1A1GA

Dsnr (zif268 variant) zinc finger-dna complex (gcgt site)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
84
structure length
84
Chain Sequence
RPYACPVESCDRRFSDSSNLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*GP*T)-3')
publication title High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
total genus 27
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1gA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1gA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1gA03
5KL7A 2EMCA 2GHFA 4R2DA 1WJPA 2EN6A 5KL6A 4R2PA 1ZU1A 1A1GA 1YUIA 2EN4A 2EPUA 4M9VC 2ELYA 2EL5A 2YU5A 4R2CA 2ADRA 2EMXA 1X6EA 5KL3A 2CT1A 2ENAA 1A1HA 2EQ1A 2EM7A 4F6NA 1G2DC 2CTDA 2WCC3 2EQ0A 3EPJA 5KL4A 2DGCA 4FK5C 2A25A 2YTPA 1A1FA 2EM9A 2R1FA 2EMZA 2YTNA 1B69A 1TN9A 2EPPA 2EOEA 1X5WA 3VHTB 2EQ3A 2YTOA 2ENHA 1G2FC 2EOQA 2EP3A 2YSPA 1A1LA 2DLQA 1UN6B 2YSOA 2PRTA 2HGHA 4X9JA 2EMYA 3UK3C 2EM3A 1ZAAC 2EOIA 2EMWA 2EM6A 2EPRA 2EM0A 1LLMC 2EOYA 4R2RA 2EN2A 4R2EA 2EOSA 2YU8A 1AAYA 2EN7A 1P47A 1A1IA 2LO3A 1A1KA 2EOJA 2M9AA 1YUJA 2LVHA 5KL2A 4IJDA 2CSHA 2LV2A 2YTFA 1BBOA 1X6FA 2GLIA 1JK1A 1UBDC 2MKDA 1X6HA 2RPCA 2YTIA 2I13A 2RSIA 2EPXA 4R2QA 2EPAA 2YTQA 1YSAC 2EN1A 2EOFA 3EPKA 2EOHA 1BB8A 3EPHA 2YRKA 1X3CA 2ELZA 2EM4A 2EM2A 2YTDA 2EOMA 2WBTA 4WSGA 1DGCA 2YTGA 2EMIA 2VRDA 4R2AA 1TF6A 2EPZA 1RMDA 2EN8A 2YTEA 2NABA 2EMKA 2J7JA 2DRPA 2EPCA 2ENCA 2BB8A 1ZR9A 2D9HA 3M99B 1A1JA 2EMBA 2E72A 2LT7A 1Z1BA 2EL6A 2EL4A 2EOXA 1F2IG 2WBUA 2YRMA 1JK2A 2MKNA 2EJ4A 2EORA 5KL5A 1KJKA 2EE8A 2EMLA 2EN3A 3EPLA 2JPAA 2JP9A 4R2SA 2DMIA 2EMFA 2YTJA 4F6MA 4IS1C 2EM8A 2LCEA 1MEYC 2DLKA 3MHSC 3MHHC 2MDGA 2EMGA 2EMAA 2EOZA 1NCSA 4F2JC 2EM5A 2WBSA 1TF3A 2YRHA 4GZNC 2EMHA 2EOOA
chains in the Genus database with same CATH superfamily
