2CSHA

Solution structure of tandem repeat of the zf-c2h2 domains of human zinc finger protein 297b
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
110
structure length
110
Chain Sequence
GSSGSSGDKLYPCQCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIHTGIKPYECNICAKRFMWRDSFHRHVTSCTKSYEAAKAEQNTTEASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 297B
publication title Solution structure of tandem repeat of the zf-C2H2 domains of human zinc finger protein 297B
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 21
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2005-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2cshA01
2EOOA 2EORA 5KL7A 2EPUA 2J7JA 1BB8A 2I13A 2WBUA 4R2RA 3EPHA 2EMHA 2GHFA 2RPCA 2LT7A 2EN4A 4GZNC 2MDGA 2EOYA 3UK3C 2EM7A 2EOXA 2EPCA 2JP9A 5KL2A 2DLQA 1NCSA 4X9JA 2EPXA 2EM0A 2LCEA 4F6NA 3EPKA 2EM4A 2EOHA 2R1FA 2ENCA 1AAYA 2ADRA 4IJDA 1A1HA 2EM2A 2EPRA 2EOMA 2EP3A 2RSIA 4R2AA 2BB8A 2EM8A 1A1KA 1X6FA 3M99B 1ZU1A 2EL6A 2LO3A 2YTOA 1ZR9A 2EOSA 2EJ4A 2EL4A 1YSAC 5KL3A 1TF3A 1G2FC 2EMWA 4R2EA 2EPPA 1X3CA 2EMBA 1B69A 1MEYC 2DMIA 2ENAA 2NABA 1G2DC 1UBDC 2WBTA 2DRPA 2EMKA 2EL5A 2LV2A 2YTIA 2YSOA 2EOEA 4R2PA 2JPAA 3EPLA 2DLKA 2EOFA 2EMYA 2YSPA 2EOZA 2ELYA 2ELZA 4WSGA 2EQ1A 2YU8A 1DGCA 2M9AA 2EMIA 2EE8A 1X5WA 2EM3A 5KL5A 1YUJA 2D9HA 4F2JC 2EQ3A 2YTNA 2EPZA 2YTEA 2EMXA 1JK1A 2MKNA 1RMDA 3MHSC 4F6MA 2EM6A 4FK5C 2EN6A 2EN3A 2EN2A 5KL4A 3EPJA 2CTDA 2DGCA 2YU5A 2CSHA 2YTDA 4R2QA 2EN8A 2EMCA 4R2SA 1A1IA 2HGHA 1A1JA 2EMZA 1F2IG 2GLIA 1TN9A 2EOJA 1LLMC 2EMAA 1BBOA 3VHTB 2EMFA 2EQ0A 2EM5A 1UN6B 2ENHA 2YRHA 2CT1A 2YTJA 1A1FA 1JK2A 1TF6A 1KJKA 1YUIA 2EMGA 1ZAAC 1Z1BA 4M9VC 2YTPA 2EOQA 5KL6A 3MHHC 2PRTA 2WBSA 2YRKA 4IS1C 2YTFA 2YTGA 4R2CA 1X6HA 2LVHA 1P47A 2E72A 4R2DA 1WJPA 2EN1A 1A1GA 1X6EA 2MKDA 2YTQA 2EPAA 1A1LA 2A25A 2EMLA 2VRDA 2WCC3 2EOIA 2EN7A 2EM9A 2YRMA
chains in the Genus database with same CATH superfamily
