2CSHA

Solution structure of tandem repeat of the zf-c2h2 domains of human zinc finger protein 297b
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
110
structure length
110
Chain Sequence
GSSGSSGDKLYPCQCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIHTGIKPYECNICAKRFMWRDSFHRHVTSCTKSYEAAKAEQNTTEASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 297B
publication title Solution structure of tandem repeat of the zf-C2H2 domains of human zinc finger protein 297B
rcsb
source organism Homo sapiens
total genus 21
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2005-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2cshA01
1TN9A 2YU8A 2EM5A 2I13A 2EN7A 4M9VC 2EMXA 2EM9A 2DLQA 1UBDC 2CSHA 2LO3A 2CT1A 2EMAA 4R2CA 2EN8A 4R2EA 3VHTB 2YTQA 1ZU1A 1X6HA 2YU5A 4R2RA 1A1IA 1BBOA 5KL2A 1YUJA 2LVHA 2MKDA 2JPAA 2MDGA 1X3CA 2EOFA 2GHFA 2ELZA 2EMHA 1ZR9A 2EOJA 2EPCA 2R1FA 2EORA 2EN3A 5KL5A 3MHSC 4IJDA 2WBUA 2YTNA 1Z1BA 1MEYC 2YTDA 2EOQA 1G2DC 2EL4A 2EOOA 2DLKA 1JK2A 1TF3A 4R2SA 1ZAAC 1X5WA 1TF6A 3MHHC 2EE8A 2EPZA 2EJ4A 2ADRA 2EOYA 2EMWA 2EPRA 2EQ3A 2EMIA 3EPJA 2YRKA 1UN6B 2EMFA 5KL7A 2DRPA 2WBSA 1DGCA 2EOEA 1YSAC 2D9HA 2EM2A 2EPPA 4R2AA 4R2QA 2EOIA 2EOHA 2J7JA 2LCEA 2YTOA 2DGCA 2EOZA 2HGHA 2E72A 2EPUA 3EPHA 2ELYA 1NCSA 5KL4A 2YTJA 1WJPA 4GZNC 2EP3A 2DMIA 1RMDA 2YTFA 2EM6A 3EPLA 2EM7A 1A1LA 2EMKA 1YUIA 5KL3A 2LV2A 2LT7A 1A1JA 2EL6A 5KL6A 2ENHA 2YSPA 2EM3A 2EMZA 3EPKA 2A25A 1P47A 2EMLA 2EM8A 4IS1C 1A1GA 2EM4A 4F2JC 2EQ1A 2WBTA 2GLIA 4F6NA 1A1FA 2RPCA 2BB8A 2YRMA 1X6EA 2M9AA 2RSIA 2YTPA 1F2IG 4X9JA 1A1HA 2JP9A 2YTIA 1AAYA 2EN1A 2VRDA 2EN6A 4R2PA 2EL5A 2EN2A 3UK3C 2EOMA 1BB8A 2EPAA 2EOXA 2EN4A 1JK1A 1B69A 2MKNA 2YRHA 3M99B 2NABA 2EMGA 2YSOA 4R2DA 2EMCA 4WSGA 1KJKA 2YTEA 4F6MA 2CTDA 2ENCA 2EM0A 2YTGA 2PRTA 1A1KA 2EOSA 1X6FA 2EPXA 2WCC3 2EQ0A 2EMBA 2EMYA 1LLMC 1G2FC 4FK5C 2ENAA
chains in the Genus database with same CATH superfamily
2YU8A 3BF2A 1XMOE 1RC7A 4M9VC 3KZYA 4R2CA 1IBKE 2YU5A 1N34E 1BBOA 1FKAE 2L8TA 4DR4E 5IWAE 2MKDA 2FTXB 4DUYE 1EH6A 1GZ6A 2UUBE 4HEIA 1ZR9A 2EPCA 3MHSC 2EL4A 1JK2A 3BGHA 1TF3A 1TF6A 5FLXC 3OMLA 1XNQE 2EJ4A 5A6KA 3C4BA 4L8NA 4X66E 3EPJA 4LF9E 5KL7A 3IWDA 2WBSA 1DGCA 1MGTA 2D9HA 4JI0E 4R2AA 4WX9A 1PKPA 4LF6E 2EOHA 2LCEA 3DJWA 2LUPB 2HGHA 1QNTA 2EPUA 5AE2A 3HTXA 3C6MA 1FJGE 4DR6E 5AE1A 2E1MA 4F9AB 2E5LE 4ZYGA 5LL6R 4YY3E 1DQ3A 2V86A 3FIGA 3EPLA 1YUIA 2LV2A 3THNA 2LT7A 2EL6A 1ZBQA 2L3JA 4JI3E 3EPKA 2NA2A 3AV0A 4KWYA 2G7HA 4Q28A 4OX9E 4KHPE 4R03A 2V89A 2ZM6E 2V85A 2UUCE 4LU9A 2EQ1A 1X47A 4LF4E 2N3HA 1X6EA 2M9AA 3BBGA 4DR5E 1SR9A 5LLQA 4DV1E 2EN2A 4L5NC 3UK3C 2EOMA 4Q35B 3J81C 4GKKE 2EMGA 4R2DA 1EH7A 2EMCA 4WSGA 4DR3E 2CPNA 2YT4A 2ENCA 2EM0A 2YTGA 3JU0A 2EOSA 1X6FA 4NXME 4HTGA 5AC5A 4NXNE 1UILA 2L2KB 4DKKA 2WZOA 3L00A 2EMYA 2F4VE 2JXPA 1X48A 1TN9A 5A6BA 2LRSA 2EN7A 5IXMB 2EM9A 2LO3A 2EMAA 1HNXE 1YYKA 1ZU1A 2M4IA 1X6HA 2LMZA 1A1IA 3ADGA 2B7VA 3BIDA 1YUJA 4DR1E 2JPAA 2YZTA 4JI8E 2EMHA 4WPYA 5F3WA 5KL5A 1Z1BA 5LMNE 2N3GA 4OOGC 3ECRA 2LJHA 4RH8A 2VQEE 4R2SA 1N36E 1ZAAC 1X5WA 3ZOQB 2EE8A 2LTSA 2EOYA 2RSMA 1PDAA 1IMUA 5BR8E 4RHBB 3F6GA 1UN6B 2EMFA 1NEIA 4ZYHA 2N8XA 3C4TA 2R76A 4JI6E 2L2NA 2L33A 2EPPA 2EPMX 3OTOE 1SFEA 2J7JA 2YTOA 4TUGA 2LUQA 5T6JA 2MDRA 4BC9A 3EPHA 2H36X 4YHHE 3HPSA 3K6QA 5A6AA 3J80C 2L6MA 4ZYEA 4GZNC 2VQFE 2LTRA 2EM6A 2UUAE 2EMKA 4DR7E 5KL3A 2ENHA 2YSPA 3QG5C 1WXRA 2DMYA 1P47A 3P1XA 2V8QB 2JWOA 4K0KE 2B3TB 2RTXA 1YYOA 1HNZE 2BB8A 2K7IA 1XMQE 2EWLA 2RSIA 2YTPA 4B3SE 4LF7E 1T4NA 4GEQB 4GKJE 2HC5A 2VRDA 4B3RE 5CFFE 4JI2E 2EL5A 1ZBTA 4WYQB 4X65E 2BBGA 2NUEA 4MLQA 2EN4A 2V87A 4TUIA 2L92A 1GQEA 1YZ9A 2MKNA 4F54A 4DV6E 2YTEA 2I9IA 4B3ME 4F6MA 2EZ6A 3HPZA 1A1KA 4BCAA 2KONA 2EPXA 2F8BA 3TQMA 2EMBA 1LLMC 3VK6A 2EM5A 2I13A 2EMXA 2JYAA 1UBDC 2CSHA 2CT1A 2ODRD 4O4KA 2EN8A 4R2EA 1N33E 1YFHA 4R2RA 3ADIA 3JTZA 4LFAE 4WFTA 2LVHA 4B3TE 5A69A 2MDGA 2EOFA 2L3CA 1WHNA 2ELZA 4BHCA 4F9BB 4I8OA 2EORA 1STUA 2EN3A 3T1HE 4F9CB 1MEYC 2EOQA 1G2DC 2UU9E 2DLKA 2JOXA 2B7TA 2LE2A 2IHR1 4MLVA 2EPZA 