1A1GA

Dsnr (zif268 variant) zinc finger-dna complex (gcgt site)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
84
structure length
84
Chain Sequence
b'RPYACPVESCDRRFSDSSNLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*GP*T)-3')
publication title High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 27
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1gA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1gA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1gA03
2EOJA 2ELYA 5KL4A 2ELZA 1BBOA 2EL6A 2JPAA 1A1LA 2DLQA 4R2EA 4GZNC 4FK5C 2EL4A 1ZAAC 5KL5A 2EM0A 2GHFA 1UN6B 2EM7A 2EOFA 4F6NA 1A1FA 2EQ1A 2LCEA 2EM6A 2EMWA 2PRTA 1G2FC 4WSGA 1A1GA 1LLMC 1YSAC 2LO3A 4R2DA 4F2JC 2YRHA 1UBDC 1X6HA 2EM9A 2J7JA 1TF6A 2VRDA 2YTNA 5KL3A 2ENHA 1F2IG 2EPRA 1X3CA 5KL6A 2CSHA 2NABA 2ENAA 5KL2A 2EN8A 1YUJA 2EOQA 2EMYA 4X9JA 2EMAA 2MKDA 4M9VC 3EPHA 3MHSC 2DLKA 2EQ0A 4R2CA 2EMCA 2EL5A 2EMBA 2YTQA 2EPCA 1TF3A 2I13A 1AAYA 4F6MA 3EPKA 2EOXA 2EOHA 3VHTB 2EOEA 4R2PA 2YRMA 1A1HA 1TN9A 2YTEA 2EJ4A 1Z1BA 2CTDA 2EM3A 2EMGA 3MHHC 1A1KA 1A1IA 4IS1C 3UK3C 2EMZA 3EPLA 1JK1A 2M9AA 2EOOA 2EN2A 2EMXA 2ADRA 2YTDA 2EOMA 2EM5A 2EORA 2EMLA 2EPZA 2RPCA 2CT1A 2EN3A 2WBUA 2YTJA 2EOYA 1X5WA 1WJPA 1ZU1A 2YU8A 1JK2A 1X6EA 1BB8A 2EMKA 2EOZA 4R2QA 2EMFA 1X6FA 2DRPA 2YU5A 1NCSA 2MKNA 2YTPA 2BB8A 2YTFA 2YTOA 2YTIA 1A1JA 1RMDA 2EN7A 2DGCA 2RSIA 2EM8A 4R2AA 2HGHA 1DGCA 2EPXA 2E72A 2EM4A 2EMIA 1ZR9A 2EE8A 2EM2A 2DMIA 2EPPA 5KL7A 3M99B 2EPUA 4IJDA 1B69A 2JP9A 2A25A 2EOSA 2EP3A 2WBSA 2EN4A 2MDGA 1P47A 2WBTA 1KJKA 2YTGA 2EQ3A 2EN1A 2EMHA 2ENCA 2R1FA 3EPJA 2EPAA 1YUIA 2YSPA 2YSOA 2GLIA 4R2RA 2D9HA 2LVHA 4R2SA 1MEYC 2LT7A 2EN6A 2EOIA 2LV2A 1G2DC 2WCC3 2YRKA
chains in the Genus database with same CATH superfamily
