2CSHA

Solution structure of tandem repeat of the zf-c2h2 domains of human zinc finger protein 297b
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
110
structure length
110
Chain Sequence
GSSGSSGDKLYPCQCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIHTGIKPYECNICAKRFMWRDSFHRHVTSCTKSYEAAKAEQNTTEASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of tandem repeat of the zf-C2H2 domains of human zinc finger protein 297B
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 297B
total genus 21
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2005-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2cshA01
4IS1C 2MKDA 2EM0A 2EM9A 2EM7A 4F6NA 3MHSC 1RMDA 2GHFA 2RPCA 4M9VC 2EMLA 4R2DA 2EOQA 2HGHA 4F2JC 1AAYA 2EN1A 1LLMC 2LT7A 2EN2A 3M99B 1JK2A 2YSOA 2EPRA 3EPKA 2LO3A 2EORA 2EPPA 1MEYC 5KL2A 2EN7A 2ENAA 5KL7A 1P47A 4FK5C 2JP9A 1WJPA 1A1HA 2MKNA 3EPJA 1F2IG 1X6EA 2EOMA 2EN3A 2ENCA 2EP3A 4X9JA 1A1IA 2J7JA 2YTOA 2EL5A 2EM2A 2E72A 2ELZA 2EM3A 2I13A 2EMWA 2EOZA 5KL6A 2M9AA 3EPHA 2EQ1A 2WCC3 4R2PA 3VHTB 2YRHA 2EL4A 2YRKA 2DRPA 2EOXA 2EN4A 1Z1BA 4R2CA 2EPUA 2EM8A 2EOHA 1ZAAC 2DMIA 2EMKA 1A1GA 2YTFA 2YU8A 2EMFA 2EOOA 2YTGA 1X6HA 2BB8A 2EMHA 1A1JA 4F6MA 2EMXA 2EQ0A 2EMAA 2A25A 2CT1A 4GZNC 2EMCA 2YSPA 2EM6A 3UK3C 2ADRA 1ZR9A 2ELYA 2YTIA 1YUJA 2EOYA 2EJ4A 2EMBA 2EPCA 1ZU1A 2D9HA 1A1LA 1TF3A 1KJKA 1BBOA 1X6FA 1JK1A 2RSIA 2NABA 1A1FA 2YTDA 2EN6A 2EMYA 1TF6A 2YTPA 1TN9A 2YTEA 2CTDA 2LV2A 4IJDA 2YRMA 1G2FC 2EOSA 2EPXA 2EOIA 1X5WA 2EM4A 2JPAA 1BB8A 2PRTA 2CSHA 1B69A 4R2RA 3EPLA 2EPAA 2EMZA 3MHHC 5KL5A 1DGCA 2R1FA 4R2EA 1YUIA 2YTQA 1UN6B 2YU5A 5KL3A 1G2DC 2EOEA 2ENHA 2EM5A 2EOFA 2EL6A 2EMGA 4R2SA 1NCSA 2YTJA 5KL4A 2DLQA 2EQ3A 4R2QA 2LVHA 2WBSA 2GLIA 1A1KA 2EN8A 4R2AA 2EOJA 2EPZA 2WBUA 2WBTA 2DLKA 1X3CA 2EMIA 2YTNA 1UBDC 2EE8A 2MDGA 2DGCA 4WSGA 2VRDA 2LCEA 1YSAC
chains in the Genus database with same CATH superfamily