3F6HA 4WSPA 1N32E 2EMWA 4JI5E 4JI7E 1J5EE 2MC6A 2EPNA 1HR0E 2DSYA 2YRKA 3T1YE 1HNWE 4DMIA 2DRPA 4M2ZA 4WXCA 2EOEA 1YSAC 2EM2A 2M7QA 2B9DA 4R2QA 4LF8E 2DGCA 4NHRA 5AC4A 4DV5E 5KL4A 3J7AG 2YTJA 1WJPA 2HHHE 1T39A 3HQ1A 1L4SA 5A6JA 4DV3E 2EP3A 2DMIA 2YTFA 1RMDA 1X49A 2DIXA 2EM7A 5KL6A 3MSWA 2EM3A 2EMZA 1UHZA 1BBGA 3LMLA 2EPLX 2EMLA 1A1GA 4IS1C 1IBME 4F2JC 2K4VA 2VF1A 2WBTA 4LFCE 1IBLE 1A1FA 4DV4E 2YRMA 1PJTA 4X9JA 4DUZE 5AASA 4X62E 3IWBA 3VYXA 1A1HA 1T38A 2KOUA 4O43A 2LJUA 3DF6A 4O5GA 3EQ1A 2NUFA 2EN6A 4R2PA 3C6KA 2JOBA 2EPAA 2EOXA 1JK1A 1YPNA 2NABA 2YSOA 1IQOA 1KJKA 3THOB 2CTDA 4M30A 5A6BD 3IWCA 2JY9A 2V88A 2WCC3 1G2FC 4FK5C 2FV4B 3H09A 4N4RB 2VE7C 4AQYE 3HXLA 2GPIA 3RMPA 4ZYDA 2DLQA 2UXCE 3VHTB 4BHBA 2YTQA 2UXDE 2RS7A 4LTYA 1O0WA 2EPOA 5KL2A 4R8OA 1WRJA 1X3CA 2GHFA 2YWQA 4JI4E 5IT9C 4JYAE 2V83A 2EOJA 2R1FA 4X8WA 5TSEA 4IJDA 2RQLA 4BBYA 4O24A 2YTNA 2WBUA 2UXBE 2YTDA 1WHQA 2EOOA 1XNRE 1N3GA 3MHHC 5IV8B 2M1SA 2ADRA 4P78A 2YPNA 1DI2A 2EPRA 2EQ3A 3AUZA 4J8ZA 2EMIA 1PJQA 2JR1A 1I94E 4NZVA 2JVAA 2EOIA 1EKZA 2EOZA 1YYWA 3KZZA 5A2QC 2E72A 2ELYA 2DB2A 1NCSA 4M0VA 4DR2E 4P7DA 1T4LB 1KYQA 1GTKA 2EPKX 2RS6A 4BC7A 1PJSA 4DV7E 1A1LA 4X64E 1A1JA 5ADZA 4JV5E 2HJJA 2ODRC 1IQSA 2A25A 4DV2E 2Q8UA 2FGGA 2EM8A 3J7Yp 2EM4A 3KWRA 1J26A 4DV0E 2GLIA 4F6NA 2RPCA 5AE3A 2NUGA 1F2IG 2L2MA 2KHXA 2JP9A 5LMUE 2YTIA 1AAYA 2EN1A 3JAMC 4LF5E 3ADJA 2LBSB 2MC5A 1BB8A 1B69A 2YRHA 3M99B 4LFBE 1EH8A 4BS9A 3ADLA 2PRTA 1QU6A 4KZSA 4WXDA 2EQ0A 1T4OA 5DNYA 1AH5A 3LLHA 1RQ0A 4BMJA 4JI1E 2ENAA 3VYYA
chains in the Genus database with same CATH topology
1TN9A 2YU8A 2EM5A 2I13A 2EN7A 4M9VC 2EMXA 2EM9A 2DLQA 1UBDC 2CSHA 2LO3A 2CT1A 2EMAA 4R2CA 2EN8A 4R2EA 3VHTB 2YTQA 1ZU1A 1X6HA 2YU5A 4R2RA 1A1IA 1BBOA 5KL2A 1YUJA 2LVHA 2MKDA 2JPAA 2MDGA 1X3CA 2EOFA 2GHFA 2ELZA 2EMHA 1ZR9A 2EOJA 2EPCA 2R1FA 2EORA 2EN3A 5KL5A 3MHSC 4IJDA 2WBUA 2YTNA 1Z1BA 1MEYC 2YTDA 2EOQA 1G2DC 2EL4A 2EOOA 2DLKA 1JK2A 1TF3A 4R2SA 1ZAAC 1X5WA 1TF6A 3MHHC 2EE8A 2EPZA 2EJ4A 2ADRA 2EOYA 