2EOOA 4DR5E 2EPUA 2KOUA 4LF6E 2J7JA 3MSWA 1MGTA 4LFCE 1X47A 3EQ1A 4TUGA 4WSPA 2LT7A 1BBGA 5T6JA 4DV0E 3UK3C 4DR1E 3HQ1A 3TQMA 4DR4E 2JP9A 1ZBQA 1NCSA 4X9JA 5AE2A 1DQ3A 2LTRA 2L3CA 4DV7E 2EM4A 2MC5A 4DUYE 2UXBE 4BCAA 3J7Yp 2ADRA 4IJDA 4DKKA 2EM2A 4DMIA 1A1HA 1RQ0A 2EPRA 2RSIA 2EP3A 4DV5E 1GTKA 1EKZA 2BB8A 1A1KA 2EWLA 3M99B 2CPNA 2LMZA 3J81C 4LU9A 2LUPB 2L2KB 1YYOA 2EL4A 2LBSB 5LL6R 2L92A 4OX9E 1TF3A 2L33A 3THOB 4LF4E 1UBDC 4YY3E 2JPAA 2I9IA 4JI4E 4BMJA 1GQEA 2HJJA 2EMIA 2EE8A 3AV0A 1YUJA 3T1HE 1HNWE 1EH8A 1YFHA 2F8BA 2FGGA 2YTNA 2VF1A 4BS9A 1JK1A 2L8TA 4JI2E 4F6MA 1XNQE 2M4IA 2RQLA 1XNRE 4JI0E 2EMCA 3DJWA 1SFEA 4M2ZA 2EOJA 2EPMX 5AC5A 1LLMC 3VHTB 1FJGE 1T4NA 2FV4B 2K7IA 2V86A 1ZBTA 4J8ZA 4JI7E 2YRHA 2UXCE 1JK2A 3K6QA 2YTPA 2EOQA 2IHR1 3L00A 1IBME 2JY9A 3MHHC 2PRTA 2NUEA 5ADZA 2YTFA 2L6MA 1IBLE 1X6HA 2L2MA 2LVHA 4O24A 4P78A 5AC4A 3RMPA 1WJPA 2EMLA 3H09A 4X65E 2WCC3 2V85A 2YWQA 2EN7A 3ADGA 4LF8E 4RHBB 4DR2E 4WXCA 2LUQA 1N33E 1BB8A 1XMOE 3BBGA 3VYXA 1WXRA 2G7HA 2M1SA 1SR9A 4L8NA 1PJSA 3KWRA 2EOYA 2EPCA 4P7DA 5A2QC 3ADIA 5KL2A 4X62E 5A69A 4NHRA 2EM0A 2LCEA 1EH6A 2WZOA 4R8OA 4DV2E 2R1FA 2KHXA 3HPZA 1GZ6A 3BF2A 2EL6A 2YTOA 1ZR9A 4HEIA 2YZTA 1J26A 4F54A 1T39A 1YSAC 1T4OA 2JOBA 4KHPE 2MC6A 2EPPA 4R2EA 1HR0E 1B69A 4M30A 1G2DC 4NXME 2WBTA 2R76A 5LMUE 4WX9A 3ZOQB 2YTIA 2YSOA 3P1XA 2NA2A 2EMYA 3C6KA 2YSPA 2EOZA 2ELYA 4YHHE 2ELZA 5CFFE 4B3SE 1T38A 1N36E 2D9HA 3FIGA 4F2JC 3DF6A 5FLXC 5AE3A 4GKKE 2EPZA 1EH7A 2EMXA 2YTEA 1RMDA 3F6HA 1DI2A 5KL4A 2F4VE 2CTDA 2FTXB 2JVAA 3JAMC 1UILA 4JI8E 1TN9A 1NEIA 4X64E 3LLHA 2EMAA 4M0VA 4L5NC 1XMQE 2JR1A 2M7QA 2UUAE 3F6GA 3THNA 2ENHA 2YTJA 5IV8B 3ADLA 1TF6A 5IXMB 5F3WA 3C4TA 2EMGA 2L2NA 4JI5E 4ZYDA 1O0WA 2DMYA 1QU6A 2ZM6E 1IBKE 2EZ6A 2E72A 2VQEE 1X6EA 2EPAA 4TUIA 1A1LA 3J80C 2A25A 3BGHA 5KL7A 4GKJE 4BHBA 2RS7A 2VE7C 5IT9C 5IWAE 4WXDA 5AE1A 2WBUA 4LF9E 4BHCA 4WYQB 1FKAE 2GHFA 1N3GA 2RPCA 2MDGA 3IWBA 2YT4A 2JYAA 4DV3E 5LMNE 2DLQA 4O5GA 4LF5E 2EPXA 4RH8A 4F9AB 4F6NA 4WPYA 5A6AA 1PKPA 4DR3E 2ENCA 1X48A 2EOMA 4R2AA 1RC7A 3QG5C 2LTSA 4MLVA 2B3TB 2YPNA 