3ADJA 5KL7A 2EMCA 3IWBA 4GKKE 3LLHA 3IWCA 1A1GA 4GEQB 2EPUA 4KWYA 1RQ0A 2V8QB 2YU5A 5A6BD 3ZOQB 2B9DA 3HQ1A 5KL3A 2CTDA 2WCC3 4LFCE 2V86A 2EPKX 5KL4A 4DV6E 2DGCA 2UU9E 5ADZA 2ODRD 2YTPA 4F9BB 5AE2A 3RMPA 2Q8UA 4NXME 2FTXB 2EMZA 1GQEA 1B69A 5A6JA 2HJJA 5A69A 1X5WA 2LUPB 5LL6R 4HTGA 1SFEA 2EP3A 2ZM6E 1UN6B 2PRTA 4OX9E 2RS6A 2E1MA 3BBGA 4WPYA 1ZAAC 5AC4A 4N4RB 2EOYA 4BMJA 2EOSA 2JR1A 2UUAE 2L3JA 3F6HA 5AC5A 1A1IA 1AH5A 2EOJA 2M9AA 2V88A 2M7QA 3OTOE 1FKAE 4GKJE 1N3GA 4L5NC 1XMQE 2LV2A 1ZBQA 1BBOA 4BHBA 3HPZA 2MKDA 4BS9A 2EOFA 4LTYA 2MC5A 3EPHA 2YRKA 3DF6A 4OOGC 1X3CA 2L92A 5AE3A 4JV5E 2WBTA 5DNYA 4ZYDA 4M2ZA 3QG5C 4WSGA 1DGCA 4O5GA 2EPZA 4KZSA 3VYXA 2NABA 2B7TA 3KZYA 4DV4E 3M99B 4WFTA 1A1JA 4LFBE 2E72A 2LT7A 3ADLA 2EJ4A 1N36E 2YZTA 1NEIA 3H09A 2EPLX 2EMLA 4JYAE 1SR9A 1HNWE 2JPAA 2E5LE 2N3GA 3THOB 3C4BA 2L3CA 2EM8A 1MEYC 2DLKA 3BIDA 2EMGA 4ZYHA 2JVAA 1NCSA 5TSEA 2JWOA 2YRHA 2EMHA 5F3WA 2UXBE 3OMLA 3FIGA 4YHHE 4R2DA 5KL6A 1ZU1A 5T6JA 5A6BA 1YUIA 4M9VC 2ELYA 2EL5A 1EH6A 1IQSA 2ADRA 2EMXA 1X6EA 2CT1A 3KZZA 2L2KB 1A1HA 1WHQA 2EM7A 2EQ1A 4P78A 4F6NA 3T1YE 2RSMA 2WZOA 4BC7A 4F54A 2A25A 3JTZA 4TUIA 1A1FA 2L2MA 4X66E 3J7Yp 1X48A 2L6MA 2HHHE 1PJTA 4JI0E 2EPMX 5IXMB 2ENHA 2L8TA 2KHXA 5IT9C 2DLQA 4JI6E 1YZ9A 2HGHA 2DIXA 2EMYA 2EM3A 3ADIA 2EPRA 2JYAA 3C4TA 3JAMC 4R2EA 4DV2E 4KHPE 1AAYA 2EN7A 4BC9A 1A1KA 1IBLE 1YUJA 3HXLA 4AQYE 5KL2A 4DR3E 2CSHA 2V87A 4DR5E 4DR6E 2YTFA 1X6FA 2GLIA 2KOUA 3KWRA 3T1HE 4WX9A 1JK1A 4WXDA 1T39A 4NHRA 2M1SA 2EPXA 2EPAA 4B3TE 2N3HA 2EN1A 1YSAC 1XMOE 3IWDA 4L8NA 1X49A 1I94E 2EOMA 3EQ1A 2VRDA 1RMDA 4LF7E 2EN8A 2YTEA 2J7JA 2DRPA 1L4SA 2BB8A 1ZR9A 2D9HA 2DSYA 2EMBA 1XNRE 1WRJA 4Q28A 4DV1E 2EOXA 4JI2E 2WBUA 4MLQA 4DR1E 4Q35B 2DB2A 4I8OA 3AUZA 4R2SA 2MDRA 2JY9A 3DJWA 2EMFA 4WSPA 1QU6A 4DKKA 5FLXC 3C6MA 3MHSC 1J26A 2MDGA 2ODRC 3TQMA 5BR8E 2EOZA 1QNTA 2WBSA 4DUZE 2L33A 1PKPA 2DMYA 2GHFA 2LUQA 1WJPA 4R2PA 2N8XA 4BBYA 2JXPA 2NUEA 2V83A 1GTKA 2KONA 4LU9A 2VF1A 4X8WA 2LBSB 3EPJA 1X47A 4O4KA 2LRSA 1O0WA 1YFHA 2EM9A 2LJHA 2R1FA 3JU0A 4R03A 2RQLA 5A2QC 4JI5E 2YTNA 3J7AG 2V85A 1TN9A 4WXCA 2EPPA 4M0VA 2EOEA 4BCAA 3VHTB 3HPSA 4LF9E 2EPNA 1G2FC 2YSPA 4DR4E 3J80C 4X9JA 3UK3C 4TUGA 2EM6A 