1A1GA

Dsnr (zif268 variant) zinc finger-dna complex (gcgt site)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
84
structure length
84
Chain Sequence
RPYACPVESCDRRFSDSSNLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*GP*T)-3')
publication title High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 27
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1gA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1gA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1gA03
2EMXA 2DGCA 2EL5A 1RMDA 2EOQA 2EPPA 2NABA 2EPZA 2ENHA 2EPRA 2YTOA 2J7JA 2ELYA 2EMWA 2ENAA 1G2FC 2EORA 4F2JC 4R2PA 2M9AA 1TN9A 4R2SA 2LCEA 1G2DC 4R2CA 1A1HA 2DLKA 2EOEA 2MDGA 2EM0A 2EM3A 1A1IA 2EOFA 2EM4A 2EPUA 4M9VC 2PRTA 2EOMA 2YTEA 1Z1BA 1BB8A 2EL4A 4WSGA 2ADRA 2EMHA 2EPAA 2YTFA 2RSIA 4IJDA 1A1KA 2YTJA 2EN2A 2EM2A 1X3CA 3EPLA 2DLQA 2EOOA 2ELZA 5KL7A 1ZAAC 1LLMC 2EMKA 1MEYC 2WBUA 2DMIA 2EM8A 2LV2A 2EMBA 2YRKA 1KJKA 2D9HA 3MHHC 2EMLA 2R1FA 2EQ3A 2MKDA 1TF6A 1YUJA 2YU8A 5KL4A 2EM5A 2EMGA 2CSHA 1YSAC 5KL3A 2WCC3 1TF3A 1X6HA 2WBTA 1YUIA 2MKNA 1A1GA 2YSPA 2EMYA 4GZNC 2YSOA 2EMAA 2EN1A 2GHFA 2YTGA 2EMCA 1P47A 2EPXA 2EPCA 2YRHA 4X9JA 4R2DA 2YU5A 2EN7A 5KL5A 1B69A 2YRMA 4R2AA 2EM9A 2EOHA 2I13A 2EQ1A 2EN6A 2EM7A 4R2RA 1F2IG 2EOIA 1AAYA 1A1FA 1ZU1A 2RPCA 2EJ4A 1UN6B 2EOSA 4IS1C 2EMZA 4FK5C 3EPHA 5KL6A 1X6FA 5KL2A 1NCSA 2EN8A 2JPAA 2LT7A 3MHSC 3EPJA 2YTNA 2ENCA 1X5WA 1JK2A 2VRDA 2EOYA 2EOZA 2EMIA 2DRPA 2LO3A 2GLIA 2CT1A 1ZR9A 2YTQA 1WJPA 2EN4A 2YTIA 4R2QA 3UK3C 1A1JA 2WBSA 1BBOA 4R2EA 1X6EA 2YTPA 2E72A 4F6NA 2A25A 2JP9A 1UBDC 2EN3A 2EOJA 2EOXA 2EMFA 1JK1A 3M99B 2YTDA 2CTDA 1DGCA 2EQ0A 4F6MA 3EPKA 2EE8A 1A1LA 2LVHA 3VHTB 2EL6A 2HGHA 2EM6A 2EP3A 2BB8A
chains in the Genus database with same CATH superfamily