2VQFE 1BBOA 1A1LA 4R2EA 4GZNC 4FK5C 5KL5A 1IMUA 2GHFA 1UN6B 2EM7A 4JI3E 2VQEE 5AASA 1A1FA 5AC5A 2EQ1A 1STUA 2LCEA 3KZYA 2UXBE 1G2FC 4DR1E 4LFBE 4ZYEA 1EH8A 4R03A 2EM9A 2B3TB 4N4RB 2VRDA 2KOUA 4JI7E 4ZYGA 5KL3A 1F2IG 1X48A 1X3CA 2UU9E 2EN8A 2Q8UA 3ADLA 4DUZE 1FKAE 3P1XA 2R76A 2DIXA 4DV3E 1PDAA 2JYAA 3MHSC 1YFHA 3HQ1A 2DLKA 1IBME 2EMBA 4JI0E 4JI1E 4HTGA 3OTOE 1TF3A 2JOBA 5T6JA 2MC6A 3L00A 2F8BA 4R2PA 2YTEA 4X66E 1A1KA 2EM3A 2EMGA 2VE7C 4BC9A 1A1IA 4IS1C 3UK3C 2V88A 4DR7E 2KONA 2N3GA 2VF1A 4LF5E 4LU9A 3C6MA 2EN3A 1WRJA 3JTZA 2DRPA 2L3JA 4LF9E 2YTOA 2V89A 4DR5E 1RMDA 2HGHA 2RSIA 2EM8A 5DNYA 4NHRA 2EPXA 4AQYE 4F54A 5IXMB 4BHCA 2EE8A 2EM2A 4YY3E 2EPPA 4DV6E 2NUFA 2EPUA 2YT4A 2ZM6E 3J80C 2JP9A 2EN4A 3F6HA 4P7DA 2WBTA 3HXLA 5A6AA 2L2NA 4WYQB 1HR0E 1XNRE 1HNWE 1T4LB 2V83A 2YTGA 2ENCA 2R1FA 4TUIA 1N3GA 4NZVA 2YPNA 2D9HA 1T38A 4JI4E 2LV2A 4WSPA 2V86A 5A6KA 1G2DC 2V85A 1QNTA 5LMNE 4X62E 2EOJA 2H36X 5KL4A 5A6BA 2JPAA 2EPLX 2EL4A 3JU0A 4WFTA 2LUPB 3BBGA 2L6MA 4R8OA 4F6NA 2EOFA 2L2MA 2B7TA 2M7QA 2EM6A 2K7IA 2EPOA 2FGGA 2L92A 2YRHA 3AUZA 3IWCA 2IHR1 1HNXE 4BHBA 3H09A 4MLVA 4JI8E 4M2ZA 3OMLA 4DR3E 1YZ9A 4X9JA 3HTXA 3J7AG 5FLXC 1BBGA 3EPHA 1EH6A 3T1HE 2EL5A 3EQ1A 4B3TE 4L5NC 3ZOQB 2EPCA 1MGTA 5LMUE 3VYYA 4DV5E 1DQ3A 2DB2A 3ADIA 5AC4A 4LF4E 1IQOA 3F6GA 2L2KB 1AAYA 3THOB 4F6MA 5IT9C 1PJTA 1SFEA 3DJWA 2EOHA 2K4VA 3T1YE 1GTKA 2YRMA 4O5GA 1TN9A 4RH8A 1SR9A 1PJSA 2EJ4A 1PJQA 2B9DA 3AV0A 2RQLA 2ADRA 3VK6A 2EM5A 3KWRA 2YTJA 1ZU1A 1JK2A 1BB8A 2EMKA 4GEQB 2UUCE 4Q35B 4Q28A 4R2QA 4JI5E 5TSEA 2EMFA 2EPMX 5IWAE 2HC5A 1L4SA 4ZYHA 2CPNA 4F9CB 2YTPA 3HPZA 4L8NA 2B7VA 1YYKA 1ZBQA 1A1JA 4M30A 2LBSB 2DGCA 4JV5E 5IV8B 2UUAE 2EM4A 1X49A 1ZR9A 3C4BA 4O43A 4IJDA 3C6KA 2EOSA 1IQSA 2MDGA 2E5LE 1P47A 2EPNA 2JWOA 1HNZE 4DR2E 1YUIA 2GLIA 2L33A 2HJJA 2FTXB 2EWLA 4HEIA 1XMOE 2LT7A 1MEYC 3J7Yp 1UILA 2YRKA 2JY9A 1J5EE 2ELYA 2YWQA 2EL6A 1UHZA 2DLQA 4DR4E 1ZAAC 4JI6E 4BS9A 2E1MA 4DV1E 2EM0A 5A2QC 4OX9E 1N33E 2DSYA 4BC7A 2ODRD 2V87A 3THNA 4WSGA 5A69A 1LLMC 4X8WA 2G7HA 2LO3A 4R2DA 5AE2A 2HHHE 4LF8E 1YYOA 2J7JA 4YHHE 2YTNA 3DF6A 3VYXA 2EPRA 2CSHA 5AE3A 2EOQA 2EMYA 5A6BD 4KHPE 5BR8E 4O4KA 4DV7E 4R2CA 2EMCA 3BF2A 1XMQE 3BGHA 3ECRA 2YZTA 