1LLMC 1T4NA 2EN2A 2YU8A 4B3SE 1UHZA 1P47A 2LO3A 4F9CB 1YPNA 1XNQE 4X65E 1MGTA 1T4LB 5AASA 1T4OA 4HEIA 4NXNE 1X6HA 3L00A 5IV8B 2MC6A 3EPKA 4BHCA 4LF6E 1N34E 2EM4A 2EM2A 2YTDA 2EZ6A 4YY3E 2UXDE 2YTGA 4R2AA 4LF5E 2NUFA 4F9AB 2ENCA 1ZBTA 1Z1BA 2EL6A 2YWQA 2EL4A 4P7DA 2UUBE 1IQOA 2NUGA 4DV3E 5AE1A 1F2IG 2NA2A 2YRMA 1JK2A 2MKNA 4DR7E 5KL5A 4DV5E 1KJKA 2EE8A 4O43A 3C6KA 5A6AA 2UXCE 2EN3A 3MSWA 4J8ZA 3EPLA 2JP9A 2F8BA 2YTJA 2VQFE 4JI4E 3HTXA 4DR2E 2R76A 3BF2A 4F2JC 2M4IA 4GZNC 4LFAE 2LMZA 4B3RE 1IMUA 5IWAE 2EN6A 5LMNE 1YYOA 1KYQA 2EN4A 2JOXA 2YPNA 4R2CA 4LF8E 2EPOA 1UILA 2G7HA 2LTRA 2B3TB 2ENAA 1PDAA 2V89A 1G2DC 4DV7E 4R8OA 2EQ0A 4FK5C 4RH8A 4DV0E 2F4VE 1DQ3A 3VK6A 4X64E 1J5EE 1BBGA 1EH8A 2LJUA 5LMUE 2EQ3A 2YTOA 3THNA 2K4VA 2EOQA 2VE7C 5CFFE 1HNZE 4LF4E 1A1LA 2YSOA 2RS7A 2EOIA 2EMWA 2B7VA 1N33E 4ZYGA 2LE2A 2EM0A 3J81C 2IHR1 5A6KA 4R2RA 3VYYA 3LMLA 4JI7E 2I9IA 1YYKA 2LVHA 2BBGA 2H36X 4IJDA 1IBKE 4JI3E 1UBDC 2GPIA 2RPCA 2YTIA 3F6GA 2I13A 2RSIA 4R2QA 2YTQA 1DI2A 1BB8A 2EOHA 1PJSA 1HR0E 3BGHA 2ELZA 4ZYEA 1STUA 1HNXE 4DUYE 4K0KE 4B3ME 4NZVA 2L2NA 4M30A 2EMIA 1TF6A 2LTSA 4MLVA 4X62E 2EMKA 2EPCA 1EH7A 2FV4B 2JOBA 2VQEE 1PJQA 3ADGA 1IBME 5LLQA 1WHNA 4RHBB 2EORA 3ECRA 3K6QA 1N32E 3AV0A 2EWLA 2RTXA 4JI1E 1GZ6A 2FGGA 2HC5A 2K7IA 1EKZA 2YT4A 4DMIA 2DMIA 1T38A 1RC7A 4F6MA 4IS1C 2UUCE 2LCEA 3MHHC 2CPNA 4JI8E 1FJGE 2EMAA 1WXRA 4WYQB 4O24A 1YYWA 2EM5A 1TF3A 3P1XA 2EOOA
chains in the Genus database with same CATH topology
5KL7A 2EMCA 2GHFA 4R2DA 1WJPA 2EN6A 5KL6A 4R2PA 1ZU1A 1A1GA 1YUIA 2EN4A 2EPUA 4M9VC 2ELYA 2EL5A 2YU5A 4R2CA 2ADRA 2EMXA 1X6EA 5KL3A 2CT1A 2ENAA 1A1HA 2EQ1A 2EM7A 4F6NA 1G2DC 2CTDA 2WCC3 2EQ0A 3EPJA 5KL4A 2DGCA 4FK5C 2A25A 2YTPA 1A1FA 2EM9A 2R1FA 2EMZA 2YTNA 1B69A 1TN9A 2EPPA 2EOEA 1X5WA 3VHTB 2EQ3A 2YTOA 2ENHA 1G2FC 2EOQA 2EP3A 2YSPA 1A1LA 2DLQA 1UN6B 2YSOA 2PRTA 2HGHA 4X9JA 2EMYA 3UK3C 2EM3A 1ZAAC 2EOIA 2EMWA 2EM6A 2EPRA 2EM0A 1LLMC 2EOYA 4R2RA 2EN2A 4R2EA 2EOSA 2YU8A 1AAYA 2EN7A 1P47A 