2EMXA 2EL5A 2LJUA 2EOQA 3K6QA 2RTXA 3BGHA 4BHBA 2J7JA 2EMWA 4X8WA 1G2FC 4F2JC 2LJHA 3C6MA 2F8BA 2LRSA 1J5EE 2M9AA 1UILA 2LCEA 1G2DC 4R2CA 2EOEA 3IWCA 2EM4A 3THOB 2EOMA 4X62E 1RQ0A 4X66E 1Z1BA 2EL4A 5IV8B 2EPAA 3VK6A 3JAMC 4DR4E 2RSMA 1YYWA 4JV5E 5KL7A 1MEYC 1NEIA 2DMIA 4I8OA 3DJWA 2R1FA 4DR6E 4DV1E 2CSHA 3P1XA 1X6HA 4KHPE 2KHXA 3HTXA 2V86A 2UUBE 3OTOE 2L6MA 2LUQA 4BMJA 2YSPA 2V88A 4O24A 5T6JA 2FGGA 2MC6A 3VYYA 1N36E 1SFEA 2EPXA 2EPCA 4X9JA 3MSWA 2EN7A 2KONA 4R2AA 2EOHA 2I13A 2EPMX 4YY3E 1F2IG 2EOIA 3IWDA 1BBGA 3L00A 2RPCA 1UN6B 1PKPA 3BIDA 4WPYA 3ZOQB 2VF1A 4DV7E 1T39A 1X6FA 5KL2A 2LMZA 2LT7A 3MHSC 4X64E 5FLXC 2ENCA 1PDAA 4BC9A 2EOZA 3FIGA 2V89A 3JU0A 2LO3A 4WFTA 4M30A 3OMLA 3ADGA 2EN4A 5AE1A 4R2QA 1IQSA 3J80C 4R2EA 1X6EA 2HC5A 2E1MA 2A25A 5AE3A 1UBDC 2EN3A 1JK1A 4WX9A 1X49A 2CTDA 4DR3E 2L8TA 4F9CB 3C4TA 2EPLX 3EPKA 2F4VE 4DR1E 2LVHA 2B7VA 4DUZE 4ZYEA 4WXDA 2NABA 2EPOA 5A6BD 3HPSA 3KZYA 2YTOA 4R03A 2ENAA 5DNYA 1N34E 2EORA 2EZ6A 5F3WA 4JI4E 1GQEA 2ODRC 2VQEE 2DLKA 1A1IA 4TUGA 1IBLE 3C6KA 4GEQB 4TUIA 4DV0E 4M9VC 4P78A 2YPNA 3IWBA 4B3TE 4LTYA 2I9IA 2DIXA 4JI6E 4IJDA 4LF9E 1A1KA 2YTJA 4HTGA 2EM2A 3HQ1A 2ELZA 4F9AB 2B3TB 1LLMC 1J26A 2EMKA 2LV2A 1YYOA 2HHHE 1N32E 1KJKA 2D9HA 1HNXE 2MKDA 4BHCA 2YU8A 2EM5A 2EMGA 2LBSB 2DSYA 1TF3A 2N3HA 1YUIA 2GPIA 4L8NA 1QU6A 1STUA 2EMAA 2YSOA 2B9DA 4BCAA 2EMCA 1O0WA 1P47A 4B3SE 3T1HE 2UU9E 5A2QC 4DV3E 2YT4A 5KL5A 1YFHA 4N4RB 2YRMA 1B69A 4DR7E 2EN6A 4R2RA 2R76A 3KWRA 1IQOA 2Q8UA 4WXCA 2UUCE 1RC7A 4JI7E 2EJ4A 2EOSA 4IS1C 2EPNA 4FK5C 5A69A 1T4NA 4DV4E 3QG5C 1NCSA 4JI8E 3F6GA 1X47A 3H09A 2EMIA 2L33A 4DUYE 4Q28A 3THNA 4ZYGA 2G7HA 4MLVA 1WHQA 1ZR9A 2ZM6E 2YTIA 3UK3C 2WBSA 1IBME 5LL6R 1BBOA 4F6NA 1N3GA 2L3CA 1XMOE 2EOXA 4DV2E 1HNZE 1UHZA 4RH8A 4Q35B 5AC5A 4WSPA 3VYXA 2EQ0A 3VHTB 1WRJA 2JXPA 3JTZA 4DR5E 2HGHA 2VE7C 2DGCA 2NUEA 2FV4B 2K4VA 2ELYA 4NHRA 4R2PA 3J81C 3HPZA 4DR2E 1A1HA 2RS6A 2MDGA 2EOFA 2H36X 2YZTA 2EPUA 1EH8A 4LF7E 1EKZA 2ADRA 2EMHA 2CPNA 2RSIA 4DV5E 2EN2A 3EPLA 2DLQA 4DMIA 5ADZA 1T4LB 5AC4A 4LF8E 5BR8E 3AUZA 2DMYA 4R8OA 1XNRE 4B3RE 4O43A 1KYQA 2MDRA 1I94E 2EQ3A 1YUJA 1TF6A 1PJSA 2HJJA 1YSAC 4LFAE 4M2ZA 4NXME 5LMNE 1AH5A 4F54A 1A1GA 4X65E 2EMYA 4GZNC 