3EPKA 2FV4B 1WXRA 3VHTB 2KHXA 2EOEA 5CFFE 1A1HA 1IBLE 1QU6A 2WZOA 3MHHC 2JR1A 2N8XA 4B3RE 2M9AA 1RC7A 2M1SA 2EN2A 2YTDA 1T39A 2EOMA 3ADJA 2EMLA 2EPZA 2N3HA 2CT1A 2RPCA 4I8OA 2WBUA 2EOYA 1WJPA 4MLQA 1NEIA 1XNQE 2EOZA 4BMJA 2NUGA 2YU5A 2YTFA 1N32E 4LFCE 1T4NA 4R2AA 4O24A 4WXCA 4B3SE 1GQEA 4WXDA 2EMIA 2NA2A 5KL7A 2MC5A 4B3ME 1B69A 2RSMA 2JVAA 4X64E 1KJKA 2EN1A 4JYAE 2LTSA 2EPAA 3C4TA 4F9AB 2YSPA 2NUEA 3K6QA 4R2SA 5LLQA 3FIGA 4F9BB 4WPYA 2UXCE 2WCC3 3BIDA 1KYQA 4K0KE 2BBGA 2ELZA 1IBKE 5AE1A 2MDRA 2UUBE 4DV4E 1N34E 1RQ0A 4P78A 2EMWA 4WX9A 1EH7A 2PRTA 3MSWA 1A1GA 2UXDE 1YSAC 4LF7E 4F2JC 1UBDC 1X6HA 2M4IA 1TF6A 2ENHA 5KL6A 1X47A 4RHBB 2LMZA 4OOGC 2NABA 2ENAA 3HPSA 4M0VA 3JAMC 5KL2A 1YUJA 2LUQA 1YYWA 4BBYA 2EMAA 2LTRA 2MKDA 1FJGE 4M9VC 5LL6R 4J8ZA 2V8QB 5ADZA 2EQ0A 2JXPA 5A6JA 2YTQA 1WHNA 3KZZA 1EKZA 2L8TA 3J81C 2I13A 4KZSA 3IWBA 1I94E 2EOXA 2JOXA 3LLHA 4DV2E 1N36E 4DMIA 1O0WA 4NXNE 1GZ6A 1Z1BA 2CTDA 2EZ6A 2EMZA 2ODRC 3EPLA 1JK1A 4X65E 2EOOA 2EMXA 2EORA 2F4VE 2EPKX 1X5WA 2YU8A 1X6EA 3RMPA 1YPNA 1X6FA 4TUGA 1WHQA 4LFAE 1NCSA 4GKJE 2MKNA 1J26A 2BB8A 2I9IA 3ADGA 2RS6A 3QG5C 2YTIA 2EN7A 3IWDA 2LJHA 1DGCA 2E72A 4ZYDA 2DMYA 2LJUA 2DMIA 3M99B 2RS7A 4LTYA 1T4OA 1ZBTA 2LE2A 2A25A 3TQMA 2EP3A 4BCAA 4LF6E 2WBSA 4DUYE 4DR6E 2GPIA 4DV0E 4JI2E 5F3WA 2EQ3A 3EPJA 2EMHA 4NXME 2YSOA 4R2RA 4GKKE 2RTXA 2L3CA 2LVHA 4KWYA 3LMLA 1AH5A 2EN6A 2EOIA 1PKPA 4DKKA 1DI2A 2LRSA
chains in the Genus database with same CATH topology
2EOJA 2ELYA 5KL4A 2ELZA 1BBOA 2EL6A 2JPAA 1A1LA 2DLQA 4R2EA 4GZNC 4FK5C 2EL4A 1ZAAC 5KL5A 2EM0A 2GHFA 1UN6B 2EM7A 2EOFA 4F6NA 1A1FA 2EQ1A 2LCEA 2EM6A 2EMWA 2PRTA 1G2FC 4WSGA 1A1GA 1LLMC 1YSAC 2LO3A 4R2DA 4F2JC 2YRHA 1UBDC 1X6HA 2EM9A 2J7JA 1TF6A 2VRDA 2YTNA 5KL3A 2ENHA 1F2IG 2EPRA 1X3CA 5KL6A 2CSHA 2NABA 2ENAA 5KL2A 2EN8A 1YUJA 2EOQA 2EMYA 4X9JA 2EMAA 2MKDA 4M9VC 3EPHA 3MHSC 2DLKA 2EQ0A 4R2CA 2EMCA 2EL5A 2EMBA 2YTQA 2EPCA 1TF3A 2I13A 1AAYA 4F6MA 3EPKA 2EOXA 2EOHA 3VHTB 2EOEA 4R2PA 2YRMA 1A1HA 