2UU9E 4MLVA 1T4LB 2DB2A 1GZ6A 4R2DA 2RSMA 2HGHA 1YYKA 1T38A 1LLMC 2NUFA 2LT7A 3LLHA 4NXME 3EPKA 2EORA 5FLXC 2N8XA 1GTKA 2ODRC 5KL2A 2F8BA 4GKKE 2JY9A 1WJPA 1F2IG 5AE2A 1J26A 4NHRA 2IHR1 5IWAE 2J7JA 5LLQA 2EM2A 2NA2A 1PDAA 5LL6R 3DJWA 3KWRA 2L6MA 4JI6E 4OX9E 3EPHA 1GQEA 4LTYA 3OTOE 4R2PA 4BHBA 4DR4E 2LJUA 3THOB 1HNWE 2EPOA 2EM8A 3QG5C 1FJGE 1PJQA 1ZAAC 3FIGA 1A1GA 4ZYGA 4LF6E 2YZTA 4LF5E 2YTGA 1X6HA 2EMHA 1PKPA 2EMXA 4DV2E 2A25A 3DF6A 2EPKX 4X62E 2EMCA 1RC7A 4B3RE 2ADRA 2ELYA 3TQMA 1EH6A 2LJHA 1L4SA 2GPIA 4M0VA 1KJKA 1BBOA 4BBYA 2RSIA 2V83A 2NABA 2UUBE 3RMPA 2BBGA 3KZZA 2CPNA 1TF6A 1TN9A 2YTEA 4JI1E 2CTDA 4WFTA 1WRJA 2LV2A 1J5EE 2RS7A 2EPXA 2EM4A 1X5WA 1BB8A 2L33A 5ADZA 5CFFE 1B69A 3EPLA 1UILA 2EPAA 2EMZA 2MC5A 5KL5A 3H09A 4LF8E 1YUIA 3BBGA 2LE2A 2EZ6A 2EOEA 1O0WA 2EOFA 2EL6A 4DUZE 2FV4B 4JI0E 2JR1A 1QU6A 1A1KA 2EN8A 3C4BA 2KHXA 2WBUA 2HJJA 4ZYEA 4WYQB 4ZYHA 2RQLA 2YTNA 3IWCA 2VRDA 2LCEA 2LBSB 4DR1E 4DV7E 2EM7A 2DMYA 5TSEA 1N36E 3ECRA 2R76A 1RMDA 2GHFA 4M9VC 2EPMX 2E5LE 2EOQA 1AAYA 1KYQA 3HXLA 4LF7E 2YSOA 3IWDA 3C6MA 5F3WA 3JAMC 3ADLA 4LFBE 4FK5C 2MKNA 4JI7E 3C6KA 2FTXB 4X9JA 1A1IA 2EL5A 4NXNE 2EM3A 2I13A 4K0KE 2M9AA 4BMJA 2WCC3 2L2MA 2N3HA 4KZSA 3VHTB 4F9CB 3EQ1A 4LFAE 3J7Yp 2JOBA 4L8NA 2EN4A 4R2CA 2EOHA 2KOUA 2YTFA 5LMNE 1MGTA 2ODRD 2JXPA 1A1JA 2BB8A 4B3SE 1WXRA 3AUZA 2VF1A 3MSWA 2EPNA 2CT1A 1PJTA 4O5GA 2EWLA 2YSPA 5AE3A 2DIXA 1ZR9A 2V86A 2LTRA 2EOYA 1BBGA 2EJ4A 2EMBA 2EPCA 4LF9E 1XNRE 3JTZA 2V89A 2V88A 2LRSA 1I94E 1A1FA 1HNXE 2YTDA 2EN6A 2UXBE 3T1YE 2YRMA 1SR9A 1G2FC 5DNYA 2EOIA 1NEIA 1XNQE 3L00A 3IWBA 2JWOA 3HPSA 4LU9A 2L3CA 1IBKE 2B3TB 4R2EA 1UN6B 4DUYE 5KL3A 1G2DC 1WHNA 2HC5A 4WXDA 2EMGA 4DR7E 1NCSA 5KL4A 4DV6E 2EQ3A 2WBSA 2LVHA 4BS9A 3ZOQB 5A69A 4X64E 4DV0E 3BIDA 4ZYDA 2EOJA 1HR0E 2WBTA 2VQEE 1EH7A 4HTGA 2HHHE 3J7AG 2E1MA 4Q35B 2MDGA 4BHCA 1YPNA 4WSGA 2L2KB 2M4IA 4RH8A 2MKDA 4DR2E 2K4VA 2RS6A 5IT9C 2EM9A 2G7HA 1XMQE 3VYXA 1ZBQA 1T39A 2K7IA 4F9AB 4JI3E 2YWQA 1X48A 2EPLX 4O43A 5A6BD 2M1SA 1T4NA 2EN1A 3M99B 1JK2A 3KZYA 1MEYC 3HTXA 2EN7A 4B3ME 2ENAA 4BC7A 1A1HA 1YZ9A 5AC4A 4TUGA 