2EN1A 2DB2A 2YTGA 4LFBE 3EQ1A 2YRHA 2UXBE 4R2DA 2K7IA 2L2MA 2JY9A 4HEIA 5IWAE 3ADIA 1YYKA 1GZ6A 1DI2A 2M1SA 4LF5E 4LF6E 1XMQE 1DQ3A 2M4IA 4MLQA 4DV6E 1A1FA 1YZ9A 4B3ME 1MGTA 4LFCE 3RMPA 3EPHA 2V83A 5KL6A 2L3JA 1WHNA 2EN8A 2JPAA 1N33E 2JOXA 1X5WA 2NA2A 5A6KA 4JI0E 4JI2E 4LU9A 3F6HA 2GLIA 2CT1A 2YTQA 4JI1E 1HNWE 1A1JA 2L2KB 5A6AA 4RHBB 2YTPA 4P7DA 1T4OA 2JVAA 1L4SA 2EOJA 2EMFA 2EPKX 2LTSA 2L92A 2IHR1 4ZYDA 4KWYA 2EE8A 2JOBA 4O4KA 2EM6A 2EP3A 1WXRA 1RMDA 2EPPA 4JI5E 2EPZA 2ENHA 2EPRA 4AQYE 3T1YE 1ZBTA 3ECRA 2M7QA 2V85A 1HR0E 1TN9A 4R2SA 4BC7A 2EM0A 2EM3A 4YHHE 4JYAE 2RS7A 4KZSA 4ZYHA 2PRTA 1EH7A 2YTEA 4O5GA 1BB8A 1ZBQA 4WSGA 4WYQB 2EWLA 1YPNA 5LLQA 2YTFA 2JR1A 3HXLA 4JI3E 1X3CA 1PJQA 4M0VA 3J7Yp 3J7AG 1T38A 2EOOA 1ZAAC 3TQMA 3LLHA 2VQFE 2WBUA 2EM8A 1X48A 2BBGA 2EMBA 2YRKA 3MHHC 2EMLA 2JYAA 4BBYA 5IXMB 5KL4A 2NUFA 5KL3A 2WCC3 2JWOA 2WBTA 2MKNA 3DF6A 2V87A 2LUPB 4OX9E 2GHFA 5IT9C 2UXCE 3LMLA 4J8ZA 1GTKA 2UXDE 4F9BB 1IBKE 4BS9A 2MC5A 2YU5A 1QNTA 3KZZA 2UUAE 2EM9A 2EQ1A 2V8QB 2EM7A 1AAYA 4OOGC 3AV0A 1PJTA 4LF4E 1ZU1A 2B7TA 5A6JA 3ADLA 2EMZA 3ADJA 2FTXB 1FKAE 2N3GA 5LMUE 3EPJA 4K0KE 2YTNA 5AASA 1JK2A 2VRDA 2EOYA 2YWQA 2DRPA 5AE2A 5A6BA 2N8XA 4L5NC 1XNQE 2LTRA 2L2NA 3BBGA 2WZOA 1WJPA 2E5LE 1EH6A 2ODRD 2E72A 4NZVA 4NXNE 2JP9A 3M99B 2YTDA 4GKKE 5CFFE 1FJGE 2NUGA 1DGCA 2RQLA 4F6MA 3BF2A 5TSEA 3C4BA 4DKKA 2LE2A 1A1LA 2EL6A 1IMUA 4GKJE 2KOUA 1SR9A 2BB8A
chains in the Genus database with same CATH topology
2EMXA 2DGCA 2EL5A 1RMDA 2EOQA 2EPPA 2NABA 2EPZA 2ENHA 2EPRA 2YTOA 2J7JA 2ELYA 2EMWA 2ENAA 1G2FC 2EORA 4F2JC 4R2PA 2M9AA 1TN9A 4R2SA 2LCEA 1G2DC 4R2CA 1A1HA 2DLKA 2EOEA 2MDGA 2EM0A 2EM3A 1A1IA 2EOFA 2EM4A 2EPUA 4M9VC 2PRTA 2EOMA 2YTEA 1Z1BA 1BB8A 2EL4A 4WSGA 2ADRA 2EMHA 2EPAA 2YTFA 2RSIA 4IJDA 1A1KA 2YTJA 2EN2A 2EM2A 1X3CA 3EPLA 2DLQA 2EOOA 2ELZA 5KL7A 1ZAAC 1LLMC 2EMKA 1MEYC 2WBUA 2DMIA 2EM8A 2LV2A 2EMBA 2YRKA 1KJKA 2D9HA 3MHHC 2EMLA 2R1FA 2EQ3A 2MKDA 1TF6A 1YUJA 2YU8A 5KL4A 2EM5A 2EMGA 2CSHA 