1A1IA 2LO3A 1A1KA 2EOJA 2M9AA 1YUJA 2LVHA 5KL2A 4IJDA 2CSHA 2LV2A 2YTFA 1BBOA 1X6FA 2GLIA 1JK1A 1UBDC 2MKDA 1X6HA 2RPCA 2YTIA 2I13A 2RSIA 2EPXA 4R2QA 2EPAA 2YTQA 1YSAC 2EN1A 2EOFA 3EPKA 2EOHA 1BB8A 3EPHA 2YRKA 1X3CA 2ELZA 2EM4A 2EM2A 2YTDA 2EOMA 2WBTA 4WSGA 1DGCA 2YTGA 2EMIA 2VRDA 4R2AA 1TF6A 2EPZA 1RMDA 2EN8A 2YTEA 2NABA 2EMKA 2J7JA 2DRPA 2EPCA 2ENCA 2BB8A 1ZR9A 2D9HA 3M99B 1A1JA 2EMBA 2E72A 2LT7A 1Z1BA 2EL6A 2EL4A 2EOXA 1F2IG 2WBUA 2YRMA 1JK2A 2MKNA 2EJ4A 2EORA 5KL5A 1KJKA 2EE8A 2EMLA 2EN3A 3EPLA 2JPAA 2JP9A 4R2SA 2DMIA 2EMFA 2YTJA 4F6MA 4IS1C 2EM8A 2LCEA 1MEYC 2DLKA 3MHSC 3MHHC 2MDGA 2EMGA 2EMAA 2EOZA 1NCSA 4F2JC 2EM5A 2WBSA 1TF3A 2YRHA 4GZNC 2EMHA 2EOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KL7 A;  2EMC A;  2GHF A;  4R2D A;  1WJP A;  2EN6 A;  5KL6 A;  4R2P A;  1ZU1 A;  1A1G A;  1YUI A;  2EN4 A;  2EPU A;  4M9V C;  2ELY A;  2EL5 A;  2YU5 A;  4R2C A;  2ADR A;  2EMX A;  1X6E A;  5KL3 A;  2CT1 A;  2ENA A;  1A1H A;  2EQ1 A;  2EM7 A;  4F6N A;  1G2D C;  2CTD A;  2WCC 3;  2EQ0 A;  3EPJ A;  5KL4 A;  2DGC A;  4FK5 C;  2A25 A;  2YTP A;  1A1F A;  2EM9 A;  2R1F A;  2EMZ A;  2YTN A;  1B69 A;  1TN9 A;  2EPP A;  2EOE A;  1X5W A;  3VHT B;  2EQ3 A;  2YTO A;  2ENH A;  1G2F C;  2EOQ A;  2EP3 A;  2YSP A;  1A1L A;  2DLQ A;  1UN6 B;  2YSO A;  2PRT A;  2HGH A;  4X9J A;  2EMY A;  3UK3 C;  2EM3 A;  1ZAA C;  2EOI A;  2EMW A;  2EM6 A;  2EPR A;  2EM0 A;  1LLM C;  2EOY A;  4R2R A;  2EN2 A;  4R2E A;  2EOS A;  2YU8 A;  1AAY A;  2EN7 A;  1P47 A;  1A1I A;  2LO3 A;  1A1K A;  2EOJ A;  2M9A A;  1YUJ A;  2LVH A;  5KL2 A;  4IJD A;  2CSH A;  2LV2 A;  2YTF A;  1BBO A;  1X6F A;  2GLI A;  1JK1 A;  1UBD C;  2MKD A;  1X6H A;  2RPC A;  2YTI A;  2I13 A;  2RSI A;  2EPX A;  4R2Q A;  2EPA A;  2YTQ A;  1YSA C;  2EN1 A;  2EOF A;  3EPK A;  2EOH A;  1BB8 A;  3EPH A;  2YRK A;  1X3C A;  2ELZ A;  2EM4 A;  2EM2 A;  2YTD A;  2EOM A;  2WBT A;  4WSG A;  1DGC A;  2YTG A;  2EMI A;  2VRD A;  4R2A A;  1TF6 A;  2EPZ A;  1RMD A;  