2EMWA 2EPRA 2EQ3A 2EMIA 3EPJA 2YRKA 1UN6B 2EMFA 5KL7A 2DRPA 2WBSA 1DGCA 2EOEA 1YSAC 2D9HA 2EM2A 2EPPA 4R2AA 4R2QA 2EOIA 2EOHA 2J7JA 2LCEA 2YTOA 2DGCA 2EOZA 2HGHA 2E72A 2EPUA 3EPHA 2ELYA 1NCSA 5KL4A 2YTJA 1WJPA 4GZNC 2EP3A 2DMIA 1RMDA 2YTFA 2EM6A 3EPLA 2EM7A 1A1LA 2EMKA 1YUIA 5KL3A 2LV2A 2LT7A 1A1JA 2EL6A 5KL6A 2ENHA 2YSPA 2EM3A 2EMZA 3EPKA 2A25A 1P47A 2EMLA 2EM8A 4IS1C 1A1GA 2EM4A 4F2JC 2EQ1A 2WBTA 2GLIA 4F6NA 1A1FA 2RPCA 2BB8A 2YRMA 1X6EA 2M9AA 2RSIA 2YTPA 1F2IG 4X9JA 1A1HA 2JP9A 2YTIA 1AAYA 2EN1A 2VRDA 2EN6A 4R2PA 2EL5A 2EN2A 3UK3C 2EOMA 1BB8A 2EPAA 2EOXA 2EN4A 1JK1A 1B69A 2MKNA 2YRHA 3M99B 2NABA 2EMGA 2YSOA 4R2DA 2EMCA 4WSGA 1KJKA 2YTEA 4F6MA 2CTDA 2ENCA 2EM0A 2YTGA 2PRTA 1A1KA 2EOSA 1X6FA 2EPXA 2WCC3 2EQ0A 2EMBA 2EMYA 1LLMC 1G2FC 4FK5C 2ENAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TN9 A;  2YU8 A;  2EM5 A;  2I13 A;  2EN7 A;  4M9V C;  2EMX A;  2EM9 A;  2DLQ A;  1UBD C;  2CSH A;  2LO3 A;  2CT1 A;  2EMA A;  4R2C A;  2EN8 A;  4R2E A;  3VHT B;  2YTQ A;  1ZU1 A;  1X6H A;  2YU5 A;  4R2R A;  1A1I A;  1BBO A;  5KL2 A;  1YUJ A;  2LVH A;  2MKD A;  2JPA A;  2MDG A;  1X3C A;  2EOF A;  2GHF A;  2ELZ A;  2EMH A;  1ZR9 A;  2EOJ A;  2EPC A;  2R1F A;  2EOR A;  2EN3 A;  5KL5 A;  3MHS C;  4IJD A;  2WBU A;  2YTN A;  1Z1B A;  1MEY C;  2YTD A;  2EOQ A;  1G2D C;  2EL4 A;  2EOO A;  2DLK A;  1JK2 A;  1TF3 A;  4R2S A;  1ZAA C;  1X5W A;  1TF6 A;  3MHH C;  2EE8 A;  2EPZ A;  2EJ4 A;  2ADR A;  2EOY A;  2EMW A;  2EPR A;  2EQ3 A;  2EMI A;  3EPJ A;  2YRK A;  1UN6 B;  2EMF A;  5KL7 A;  2DRP A;  2WBS A;  1DGC A;  2EOE A;  1YSA C;  2D9H A;  2EM2 A;  2EPP A;  4R2A A;  4R2Q A;  2EOI A;  2EOH A;  2J7J A;  2LCE A;  2YTO A;  2DGC A;  2EOZ A;  2HGH A;  2E72 A;  2EPU A;  3EPH A;  2ELY A;  1NCS A;  5KL4 A;  2YTJ A;  1WJP A;  4GZN C;  2EP3 A;  2DMI A;  1RMD A;  2YTF A;  2EM6 A;  3EPL A;  2EM7 A;  1A1L A;  2EMK A;  1YUI A;  5KL3 A;  2LV2 A;  2LT7 A;  1A1J A;  2EL6 A;  5KL6 A;  2ENH A;  2YSP A;  2EM3 A;  2EMZ A;  3EPK A;  2A25 A;  