1YSAC 5KL3A 2WCC3 1TF3A 1X6HA 2WBTA 1YUIA 2MKNA 1A1GA 2YSPA 2EMYA 4GZNC 2YSOA 2EMAA 2EN1A 2GHFA 2YTGA 2EMCA 1P47A 2EPXA 2EPCA 2YRHA 4X9JA 4R2DA 2YU5A 2EN7A 5KL5A 1B69A 2YRMA 4R2AA 2EM9A 2EOHA 2I13A 2EQ1A 2EN6A 2EM7A 4R2RA 1F2IG 2EOIA 1AAYA 1A1FA 1ZU1A 2RPCA 2EJ4A 1UN6B 2EOSA 4IS1C 2EMZA 4FK5C 3EPHA 5KL6A 1X6FA 5KL2A 1NCSA 2EN8A 2JPAA 2LT7A 3MHSC 3EPJA 2YTNA 2ENCA 1X5WA 1JK2A 2VRDA 2EOYA 2EOZA 2EMIA 2DRPA 2LO3A 2GLIA 2CT1A 1ZR9A 2YTQA 1WJPA 2EN4A 2YTIA 4R2QA 3UK3C 1A1JA 2WBSA 1BBOA 4R2EA 1X6EA 2YTPA 2E72A 4F6NA 2A25A 2JP9A 1UBDC 2EN3A 2EOJA 2EOXA 2EMFA 1JK1A 3M99B 2YTDA 2CTDA 1DGCA 2EQ0A 4F6MA 3EPKA 2EE8A 1A1LA 2LVHA 3VHTB 2EL6A 2HGHA 2EM6A 2EP3A 2BB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMX A;  2DGC A;  2EL5 A;  1RMD A;  2EOQ A;  2EPP A;  2NAB A;  2EPZ A;  2ENH A;  2EPR A;  2YTO A;  2J7J A;  2ELY A;  2EMW A;  2ENA A;  1G2F C;  2EOR A;  4F2J C;  4R2P A;  2M9A A;  1TN9 A;  4R2S A;  2LCE A;  1G2D C;  4R2C A;  1A1H A;  2DLK A;  2EOE A;  2MDG A;  2EM0 A;  2EM3 A;  1A1I A;  2EOF A;  2EM4 A;  2EPU A;  4M9V C;  2PRT A;  2EOM A;  2YTE A;  1Z1B A;  1BB8 A;  2EL4 A;  4WSG A;  2ADR A;  2EMH A;  2EPA A;  2YTF A;  2RSI A;  4IJD A;  1A1K A;  2YTJ A;  2EN2 A;  2EM2 A;  1X3C A;  3EPL A;  2DLQ A;  2EOO A;  2ELZ A;  5KL7 A;  1ZAA C;  1LLM C;  2EMK A;  1MEY C;  2WBU A;  2DMI A;  2EM8 A;  2LV2 A;  2EMB A;  2YRK A;  1KJK A;  2D9H A;  3MHH C;  2EML A;  2R1F A;  2EQ3 A;  2MKD A;  1TF6 A;  1YUJ A;  2YU8 A;  5KL4 A;  2EM5 A;  2EMG A;  2CSH A;  1YSA C;  5KL3 A;  2WCC 3;  1TF3 A;  1X6H A;  2WBT A;  1YUI A;  2MKN A;  1A1G A;  2YSP A;  2EMY A;  4GZN C;  2YSO A;  2EMA A;  2EN1 A;  2GHF A;  2YTG A;  2EMC A;  1P47 A;  2EPX A;  2EPC A;  2YRH A;  4X9J A;  4R2D A;  2YU5 A;  2EN7 A;  5KL5 A;  1B69 A;  2YRM A;  4R2A A;  2EM9 A;  2EOH A;  2I13 A;  2EQ1 A;  2EN6 A;  2EM7 A;  4R2R A;  1F2I G;  2EOI A;  1AAY A;  1A1F A;  1ZU1 A;  2RPC A;  2EJ4 A;  1UN6 B;  2EOS A;  4IS1 C;  2EMZ A;  4FK5 C;  3EPH A;  5KL6 A;  