2EN8 A;  2YTE A;  2NAB A;  2EMK A;  2J7J A;  2DRP A;  2EPC A;  2ENC A;  2BB8 A;  1ZR9 A;  2D9H A;  3M99 B;  1A1J A;  2EMB A;  2E72 A;  2LT7 A;  1Z1B A;  2EL6 A;  2EL4 A;  2EOX A;  1F2I G;  2WBU A;  2YRM A;  1JK2 A;  2MKN A;  2EJ4 A;  2EOR A;  5KL5 A;  1KJK A;  2EE8 A;  2EML A;  2EN3 A;  3EPL A;  2JPA A;  2JP9 A;  4R2S A;  2DMI A;  2EMF A;  2YTJ A;  4F6M A;  4IS1 C;  2EM8 A;  2LCE A;  1MEY C;  2DLK A;  3MHS C;  3MHH C;  2MDG A;  2EMG A;  2EMA A;  2EOZ A;  1NCS A;  4F2J C;  2EM5 A;  2WBS A;  1TF3 A;  2YRH A;  4GZN C;  2EMH A;  2EOO A; 
#chains in the Genus database with same CATH topology
 3ADJ A;  5KL7 A;  2EMC A;  3IWB A;  4GKK E;  3LLH A;  3IWC A;  1A1G A;  4GEQ B;  2EPU A;  4KWY A;  1RQ0 A;  2V8Q B;  2YU5 A;  5A6B D;  3ZOQ B;  2B9D A;  3HQ1 A;  5KL3 A;  2CTD A;  2WCC 3;  4LFC E;  2V86 A;  2EPK X;  5KL4 A;  4DV6 E;  2DGC A;  2UU9 E;  5ADZ A;  2ODR D;  2YTP A;  4F9B B;  5AE2 A;  3RMP A;  2Q8U A;  4NXM E;  2FTX B;  2EMZ A;  1GQE A;  1B69 A;  5A6J A;  2HJJ A;  5A69 A;  1X5W A;  2LUP B;  5LL6 R;  4HTG A;  1SFE A;  2EP3 A;  2ZM6 E;  1UN6 B;  2PRT A;  4OX9 E;  2RS6 A;  2E1M A;  3BBG A;  4WPY A;  1ZAA C;  5AC4 A;  4N4R B;  2EOY A;  4BMJ A;  2EOS A;  2JR1 A;  2UUA E;  2L3J A;  3F6H A;  5AC5 A;  1A1I A;  1AH5 A;  2EOJ A;  2M9A A;  2V88 A;  2M7Q A;  3OTO E;  1FKA E;  4GKJ E;  1N3G A;  4L5N C;  1XMQ E;  2LV2 A;  1ZBQ A;  1BBO A;  4BHB A;  3HPZ A;  2MKD A;  4BS9 A;  2EOF A;  4LTY A;  2MC5 A;  3EPH A;  2YRK A;  3DF6 A;  4OOG C;  1X3C A;  2L92 A;  5AE3 A;  4JV5 E;  2WBT A;  5DNY A;  4ZYD A;  4M2Z A;  3QG5 C;  4WSG A;  1DGC A;  4O5G A;  2EPZ A;  4KZS A;  3VYX A;  2NAB A;  2B7T A;  3KZY A;  4DV4 E;  3M99 B;  4WFT A;  1A1J A;  4LFB E;  2E72 A;  2LT7 A;  3ADL A;  2EJ4 A;  1N36 E;  2YZT A;  1NEI A;  3H09 A;  2EPL X;  2EML A;  4JYA E;  1SR9 A;  1HNW E;  2JPA A;  2E5L E;  2N3G A;  3THO B;  3C4B A;  2L3C A;  2EM8 A;  1MEY C;  2DLK A;  3BID A;  2EMG A;  4ZYH A;  2JVA A;  1NCS A;  5TSE A;  2JWO A;  2YRH