1TN9A 2YTEA 2EJ4A 1Z1BA 2CTDA 2EM3A 2EMGA 3MHHC 1A1KA 1A1IA 4IS1C 3UK3C 2EMZA 3EPLA 1JK1A 2M9AA 2EOOA 2EN2A 2EMXA 2ADRA 2YTDA 2EOMA 2EM5A 2EORA 2EMLA 2EPZA 2RPCA 2CT1A 2EN3A 2WBUA 2YTJA 2EOYA 1X5WA 1WJPA 1ZU1A 2YU8A 1JK2A 1X6EA 1BB8A 2EMKA 2EOZA 4R2QA 2EMFA 1X6FA 2DRPA 2YU5A 1NCSA 2MKNA 2YTPA 2BB8A 2YTFA 2YTOA 2YTIA 1A1JA 1RMDA 2EN7A 2DGCA 2RSIA 2EM8A 4R2AA 2HGHA 1DGCA 2EPXA 2E72A 2EM4A 2EMIA 1ZR9A 2EE8A 2EM2A 2DMIA 2EPPA 5KL7A 3M99B 2EPUA 4IJDA 1B69A 2JP9A 2A25A 2EOSA 2EP3A 2WBSA 2EN4A 2MDGA 1P47A 2WBTA 1KJKA 2YTGA 2EQ3A 2EN1A 2EMHA 2ENCA 2R1FA 3EPJA 2EPAA 1YUIA 2YSPA 2YSOA 2GLIA 4R2RA 2D9HA 2LVHA 4R2SA 1MEYC 2LT7A 2EN6A 2EOIA 2LV2A 1G2DC 2WCC3 2YRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOJ A;  2ELY A;  5KL4 A;  2ELZ A;  1BBO A;  2EL6 A;  2JPA A;  1A1L A;  2DLQ A;  4R2E A;  4GZN C;  4FK5 C;  2EL4 A;  1ZAA C;  5KL5 A;  2EM0 A;  2GHF A;  1UN6 B;  2EM7 A;  2EOF A;  4F6N A;  1A1F A;  2EQ1 A;  2LCE A;  2EM6 A;  2EMW A;  2PRT A;  1G2F C;  4WSG A;  1A1G A;  1LLM C;  1YSA C;  2LO3 A;  4R2D A;  4F2J C;  2YRH A;  1UBD C;  1X6H A;  2EM9 A;  2J7J A;  1TF6 A;  2VRD A;  2YTN A;  5KL3 A;  2ENH A;  1F2I G;  2EPR A;  1X3C A;  5KL6 A;  2CSH A;  2NAB A;  2ENA A;  5KL2 A;  2EN8 A;  1YUJ A;  2EOQ A;  2EMY A;  4X9J A;  2EMA A;  2MKD A;  4M9V C;  3EPH A;  3MHS C;  2DLK A;  2EQ0 A;  4R2C A;  2EMC A;  2EL5 A;  2EMB A;  2YTQ A;  2EPC A;  1TF3 A;  2I13 A;  1AAY A;  4F6M A;  3EPK A;  2EOX A;  2EOH A;  3VHT B;  2EOE A;  4R2P A;  2YRM A;  1A1H A;  1TN9 A;  2YTE A;  2EJ4 A;  1Z1B A;  2CTD A;  2EM3 A;  2EMG A;  3MHH C;  1A1K A;  1A1I A;  4IS1 C;  3UK3 C;  2EMZ A;  3EPL A;  1JK1 A;  2M9A A;  2EOO A;  2EN2 A;  2EMX A;  2ADR A;  2YTD A;  2EOM A;  2EM5 A;  2EOR A;  2EML A;  2EPZ A;  2RPC A;  2CT1 A;  2EN3 A;  2WBU A;  2YTJ A;  2EOY A;  1X5W A;  1WJP A;  1ZU1 A;  2YU8 A;  1JK2 A;  1X6E A;  1BB8 A;  2EMK A;  2EOZ A;  4R2Q A;  2EMF A;  1X6F A;  2DRP A;  2YU5 A;  1NCS A;  2MKN A;  2YTP A;  2BB8 A;  2YTF A;  