2H36X 2EN3A 3BGHA 3ADIA 3K6QA 1ZBTA 2YTOA 4GKJE 4DR5E 2E72A 2ELZA 4J8ZA 2EMWA 4DKKA 2EQ1A 2MC6A 4JI2E 2YRHA 1YFHA 2YRKA 2EOXA 1FKAE 1SFEA 2DMIA 5T6JA 4X65E 2EMFA 4N4RB 2I9IA 1STUA 2LMZA 1UHZA 5A6BA 4F6MA 2EMAA 4R8OA 3AV0A 4L5NC 4GZNC 4JI8E 1DQ3A 3UK3C 2YTIA 1AH5A 2V85A 1YUJA 2LUPB 1QNTA 2V87A 1ZU1A 2D9HA 4WXCA 1A1LA 1TF3A 5AE1A 3THNA 3VYYA 4LFCE 3LMLA 2EMYA 1N33E 2JVAA 1IQSA 4TUIA 4DV5E 5A2QC 4M30A 4IJDA 2EOSA 2JPAA 2WZOA 2PRTA 5LMUE 2CSHA 4DV1E 2VQFE 4DV4E 2B9DA 3MHHC 1DGCA 2R1FA 1EKZA 4YHHE 4F54A 1DI2A 2YU5A 2NUEA 4M2ZA 2FGGA 4P7DA 4WSPA 2YTJA 1X47A 4R03A 4JYAE 4R2AA 4P78A 2L3JA 2EPZA 1T4OA 4WX9A 5BR8E 1X3CA 2B7VA 2EMIA 1UBDC 2EE8A 1YSAC 2LTSA 4IS1C 2LUQA 2EM0A 2UUCE 4B3TE 4JI5E 4Q28A 4F6NA 5A6JA 3MHSC 4I8OA 3BF2A 1WHQA 2RPCA 2MDRA 2EMLA 1IQOA 4F2JC 2N3GA 2EN2A 4KWYA 4JV5E 2EPRA 2RTXA 2UXDE 4OOGC 2LO3A 2UXCE 2EPPA 2L8TA 1YYOA 5KL7A 1P47A 2JP9A 3P1XA 3J81C 3ADGA 3EPJA 1X6EA 2EOMA 3JU0A 3F6HA 2ENCA 2EP3A 2NUGA 4DR6E 2ZM6E 1X49A 2EOZA 5KL6A 4YY3E 3VK6A 2UUAE 1YYWA 2F4VE 2EL4A 4DR3E 2DRPA 1IBME 2L92A 4X66E 1Z1BA 2EPUA 1RQ0A 2EMKA 2YT4A 2V8QB 1HNZE 2YU8A 4GEQB 2EOOA 1N3GA 1N34E 3F6GA 2L2NA 5AASA 2EQ0A 5AC5A 1IMUA 4DMIA 2M7QA 4F9BB 2DSYA 2EM6A 5A6KA 1PJSA 3ADJA 5IV8B 3T1HE 4WPYA 2JOXA 1X6FA 4X8WA 1JK1A 4BC9A 3C4TA 5A6AA 2YTPA 1EH8A 2KONA 2JYAA 3HQ1A 4BCAA 4R2RA 2YPNA 5IXMB 2VE7C 1N32E 4NZVA 4LF4E 4RHBB 3J80C 2YTQA 2ENHA 2EM5A 4DV3E 4R2SA 2DLQA 2B7TA 3HPZA 4R2QA 2GLIA 2Q8UA 4HEIA 1IBLE 4MLQA 1XMOE 2DLKA 4O24A 4AQYE 4JI4E 4KHPE 3OMLA 4O4KA 2DGCA
chains in the Genus database with same CATH topology
4IS1C 2MKDA 2EM0A 2EM9A 2EM7A 4F6NA 3MHSC 1RMDA 2GHFA 2RPCA 4M9VC 2EMLA 4R2DA 2EOQA 2HGHA 4F2JC 1AAYA 2EN1A 1LLMC 2LT7A 2EN2A 3M99B 1JK2A 2YSOA 2EPRA 3EPKA 2LO3A 2EORA 2EPPA 1MEYC 5KL2A 2EN7A 2ENAA 5KL7A 1P47A 4FK5C 2JP9A 1WJPA 1A1HA 2MKNA 3EPJA 1F2IG 1X6EA 2EOMA 2EN3A 2ENCA 2EP3A 4X9JA 1A1IA 2J7JA 2YTOA 2EL5A 2EM2A 2E72A 2ELZA 2EM3A 2I13A 2EMWA 2EOZA 5KL6A 2M9AA 3EPHA 2EQ1A 2WCC3 4R2PA 3VHTB 2YRHA 2EL4A 2YRKA 