1P47 A;  2EML A;  2EM8 A;  4IS1 C;  1A1G A;  2EM4 A;  4F2J C;  2EQ1 A;  2WBT A;  2GLI A;  4F6N A;  1A1F A;  2RPC A;  2BB8 A;  2YRM A;  1X6E A;  2M9A A;  2RSI A;  2YTP A;  1F2I G;  4X9J A;  1A1H A;  2JP9 A;  2YTI A;  1AAY A;  2EN1 A;  2VRD A;  2EN6 A;  4R2P A;  2EL5 A;  2EN2 A;  3UK3 C;  2EOM A;  1BB8 A;  2EPA A;  2EOX A;  2EN4 A;  1JK1 A;  1B69 A;  2MKN A;  2YRH A;  3M99 B;  2NAB A;  2EMG A;  2YSO A;  4R2D A;  2EMC A;  4WSG A;  1KJK A;  2YTE A;  4F6M A;  2CTD A;  2ENC A;  2EM0 A;  2YTG A;  2PRT A;  1A1K A;  2EOS A;  1X6F A;  2EPX A;  2WCC 3;  2EQ0 A;  2EMB A;  2EMY A;  1LLM C;  1G2F C;  4FK5 C;  2ENA A; 
#chains in the Genus database with same CATH topology
 2YU8 A;  3BF2 A;  1XMO E;  1RC7 A;  4M9V C;  3KZY A;  4R2C A;  1IBK E;  2YU5 A;  1N34 E;  1BBO A;  1FKA E;  2L8T A;  4DR4 E;  5IWA E;  2MKD A;  2FTX B;  4DUY E;  1EH6 A;  1GZ6 A;  2UUB E;  4HEI A;  1ZR9 A;  2EPC A;  3MHS C;  2EL4 A;  1JK2 A;  3BGH A;  1TF3 A;  1TF6 A;  5FLX C;  3OML A;  1XNQ E;  2EJ4 A;  5A6K A;  3C4B A;  4L8N A;  4X66 E;  3EPJ A;  4LF9 E;  5KL7 A;  3IWD A;  2WBS A;  1DGC A;  1MGT A;  2D9H A;  4JI0 E;  4R2A A;  4WX9 A;  1PKP A;  4LF6 E;  2EOH A;  2LCE A;  3DJW A;  2LUP B;  2HGH A;  1QNT A;  2EPU A;  5AE2 A;  3HTX A;  3C6M A;  1FJG E;  4DR6 E;  5AE1 A;  2E1M A;  4F9A B;  2E5L E;  4ZYG A;  5LL6 R;  4YY3 E;  1DQ3 A;  2V86 A;  3FIG A;  3EPL A;  1YUI A;  2LV2 A;  3THN A;  2LT7 A;  2EL6 A;  1ZBQ A;  2L3J A;  4JI3 E;  3EPK A;  2NA2 A;  3AV0 A;  4KWY A;  2G7H A;  4Q28 A;  4OX9 E;  4KHP E;  4R03 A;  2V89 A;  2ZM6 E;  2V85 A;  2UUC E;  4LU9 A;  2EQ1 A;  1X47 A;  4LF4 E;  2N3H A;  1X6E A;  2M9A A;  3BBG A;  4DR5 E;  1SR9 A;  5LLQ A;  4DV1 E;  2EN2 A;  4L5N C;  3UK3 C;  2EOM A;  4Q35 B;  3J81 C;  4GKK E;  2EMG A;  4R2D A;  1EH7 A;  2EMC A;  4WSG A;  4DR3 E;  2CPN A;  2YT4 A;  2ENC A;  2EM0 A;  2YTG A;  3JU0 A;  2EOS A;  1X6F A;  4NXM E;  4HTG A;  5AC5 A;  4NXN E;  1UIL A;  2L2K B;  4DKK A;  2WZO A;  3L00 A;  2EMY A;  2F4V E;  2JXP A;  1X48 