1ZBTA 4GZNC 2EMAA 3DF6A 2B9DA 5IXMB 1YZ9A 3EQ1A 3EPHA 4B3SE 2YTIA 5KL2A 2EM2A 2RSIA 3JTZA 2YZTA 1WRJA 1QU6A 2YWQA 5KL6A 5AC5A 2L2KB 2EM4A 3C4TA 1UBDC 4LF4E 4HTGA 4DV2E 4DUYE 3J80C 2WBTA 4ZYDA 3RMPA 2EM0A 1P47A 3VK6A 2YRKA 2YT4A 4JI6E 2Q8UA 3C6KA 2UUBE 2DLKA 4KWYA 2KHXA 1XNRE 1X48A 2RPCA 3MSWA 4M0VA 4BHBA 4F9CB 1NEIA 4DR4E 3HPZA 5LMUE 3ADLA 4GKKE 4ZYHA 2GPIA 1B69A 2HGHA 3K6QA 1YFHA 2RQLA 2L92A 3MHSC 2B7VA 2L3JA 2E72A 4R2EA 3MHHC 4LF8E 1ZR9A 4Q35B 1YPNA 5A2QC 1ZU1A 3VYYA 4BMJA 1PJSA 2EPPA 3BF2A 2ODRD 1GQEA 2EPRA 4BHCA 2N3HA 4X66E 4Q28A 3J7Yp 4R2SA 1IMUA 2ELYA 1SFEA 1A1JA 3HXLA 1RC7A 4IJDA 2YSOA 4JI1E 2EOMA 4LF5E 2RS7A 1KJKA 1DI2A 4X64E 5LMNE 2NUEA 1WJPA 2EQ3A 1A1FA 3ECRA 3AV0A 2F8BA 5A6AA 3ADGA 2R76A 1X6FA 3LLHA 4F2JC 2EPZA 2NUFA 2EMGA 4MLVA 3IWCA 2EMWA 2LJHA 1UHZA 2EPAA 1T4NA 1SR9A 2WBSA 2JWOA 4LU9A 4R2AA 4DR5E 1Z1BA 2LT7A 4R03A 1X5WA 2EWLA 2YTJA 2I13A 2EMFA 3HTXA 2EOYA 3L00A 3OTOE 4JI4E 2EMXA 2YSPA 2LUPB 2EJ4A 1N32E 1NCSA 2EM7A 4WXCA 2WBUA 2LO3A 4NHRA 2GLIA 1HNZE 2LE2A 5AE3A 3F6HA 4B3TE 4DR7E 2CPNA 2EM6A 4LF7E 2UUCE 5A69A 3VHTB 4LTYA 5AC4A 2LTRA 2F4VE 1YUJA 4O24A 2EMKA 2V8QB 1BBOA 2UXCE 4NXME 4LFBE 4O5GA 2E5LE 1MGTA 4O4KA 1HNWE
chains in the Genus database with same CATH topology
4GKJE 2UXDE 4L5NC 2RTXA 4J8ZA 4M0VA 4F9CB 1YYOA 3J7AG 4DR4E 3HPZA 2DIXA 4JYAE 2L3CA 4DV7E 5LMUE 3ADLA 4GKKE 2H36X 4F9BB 1RQ0A 2LBSB 3JU0A 2DB2A 2NA2A 3K6QA 1ZBQA 2L92A 2UUAE 2B7VA 4P7DA 4DV6E 2L3JA 3ADIA 1T4LB 1HR0E 2VE7C 1HNXE 4X62E 2JR1A 4LF8E 2ODRC 5FLXC 5A2QC 1GZ6A 4WFTA 4DV4E 2M7QA 3T1YE 3VYYA 2JVAA 4BMJA 4X65E 2KONA 2LRSA 2EZ6A 4TUGA 2WZOA 2K4VA 1T4OA 5T6JA 4LF6E 4OX9E 3HQ1A 2ODRD 3H09A 1GQEA 3J7Yp 1XMQE 2N3HA 4X66E 1DQ3A 4Q28A 4YY3E 1FJGE 4M30A 4JI3E 4F9AB 2V87A 1I94E 4I8OA 1STUA 3HPSA 4P78A 5BR8E 5AE1A 4YHHE 4DR3E 2L33A 3HXLA 3OMLA 5AASA 2HHHE 4WYQB 4BC7A 4OOGC 1RC7A 5IWAE 1N36E 2M4IA 1WHQA 2V83A 4JI1E 4LF5E 2E1MA 5DNYA 2NUGA 