2DRPA 2EOXA 2EN4A 1Z1BA 4R2CA 2EPUA 2EM8A 2EOHA 1ZAAC 2DMIA 2EMKA 1A1GA 2YTFA 2YU8A 2EMFA 2EOOA 2YTGA 1X6HA 2BB8A 2EMHA 1A1JA 4F6MA 2EMXA 2EQ0A 2EMAA 2A25A 2CT1A 4GZNC 2EMCA 2YSPA 2EM6A 3UK3C 2ADRA 1ZR9A 2ELYA 2YTIA 1YUJA 2EOYA 2EJ4A 2EMBA 2EPCA 1ZU1A 2D9HA 1A1LA 1TF3A 1KJKA 1BBOA 1X6FA 1JK1A 2RSIA 2NABA 1A1FA 2YTDA 2EN6A 2EMYA 1TF6A 2YTPA 1TN9A 2YTEA 2CTDA 2LV2A 4IJDA 2YRMA 1G2FC 2EOSA 2EPXA 2EOIA 1X5WA 2EM4A 2JPAA 1BB8A 2PRTA 2CSHA 1B69A 4R2RA 3EPLA 2EPAA 2EMZA 3MHHC 5KL5A 1DGCA 2R1FA 4R2EA 1YUIA 2YTQA 1UN6B 2YU5A 5KL3A 1G2DC 2EOEA 2ENHA 2EM5A 2EOFA 2EL6A 2EMGA 4R2SA 1NCSA 2YTJA 5KL4A 2DLQA 2EQ3A 4R2QA 2LVHA 2WBSA 2GLIA 1A1KA 2EN8A 4R2AA 2EOJA 2EPZA 2WBUA 2WBTA 2DLKA 1X3CA 2EMIA 2YTNA 1UBDC 2EE8A 2MDGA 2DGCA 4WSGA 2VRDA 2LCEA 1YSAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IS1 C;  2MKD A;  2EM0 A;  2EM9 A;  2EM7 A;  4F6N A;  3MHS C;  1RMD A;  2GHF A;  2RPC A;  4M9V C;  2EML A;  4R2D A;  2EOQ A;  2HGH A;  4F2J C;  1AAY A;  2EN1 A;  1LLM C;  2LT7 A;  2EN2 A;  3M99 B;  1JK2 A;  2YSO A;  2EPR A;  3EPK A;  2LO3 A;  2EOR A;  2EPP A;  1MEY C;  5KL2 A;  2EN7 A;  2ENA A;  5KL7 A;  1P47 A;  4FK5 C;  2JP9 A;  1WJP A;  1A1H A;  2MKN A;  3EPJ A;  1F2I G;  1X6E A;  2EOM A;  2EN3 A;  2ENC A;  2EP3 A;  4X9J A;  1A1I A;  2J7J A;  2YTO A;  2EL5 A;  2EM2 A;  2E72 A;  2ELZ A;  2EM3 A;  2I13 A;  2EMW A;  2EOZ A;  5KL6 A;  2M9A A;  3EPH A;  2EQ1 A;  2WCC 3;  4R2P A;  3VHT B;  2YRH A;  2EL4 A;  2YRK A;  2DRP A;  2EOX A;  2EN4 A;  1Z1B A;  4R2C A;  2EPU A;  2EM8 A;  2EOH A;  1ZAA C;  2DMI A;  2EMK A;  1A1G A;  2YTF A;  2YU8 A;  2EMF A;  2EOO A;  2YTG A;  1X6H A;  2BB8 A;  2EMH A;  1A1J A;  4F6M A;  2EMX A;  2EQ0 A;  2EMA A;  2A25 A;  2CT1 A;  4GZN C;  2EMC A;  2YSP A;  2EM6 A;  3UK3 C;  2ADR A;  1ZR9 A;  2ELY A;  2YTI A;  1YUJ A;  2EOY A;  2EJ4 A;  2EMB A;  2EPC A;  1ZU1 A;  2D9H A;  1A1L A;  1TF3 A;  1KJK A;  1BBO A;  1X6F A;  1JK1 A;  2RSI A;  2NAB A;  1A1F A;  2YTD A;  2EN6 A;  2EMY A;  1TF6 A;  2YTP A;  