2CSHA

Solution structure of tandem repeat of the zf-c2h2 domains of human zinc finger protein 297b
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
110
structure length
110
Chain Sequence
GSSGSSGDKLYPCQCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIHTGIKPYECNICAKRFMWRDSFHRHVTSCTKSYEAAKAEQNTTEASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 297B
publication title Solution structure of tandem repeat of the zf-C2H2 domains of human zinc finger protein 297B
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 21
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2005-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2cshA01
2ENHA 4R2EA 2YTPA 2EL4A 2PRTA 2EM8A 1A1JA 2YTJA 2J7JA 4F2JC 2EOFA 2YTOA 2YSPA 1JK2A 2LT7A 4R2AA 2EOHA 2EM5A 2EOSA 3M99B 2EOXA 2GHFA 1ZU1A 2RSIA 2VRDA 2EORA 5KL2A 1G2FC 1TN9A 2EM3A 2YTIA 1JK1A 1ZAAC 2EPUA 2EN3A 2EE8A 2LV2A 2MKNA 1UBDC 2EQ1A 2WBSA 2RPCA 3EPKA 2LO3A 3MHHC 2A25A 2YTDA 2EN2A 2EOIA 2ELYA 3MHSC 4WSGA 1YSAC 1A1GA 2NABA 1BB8A 1ZR9A 2EMHA 1F2IG 5KL4A 2DGCA 1YUJA 4R2CA 1KJKA 2EJ4A 1BBOA 2E72A 1TF6A 2EMLA 1A1HA 3EPJA 2ADRA 1A1KA 1A1LA 1TF3A 2EM9A 2WBTA 2YTQA 4M9VC 2EMGA 1X6EA 2EPAA 2EN7A 3EPLA 2JPAA 2WBUA 2YTFA 2BB8A 2EP3A 2EM7A 4IS1C 4F6NA 2EN1A 2YTEA 4F6MA 2CT1A 2EQ3A 5KL7A 2JP9A 2YTGA 2YU8A 2EPPA 2CSHA 1Z1BA 3VHTB 1A1FA 2YRHA 2I13A 2HGHA 2EOQA 1MEYC 2YRKA 2EMBA 2EMZA 2EMKA 2EPCA 2GLIA 3EPHA 4R2RA 1X3CA 2YU5A 2WCC3 2YRMA 2M9AA 2R1FA 2EPXA 4R2PA 2EQ0A 2MDGA 2EM4A 1AAYA 2DRPA 2EN4A 1B69A 2EMCA 4FK5C 2EOEA 2EPRA 4R2QA 2DLQA 1X5WA 1WJPA 1NCSA 2YSOA 2EMAA 2EM0A 2EOOA 2EOZA 3UK3C 2LCEA 1G2DC 4R2SA 2EN6A 1P47A 2EPZA 1UN6B 2EMFA 2EM2A 2EOMA 2EL6A 4GZNC 5KL6A 5KL3A 2YTNA 2ENAA 2DLKA 1LLMC 4R2DA 1YUIA 2EMWA 1A1IA 2EN8A 2LVHA 2ENCA 5KL5A 1RMDA 4X9JA 2MKDA 1X6FA 2D9HA 2EM6A 2EMXA 2ELZA 2CTDA 2EL5A 2EOJA 2EMYA 1DGCA 2EMIA 2DMIA 4IJDA 2EOYA 1X6HA
chains in the Genus database with same CATH superfamily
2ENHA 4DR7E 2EM8A 4JI6E 2M7QA 4F2JC 2UXDE 2N3HA 2FTXB 3DF6A 4R2AA 4DV2E 3OMLA 2EOSA 2YZTA 1TN9A 4LFBE 2YPNA 1ZAAC 3THNA 2MKNA 1QNTA 4HEIA 4LF6E 1EH8A 4ZYEA 2LO3A 4DR4E 3RMPA 1NEIA 4HTGA 1YSAC 1UILA 1F2IG 4WXCA 4NXNE 4R2CA 1T39A 1N33E 1WHNA 2JYAA 2E72A 1TF6A 4DV7E 2ADRA 2YWQA 1A1LA 2UUCE 1SFEA 2EWLA 4M9VC 5LLQA 1BBGA 5A6BA 4F6NA 2EN1A 4LF5E 5KL7A 1XMQE 1HNXE 1PJQA 4ZYGA 2NUGA 3J7Yp 2KOUA 1A1FA 2YRHA 2HGHA 2L3JA 1MEYC 2EMZA 2EMKA 2EPCA 2GLIA 5AE3A 4R2RA 1X3CA 2YU5A 2N8XA 2I9IA 4LF8E 4B3TE 2L33A 2EPKX 2LE2A 2EM4A 2K7IA 2DRPA 1YPNA 2V89A 2EMCA 5AASA 2EOEA 2R76A 4YHHE 1STUA 3AV0A 4O4KA 4AQYE 3FIGA 