3FIGA 2RS7A 2B7TA 4KZSA 1WXRA 4AQYE 2JOBA 4LFCE 4NXNE 1DI2A 3JAMC 2LTSA 2L8TA 4X64E 3C4BA 5LMNE 2KOUA 1XNQE 2NUEA 4JI5E 4DMIA 3AV0A 2F8BA 4X8WA 3ADGA 2LUQA 1FKAE 2V89A 1IBME 3LLHA 4DR1E 2DSYA 2FV4B 2MC5A 2JY9A 2V88A 4WPYA 1YYKA 2NUFA 5AE2A 1XMOE 1N33E 4M2ZA 2V86A 2FGGA 4JI7E 4DV0E 3P1XA 4DR2E 4BCAA 2DMYA 3IWCA 5LL6R 5CFFE 1J5EE 4JI2E 2LJHA 1UHZA 4TUIA 2L2NA 3LMLA 2V85A 1T4NA 4BBYA 2FTXB 1SR9A 4DV1E 2JWOA 4LU9A 4DR5E 4B3RE 4B3ME 2JOXA 4JI8E 4DR6E 4R03A 3ADJA 5IT9C 2EWLA 2VF1A 4LFAE 2L6MA 2RS6A 2VQEE 4K0KE 3HTXA 3T1HE 2B3TB 2LMZA 3IWDA 3OTOE 4JI4E 2N3GA 3AUZA 3IWBA 1UILA 2MC6A 2LUPB 2ZM6E 2UU9E 1N32E 4JV5E 1J26A 4L8NA 3DJWA 1ZBTA 2M1SA 3DF6A 1N34E 2B9DA 4R8OA 2UXBE 4LF9E 1IBKE 1YZ9A 4GEQB 1HNZE 2LE2A 5ADZA 1O0WA 5AE3A 1X49A 4B3SE 4JI0E 3VYXA 3F6HA 1IBLE 4B3TE 4DR7E 1WHNA 1PKPA 4DKKA 4DV5E 4KHPE 1X47A 3JTZA 2YZTA 2CPNA 4F54A 4BC9A 1QU6A 2G7HA 4LF7E 2UUCE 2VQFE 3J81C 2RSMA 2L2KB 3KWRA 3C4TA 4DUZE 4LF4E 3ZOQB 4DV3E 2L2MA 4LTYA 2LTRA 2F4VE 4DV2E 4DUYE 3J80C 3RMPA 3VK6A 1EKZA 2YT4A 4JI6E 4WSPA 2V8QB 2UUBE 1YYWA 2IHR1 2UXCE 3F6GA 4NXME 4LFBE 2E5LE 2KHXA 1XNRE 1HNWE 5F3WA 1X48A 4BS9A 3MSWA 2MDRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FV4 B;  2FTX B;  5T6J A;  4GEQ B; 
#chains in the Genus database with same CATH topology
 4GKJ E;  2EN7 A;  2RTX A;  4L5N C;  2L3C A;  2H36 X;  4F9B B;  1RQ0 A;  2EMC A;  1PJT A;  2DB2 A;  2K7I A;  2EML A;  4DV6 E;  3ADI A;  2JR1 A;  2ENA A;  2YTD A;  5FLX C;  3T1Y E;  1BBG A;  2EZ6 A;  2WZO A;  2K4V A;  4LF6 E;  3HQ1 A;  2EP3 A;  3UK3 C;  1DQ3 A;  2EOI A;  4M30 A;  1X6E A;  1I94 E;  5IV8 B;  4P78 A;  4YHH E;  2L33 A;  3OML A;  5LLQ A;  2YRM A;  2EE8 A;  4FK5 C;  2ENC A;  1TF6 A;  2YTN A;  2EMY A;  2YTG A;  2EQ0 A;  2NUG A;  2EMZ A;  1GTK A;  2JOB A;  4HEI A;  4LFC E;  2I9I A;  2LCE A;  2LTS A;  2KOU A;  1RMD A;  3BID A;  3THN A;  4X8W A;  2EM3 A;  2EM9 A;  1IBM E;  2LJU