1X6F A;  5KL2 A;  1NCS A;  2EN8 A;  2JPA A;  2LT7 A;  3MHS C;  3EPJ A;  2YTN A;  2ENC A;  1X5W A;  1JK2 A;  2VRD A;  2EOY A;  2EOZ A;  2EMI A;  2DRP A;  2LO3 A;  2GLI A;  2CT1 A;  1ZR9 A;  2YTQ A;  1WJP A;  2EN4 A;  2YTI A;  4R2Q A;  3UK3 C;  1A1J A;  2WBS A;  1BBO A;  4R2E A;  1X6E A;  2YTP A;  2E72 A;  4F6N A;  2A25 A;  2JP9 A;  1UBD C;  2EN3 A;  2EOJ A;  2EOX A;  2EMF A;  1JK1 A;  3M99 B;  2YTD A;  2CTD A;  1DGC A;  2EQ0 A;  4F6M A;  3EPK A;  2EE8 A;  1A1L A;  2LVH A;  3VHT B;  2EL6 A;  2HGH A;  2EM6 A;  2EP3 A;  2BB8 A; 
#chains in the Genus database with same CATH topology
 2EMX A;  2EL5 A;  2LJU A;  2EOQ A;  3K6Q A;  2RTX A;  3BGH A;  4BHB A;  2J7J A;  2EMW A;  4X8W A;  1G2F C;  4F2J C;  2LJH A;  3C6M A;  2F8B A;  2LRS A;  1J5E E;  2M9A A;  1UIL A;  2LCE A;  1G2D C;  4R2C A;  2EOE A;  3IWC A;  2EM4 A;  3THO B;  2EOM A;  4X62 E;  1RQ0 A;  4X66 E;  1Z1B A;  2EL4 A;  5IV8 B;  2EPA A;  3VK6 A;  3JAM C;  4DR4 E;  2RSM A;  1YYW A;  4JV5 E;  5KL7 A;  1MEY C;  1NEI A;  2DMI A;  4I8O A;  3DJW A;  2R1F A;  4DR6 E;  4DV1 E;  2CSH A;  3P1X A;  1X6H A;  4KHP E;  2KHX A;  3HTX A;  2V86 A;  2UUB E;  3OTO E;  2L6M A;  2LUQ A;  4BMJ A;  2YSP A;  2V88 A;  4O24 A;  5T6J A;  2FGG A;  2MC6 A;  3VYY A;  1N36 E;  1SFE A;  2EPX A;  2EPC A;  4X9J A;  3MSW A;  2EN7 A;  2KON A;  4R2A A;  2EOH A;  2I13 A;  2EPM X;  4YY3 E;  1F2I G;  2EOI A;  3IWD A;  1BBG A;  3L00 A;  2RPC A;  1UN6 B;  1PKP A;  3BID A;  4WPY A;  3ZOQ B;  2VF1 A;  4DV7 E;  1T39 A;  1X6F A;  5KL2 A;  2LMZ A;  2LT7 A;  3MHS C;  4X64 E;  5FLX C;  2ENC A;  1PDA A;  4BC9 A;  2EOZ A;  3FIG A;  2V89 A;  3JU0 A;  2LO3 A;  4WFT A;  4M30 A;  3OML A;  3ADG A;  2EN4 A;  5AE1 A;  4R2Q A;  1IQS A;  3J80 C;  4R2E A;  1X6E A;  2HC5 A;  2E1M A;  2A25 A;  5AE3 A;  1UBD C;  2EN3 A;  1JK1 A;  4WX9 A;  1X49 A;  2CTD A;  4DR3 E;  2L8T A;  4F9C B;  3C4T A;  2EPL X;  3EPK A;  2F4V E;  4DR1 E;  2LVH A;  2B7V A;  4DUZ E;  4ZYE A;  4WXD A;  2NAB A;  2EPO A;  5A6B