2YTO A;  2YTI A;  1A1J A;  1RMD A;  2EN7 A;  2DGC A;  2RSI A;  2EM8 A;  4R2A A;  2HGH A;  1DGC A;  2EPX A;  2E72 A;  2EM4 A;  2EMI A;  1ZR9 A;  2EE8 A;  2EM2 A;  2DMI A;  2EPP A;  5KL7 A;  3M99 B;  2EPU A;  4IJD A;  1B69 A;  2JP9 A;  2A25 A;  2EOS A;  2EP3 A;  2WBS A;  2EN4 A;  2MDG A;  1P47 A;  2WBT A;  1KJK A;  2YTG A;  2EQ3 A;  2EN1 A;  2EMH A;  2ENC A;  2R1F A;  3EPJ A;  2EPA A;  1YUI A;  2YSP A;  2YSO A;  2GLI A;  4R2R A;  2D9H A;  2LVH A;  4R2S A;  1MEY C;  2LT7 A;  2EN6 A;  2EOI A;  2LV2 A;  1G2D C;  2WCC 3;  2YRK A; 
#chains in the Genus database with same CATH topology
 2VQF E;  1BBO A;  1A1L A;  4R2E A;  4GZN C;  4FK5 C;  5KL5 A;  1IMU A;  2GHF A;  1UN6 B;  2EM7 A;  4JI3 E;  2VQE E;  5AAS A;  1A1F A;  5AC5 A;  2EQ1 A;  1STU A;  2LCE A;  3KZY A;  2UXB E;  1G2F C;  4DR1 E;  4LFB E;  4ZYE A;  1EH8 A;  4R03 A;  2EM9 A;  2B3T B;  4N4R B;  2VRD A;  2KOU A;  4JI7 E;  4ZYG A;  5KL3 A;  1F2I G;  1X48 A;  1X3C A;  2UU9 E;  2EN8 A;  2Q8U A;  3ADL A;  4DUZ E;  1FKA E;  3P1X A;  2R76 A;  2DIX A;  4DV3 E;  1PDA A;  2JYA A;  3MHS C;  1YFH A;  3HQ1 A;  2DLK A;  1IBM E;  2EMB A;  4JI0 E;  4JI1 E;  4HTG A;  3OTO E;  1TF3 A;  2JOB A;  5T6J A;  2MC6 A;  3L00 A;  2F8B A;  4R2P A;  2YTE A;  4X66 E;  1A1K A;  2EM3 A;  2EMG A;  2VE7 C;  4BC9 A;  1A1I A;  4IS1 C;  3UK3 C;  2V88 A;  4DR7 E;  2KON A;  2N3G A;  2VF1 A;  4LF5 E;  4LU9 A;  3C6M A;  2EN3 A;  1WRJ A;  3JTZ A;  2DRP A;  2L3J A;  4LF9 E;  2YTO A;  2V89 A;  4DR5 E;  1RMD A;  2HGH A;  2RSI A;  2EM8 A;  5DNY A;  4NHR A;  2EPX A;  4AQY E;  4F54 A;  5IXM B;  4BHC A;  2EE8 A;  2EM2 A;  4YY3 E;  2EPP A;  4DV6 E;  2NUF A;  2EPU A;  2YT4 A;  2ZM6 E;  3J80 C;  2JP9 A;  2EN4 A;  3F6H A;  4P7D A;  2WBT A;  3HXL A;  5A6A A;  2L2N A;  4WYQ B;  1HR0 E;  1XNR E;  1HNW E;  1T4L B;  2V83 A;  2YTG A;  2ENC A;  2R1F A;  4TUI A;  1N3G A;  4NZV A;  2YPN A;  2D9H A;  1T38 A;  4JI4 E;  2LV2 A;  4WSP A;  2V86 A;  5A6K A;  1G2D C;  2V85 A;  1QNT A;  5LMN E;  