A;  2EMH A;  5F3W A;  2UXB E;  3OML A;  3FIG A;  4YHH E;  4R2D A;  5KL6 A;  1ZU1 A;  5T6J A;  5A6B A;  1YUI A;  4M9V C;  2ELY A;  2EL5 A;  1EH6 A;  1IQS A;  2ADR A;  2EMX A;  1X6E A;  2CT1 A;  3KZZ A;  2L2K B;  1A1H A;  1WHQ A;  2EM7 A;  2EQ1 A;  4P78 A;  4F6N A;  3T1Y E;  2RSM A;  2WZO A;  4BC7 A;  4F54 A;  2A25 A;  3JTZ A;  4TUI A;  1A1F A;  2L2M A;  4X66 E;  3J7Y p;  1X48 A;  2L6M A;  2HHH E;  1PJT A;  4JI0 E;  2EPM X;  5IXM B;  2ENH A;  2L8T A;  2KHX A;  5IT9 C;  2DLQ A;  4JI6 E;  1YZ9 A;  2HGH A;  2DIX A;  2EMY A;  2EM3 A;  3ADI A;  2EPR A;  2JYA A;  3C4T A;  3JAM C;  4R2E A;  4DV2 E;  4KHP E;  1AAY A;  2EN7 A;  4BC9 A;  1A1K A;  1IBL E;  1YUJ A;  3HXL A;  4AQY E;  5KL2 A;  4DR3 E;  2CSH A;  2V87 A;  4DR5 E;  4DR6 E;  2YTF A;  1X6F A;  2GLI A;  2KOU A;  3KWR A;  3T1H E;  4WX9 A;  1JK1 A;  4WXD A;  1T39 A;  4NHR A;  2M1S A;  2EPX A;  2EPA A;  4B3T E;  2N3H A;  2EN1 A;  1YSA C;  1XMO E;  3IWD A;  4L8N A;  1X49 A;  1I94 E;  2EOM A;  3EQ1 A;  2VRD A;  1RMD A;  4LF7 E;  2EN8 A;  2YTE A;  2J7J A;  2DRP A;  1L4S A;  2BB8 A;  1ZR9 A;  2D9H A;  2DSY A;  2EMB A;  1XNR E;  1WRJ A;  4Q28 A;  4DV1 E;  2EOX A;  4JI2 E;  2WBU A;  4MLQ A;  4DR1 E;  4Q35 B;  2DB2 A;  4I8O A;  3AUZ A;  4R2S A;  2MDR A;  2JY9 A;  3DJW A;  2EMF A;  4WSP A;  1QU6 A;  4DKK A;  5FLX C;  3C6M A;  3MHS C;  1J26 A;  2MDG A;  2ODR C;  3TQM A;  5BR8 E;  2EOZ A;  1QNT A;  2WBS A;  4DUZ E;  2L33 A;  1PKP A;  2DMY A;  2GHF A;  2LUQ A;  1WJP A;  4R2P A;  2N8X A;  4BBY A;  2JXP A;  2NUE A;  2V83 A;  1GTK A;  2KON A;  4LU9 A;  2VF1 A;  4X8W A;  2LBS B;  3EPJ A;  1X47 A;  4O4K A;  2LRS A;  1O0W A;  1YFH A;  2EM9 A;  2LJH A;  2R1F A;  3JU0 A;  4R03 A;  2RQL A;  5A2Q C;  4JI5 E;  2YTN A;  3J7A G;  2V85 A;  1TN9 A;  4WXC A;  2EPP A;  4M0V A;  2EOE A;  4BCA A;  3VHT B;  3HPS A;  4LF9 E;  2EPN A;  1G2F C;  2YSP A;  4DR4 E;  3J80 C;  4X9J A;  3UK3 C;  4TUG A;  2EM6 A;  1LLM C;  1T4N A;  2EN2 A;  2YU8 A;  4B3S E;  1UHZ A;  1P47 A;  2LO3 