A;  1TN9 A;  5A6B A;  2LRS A;  2EN7 A;  5IXM B;  2EM9 A;  2LO3 A;  2EMA A;  1HNX E;  1YYK A;  1ZU1 A;  2M4I A;  1X6H A;  2LMZ A;  1A1I A;  3ADG A;  2B7V A;  3BID A;  1YUJ A;  4DR1 E;  2JPA A;  2YZT A;  4JI8 E;  2EMH A;  4WPY A;  5F3W A;  5KL5 A;  1Z1B A;  5LMN E;  2N3G A;  4OOG C;  3ECR A;  2LJH A;  4RH8 A;  2VQE E;  4R2S A;  1N36 E;  1ZAA C;  1X5W A;  3ZOQ B;  2EE8 A;  2LTS A;  2EOY A;  2RSM A;  1PDA A;  1IMU A;  5BR8 E;  4RHB B;  3F6G A;  1UN6 B;  2EMF A;  1NEI A;  4ZYH A;  2N8X A;  3C4T A;  2R76 A;  4JI6 E;  2L2N A;  2L33 A;  2EPP A;  2EPM X;  3OTO E;  1SFE A;  2J7J A;  2YTO A;  4TUG A;  2LUQ A;  5T6J A;  2MDR A;  4BC9 A;  3EPH A;  2H36 X;  4YHH E;  3HPS A;  3K6Q A;  5A6A A;  3J80 C;  2L6M A;  4ZYE A;  4GZN C;  2VQF E;  2LTR A;  2EM6 A;  2UUA E;  2EMK A;  4DR7 E;  5KL3 A;  2ENH A;  2YSP A;  3QG5 C;  1WXR A;  2DMY A;  1P47 A;  3P1X A;  2V8Q B;  2JWO A;  4K0K E;  2B3T B;  2RTX A;  1YYO A;  1HNZ E;  2BB8 A;  2K7I A;  1XMQ E;  2EWL A;  2RSI A;  2YTP A;  4B3S E;  4LF7 E;  1T4N A;  4GEQ B;  4GKJ E;  2HC5 A;  2VRD A;  4B3R E;  5CFF E;  4JI2 E;  2EL5 A;  1ZBT A;  4WYQ B;  4X65 E;  2BBG A;  2NUE A;  4MLQ A;  2EN4 A;  2V87 A;  4TUI A;  2L92 A;  1GQE A;  1YZ9 A;  2MKN A;  4F54 A;  4DV6 E;  2YTE A;  2I9I A;  4B3M E;  4F6M A;  2EZ6 A;  3HPZ A;  1A1K A;  4BCA A;  2KON A;  2EPX A;  2F8B A;  3TQM A;  2EMB A;  1LLM C;  3VK6 A;  2EM5 A;  2I13 A;  2EMX A;  2JYA A;  1UBD C;  2CSH A;  2CT1 A;  2ODR D;  4O4K A;  2EN8 A;  4R2E A;  1N33 E;  1YFH A;  4R2R A;  3ADI A;  3JTZ A;  4LFA E;  4WFT A;  2LVH A;  4B3T E;  5A69 A;  2MDG A;  2EOF A;  2L3C A;  1WHN A;  2ELZ A;  4BHC A;  4F9B B;  4I8O A;  2EOR A;  1STU A;  2EN3 A;  3T1H E;  4F9C B;  1MEY C;  2EOQ A;  1G2D C;  2UU9 E;  2DLK A;  2JOX A;  2B7T A;  2LE2 A;  2IHR 1;  4MLV A;  2EPZ A;  3F6H A;  4WSP A;  1N32 E;  2EMW A;  4JI5 E;  4JI7 E;  1J5E E;  2MC6 A;  2EPN A;  1HR0 E;  2DSY A;  2YRK A;  3T1Y E;  1HNW E;  4DMI A;  2DRP A;  4M2Z A;  4WXC A;  2EOE A;  1YSA C;  2EM2 A;  2M7Q