4X62 E;  2EOJ A;  2H36 X;  5KL4 A;  5A6B A;  2JPA A;  2EPL X;  2EL4 A;  3JU0 A;  4WFT A;  2LUP B;  3BBG A;  2L6M A;  4R8O A;  4F6N A;  2EOF A;  2L2M A;  2B7T A;  2M7Q A;  2EM6 A;  2K7I A;  2EPO A;  2FGG A;  2L92 A;  2YRH A;  3AUZ A;  3IWC A;  2IHR 1;  1HNX E;  4BHB A;  3H09 A;  4MLV A;  4JI8 E;  4M2Z A;  3OML A;  4DR3 E;  1YZ9 A;  4X9J A;  3HTX A;  3J7A G;  5FLX C;  1BBG A;  3EPH A;  1EH6 A;  3T1H E;  2EL5 A;  3EQ1 A;  4B3T E;  4L5N C;  3ZOQ B;  2EPC A;  1MGT A;  5LMU E;  3VYY A;  4DV5 E;  1DQ3 A;  2DB2 A;  3ADI A;  5AC4 A;  4LF4 E;  1IQO A;  3F6G A;  2L2K B;  1AAY A;  3THO B;  4F6M A;  5IT9 C;  1PJT A;  1SFE A;  3DJW A;  2EOH A;  2K4V A;  3T1Y E;  1GTK A;  2YRM A;  4O5G A;  1TN9 A;  4RH8 A;  1SR9 A;  1PJS A;  2EJ4 A;  1PJQ A;  2B9D A;  3AV0 A;  2RQL A;  2ADR A;  3VK6 A;  2EM5 A;  3KWR A;  2YTJ A;  1ZU1 A;  1JK2 A;  1BB8 A;  2EMK A;  4GEQ B;  2UUC E;  4Q35 B;  4Q28 A;  4R2Q A;  4JI5 E;  5TSE A;  2EMF A;  2EPM X;  5IWA E;  2HC5 A;  1L4S A;  4ZYH A;  2CPN A;  4F9C B;  2YTP A;  3HPZ A;  4L8N A;  2B7V A;  1YYK A;  1ZBQ A;  1A1J A;  4M30 A;  2LBS B;  2DGC A;  4JV5 E;  5IV8 B;  2UUA E;  2EM4 A;  1X49 A;  1ZR9 A;  3C4B A;  4O43 A;  4IJD A;  3C6K A;  2EOS A;  1IQS A;  2MDG A;  2E5L E;  1P47 A;  2EPN A;  2JWO A;  1HNZ E;  4DR2 E;  1YUI A;  2GLI A;  2L33 A;  2HJJ A;  2FTX B;  2EWL A;  4HEI A;  1XMO E;  2LT7 A;  1MEY C;  3J7Y p;  1UIL A;  2YRK A;  2JY9 A;  1J5E E;  2ELY A;  2YWQ A;  2EL6 A;  1UHZ A;  2DLQ A;  4DR4 E;  1ZAA C;  4JI6 E;  4BS9 A;  2E1M A;  4DV1 E;  2EM0 A;  5A2Q C;  4OX9 E;  1N33 E;  2DSY A;  4BC7 A;  2ODR D;  2V87 A;  3THN A;  4WSG A;  5A69 A;  1LLM C;  4X8W A;  2G7H A;  2LO3 A;  4R2D A;  5AE2 A;  2HHH E;  4LF8 E;  1YYO A;  2J7J A;  4YHH E;  2YTN A;  3DF6 A;  3VYX A;  2EPR A;  2CSH A;  5AE3 A;  2EOQ A;  2EMY A;  5A6B D;  4KHP E;  5BR8 E;  4O4K A;  4DV7 E;  4R2C A;  2EMC A;  3BF2 A;  1XMQ E;  3BGH A;  3ECR A;  2YZT A;  3EPK A;  2FV4 B;  1WXR A;  3VHT B;  2KHX A;  2EOE A;  5CFF