A;  4F9C B;  1YPN A;  1XNQ E;  4X65 E;  1MGT A;  1T4L B;  5AAS A;  1T4O A;  4HEI A;  4NXN E;  1X6H A;  3L00 A;  5IV8 B;  2MC6 A;  3EPK A;  4BHC A;  4LF6 E;  1N34 E;  2EM4 A;  2EM2 A;  2YTD A;  2EZ6 A;  4YY3 E;  2UXD E;  2YTG A;  4R2A A;  4LF5 E;  2NUF A;  4F9A B;  2ENC A;  1ZBT A;  1Z1B A;  2EL6 A;  2YWQ A;  2EL4 A;  4P7D A;  2UUB E;  1IQO A;  2NUG A;  4DV3 E;  5AE1 A;  1F2I G;  2NA2 A;  2YRM A;  1JK2 A;  2MKN A;  4DR7 E;  5KL5 A;  4DV5 E;  1KJK A;  2EE8 A;  4O43 A;  3C6K A;  5A6A A;  2UXC E;  2EN3 A;  3MSW A;  4J8Z A;  3EPL A;  2JP9 A;  2F8B A;  2YTJ A;  2VQF E;  4JI4 E;  3HTX A;  4DR2 E;  2R76 A;  3BF2 A;  4F2J C;  2M4I A;  4GZN C;  4LFA E;  2LMZ A;  4B3R E;  1IMU A;  5IWA E;  2EN6 A;  5LMN E;  1YYO A;  1KYQ A;  2EN4 A;  2JOX A;  2YPN A;  4R2C A;  4LF8 E;  2EPO A;  1UIL A;  2G7H A;  2LTR A;  2B3T B;  2ENA A;  1PDA A;  2V89 A;  1G2D C;  4DV7 E;  4R8O A;  2EQ0 A;  4FK5 C;  4RH8 A;  4DV0 E;  2F4V E;  1DQ3 A;  3VK6 A;  4X64 E;  1J5E E;  1BBG A;  1EH8 A;  2LJU A;  5LMU E;  2EQ3 A;  2YTO A;  3THN A;  2K4V A;  2EOQ A;  2VE7 C;  5CFF E;  1HNZ E;  4LF4 E;  1A1L A;  2YSO A;  2RS7 A;  2EOI A;  2EMW A;  2B7V A;  1N33 E;  4ZYG A;  2LE2 A;  2EM0 A;  3J81 C;  2IHR 1;  5A6K A;  4R2R A;  3VYY A;  3LML A;  4JI7 E;  2I9I A;  1YYK A;  2LVH A;  2BBG A;  2H36 X;  4IJD A;  1IBK E;  4JI3 E;  1UBD C;  2GPI A;  2RPC A;  2YTI A;  3F6G A;  2I13 A;  2RSI A;  4R2Q A;  2YTQ A;  1DI2 A;  1BB8 A;  2EOH A;  1PJS A;  1HR0 E;  3BGH A;  2ELZ A;  4ZYE A;  1STU A;  1HNX E;  4DUY E;  4K0K E;  4B3M E;  4NZV A;  2L2N A;  4M30 A;  2EMI A;  1TF6 A;  2LTS A;  4MLV A;  4X62 E;  2EMK A;  2EPC A;  1EH7 A;  2FV4 B;  2JOB A;  2VQE E;  1PJQ A;  3ADG A;  1IBM E;  5LLQ A;  1WHN A;  4RHB B;  2EOR A;  3ECR A;  3K6Q A;  1N32 E;  3AV0 A;  2EWL A;  2RTX A;  4JI1 E;  1GZ6 A;  2FGG A;  2HC5 A;  2K7I A;  1EKZ A;  2YT4 A;  4DMI A;  2DMI A;  1T38 A;  1RC7 A;  4F6M A;  4IS1 C;  2UUC E;  2LCE A;  3MHH C;  2CPN A;  4JI8 E;  1FJG E;  2EMA A;  1WXR A;  4WYQ B;  4O24 A;  1YYW A;  2EM5 A;  1TF3 A;  3P1X A;  2EOO A; 