A;  2LV2 A;  1KYQ A;  2V88 A;  4WPY A;  4M2Z A;  2FGG A;  3TQM A;  4DV0 E;  4BCA A;  2DMY A;  2ADR A;  2A25 A;  5CFF E;  4JI2 E;  5A6K A;  3EPL A;  3LML A;  2EPU A;  1N3G A;  2EN2 A;  4B3R E;  4R2Q A;  3ADJ A;  3KZY A;  2BB8 A;  2EOF A;  2VQE E;  2HJJ A;  1L4S A;  3T1H E;  3AUZ A;  3IWB A;  1YUI A;  2UU9 E;  4WX9 A;  2ZM6 E;  1G2F C;  2EMI A;  1X3C A;  1BB8 A;  2EOS A;  2M1S A;  1N34 E;  4R8O A;  4LF9 E;  4WXD A;  3EPK A;  1O0W A;  2EPN A;  1IBL E;  1ZAA C;  1PKP A;  1IQS A;  4KHP E;  4F54 A;  2EN3 A;  5TSE A;  5KL5 A;  4O43 A;  4X9J A;  4BC9 A;  2GHF A;  5KL7 A;  3KWR A;  2L2M A;  1MEY C;  1IQO A;  1YYW A;  2IHR 1;  2DGC A;  4M9V C;  3F6G A;  1A1H A;  5F3W A;  2YRH A;  5ADZ A;  4J8Z A;  3J7A G;  2DIX A;  4DV7 E;  2EQ1 A;  1AH5 A;  3C6M A;  2LBS B;  3JU0 A;  2EPL X;  2UUA E;  1T4L B;  2YU8 A;  3KZZ A;  4X62 E;  1PDA A;  1GZ6 A;  4WFT A;  2EPM X;  4DV4 E;  2LRS A;  2JXP A;  2CTD A;  3M99 B;  5T6J A;  1T4O A;  4OX9 E;  4R2D A;  3H09 A;  2EPO A;  1XMQ E;  4RH8 A;  1FJG E;  1TN9 A;  5A6B A;  4F9A B;  2EMB A;  1EH7 A;  2LVH A;  4I8O A;  3BGH A;  5AE1 A;  2WCC 3;  2JYA A;  4WYQ B;  4OOG C;  1N36 E;  2M4I A;  1T38 A;  2V83 A;  5DNY A;  2B7T A;  2J7J A;  4NXN E;  1WXR A;  3JAM C;  5KL4 A;  2EOE A;  2EN4 A;  2YTE A;  1XNQ E;  4JI5 E;  2LUQ A;  4DR1 E;  2DSY A;  2MC5 A;  2HC5 A;  4R2C A;  5AE2 A;  2EN8 A;  1N33 E;  4JI7 E;  5A6J A;  2EOJ A;  4DR2 E;  1F2I G;  5LL6 R;  1PJQ A;  2DMI A;  2L2N A;  2V85 A;  4BBY A;  4DV1 E;  2EL5 A;  1A1I A;  2D9H A;  3QG5 C;  5IT9 C;  2EL4 A;  2L6M A;  2BBG A;  1AAY A;  1LLM C;  4IS1 C;  4JV5 E;  1J26 A;  2PRT A;  4L8N A;  2M9A A;  2UXB E;  2YPN A;  2R1F A;  2EOR A;  1IBK E;  4GEQ B;  1A1K A;  2ELZ A;  1X49 A;  1TF3 A;  4JI0 E;  3VYX A;  2EOZ A;  1WHN A;  4DKK A;  4DV5 E;  1X47 A;  2YTO A;  2G7H A;  2EPK X;  2VQF E;  3J81 C;  2RSM A;  4DUZ E;  4NZV A;  3ZOQ B;  4DV3 E;  1YSA C;  4WSG A;  