E;  1A1H A;  1IBL E;  1QU6 A;  2WZO A;  3MHH C;  2JR1 A;  2N8X A;  4B3R E;  2M9A A;  1RC7 A;  2M1S A;  2EN2 A;  2YTD A;  1T39 A;  2EOM A;  3ADJ A;  2EML A;  2EPZ A;  2N3H A;  2CT1 A;  2RPC A;  4I8O A;  2WBU A;  2EOY A;  1WJP A;  4MLQ A;  1NEI A;  1XNQ E;  2EOZ A;  4BMJ A;  2NUG A;  2YU5 A;  2YTF A;  1N32 E;  4LFC E;  1T4N A;  4R2A A;  4O24 A;  4WXC A;  4B3S E;  1GQE A;  4WXD A;  2EMI A;  2NA2 A;  5KL7 A;  2MC5 A;  4B3M E;  1B69 A;  2RSM A;  2JVA A;  4X64 E;  1KJK A;  2EN1 A;  4JYA E;  2LTS A;  2EPA A;  3C4T A;  4F9A B;  2YSP A;  2NUE A;  3K6Q A;  4R2S A;  5LLQ A;  3FIG A;  4F9B B;  4WPY A;  2UXC E;  2WCC 3;  3BID A;  1KYQ A;  4K0K E;  2BBG A;  2ELZ A;  1IBK E;  5AE1 A;  2MDR A;  2UUB E;  4DV4 E;  1N34 E;  1RQ0 A;  4P78 A;  2EMW A;  4WX9 A;  1EH7 A;  2PRT A;  3MSW A;  1A1G A;  2UXD E;  1YSA C;  4LF7 E;  4F2J C;  1UBD C;  1X6H A;  2M4I A;  1TF6 A;  2ENH A;  5KL6 A;  1X47 A;  4RHB B;  2LMZ A;  4OOG C;  2NAB A;  2ENA A;  3HPS A;  4M0V A;  3JAM C;  5KL2 A;  1YUJ A;  2LUQ A;  1YYW A;  4BBY A;  2EMA A;  2LTR A;  2MKD A;  1FJG E;  4M9V C;  5LL6 R;  4J8Z A;  2V8Q B;  5ADZ A;  2EQ0 A;  2JXP A;  5A6J A;  2YTQ A;  1WHN A;  3KZZ A;  1EKZ A;  2L8T A;  3J81 C;  2I13 A;  4KZS A;  3IWB A;  1I94 E;  2EOX A;  2JOX A;  3LLH A;  4DV2 E;  1N36 E;  4DMI A;  1O0W A;  4NXN E;  1GZ6 A;  1Z1B A;  2CTD A;  2EZ6 A;  2EMZ A;  2ODR C;  3EPL A;  1JK1 A;  4X65 E;  2EOO A;  2EMX A;  2EOR A;  2F4V E;  2EPK X;  1X5W A;  2YU8 A;  1X6E A;  3RMP A;  1YPN A;  1X6F A;  4TUG A;  1WHQ A;  4LFA E;  1NCS A;  4GKJ E;  2MKN A;  1J26 A;  2BB8 A;  2I9I A;  3ADG A;  2RS6 A;  3QG5 C;  2YTI A;  2EN7 A;  3IWD A;  2LJH A;  1DGC A;  2E72 A;  4ZYD A;  2DMY A;  2LJU A;  2DMI A;  3M99 B;  2RS7 A;  4LTY A;  1T4O A;  1ZBT A;  2LE2 A;  2A25 A;  3TQM A;  2EP3 A;  4BCA A;  4LF6 E;  2WBS A;  4DUY E;  4DR6 E;  2GPI A;  4DV0 E;  4JI2 E;  5F3W A;  2EQ3 A;  3EPJ A;  2EMH A;  4NXM E;  2YSO A;  4R2R A;  4GKK E;  2RTX A;  2L3C A;  2LVH A;  4KWY A;  3LML A;  1AH5 A;  2EN6 A;  2EOI A;  1PKP A;  4DKK A;  1DI2 A;  2LRS A; 