1KYQA 2DSYA 2EOSA 2EJ4A 4B3TE 2DB2A 2H36X 4K0KE 4X66E 2EMWA 2BBGA 1MEYC 5LLQA 2KONA 2ENAA 2NABA 4BBYA 4R2PA 2JWOA 2E1MA 3EPLA 2EOFA 2DIXA 4WSGA 2M9AA 4MLQA 2EM3A 5A6BA 1YYKA 2EQ3A 5A6KA 3OMLA 4NXNE 5BR8E 4ZYEA 3MHSC 2N8XA 2EM6A 3HTXA 4FK5C 2EN6A 2EN3A 2EN2A 3HXLA 1HNXE 4O4KA 2CSHA 2V88A 2YTDA 3LMLA 4R2QA 3ADJA 1A1JA 2EMZA 2GLIA 1YPNA 4DR7E 2EMFA 4Q28A 1IQSA 1QNTA 2B7TA 3C6MA 2LRSA 5TSEA 4ZYHA 4X8WA 3VYYA 2NUFA 5DNYA 2LJUA 4DV1E 3ECRA 4JI6E 4NZVA 3JU0A 2YRKA 4IS1C 2YTGA 3HPSA 1WRJA 1STUA 4R2DA 4I8OA 3OTOE 1J5EE 2HHHE 2EN1A 2N3HA 1IMUA 2MKDA 2YTQA 2GPIA 2V87A 2VRDA 1X49A 3IWCA 2EOIA 2EM9A 2Q8UA 4N4RB 2EORA 2EPNA 4R03A 3T1YE 5AASA 4JV5E 2I13A 4WFTA 4R2RA 2EMHA 3EPHA 4Q35B 2EN4A 4BC7A 5A6JA 1HNZE 4GZNC 1WHQA 1L4SA 4JYAE 2EM7A 2EOXA 3VK6A 3KZYA 4ZYGA 2EPLX 2UXDE 2JOXA 4B3ME 4BC9A 3EPKA 2UUBE 2EOHA 1AAYA 2RS6A 4DUZE 2EM8A 2JXPA 1X6FA 4KWYA 2K4VA 4F9BB 1ZU1A 2LO3A 1T4LB 5KL3A 1G2FC 2UU9E 2MDRA 1X3CA 2EMBA 2VQFE 2RSMA 4DV4E 2DMIA 1WHNA 1YZ9A 2V8QB 1PDAA 4KZSA 2DRPA 2EMKA 2EL5A 2LV2A 1PJTA 2EOEA 2DLKA 2L3JA 2EQ1A 3C4BA 4OOGC 2YU8A 3KZZA 1DGCA 4AQYE 5KL5A 1X5WA 2V89A 2LJHA 1N34E 2E5LE 5A6BD 2EPKX 4F9CB 1IQOA 2MKNA 4LTYA 4JI1E 4LF7E 2NUGA 3EPJA 3JTZA 4DV6E 2DGCA 4HTGA 2YU5A 4GEQB 2EN8A 4R2SA 2LE2A 4B3RE 1A1IA 2HGHA 2HC5A 1F2IG 2V83A 1BBOA 4LFAE 2EQ0A 1YYWA 2EPOA 3J7AG 1PJQA 2EM5A 3IWDA 1UN6B 4O43A 2CT1A 1A1FA 2N3GA 1AH5A 1KJKA 1UHZA 1YUIA 1ZAAC 1Z1BA 4M9VC 5KL6A 2UUCE 3AUZA 2ODRD 2WBSA 2B7VA 4R2CA 4DR6E 1P47A 1I94E 2ODRC 1A1GA 1N32E 4LFBE 2RTXA 2B9DA 4JI3E 3BIDA 2YRMA
chains in the Genus database with same CATH topology
2EOOA 2EORA 5KL7A 2EPUA 2J7JA 1BB8A 2I13A 2WBUA 4R2RA 3EPHA 2EMHA 2GHFA 2RPCA 2LT7A 2EN4A 4GZNC 2MDGA 2EOYA 3UK3C 2EM7A 2EOXA 2EPCA 2JP9A 5KL2A 2DLQA 1NCSA 4X9JA 2EPXA 2EM0A 2LCEA 4F6NA 3EPKA 2EM4A 2EOHA 2R1FA 2ENCA 1AAYA 2ADRA 4IJDA 1A1HA 2EM2A 2EPRA 2EOMA 2EP3A 2RSIA 4R2AA 2BB8A 2EM8A 1A1KA 1X6FA 3M99B 1ZU1A 2EL6A 2LO3A 2YTOA 1ZR9A 2EOSA 2EJ4A 2EL4A 1YSAC 5KL3A 1TF3A 1G2FC 2EMWA 4R2EA 2EPPA 