1EKZ A;  2NAB A;  4WSP A;  3THO B;  2ENH A;  1XMO E;  1A1G A;  4BS9 A;  2N8X A;  2MDR A;  2UXD E;  1YYO A;  2EL6 A;  2YTQ A;  4JYA E;  3BBG A;  2YTP A;  2JP9 A;  2NA2 A;  4ZYG A;  4ZYE A;  1ZBQ A;  4P7D A;  2DLQ A;  1HR0 E;  4N4R B;  2VE7 C;  1HNX E;  2EN1 A;  2ODR C;  1EH6 A;  1DGC A;  2YU5 A;  1T39 A;  2M7Q A;  2JVA A;  4X65 E;  2KON A;  2MKD A;  4TUG A;  2EOQ A;  2EN6 A;  2MDG A;  4YY3 E;  2EOH A;  4F6M A;  4JI3 E;  2V87 A;  2EPC A;  1STU A;  3HPS A;  5BR8 E;  4DR3 E;  1JK1 A;  5AAS A;  2HHH E;  2EMH A;  4BC7 A;  4R2P A;  5IWA E;  1WHQ A;  2MKN A;  5KL3 A;  2E1M A;  3FIG A;  4KZS A;  4AQY E;  1UN6 B;  2DRP A;  2L8T A;  3C4B A;  1G2D C;  4R2R A;  1JK2 A;  4DMI A;  2EOO A;  1FKA E;  4MLQ A;  1EH8 A;  2V89 A;  4RHB B;  2FV4 B;  2JY9 A;  2EPX A;  1YYK A;  1QNT A;  2V86 A;  2JPA A;  3P1X A;  2EOX A;  2CT1 A;  1J5E E;  3EPJ A;  2CSH A;  4TUI A;  2FTX B;  2YTF A;  4B3M E;  2JOX A;  4JI8 E;  4DR6 E;  1X6H A;  2VF1 A;  4F6N A;  4LFA E;  2RS6 A;  4K0K E;  2VRD A;  5A6B D;  2B3T B;  2LMZ A;  3IWD A;  2N3G A;  1UIL A;  2EM8 A;  2MC6 A;  1A1L A;  2EM5 A;  3DJW A;  1ZBT A;  4GZN C;  2EMA A;  3DF6 A;  2B9D A;  5IXM B;  1YZ9 A;  3EQ1 A;  3EPH A;  4B3S E;  2YTI A;  5KL2 A;  2EM2 A;  2RSI A;  3JTZ A;  2YZT A;  1WRJ A;  1QU6 A;  2YWQ A;  5KL6 A;  5AC5 A;  2L2K B;  2EM4 A;  3C4T A;  1UBD C;  4LF4 E;  4HTG A;  4DV2 E;  4DUY E;  3J80 C;  2WBT A;  4ZYD A;  3RMP A;  2EM0 A;  1P47 A;  3VK6 A;  2YRK A;  2YT4 A;  4JI6 E;  2Q8U A;  3C6K A;  2UUB E;  2DLK A;  4KWY A;  2KHX A;  1XNR E;  1X48 A;  2RPC A;  3MSW A;  4M0V A;  4BHB A;  4F9C B;  1NEI A;  4DR4 E;  3HPZ A;  5LMU E;  3ADL A;  4GKK E;  4ZYH A;  2GPI A;  1B69 A;  2HGH A;  3K6Q A;  1YFH A;  2RQL A;  2L92 A;  3MHS C;  2B7V A;  2L3J A;  2E72 A;  4R2E A;  3MHH C;  4LF8 E;  1ZR9 A;  4Q35 B;  1YPN A;  5A2Q C;  1ZU1 A;  3VYY A;  4BMJ A;  1PJS A;  2EPP A;  3BF2 A;  2ODR D;  1GQE A;  