1TN9 A;  2YTE A;  2CTD A;  2LV2 A;  4IJD A;  2YRM A;  1G2F C;  2EOS A;  2EPX A;  2EOI A;  1X5W A;  2EM4 A;  2JPA A;  1BB8 A;  2PRT A;  2CSH A;  1B69 A;  4R2R A;  3EPL A;  2EPA A;  2EMZ A;  3MHH C;  5KL5 A;  1DGC A;  2R1F A;  4R2E A;  1YUI A;  2YTQ A;  1UN6 B;  2YU5 A;  5KL3 A;  1G2D C;  2EOE A;  2ENH A;  2EM5 A;  2EOF A;  2EL6 A;  2EMG A;  4R2S A;  1NCS A;  2YTJ A;  5KL4 A;  2DLQ A;  2EQ3 A;  4R2Q A;  2LVH A;  2WBS A;  2GLI A;  1A1K A;  2EN8 A;  4R2A A;  2EOJ A;  2EPZ A;  2WBU A;  2WBT A;  2DLK A;  1X3C A;  2EMI A;  2YTN A;  1UBD C;  2EE8 A;  2MDG A;  2DGC A;  4WSG A;  2VRD A;  2LCE A;  1YSA C; 
#chains in the Genus database with same CATH topology
 2UU9 E;  4MLV A;  1T4L B;  2DB2 A;  1GZ6 A;  4R2D A;  2RSM A;  2HGH A;  1YYK A;  1T38 A;  1LLM C;  2NUF A;  2LT7 A;  3LLH A;  4NXM E;  3EPK A;  2EOR A;  5FLX C;  2N8X A;  1GTK A;  2ODR C;  5KL2 A;  2F8B A;  4GKK E;  2JY9 A;  1WJP A;  1F2I G;  5AE2 A;  1J26 A;  4NHR A;  2IHR 1;  5IWA E;  2J7J A;  5LLQ A;  2EM2 A;  2NA2 A;  1PDA A;  5LL6 R;  3DJW A;  3KWR A;  2L6M A;  4JI6 E;  4OX9 E;  3EPH A;  1GQE A;  4LTY A;  3OTO E;  4R2P A;  4BHB A;  4DR4 E;  2LJU A;  3THO B;  1HNW E;  2EPO A;  2EM8 A;  3QG5 C;  1FJG E;  1PJQ A;  1ZAA C;  3FIG A;  1A1G A;  4ZYG A;  4LF6 E;  2YZT A;  4LF5 E;  2YTG A;  1X6H A;  2EMH A;  1PKP A;  2EMX A;  4DV2 E;  2A25 A;  3DF6 A;  2EPK X;  4X62 E;  2EMC A;  1RC7 A;  4B3R E;  2ADR A;  2ELY A;  3TQM A;  1EH6 A;  2LJH A;  1L4S A;  2GPI A;  4M0V A;  1KJK A;  1BBO A;  4BBY A;  2RSI A;  2V83 A;  2NAB A;  2UUB E;  3RMP A;  2BBG A;  3KZZ A;  2CPN A;  1TF6 A;  1TN9 A;  2YTE A;  4JI1 E;  2CTD A;  4WFT A;  1WRJ A;  2LV2 A;  1J5E E;  2RS7 A;  2EPX A;  2EM4 A;  1X5W A;  1BB8 A;  2L33 A;  5ADZ A;  5CFF E;  1B69 A;  3EPL A;  1UIL A;  2EPA A;  2EMZ A;  2MC5 A;  5KL5 A;  3H09 A;  4LF8 E;  1YUI A;  3BBG A;  2LE2 A;  2EZ6 A;  2EOE A;  1O0W A;  2EOF A;  2EL6 A;  4DUZ E;  2FV4 B;  4JI0 E;  2JR1 A;  1QU6 A;  1A1K A;  2EN8 A;  3C4B A;  2KHX A;  2WBU A;  2HJJ A;  4ZYE A;  4WYQ B;  4ZYH A;  2RQL A;  2YTN A;  3IWC A;  2VRD A;  2LCE A;  2LBS B;  4DR1 E;  4DV7 E;  2EM7 A;  2DMY A;  5TSE A;  1N36 E;  3ECR A;  2R76 A;  1RMD A;  2GHF A;  4M9V C;  2EPM X;  2E5L E;  2EOQ A;  1AAY A;  1KYQ A;  3HXL A;  4LF7 E;  2YSO A;  3IWD A;  3C6M A;  5F3W A;  3JAM C;  3ADL A;  4LFB E;  4FK5 C;  2MKN A;  4JI7 E;  3C6K A;  2FTX B;  4X9J A;  1A1I A;  2EL5 A;  4NXN E;  2EM3 A;  2I13 A;  4K0K E;  2M9A A;  4BMJ A;  2WCC 3;  2L2M A;  2N3H A;  4KZS A;  3VHT B;  4F9C B;  3EQ1 A;  4LFA E;  3J7Y p;  2JOB A;  4L8N A;  2EN4 A;  4R2C A;  2EOH A;  2KOU A;  2YTF A;  5LMN E;  1MGT A;  2ODR D;  2JXP A;  1A1J A;  2BB8 A;  4B3S E;  1WXR A;  3AUZ A;  2VF1 A;  3MSW A;  2EPN A;  2CT1 A;  1PJT A;  4O5G A;  2EWL A;  2YSP A;  5AE3 A;  2DIX A;  1ZR9 A;  2V86 A;  2LTR A;  2EOY A;  1BBG A;  2EJ4 A;  2EMB A;  2EPC A;  4LF9 E;  1XNR E;  3JTZ A;  2V89 A;  2V88 A;  2LRS A;  1I94 E;  1A1F A;  1HNX E;  2YTD A;  2EN6 A;  2UXB E;  3T1Y E;  2YRM A;  1SR9 A;  1G2F C;  5DNY A;  2EOI A;  1NEI A;  1XNQ E;  3L00 A;  3IWB A;  2JWO A;  3HPS A;  4LU9 A;  2L3C A;  1IBK E;  2B3T B;  4R2E A;  1UN6 B;  4DUY E;  5KL3 A;  1G2D C;  1WHN A;  2HC5 A;  4WXD A;  2EMG A;  4DR7 E;  1NCS A;  5KL4 A;  4DV6 E;  2EQ3 A;  2WBS A;  2LVH A;  4BS9 A;  3ZOQ B;  5A69 A;  4X64 E;  4DV0 E;  3BID A;  4ZYD A;  2EOJ A;  1HR0 E;  2WBT A;  2VQE E;  1EH7 A;  4HTG A;  2HHH E;  3J7A G;  2E1M A;  4Q35 B;  2MDG A;  4BHC A;  1YPN A;  4WSG A;  2L2K B;  2M4I A;  4RH8 A;  2MKD A;  4DR2 E;  2K4V A;  2RS6 A;  5IT9 C;  2EM9 A;  2G7H A;  1XMQ E;  3VYX A;  1ZBQ A;  1T39 A;  2K7I A;  4F9A B;  4JI3 E;  2YWQ A;  1X48 A;  2EPL X;  4O43 A;  5A6B D;  2M1S A;  1T4N A;  2EN1 A;  3M99 B;  1JK2 A;  3KZY A;  1MEY C;  3HTX A;  2EN7 A;  4B3M E;  2ENA A;  4BC7 A;  1A1H A;  1YZ9 A;  5AC4 A;  4TUG A;  2H36 X;  2EN3 A;  3BGH A;  3ADI A;  3K6Q A;  1ZBT A;  2YTO A;  4GKJ E;  4DR5 E;  2E72 A;  2ELZ A;  4J8Z A;  2EMW A;  4DKK A;  2EQ1 A;  2MC6 A;  4JI2 E;  2YRH A;  1YFH A;  2YRK A;  