D;  3HPS A;  3KZY A;  2YTO A;  4R03 A;  2ENA A;  5DNY A;  1N34 E;  2EOR A;  2EZ6 A;  5F3W A;  4JI4 E;  1GQE A;  2ODR C;  2VQE E;  2DLK A;  1A1I A;  4TUG A;  1IBL E;  3C6K A;  4GEQ B;  4TUI A;  4DV0 E;  4M9V C;  4P78 A;  2YPN A;  3IWB A;  4B3T E;  4LTY A;  2I9I A;  2DIX A;  4JI6 E;  4IJD A;  4LF9 E;  1A1K A;  2YTJ A;  4HTG A;  2EM2 A;  3HQ1 A;  2ELZ A;  4F9A B;  2B3T B;  1LLM C;  1J26 A;  2EMK A;  2LV2 A;  1YYO A;  2HHH E;  1N32 E;  1KJK A;  2D9H A;  1HNX E;  2MKD A;  4BHC A;  2YU8 A;  2EM5 A;  2EMG A;  2LBS B;  2DSY A;  1TF3 A;  2N3H A;  1YUI A;  2GPI A;  4L8N A;  1QU6 A;  1STU A;  2EMA A;  2YSO A;  2B9D A;  4BCA A;  2EMC A;  1O0W A;  1P47 A;  4B3S E;  3T1H E;  2UU9 E;  5A2Q C;  4DV3 E;  2YT4 A;  5KL5 A;  1YFH A;  4N4R B;  2YRM A;  1B69 A;  4DR7 E;  2EN6 A;  4R2R A;  2R76 A;  3KWR A;  1IQO A;  2Q8U A;  4WXC A;  2UUC E;  1RC7 A;  4JI7 E;  2EJ4 A;  2EOS A;  4IS1 C;  2EPN A;  4FK5 C;  5A69 A;  1T4N A;  4DV4 E;  3QG5 C;  1NCS A;  4JI8 E;  3F6G A;  1X47 A;  3H09 A;  2EMI A;  2L33 A;  4DUY E;  4Q28 A;  3THN A;  4ZYG A;  2G7H A;  4MLV A;  1WHQ A;  1ZR9 A;  2ZM6 E;  2YTI A;  3UK3 C;  2WBS A;  1IBM E;  5LL6 R;  1BBO A;  4F6N A;  1N3G A;  2L3C A;  1XMO E;  2EOX A;  4DV2 E;  1HNZ E;  1UHZ A;  4RH8 A;  4Q35 B;  5AC5 A;  4WSP A;  3VYX A;  2EQ0 A;  3VHT B;  1WRJ A;  2JXP A;  3JTZ A;  4DR5 E;  2HGH A;  2VE7 C;  2DGC A;  2NUE A;  2FV4 B;  2K4V A;  2ELY A;  4NHR A;  4R2P A;  3J81 C;  3HPZ A;  4DR2 E;  1A1H A;  2RS6 A;  2MDG A;  2EOF A;  2H36 X;  2YZT A;  2EPU A;  1EH8 A;  4LF7 E;  1EKZ A;  2ADR A;  2EMH A;  2CPN A;  2RSI A;  4DV5 E;  2EN2 A;  3EPL A;  2DLQ A;  4DMI A;  5ADZ A;  1T4L B;  5AC4 A;  4LF8 E;  5BR8 E;  3AUZ A;  2DMY A;  4R8O A;  1XNR E;  4B3R E;  4O43 A;  1KYQ A;  2MDR A;  1I94 E;  2EQ3 A;  1YUJ A;  1TF6 A;  1PJS A;  2HJJ A;  1YSA C;  4LFA E;  4M2Z A;  4NXM E;  5LMN E;  1AH5 A;  4F54 A;  1A1G A;  4X65 E;  2EMY A;  4GZN C;  2EN1 A;  2DB2 A;  2YTG A;  4LFB E;  3EQ1 A;  2YRH A;  2UXB