2EPR A;  4BHC A;  2N3H A;  4X66 E;  4Q28 A;  3J7Y p;  4R2S A;  1IMU A;  2ELY A;  1SFE A;  1A1J A;  3HXL A;  1RC7 A;  4IJD A;  2YSO A;  4JI1 E;  2EOM A;  4LF5 E;  2RS7 A;  1KJK A;  1DI2 A;  4X64 E;  5LMN E;  2NUE A;  1WJP A;  2EQ3 A;  1A1F A;  3ECR A;  3AV0 A;  2F8B A;  5A6A A;  3ADG A;  2R76 A;  1X6F A;  3LLH A;  4F2J C;  2EPZ A;  2NUF A;  2EMG A;  4MLV A;  3IWC A;  2EMW A;  2LJH A;  1UHZ A;  2EPA A;  1T4N A;  1SR9 A;  2WBS A;  2JWO A;  4LU9 A;  4R2A A;  4DR5 E;  1Z1B A;  2LT7 A;  4R03 A;  1X5W A;  2EWL A;  2YTJ A;  2I13 A;  2EMF A;  3HTX A;  2EOY A;  3L00 A;  3OTO E;  4JI4 E;  2EMX A;  2YSP A;  2LUP B;  2EJ4 A;  1N32 E;  1NCS A;  2EM7 A;  4WXC A;  2WBU A;  2LO3 A;  4NHR A;  2GLI A;  1HNZ E;  2LE2 A;  5AE3 A;  3F6H A;  4B3T E;  4DR7 E;  2CPN A;  2EM6 A;  4LF7 E;  2UUC E;  5A69 A;  3VHT B;  4LTY A;  5AC4 A;  2LTR A;  2F4V E;  1YUJ A;  4O24 A;  2EMK A;  2V8Q B;  1BBO A;  2UXC E;  4NXM E;  4LFB E;  4O5G A;  2E5L E;  1MGT A;  4O4K A;  1HNW E; 
#chains in the Genus database with same CATH homology
 4GKJ E;  2UXD E;  4L5N C;  2RTX A;  4J8Z A;  4M0V A;  4F9C B;  1YYO A;  3J7A G;  4DR4 E;  3HPZ A;  2DIX A;  4JYA E;  2L3C A;  4DV7 E;  5LMU E;  3ADL A;  4GKK E;  2H36 X;  4F9B B;  1RQ0 A;  2LBS B;  3JU0 A;  2DB2 A;  2NA2 A;  3K6Q A;  1ZBQ A;  2L92 A;  2UUA E;  2B7V A;  4P7D A;  4DV6 E;  2L3J A;  3ADI A;  1T4L B;  1HR0 E;  2VE7 C;  1HNX E;  4X62 E;  2JR1 A;  4LF8 E;  2ODR C;  5FLX C;  5A2Q C;  1GZ6 A;  4WFT A;  4DV4 E;  2M7Q A;  3T1Y E;  3VYY A;  2JVA A;  4BMJ A;  4X65 E;  2KON A;  2LRS A;  2EZ6 A;  4TUG A;  2WZO A;  2K4V A;  1T4O A;  5T6J A;  4LF6 E;  4OX9 E;  3HQ1 A;  2ODR D;  3H09 A;  1GQE A;  3J7Y p;  1XMQ E;  2N3H A;  4X66 E;  1DQ3 A;  4Q28 A;  4YY3 E;  1FJG E;  4M30 A;  4JI3 E;  4F9A B;  2V87 A;  1I94 E;  4I8O A;  1STU A;  3HPS A;  4P78 A;  5BR8 E;  5AE1 A;  4YHH E;  4DR3 E;  2L33 A;  3HXL A;  3OML A;  5AAS A;  2HHH