2EOX A;  1FKA E;  1SFE A;  2DMI A;  5T6J A;  4X65 E;  2EMF A;  4N4R B;  2I9I A;  1STU A;  2LMZ A;  1UHZ A;  5A6B A;  4F6M A;  2EMA A;  4R8O A;  3AV0 A;  4L5N C;  4GZN C;  4JI8 E;  1DQ3 A;  3UK3 C;  2YTI A;  1AH5 A;  2V85 A;  1YUJ A;  2LUP B;  1QNT A;  2V87 A;  1ZU1 A;  2D9H A;  4WXC A;  1A1L A;  1TF3 A;  5AE1 A;  3THN A;  3VYY A;  4LFC E;  3LML A;  2EMY A;  1N33 E;  2JVA A;  1IQS A;  4TUI A;  4DV5 E;  5A2Q C;  4M30 A;  4IJD A;  2EOS A;  2JPA A;  2WZO A;  2PRT A;  5LMU E;  2CSH A;  4DV1 E;  2VQF E;  4DV4 E;  2B9D A;  3MHH C;  1DGC A;  2R1F A;  1EKZ A;  4YHH E;  4F54 A;  1DI2 A;  2YU5 A;  2NUE A;  4M2Z A;  2FGG A;  4P7D A;  4WSP A;  2YTJ A;  1X47 A;  4R03 A;  4JYA E;  4R2A A;  4P78 A;  2L3J A;  2EPZ A;  1T4O A;  4WX9 A;  5BR8 E;  1X3C A;  2B7V A;  2EMI A;  1UBD C;  2EE8 A;  1YSA C;  2LTS A;  4IS1 C;  2LUQ A;  2EM0 A;  2UUC E;  4B3T E;  4JI5 E;  4Q28 A;  4F6N A;  5A6J A;  3MHS C;  4I8O A;  3BF2 A;  1WHQ A;  2RPC A;  2MDR A;  2EML A;  1IQO A;  4F2J C;  2N3G A;  2EN2 A;  4KWY A;  4JV5 E;  2EPR A;  2RTX A;  2UXD E;  4OOG C;  2LO3 A;  2UXC E;  2EPP A;  2L8T A;  1YYO A;  5KL7 A;  1P47 A;  2JP9 A;  3P1X A;  3J81 C;  3ADG A;  3EPJ A;  1X6E A;  2EOM A;  3JU0 A;  3F6H A;  2ENC A;  2EP3 A;  2NUG A;  4DR6 E;  2ZM6 E;  1X49 A;  2EOZ A;  5KL6 A;  4YY3 E;  3VK6 A;  2UUA E;  1YYW A;  2F4V E;  2EL4 A;  4DR3 E;  2DRP A;  1IBM E;  2L92 A;  4X66 E;  1Z1B A;  2EPU A;  1RQ0 A;  2EMK A;  2YT4 A;  2V8Q B;  1HNZ E;  2YU8 A;  4GEQ B;  2EOO A;  1N3G A;  1N34 E;  3F6G A;  2L2N A;  5AAS A;  2EQ0 A;  5AC5 A;  1IMU A;  4DMI A;  2M7Q A;  4F9B B;  2DSY A;  2EM6 A;  5A6K A;  1PJS A;  3ADJ A;  5IV8 B;  3T1H E;  4WPY A;  2JOX A;  1X6F A;  4X8W A;  1JK1 A;  4BC9 A;  3C4T A;  5A6A A;  2YTP A;  1EH8 A;  2KON A;  2JYA A;  3HQ1 A;  4BCA A;  4R2R A;  2YPN A;  5IXM B;  2VE7 C;  1N32 E;  4NZV A;  4LF4 E;  4RHB B;  3J80 C;  2YTQ A;  2ENH A;  2EM5 A;  4DV3 E;  4R2S A;  2DLQ A;  2B7T A;  3HPZ A;  4R2Q A;  2GLI A;  2Q8U A;  4HEI A;  1IBL E;  4MLQ A;  1XMO E;  2DLK A;  4O24 A;  4AQY E;  4JI4 E;  4KHP E;  3OML A;  4O4K A;  2DGC A; 