1X3CA 2EMBA 1B69A 1MEYC 2DMIA 2ENAA 2NABA 1G2DC 1UBDC 2WBTA 2DRPA 2EMKA 2EL5A 2LV2A 2YTIA 2YSOA 2EOEA 4R2PA 2JPAA 3EPLA 2DLKA 2EOFA 2EMYA 2YSPA 2EOZA 2ELYA 2ELZA 4WSGA 2EQ1A 2YU8A 1DGCA 2M9AA 2EMIA 2EE8A 1X5WA 2EM3A 5KL5A 1YUJA 2D9HA 4F2JC 2EQ3A 2YTNA 2EPZA 2YTEA 2EMXA 1JK1A 2MKNA 1RMDA 3MHSC 4F6MA 2EM6A 4FK5C 2EN6A 2EN3A 2EN2A 5KL4A 3EPJA 2CTDA 2DGCA 2YU5A 2CSHA 2YTDA 4R2QA 2EN8A 2EMCA 4R2SA 1A1IA 2HGHA 1A1JA 2EMZA 1F2IG 2GLIA 1TN9A 2EOJA 1LLMC 2EMAA 1BBOA 3VHTB 2EMFA 2EQ0A 2EM5A 1UN6B 2ENHA 2YRHA 2CT1A 2YTJA 1A1FA 1JK2A 1TF6A 1KJKA 1YUIA 2EMGA 1ZAAC 1Z1BA 4M9VC 2YTPA 2EOQA 5KL6A 3MHHC 2PRTA 2WBSA 2YRKA 4IS1C 2YTFA 2YTGA 4R2CA 1X6HA 2LVHA 1P47A 2E72A 4R2DA 1WJPA 2EN1A 1A1GA 1X6EA 2MKDA 2YTQA 2EPAA 1A1LA 2A25A 2EMLA 2VRDA 2WCC3 2EOIA 2EN7A 2EM9A 2YRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOO A;  2EOR A;  5KL7 A;  2EPU A;  2J7J A;  1BB8 A;  2I13 A;  2WBU A;  4R2R A;  3EPH A;  2EMH A;  2GHF A;  2RPC A;  2LT7 A;  2EN4 A;  4GZN C;  2MDG A;  2EOY A;  3UK3 C;  2EM7 A;  2EOX A;  2EPC A;  2JP9 A;  5KL2 A;  2DLQ A;  1NCS A;  4X9J A;  2EPX A;  2EM0 A;  2LCE A;  4F6N A;  3EPK A;  2EM4 A;  2EOH A;  2R1F A;  2ENC A;  1AAY A;  2ADR A;  4IJD A;  1A1H A;  2EM2 A;  2EPR A;  2EOM A;  2EP3 A;  2RSI A;  4R2A A;  2BB8 A;  2EM8 A;  1A1K A;  1X6F A;  3M99 B;  1ZU1 A;  2EL6 A;  2LO3 A;  2YTO A;  1ZR9 A;  2EOS A;  2EJ4 A;  2EL4 A;  1YSA C;  5KL3 A;  1TF3 A;  1G2F C;  2EMW A;  4R2E A;  2EPP A;  1X3C A;  2EMB A;  1B69 A;  1MEY C;  2DMI A;  2ENA A;  2NAB A;  1G2D C;  1UBD C;  2WBT A;  2DRP A;  2EMK A;  2EL5 A;  2LV2 A;  2YTI A;  2YSO A;  2EOE A;  4R2P A;  2JPA A;  3EPL A;  2DLK A;  2EOF A;  2EMY A;  2YSP A;  2EOZ A;  2ELY A;  2ELZ A;  4WSG A;  2EQ1 A;  2YU8 A;  1DGC A;  2M9A A;  2EMI A;  2EE8 A;  1X5W A;  2EM3 A;  5KL5 A;  1YUJ A;  2D9H A;  4F2J C;  2EQ3 A;  2YTN A;  2EPZ A;  2YTE A;  2EMX A;  1JK1 A;  2MKN A;  1RMD A;  3MHS C;  4F6M A;  2EM6 A;  4FK5 C;  2EN6 A;  2EN3 A;  2EN2 A;  5KL4 A;  3EPJ A;  2CTD A;  2DGC