#chains in the Genus database with same CATH homology
 2EOJ A;  2ELY A;  5KL4 A;  2ELZ A;  1BBO A;  2EL6 A;  2JPA A;  1A1L A;  2DLQ A;  4R2E A;  4GZN C;  4FK5 C;  2EL4 A;  1ZAA C;  5KL5 A;  2EM0 A;  2GHF A;  1UN6 B;  2EM7 A;  2EOF A;  4F6N A;  1A1F A;  2EQ1 A;  2LCE A;  2EM6 A;  2EMW A;  2PRT A;  1G2F C;  4WSG A;  1A1G A;  1LLM C;  1YSA C;  2LO3 A;  4R2D A;  4F2J C;  2YRH A;  1UBD C;  1X6H A;  2EM9 A;  2J7J A;  1TF6 A;  2VRD A;  2YTN A;  5KL3 A;  2ENH A;  1F2I G;  2EPR A;  1X3C A;  5KL6 A;  2CSH A;  2NAB A;  2ENA A;  5KL2 A;  2EN8 A;  1YUJ A;  2EOQ A;  2EMY A;  4X9J A;  2EMA A;  2MKD A;  4M9V C;  3EPH A;  3MHS C;  2DLK A;  2EQ0 A;  4R2C A;  2EMC A;  2EL5 A;  2EMB A;  2YTQ A;  2EPC A;  1TF3 A;  2I13 A;  1AAY A;  4F6M A;  3EPK A;  2EOX A;  2EOH A;  3VHT B;  2EOE A;  4R2P A;  2YRM A;  1A1H A;  1TN9 A;  2YTE A;  2EJ4 A;  1Z1B A;  2CTD A;  2EM3 A;  2EMG A;  3MHH C;  1A1K A;  1A1I A;  4IS1 C;  3UK3 C;  2EMZ A;  3EPL A;  1JK1 A;  2M9A A;  2EOO A;  2EN2 A;  2EMX A;  2ADR A;  2YTD A;  2EOM A;  2EM5 A;  2EOR A;  2EML A;  2EPZ A;  2RPC A;  2CT1 A;  2EN3 A;  2WBU A;  2YTJ A;  2EOY A;  1X5W A;  1WJP A;  1ZU1 A;  2YU8 A;  1JK2 A;  1X6E A;  1BB8 A;  2EMK A;  2EOZ A;  4R2Q A;  2EMF A;  1X6F A;  2DRP A;  2YU5 A;  1NCS A;  2MKN A;  2YTP A;  2BB8 A;  2YTF A;  2YTO A;  2YTI A;  1A1J A;  1RMD A;  2EN7 A;  2DGC A;  2RSI A;  2EM8 A;  4R2A A;  2HGH A;  1DGC A;  2EPX A;  2E72 A;  2EM4 A;  2EMI A;  1ZR9 A;  2EE8 A;  2EM2 A;  2DMI A;  2EPP A;  5KL7 A;  3M99 B;  2EPU A;  4IJD A;  1B69 A;  2JP9 A;  2A25 A;  2EOS A;  2EP3 A;  2WBS A;  2EN4 A;  2MDG A;  1P47 A;  2WBT A;  1KJK A;  2YTG A;  2EQ3 A;  2EN1 A;  2EMH A;  2ENC A;  2R1F A;  3EPJ A;  2EPA A;  1YUI A;  2YSP A;  2YSO A;  2GLI A;  4R2R A;  2D9H A;  2LVH A;  4R2S A;  1MEY C;  2LT7 A;  2EN6 A;  2EOI A;  2LV2 A;  1G2D C;  2WCC 3;  2YRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...