#chains in the Genus database with same CATH homology
 4IS1 C;  2MKD A;  2EM0 A;  2EM9 A;  2EM7 A;  4F6N A;  3MHS C;  1RMD A;  2GHF A;  2RPC A;  4M9V C;  2EML A;  4R2D A;  2EOQ A;  2HGH A;  4F2J C;  1AAY A;  2EN1 A;  1LLM C;  2LT7 A;  2EN2 A;  3M99 B;  1JK2 A;  2YSO A;  2EPR A;  3EPK A;  2LO3 A;  2EOR A;  2EPP A;  1MEY C;  5KL2 A;  2EN7 A;  2ENA A;  5KL7 A;  1P47 A;  4FK5 C;  2JP9 A;  1WJP A;  1A1H A;  2MKN A;  3EPJ A;  1F2I G;  1X6E A;  2EOM A;  2EN3 A;  2ENC A;  2EP3 A;  4X9J A;  1A1I A;  2J7J A;  2YTO A;  2EL5 A;  2EM2 A;  2E72 A;  2ELZ A;  2EM3 A;  2I13 A;  2EMW A;  2EOZ A;  5KL6 A;  2M9A A;  3EPH A;  2EQ1 A;  2WCC 3;  4R2P A;  3VHT B;  2YRH A;  2EL4 A;  2YRK A;  2DRP A;  2EOX A;  2EN4 A;  1Z1B A;  4R2C A;  2EPU A;  2EM8 A;  2EOH A;  1ZAA C;  2DMI A;  2EMK A;  1A1G A;  2YTF A;  2YU8 A;  2EMF A;  2EOO A;  2YTG A;  1X6H A;  2BB8 A;  2EMH A;  1A1J A;  4F6M A;  2EMX A;  2EQ0 A;  2EMA A;  2A25 A;  2CT1 A;  4GZN C;  2EMC A;  2YSP A;  2EM6 A;  3UK3 C;  2ADR A;  1ZR9 A;  2ELY A;  2YTI A;  1YUJ A;  2EOY A;  2EJ4 A;  2EMB A;  2EPC A;  1ZU1 A;  2D9H A;  1A1L A;  1TF3 A;  1KJK A;  1BBO A;  1X6F A;  1JK1 A;  2RSI A;  2NAB A;  1A1F A;  2YTD A;  2EN6 A;  2EMY A;  1TF6 A;  2YTP A;  1TN9 A;  2YTE A;  2CTD A;  2LV2 A;  4IJD A;  2YRM A;  1G2F C;  2EOS A;  2EPX A;  2EOI A;  1X5W A;  2EM4 A;  2JPA A;  1BB8 A;  2PRT A;  2CSH A;  1B69 A;  4R2R A;  3EPL A;  2EPA A;  2EMZ A;  3MHH C;  5KL5 A;  1DGC A;  2R1F A;  4R2E A;  1YUI A;  2YTQ A;  1UN6 B;  2YU5 A;  5KL3 A;  1G2D C;  2EOE A;  2ENH A;  2EM5 A;  2EOF A;  2EL6 A;  2EMG A;  4R2S A;  1NCS A;  2YTJ A;  5KL4 A;  2DLQ A;  2EQ3 A;  4R2Q A;  2LVH A;  2WBS A;  2GLI A;  1A1K A;  2EN8 A;  4R2A A;  2EOJ A;  2EPZ A;  2WBU A;  2WBT A;  2DLK A;  1X3C A;  2EMI A;  2YTN A;  1UBD C;  2EE8 A;  2MDG A;  2DGC A;  4WSG A;  2VRD A;  2LCE A;  1YSA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...