A;  2YU5 A;  2CSH A;  2YTD A;  4R2Q A;  2EN8 A;  2EMC A;  4R2S A;  1A1I A;  2HGH A;  1A1J A;  2EMZ A;  1F2I G;  2GLI A;  1TN9 A;  2EOJ A;  1LLM C;  2EMA A;  1BBO A;  3VHT B;  2EMF A;  2EQ0 A;  2EM5 A;  1UN6 B;  2ENH A;  2YRH A;  2CT1 A;  2YTJ A;  1A1F A;  1JK2 A;  1TF6 A;  1KJK A;  1YUI A;  2EMG A;  1ZAA C;  1Z1B A;  4M9V C;  2YTP A;  2EOQ A;  5KL6 A;  3MHH C;  2PRT A;  2WBS A;  2YRK A;  4IS1 C;  2YTF A;  2YTG A;  4R2C A;  1X6H A;  2LVH A;  1P47 A;  2E72 A;  4R2D A;  1WJP A;  2EN1 A;  1A1G A;  1X6E A;  2MKD A;  2YTQ A;  2EPA A;  1A1L A;  2A25 A;  2EML A;  2VRD A;  2WCC 3;  2EOI A;  2EN7 A;  2EM9 A;  2YRM A; 
#chains in the Genus database with same CATH topology
 2EOO A;  4DR5 E;  2EPU A;  2KOU A;  4LF6 E;  2J7J A;  3MSW A;  1MGT A;  4LFC E;  1X47 A;  3EQ1 A;  4TUG A;  4WSP A;  2LT7 A;  1BBG A;  5T6J A;  4DV0 E;  3UK3 C;  4DR1 E;  3HQ1 A;  3TQM A;  4DR4 E;  2JP9 A;  1ZBQ A;  1NCS A;  4X9J A;  5AE2 A;  1DQ3 A;  2LTR A;  2L3C A;  4DV7 E;  2EM4 A;  2MC5 A;  4DUY E;  2UXB E;  4BCA A;  3J7Y p;  2ADR A;  4IJD A;  4DKK A;  2EM2 A;  4DMI A;  1A1H A;  1RQ0 A;  2EPR A;  2RSI A;  2EP3 A;  4DV5 E;  1GTK A;  1EKZ A;  2BB8 A;  1A1K A;  2EWL A;  3M99 B;  2CPN A;  2LMZ A;  3J81 C;  4LU9 A;  2LUP B;  2L2K B;  1YYO A;  2EL4 A;  2LBS B;  5LL6 R;  2L92 A;  4OX9 E;  1TF3 A;  2L33 A;  3THO B;  4LF4 E;  1UBD C;  4YY3 E;  2JPA A;  2I9I A;  4JI4 E;  4BMJ A;  1GQE A;  2HJJ A;  2EMI A;  2EE8 A;  3AV0 A;  1YUJ A;  3T1H E;  1HNW E;  1EH8 A;  1YFH A;  2F8B A;  2FGG A;  2YTN A;  2VF1 A;  4BS9 A;  1JK1 A;  2L8T A;  4JI2 E;  4F6M A;  1XNQ E;  2M4I A;  2RQL A;  1XNR E;  4JI0 E;  2EMC A;  3DJW A;  1SFE A;  4M2Z A;  2EOJ A;  2EPM X;  5AC5 A;  1LLM C;  3VHT B;  1FJG E;  1T4N A;  2FV4 B;  2K7I A;  2V86 A;  1ZBT A;  4J8Z A;  4JI7 E;  2YRH A;  2UXC E;  1JK2 A;  3K6Q A;  2YTP A;  2EOQ A;  2IHR 1;  3L00 A;  1IBM E;  2JY9 A;  3MHH C;  2PRT A;  2NUE A;  5ADZ A;  2YTF A;  2L6M A;  1IBL E;  1X6H A;  2L2M A;  2LVH A;  4O24 A;  4P78 A;  5AC4 A;  3RMP