A;  2B9D A;  4R2Q A;  4LF8 E;  2DGC A;  4NHR A;  5AC4 A;  4DV5 E;  5KL4 A;  3J7A G;  2YTJ A;  1WJP A;  2HHH E;  1T39 A;  3HQ1 A;  1L4S A;  5A6J A;  4DV3 E;  2EP3 A;  2DMI A;  2YTF A;  1RMD A;  1X49 A;  2DIX A;  2EM7 A;  5KL6 A;  3MSW A;  2EM3 A;  2EMZ A;  1UHZ A;  1BBG A;  3LML A;  2EPL X;  2EML A;  1A1G A;  4IS1 C;  1IBM E;  4F2J C;  2K4V A;  2VF1 A;  2WBT A;  4LFC E;  1IBL E;  1A1F A;  4DV4 E;  2YRM A;  1PJT A;  4X9J A;  4DUZ E;  5AAS A;  4X62 E;  3IWB A;  3VYX A;  1A1H A;  1T38 A;  2KOU A;  4O43 A;  2LJU A;  3DF6 A;  4O5G A;  3EQ1 A;  2NUF A;  2EN6 A;  4R2P A;  3C6K A;  2JOB A;  2EPA A;  2EOX A;  1JK1 A;  1YPN A;  2NAB A;  2YSO A;  1IQO A;  1KJK A;  3THO B;  2CTD A;  4M30 A;  5A6B D;  3IWC A;  2JY9 A;  2V88 A;  2WCC 3;  1G2F C;  4FK5 C;  2FV4 B;  3H09 A;  4N4R B;  2VE7 C;  4AQY E;  3HXL A;  2GPI A;  3RMP A;  4ZYD A;  2DLQ A;  2UXC E;  3VHT B;  4BHB A;  2YTQ A;  2UXD E;  2RS7 A;  4LTY A;  1O0W A;  2EPO A;  5KL2 A;  4R8O A;  1WRJ A;  1X3C A;  2GHF A;  2YWQ A;  4JI4 E;  5IT9 C;  4JYA E;  2V83 A;  2EOJ A;  2R1F A;  4X8W A;  5TSE A;  4IJD A;  2RQL A;  4BBY A;  4O24 A;  2YTN A;  2WBU A;  2UXB E;  2YTD A;  1WHQ A;  2EOO A;  1XNR E;  1N3G A;  3MHH C;  5IV8 B;  2M1S A;  2ADR A;  4P78 A;  2YPN A;  1DI2 A;  2EPR A;  2EQ3 A;  3AUZ A;  4J8Z A;  2EMI A;  1PJQ A;  2JR1 A;  1I94 E;  4NZV A;  2JVA A;  2EOI A;  1EKZ A;  2EOZ A;  1YYW A;  3KZZ A;  5A2Q C;  2E72 A;  2ELY A;  2DB2 A;  1NCS A;  4M0V A;  4DR2 E;  4P7D A;  1T4L B;  1KYQ A;  1GTK A;  2EPK X;  2RS6 A;  4BC7 A;  1PJS A;  4DV7 E;  1A1L A;  4X64 E;  1A1J A;  5ADZ A;  4JV5 E;  2HJJ A;  2ODR C;  1IQS A;  2A25 A;  4DV2 E;  2Q8U A;  2FGG A;  2EM8 A;  3J7Y p;  2EM4 A;  3KWR A;  1J26 A;  4DV0 E;  2GLI A;  4F6N A;  2RPC A;  5AE3 A;  2NUG A;  1F2I G;  2L2M A;  2KHX A;  2JP9 A;  5LMU E;  2YTI A;  1AAY A;  2EN1 A;  3JAM C;  4LF5 E;  3ADJ A;  2LBS B;  2MC5 A;  1BB8 A;  1B69 A;  2YRH A;  3M99 B;  4LFB E;  1EH8 A;  4BS9 A;  3ADL A;  2PRT A;  1QU6 A;  4KZS A;  4WXD A;  2EQ0 A;  1T4O A;  5DNY A;  1AH5 A;  3LLH A;  1RQ0 A;  4BMJ A;  4JI1 E;  2ENA A;  3VYY A; 