E;  4R2D A;  2K7I A;  2L2M A;  2JY9 A;  4HEI A;  5IWA E;  3ADI A;  1YYK A;  1GZ6 A;  1DI2 A;  2M1S A;  4LF5 E;  4LF6 E;  1XMQ E;  1DQ3 A;  2M4I A;  4MLQ A;  4DV6 E;  1A1F A;  1YZ9 A;  4B3M E;  1MGT A;  4LFC E;  3RMP A;  3EPH A;  2V83 A;  5KL6 A;  2L3J A;  1WHN A;  2EN8 A;  2JPA A;  1N33 E;  2JOX A;  1X5W A;  2NA2 A;  5A6K A;  4JI0 E;  4JI2 E;  4LU9 A;  3F6H A;  2GLI A;  2CT1 A;  2YTQ A;  4JI1 E;  1HNW E;  1A1J A;  2L2K B;  5A6A A;  4RHB B;  2YTP A;  4P7D A;  1T4O A;  2JVA A;  1L4S A;  2EOJ A;  2EMF A;  2EPK X;  2LTS A;  2L92 A;  2IHR 1;  4ZYD A;  4KWY A;  2EE8 A;  2JOB A;  4O4K A;  2EM6 A;  2EP3 A;  1WXR A;  1RMD A;  2EPP A;  4JI5 E;  2EPZ A;  2ENH A;  2EPR A;  4AQY E;  3T1Y E;  1ZBT A;  3ECR A;  2M7Q A;  2V85 A;  1HR0 E;  1TN9 A;  4R2S A;  4BC7 A;  2EM0 A;  2EM3 A;  4YHH E;  4JYA E;  2RS7 A;  4KZS A;  4ZYH A;  2PRT A;  1EH7 A;  2YTE A;  4O5G A;  1BB8 A;  1ZBQ A;  4WSG A;  4WYQ B;  2EWL A;  1YPN A;  5LLQ A;  2YTF A;  2JR1 A;  3HXL A;  4JI3 E;  1X3C A;  1PJQ A;  4M0V A;  3J7Y p;  3J7A G;  1T38 A;  2EOO A;  1ZAA C;  3TQM A;  3LLH A;  2VQF E;  2WBU A;  2EM8 A;  1X48 A;  2BBG A;  2EMB A;  2YRK A;  3MHH C;  2EML A;  2JYA A;  4BBY A;  5IXM B;  5KL4 A;  2NUF A;  5KL3 A;  2WCC 3;  2JWO A;  2WBT A;  2MKN A;  3DF6 A;  2V87 A;  2LUP B;  4OX9 E;  2GHF A;  5IT9 C;  2UXC E;  3LML A;  4J8Z A;  1GTK A;  2UXD E;  4F9B B;  1IBK E;  4BS9 A;  2MC5 A;  2YU5 A;  1QNT A;  3KZZ A;  2UUA E;  2EM9 A;  2EQ1 A;  2V8Q B;  2EM7 A;  1AAY A;  4OOG C;  3AV0 A;  1PJT A;  4LF4 E;  1ZU1 A;  2B7T A;  5A6J A;  3ADL A;  2EMZ A;  3ADJ A;  2FTX B;  1FKA E;  2N3G A;  5LMU E;  3EPJ A;  4K0K E;  2YTN A;  5AAS A;  1JK2 A;  2VRD A;  2EOY A;  2YWQ A;  2DRP A;  5AE2 A;  5A6B A;  2N8X A;  4L5N C;  1XNQ E;  2LTR A;  2L2N A;  3BBG A;  2WZO A;  1WJP A;  2E5L E;  1EH6 A;  2ODR D;  2E72 A;  4NZV A;  4NXN E;  2JP9 A;  3M99 B;  2YTD A;  4GKK E;  5CFF E;  1FJG E;  2NUG A;  1DGC A;  2RQL A;  4F6M A;  3BF2 A;  5TSE A;  3C4B A;  4DKK A;  2LE2 A;  1A1L A;  2EL6 A;  1IMU A;  4GKJ E;  2KOU A;  1SR9 A;  2BB8 A; 