A;  1WJP A;  2EML A;  3H09 A;  4X65 E;  2WCC 3;  2V85 A;  2YWQ A;  2EN7 A;  3ADG A;  4LF8 E;  4RHB B;  4DR2 E;  4WXC A;  2LUQ A;  1N33 E;  1BB8 A;  1XMO E;  3BBG A;  3VYX A;  1WXR A;  2G7H A;  2M1S A;  1SR9 A;  4L8N A;  1PJS A;  3KWR A;  2EOY A;  2EPC A;  4P7D A;  5A2Q C;  3ADI A;  5KL2 A;  4X62 E;  5A69 A;  4NHR A;  2EM0 A;  2LCE A;  1EH6 A;  2WZO A;  4R8O A;  4DV2 E;  2R1F A;  2KHX A;  3HPZ A;  1GZ6 A;  3BF2 A;  2EL6 A;  2YTO A;  1ZR9 A;  4HEI A;  2YZT A;  1J26 A;  4F54 A;  1T39 A;  1YSA C;  1T4O A;  2JOB A;  4KHP E;  2MC6 A;  2EPP A;  4R2E A;  1HR0 E;  1B69 A;  4M30 A;  1G2D C;  4NXM E;  2WBT A;  2R76 A;  5LMU E;  4WX9 A;  3ZOQ B;  2YTI A;  2YSO A;  3P1X A;  2NA2 A;  2EMY A;  3C6K A;  2YSP A;  2EOZ A;  2ELY A;  4YHH E;  2ELZ A;  5CFF E;  4B3S E;  1T38 A;  1N36 E;  2D9H A;  3FIG A;  4F2J C;  3DF6 A;  5FLX C;  5AE3 A;  4GKK E;  2EPZ A;  1EH7 A;  2EMX A;  2YTE A;  1RMD A;  3F6H A;  1DI2 A;  5KL4 A;  2F4V E;  2CTD A;  2FTX B;  2JVA A;  3JAM C;  1UIL A;  4JI8 E;  1TN9 A;  1NEI A;  4X64 E;  3LLH A;  2EMA A;  4M0V A;  4L5N C;  1XMQ E;  2JR1 A;  2M7Q A;  2UUA E;  3F6G A;  3THN A;  2ENH A;  2YTJ A;  5IV8 B;  3ADL A;  1TF6 A;  5IXM B;  5F3W A;  3C4T A;  2EMG A;  2L2N A;  4JI5 E;  4ZYD A;  1O0W A;  2DMY A;  1QU6 A;  2ZM6 E;  1IBK E;  2EZ6 A;  2E72 A;  2VQE E;  1X6E A;  2EPA A;  4TUI A;  1A1L A;  3J80 C;  2A25 A;  3BGH A;  5KL7 A;  4GKJ E;  4BHB A;  2RS7 A;  2VE7 C;  5IT9 C;  5IWA E;  4WXD A;  5AE1 A;  2WBU A;  4LF9 E;  4BHC A;  4WYQ B;  1FKA E;  2GHF A;  1N3G A;  2RPC A;  2MDG A;  3IWB A;  2YT4 A;  2JYA A;  4DV3 E;  5LMN E;  2DLQ A;  4O5G A;  4LF5 E;  2EPX A;  4RH8 A;  4F9A B;  4F6N A;  4WPY A;  5A6A A;  1PKP A;  4DR3 E;  2ENC A;  1X48 A;  2EOM A;  4R2A A;  1RC7 A;  3QG5 C;  2LTS A;  4MLV A;  2B3T B;  2YPN A;  1KYQ A;  2DSY A;  2EOS A;  2EJ4 A;  4B3T E;  2DB2 A;  2H36 X;  4K0K E;  4X66 E;  2EMW A;  2BBG A;  1MEY C;  5LLQ A;  2KON A;  2ENA A;  2NAB A;  4BBY A;  4R2P A;  2JWO A;  2E1M A;  3EPL A;  2EOF A;  