E;  4WYQ B;  4BC7 A;  4OOG C;  1RC7 A;  5IWA E;  1N36 E;  2M4I A;  1WHQ A;  2V83 A;  4JI1 E;  4LF5 E;  2E1M A;  5DNY A;  2NUG A;  3FIG A;  2RS7 A;  2B7T A;  4KZS A;  1WXR A;  4AQY E;  2JOB A;  4LFC E;  4NXN E;  1DI2 A;  3JAM C;  2LTS A;  2L8T A;  4X64 E;  3C4B A;  5LMN E;  2KOU A;  1XNQ E;  2NUE A;  4JI5 E;  4DMI A;  3AV0 A;  2F8B A;  4X8W A;  3ADG A;  2LUQ A;  1FKA E;  2V89 A;  1IBM E;  3LLH A;  4DR1 E;  2DSY A;  2FV4 B;  2MC5 A;  2JY9 A;  2V88 A;  4WPY A;  1YYK A;  2NUF A;  5AE2 A;  1XMO E;  1N33 E;  4M2Z A;  2V86 A;  2FGG A;  4JI7 E;  4DV0 E;  3P1X A;  4DR2 E;  4BCA A;  2DMY A;  3IWC A;  5LL6 R;  5CFF E;  1J5E E;  4JI2 E;  2LJH A;  1UHZ A;  4TUI A;  2L2N A;  3LML A;  2V85 A;  1T4N A;  4BBY A;  2FTX B;  1SR9 A;  4DV1 E;  2JWO A;  4LU9 A;  4DR5 E;  4B3R E;  4B3M E;  2JOX A;  4JI8 E;  4DR6 E;  4R03 A;  3ADJ A;  5IT9 C;  2EWL A;  2VF1 A;  4LFA E;  2L6M A;  2RS6 A;  2VQE E;  4K0K E;  3HTX A;  3T1H E;  2B3T B;  2LMZ A;  3IWD A;  3OTO E;  4JI4 E;  2N3G A;  3AUZ A;  3IWB A;  1UIL A;  2MC6 A;  2LUP B;  2ZM6 E;  2UU9 E;  1N32 E;  4JV5 E;  1J26 A;  4L8N A;  3DJW A;  1ZBT A;  2M1S A;  3DF6 A;  1N34 E;  2B9D A;  4R8O A;  2UXB E;  4LF9 E;  1IBK E;  1YZ9 A;  4GEQ B;  1HNZ E;  2LE2 A;  5ADZ A;  1O0W A;  5AE3 A;  1X49 A;  4B3S E;  4JI0 E;  3VYX A;  3F6H A;  1IBL E;  4B3T E;  4DR7 E;  1WHN A;  1PKP A;  4DKK A;  4DV5 E;  4KHP E;  1X47 A;  3JTZ A;  2YZT A;  2CPN A;  4F54 A;  4BC9 A;  1QU6 A;  2G7H A;  4LF7 E;  2UUC E;  2VQF E;  3J81 C;  2RSM A;  2L2K B;  3KWR A;  3C4T A;  4DUZ E;  4LF4 E;  3ZOQ B;  4DV3 E;  2L2M A;  4LTY A;  2LTR A;  2F4V E;  4DV2 E;  4DUY E;  3J80 C;  3RMP A;  3VK6 A;  1EKZ A;  2YT4 A;  4JI6 E;  4WSP A;  2V8Q B;  2UUB E;  1YYW A;  2IHR 1;  2UXC E;  3F6G A;  4NXM E;  4LFB E;  2E5L E;  2KHX A;  1XNR E;  1HNW E;  5F3W A;  1X48 A;  4BS9 A;  3MSW A;  2MDR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...