#chains in the Genus database with same CATH homology
 2EMX A;  2DGC A;  2EL5 A;  1RMD A;  2EOQ A;  2EPP A;  2NAB A;  2EPZ A;  2ENH A;  2EPR A;  2YTO A;  2J7J A;  2ELY A;  2EMW A;  2ENA A;  1G2F C;  2EOR A;  4F2J C;  4R2P A;  2M9A A;  1TN9 A;  4R2S A;  2LCE A;  1G2D C;  4R2C A;  1A1H A;  2DLK A;  2EOE A;  2MDG A;  2EM0 A;  2EM3 A;  1A1I A;  2EOF A;  2EM4 A;  2EPU A;  4M9V C;  2PRT A;  2EOM A;  2YTE A;  1Z1B A;  1BB8 A;  2EL4 A;  4WSG A;  2ADR A;  2EMH A;  2EPA A;  2YTF A;  2RSI A;  4IJD A;  1A1K A;  2YTJ A;  2EN2 A;  2EM2 A;  1X3C A;  3EPL A;  2DLQ A;  2EOO A;  2ELZ A;  5KL7 A;  1ZAA C;  1LLM C;  2EMK A;  1MEY C;  2WBU A;  2DMI A;  2EM8 A;  2LV2 A;  2EMB A;  2YRK A;  1KJK A;  2D9H A;  3MHH C;  2EML A;  2R1F A;  2EQ3 A;  2MKD A;  1TF6 A;  1YUJ A;  2YU8 A;  5KL4 A;  2EM5 A;  2EMG A;  2CSH A;  1YSA C;  5KL3 A;  2WCC 3;  1TF3 A;  1X6H A;  2WBT A;  1YUI A;  2MKN A;  1A1G A;  2YSP A;  2EMY A;  4GZN C;  2YSO A;  2EMA A;  2EN1 A;  2GHF A;  2YTG A;  2EMC A;  1P47 A;  2EPX A;  2EPC A;  2YRH A;  4X9J A;  4R2D A;  2YU5 A;  2EN7 A;  5KL5 A;  1B69 A;  2YRM A;  4R2A A;  2EM9 A;  2EOH A;  2I13 A;  2EQ1 A;  2EN6 A;  2EM7 A;  4R2R A;  1F2I G;  2EOI A;  1AAY A;  1A1F A;  1ZU1 A;  2RPC A;  2EJ4 A;  1UN6 B;  2EOS A;  4IS1 C;  2EMZ A;  4FK5 C;  3EPH A;  5KL6 A;  1X6F A;  5KL2 A;  1NCS A;  2EN8 A;  2JPA A;  2LT7 A;  3MHS C;  3EPJ A;  2YTN A;  2ENC A;  1X5W A;  1JK2 A;  2VRD A;  2EOY A;  2EOZ A;  2EMI A;  2DRP A;  2LO3 A;  2GLI A;  2CT1 A;  1ZR9 A;  2YTQ A;  1WJP A;  2EN4 A;  2YTI A;  4R2Q A;  3UK3 C;  1A1J A;  2WBS A;  1BBO A;  4R2E A;  1X6E A;  2YTP A;  2E72 A;  4F6N A;  2A25 A;  2JP9 A;  1UBD C;  2EN3 A;  2EOJ A;  2EOX A;  2EMF A;  1JK1 A;  3M99 B;  2YTD A;  2CTD A;  1DGC A;  2EQ0 A;  4F6M A;  3EPK A;  2EE8 A;  1A1L A;  2LVH A;  3VHT B;  2EL6 A;  2HGH A;  2EM6 A;  2EP3 A;  2BB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...