2DIX A;  4WSG A;  2M9A A;  4MLQ A;  2EM3 A;  5A6B A;  1YYK A;  2EQ3 A;  5A6K A;  3OML A;  4NXN E;  5BR8 E;  4ZYE A;  3MHS C;  2N8X A;  2EM6 A;  3HTX A;  4FK5 C;  2EN6 A;  2EN3 A;  2EN2 A;  3HXL A;  1HNX E;  4O4K A;  2CSH A;  2V88 A;  2YTD A;  3LML A;  4R2Q A;  3ADJ A;  1A1J A;  2EMZ A;  2GLI A;  1YPN A;  4DR7 E;  2EMF A;  4Q28 A;  1IQS A;  1QNT A;  2B7T A;  3C6M A;  2LRS A;  5TSE A;  4ZYH A;  4X8W A;  3VYY A;  2NUF A;  5DNY A;  2LJU A;  4DV1 E;  3ECR A;  4JI6 E;  4NZV A;  3JU0 A;  2YRK A;  4IS1 C;  2YTG A;  3HPS A;  1WRJ A;  1STU A;  4R2D A;  4I8O A;  3OTO E;  1J5E E;  2HHH E;  2EN1 A;  2N3H A;  1IMU A;  2MKD A;  2YTQ A;  2GPI A;  2V87 A;  2VRD A;  1X49 A;  3IWC A;  2EOI A;  2EM9 A;  2Q8U A;  4N4R B;  2EOR A;  2EPN A;  4R03 A;  3T1Y E;  5AAS A;  4JV5 E;  2I13 A;  4WFT A;  4R2R A;  2EMH A;  3EPH A;  4Q35 B;  2EN4 A;  4BC7 A;  5A6J A;  1HNZ E;  4GZN C;  1WHQ A;  1L4S A;  4JYA E;  2EM7 A;  2EOX A;  3VK6 A;  3KZY A;  4ZYG A;  2EPL X;  2UXD E;  2JOX A;  4B3M E;  4BC9 A;  3EPK A;  2UUB E;  2EOH A;  1AAY A;  2RS6 A;  4DUZ E;  2EM8 A;  2JXP A;  1X6F A;  4KWY A;  2K4V A;  4F9B B;  1ZU1 A;  2LO3 A;  1T4L B;  5KL3 A;  1G2F C;  2UU9 E;  2MDR A;  1X3C A;  2EMB A;  2VQF E;  2RSM A;  4DV4 E;  2DMI A;  1WHN A;  1YZ9 A;  2V8Q B;  1PDA A;  4KZS A;  2DRP A;  2EMK A;  2EL5 A;  2LV2 A;  1PJT A;  2EOE A;  2DLK A;  2L3J A;  2EQ1 A;  3C4B A;  4OOG C;  2YU8 A;  3KZZ A;  1DGC A;  4AQY E;  5KL5 A;  1X5W A;  2V89 A;  2LJH A;  1N34 E;  2E5L E;  5A6B D;  2EPK X;  4F9C B;  1IQO A;  2MKN A;  4LTY A;  4JI1 E;  4LF7 E;  2NUG A;  3EPJ A;  3JTZ A;  4DV6 E;  2DGC A;  4HTG A;  2YU5 A;  4GEQ B;  2EN8 A;  4R2S A;  2LE2 A;  4B3R E;  1A1I A;  2HGH A;  2HC5 A;  1F2I G;  2V83 A;  1BBO A;  4LFA E;  2EQ0 A;  1YYW A;  2EPO A;  3J7A G;  1PJQ A;  2EM5 A;  3IWD A;  1UN6 B;  4O43 A;  2CT1 A;  1A1F A;  2N3G A;  1AH5 A;  1KJK A;  1UHZ A;  1YUI A;  1ZAA C;  1Z1B A;  4M9V C;  5KL6 A;  2UUC E;  3AUZ A;  2ODR D;  2WBS A;  2B7V A;  4R2C A;  4DR6 E;  1P47 A;  1I94 E;  2ODR C;  1A1G A;  1N32 E;  4LFB E;  2RTX A;  2B9D A;  4JI3 E;  3BID A;  2YRM A; 