#chains in the Genus database with same CATH homology
 1TN9 A;  2YU8 A;  2EM5 A;  2I13 A;  2EN7 A;  4M9V C;  2EMX A;  2EM9 A;  2DLQ A;  1UBD C;  2CSH A;  2LO3 A;  2CT1 A;  2EMA A;  4R2C A;  2EN8 A;  4R2E A;  3VHT B;  2YTQ A;  1ZU1 A;  1X6H A;  2YU5 A;  4R2R A;  1A1I A;  1BBO A;  5KL2 A;  1YUJ A;  2LVH A;  2MKD A;  2JPA A;  2MDG A;  1X3C A;  2EOF A;  2GHF A;  2ELZ A;  2EMH A;  1ZR9 A;  2EOJ A;  2EPC A;  2R1F A;  2EOR A;  2EN3 A;  5KL5 A;  3MHS C;  4IJD A;  2WBU A;  2YTN A;  1Z1B A;  1MEY C;  2YTD A;  2EOQ A;  1G2D C;  2EL4 A;  2EOO A;  2DLK A;  1JK2 A;  1TF3 A;  4R2S A;  1ZAA C;  1X5W A;  1TF6 A;  3MHH C;  2EE8 A;  2EPZ A;  2EJ4 A;  2ADR A;  2EOY A;  2EMW A;  2EPR A;  2EQ3 A;  2EMI A;  3EPJ A;  2YRK A;  1UN6 B;  2EMF A;  5KL7 A;  2DRP A;  2WBS A;  1DGC A;  2EOE A;  1YSA C;  2D9H A;  2EM2 A;  2EPP A;  4R2A A;  4R2Q A;  2EOI A;  2EOH A;  2J7J A;  2LCE A;  2YTO A;  2DGC A;  2EOZ A;  2HGH A;  2E72 A;  2EPU A;  3EPH A;  2ELY A;  1NCS A;  5KL4 A;  2YTJ A;  1WJP A;  4GZN C;  2EP3 A;  2DMI A;  1RMD A;  2YTF A;  2EM6 A;  3EPL A;  2EM7 A;  1A1L A;  2EMK A;  1YUI A;  5KL3 A;  2LV2 A;  2LT7 A;  1A1J A;  2EL6 A;  5KL6 A;  2ENH A;  2YSP A;  2EM3 A;  2EMZ A;  3EPK A;  2A25 A;  1P47 A;  2EML A;  2EM8 A;  4IS1 C;  1A1G A;  2EM4 A;  4F2J C;  2EQ1 A;  2WBT A;  2GLI A;  4F6N A;  1A1F A;  2RPC A;  2BB8 A;  2YRM A;  1X6E A;  2M9A A;  2RSI A;  2YTP A;  1F2I G;  4X9J A;  1A1H A;  2JP9 A;  2YTI A;  1AAY A;  2EN1 A;  2VRD A;  2EN6 A;  4R2P A;  2EL5 A;  2EN2 A;  3UK3 C;  2EOM A;  1BB8 A;  2EPA A;  2EOX A;  2EN4 A;  1JK1 A;  1B69 A;  2MKN A;  2YRH A;  3M99 B;  2NAB A;  2EMG A;  2YSO A;  4R2D A;  2EMC A;  4WSG A;  1KJK A;  2YTE A;  4F6M A;  2CTD A;  2ENC A;  2EM0 A;  2YTG A;  2PRT A;  1A1K A;  2EOS A;  1X6F A;  2EPX A;  2WCC 3;  2EQ0 A;  2EMB A;  2EMY A;  1LLM C;  1G2F C;  4FK5 C;  2ENA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...