#chains in the Genus database with same CATH homology
 5KL7 A;  2EMC A;  2GHF A;  4R2D A;  1WJP A;  2EN6 A;  5KL6 A;  4R2P A;  1ZU1 A;  1A1G A;  1YUI A;  2EN4 A;  2EPU A;  4M9V C;  2ELY A;  2EL5 A;  2YU5 A;  4R2C A;  2ADR A;  2EMX A;  1X6E A;  5KL3 A;  2CT1 A;  2ENA A;  1A1H A;  2EQ1 A;  2EM7 A;  4F6N A;  1G2D C;  2CTD A;  2WCC 3;  2EQ0 A;  3EPJ A;  5KL4 A;  2DGC A;  4FK5 C;  2A25 A;  2YTP A;  1A1F A;  2EM9 A;  2R1F A;  2EMZ A;  2YTN A;  1B69 A;  1TN9 A;  2EPP A;  2EOE A;  1X5W A;  3VHT B;  2EQ3 A;  2YTO A;  2ENH A;  1G2F C;  2EOQ A;  2EP3 A;  2YSP A;  1A1L A;  2DLQ A;  1UN6 B;  2YSO A;  2PRT A;  2HGH A;  4X9J A;  2EMY A;  3UK3 C;  2EM3 A;  1ZAA C;  2EOI A;  2EMW A;  2EM6 A;  2EPR A;  2EM0 A;  1LLM C;  2EOY A;  4R2R A;  2EN2 A;  4R2E A;  2EOS A;  2YU8 A;  1AAY A;  2EN7 A;  1P47 A;  1A1I A;  2LO3 A;  1A1K A;  2EOJ A;  2M9A A;  1YUJ A;  2LVH A;  5KL2 A;  4IJD A;  2CSH A;  2LV2 A;  2YTF A;  1BBO A;  1X6F A;  2GLI A;  1JK1 A;  1UBD C;  2MKD A;  1X6H A;  2RPC A;  2YTI A;  2I13 A;  2RSI A;  2EPX A;  4R2Q A;  2EPA A;  2YTQ A;  1YSA C;  2EN1 A;  2EOF A;  3EPK A;  2EOH A;  1BB8 A;  3EPH A;  2YRK A;  1X3C A;  2ELZ A;  2EM4 A;  2EM2 A;  2YTD A;  2EOM A;  2WBT A;  4WSG A;  1DGC A;  2YTG A;  2EMI A;  2VRD A;  4R2A A;  1TF6 A;  2EPZ A;  1RMD A;  2EN8 A;  2YTE A;  2NAB A;  2EMK A;  2J7J A;  2DRP A;  2EPC A;  2ENC A;  2BB8 A;  1ZR9 A;  2D9H A;  3M99 B;  1A1J A;  2EMB A;  2E72 A;  2LT7 A;  1Z1B A;  2EL6 A;  2EL4 A;  2EOX A;  1F2I G;  2WBU A;  2YRM A;  1JK2 A;  2MKN A;  2EJ4 A;  2EOR A;  5KL5 A;  1KJK A;  2EE8 A;  2EML A;  2EN3 A;  3EPL A;  2JPA A;  2JP9 A;  4R2S A;  2DMI A;  2EMF A;  2YTJ A;  4F6M A;  4IS1 C;  2EM8 A;  2LCE A;  1MEY C;  2DLK A;  3MHS C;  3MHH C;  2MDG A;  2EMG A;  2EMA A;  2EOZ A;  1NCS A;  4F2J C;  2EM5 A;  2WBS A;  1TF3 A;  2YRH A;  4GZN C;  2EMH A;  2EOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...