#chains in the Genus database with same CATH homology
 2EOO A;  2EOR A;  5KL7 A;  2EPU A;  2J7J A;  1BB8 A;  2I13 A;  2WBU A;  4R2R A;  3EPH A;  2EMH A;  2GHF A;  2RPC A;  2LT7 A;  2EN4 A;  4GZN C;  2MDG A;  2EOY A;  3UK3 C;  2EM7 A;  2EOX A;  2EPC A;  2JP9 A;  5KL2 A;  2DLQ A;  1NCS A;  4X9J A;  2EPX A;  2EM0 A;  2LCE A;  4F6N A;  3EPK A;  2EM4 A;  2EOH A;  2R1F A;  2ENC A;  1AAY A;  2ADR A;  4IJD A;  1A1H A;  2EM2 A;  2EPR A;  2EOM A;  2EP3 A;  2RSI A;  4R2A A;  2BB8 A;  2EM8 A;  1A1K A;  1X6F A;  3M99 B;  1ZU1 A;  2EL6 A;  2LO3 A;  2YTO A;  1ZR9 A;  2EOS A;  2EJ4 A;  2EL4 A;  1YSA C;  5KL3 A;  1TF3 A;  1G2F C;  2EMW A;  4R2E A;  2EPP A;  1X3C A;  2EMB A;  1B69 A;  1MEY C;  2DMI A;  2ENA A;  2NAB A;  1G2D C;  1UBD C;  2WBT A;  2DRP A;  2EMK A;  2EL5 A;  2LV2 A;  2YTI A;  2YSO A;  2EOE A;  4R2P A;  2JPA A;  3EPL A;  2DLK A;  2EOF A;  2EMY A;  2YSP A;  2EOZ A;  2ELY A;  2ELZ A;  4WSG A;  2EQ1 A;  2YU8 A;  1DGC A;  2M9A A;  2EMI A;  2EE8 A;  1X5W A;  2EM3 A;  5KL5 A;  1YUJ A;  2D9H A;  4F2J C;  2EQ3 A;  2YTN A;  2EPZ A;  2YTE A;  2EMX A;  1JK1 A;  2MKN A;  1RMD A;  3MHS C;  4F6M A;  2EM6 A;  4FK5 C;  2EN6 A;  2EN3 A;  2EN2 A;  5KL4 A;  3EPJ A;  2CTD A;  2DGC A;  2YU5 A;  2CSH A;  2YTD A;  4R2Q A;  2EN8 A;  2EMC A;  4R2S A;  1A1I A;  2HGH A;  1A1J A;  2EMZ A;  1F2I G;  2GLI A;  1TN9 A;  2EOJ A;  1LLM C;  2EMA A;  1BBO A;  3VHT B;  2EMF A;  2EQ0 A;  2EM5 A;  1UN6 B;  2ENH A;  2YRH A;  2CT1 A;  2YTJ A;  1A1F A;  1JK2 A;  1TF6 A;  1KJK A;  1YUI A;  2EMG A;  1ZAA C;  1Z1B A;  4M9V C;  2YTP A;  2EOQ A;  5KL6 A;  3MHH C;  2PRT A;  2WBS A;  2YRK A;  4IS1 C;  2YTF A;  2YTG A;  4R2C A;  1X6H A;  2LVH A;  1P47 A;  2E72 A;  4R2D A;  1WJP A;  2EN1 A;  1A1G A;  1X6E A;  2MKD A;  2YTQ A;  2EPA A;  1A1L A;  2A25 A;  2EML A;  2VRD A;  2WCC 3;  2EOI A;  2EN7 A;  2EM9 A;  2YRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...