4DR5E 2EPLX 4B3SE 2ZM6E 4WYQB 3ADIA 1GTKA 2EM0A 5DNYA 4DR6E 2DB2A 4O43A 2L2MA 1UN6B 4O24A 4LF7E 2RTXA 4GKKE 3L00A 1YFHA 3JU0A 1T38A 1PJSA 2EN8A 1ZBQA 1I94E 2UXCE 2K4VA 4L5NC 3JTZA 2MKDA 2F4VE 4DV4E 2EM6A 2ELZA 3BF2A 1HNZE 4BHCA 2LUQA 2KONA 4BC7A 2MDGA 2L8TA 2YTPA 4F9BB 4TUGA 2JXPA 3IWCA 2J7JA 2EOFA 4M30A 3HPSA 3DJWA 2BBGA 5BR8E 1T4NA 3T1YE 3KWRA 2EOHA 1IBME 2Q8UA 4F9AB 2NUEA 3KZYA 2EOXA 5AC5A 4M2ZA 3F6GA 1YYKA 4OX9E 4BHBA 2VRDA 1G2FC 2EPUA 5LMNE 2IHR1 4LF4E 1UBDC 3ECRA 4F54A 4P78A 2DMYA 2ELYA 4WSGA 1A1GA 2NABA 3MSWA 5KL4A 4JI5E 5A6AA 2E1MA 3VK6A 3J81C 4ZYDA 4WXDA 1YYOA 1TF3A 1ZBTA 4J8ZA 5AC4A 2WBTA 1XNRE 2ODRC 2EN7A 1IQSA 2JPAA 2YTFA 2B7TA 2EM7A 2EP3A 2MC6A 4B3ME 2CT1A 2G7HA 3IWDA 1X47A 1RQ0A 5F3WA 4JI1E 2YRKA 4JI0E 2EMBA 2FGGA 3QG5C 2WCC3 2HJJA 4JYAE 2R1FA 2EPMX 3BBGA 2V87A 4LFCE 1L4SA 5IXMB 2HHHE 4B3RE 1B69A 3C6MA 4DV1E 4BC9A 2FV4B 5AE1A 2EMAA 1FKAE 2EOOA 4GKJE 4X64E 3UK3C 2V85A 1G2DC 2DIXA 4R2SA 3OTOE 2EPZA 2EPOA 3HPZA 4BMJA 1EKZA 2EOMA 2VE7C 2EL6A 3ADGA 4LTYA 4N4RB 2UXBE 2ENAA 2DLKA 1LLMC 1EH7A 1A1IA 2F8BA 2ENCA 3THOB 3EQ1A 4O5GA 4JI7E 3ADLA 4X65E 2L2NA 1X49A 3LMLA 5LL6R 4DR3E 3H09A 2CTDA 1RC7A 2EMYA 4IJDA 2EOYA 4RH8A 3F6HA 4R2EA 2PRTA 1FJGE 1MGTA 2YTJA 4KHPE 3HQ1A 2MDRA 2HC5A 5IV8B 1JK2A 2LTRA 2GPIA 2LBSB 5AE2A 2EM5A 3M99B 2GHFA 4L8NA 3T1HE 3VYYA 4P7DA 3KZZA 2KHXA 4DUZE 1T4OA 3EPKA 4X62E 2A25A 2YT4A 2EN2A 2EOIA 3MHSC 3J7AG 2MC5A 1BB8A 1GZ6A 2DSYA 1YUJA 1IQOA 1KJKA 2UUBE 4NXME 2EJ4A 1J5EE 5ADZA 2EMLA 2L3CA 3EPJA 2CPNA 1N32E 3BGHA 2RS7A 1IMUA 2B3TB 5A2QC 1PJTA 3AUZA 2WBUA 4BBYA 4M0VA 2YTEA 3VYXA 3BIDA 4DV6E 4DV0E 2V8QB 4R8OA 1T4LB 1DI2A 1QU6A 3VHTB 2UUAE 1O0WA 2I13A 2EOQA 1N3GA 3HXLA 4JV5E 3EPHA 4WSPA 4BS9A 4DMIA 4R03A 5FLXC 2YRMA 2M9AA 4R2PA 3TQMA 2EQ0A 4ZYHA 2WZOA 4GEQB 1WHQA 1AAYA 5TSEA 2ODRD 3ZOQB 4KZSA 2B7VA 1SR9A 2VQEE 2DLQA 1X5WA 5IT9C 1NCSA 4Q28A 2YSOA 3C4TA 2L2KB 1P47A 1AH5A 2EN6A 5A6KA 2EMFA 1PDAA 1X48A 4X8WA 3JAMC 1YUIA 4R2DA 2EMWA 2L6MA 2LVHA 2L92A 4JI2E 5KL5A 5T6JA 4DR2E 1UHZA 1X6FA 2V86A 1XNQE 2D9HA 4DV3E 2EL5A 1IBKE 2EOJA 2EZ6A 1DGCA 2DMIA 1X6HA 4GZNC 2M4IA 2LRSA 2EL4A 4NHRA 3P1XA 1A1JA 2V88A 4LFAE 2LJHA 4MLVA 2YTOA 2YSPA 3J80C 2RQLA 2LT7A 2JR1A 2EPNA 3C6KA 2RSIA 1ZU1A 4WPYA 5A69A 2EORA 5KL2A 2EM3A 2YTIA 4KWYA 1JK1A 2EN3A 2EE8A 2LV2A 2LUPB 2EQ1A 1WXRA 4JI4E 2WBSA 2LJUA 3C4BA 4WFTA 2RPCA 3MHHC 2YTDA 1J26A 1PKPA 1XMOE 1ZR9A 2EMHA 2LMZA 2DGCA 2VQFE 4YY3E 2NA2A 1BBOA 2V83A 1A1HA 3K6QA 4LU9A 2EM9A 2YTQA 4TUIA 2B9DA 4MLQA 2UU9E 2EMGA 4WX9A 1X6EA 2EPAA 4JI3E 4DV5E 3EPLA 2BB8A 2JVAA 2N3GA 2JOBA 4IS1C 5LMUE 2JWOA 4F6MA 2EQ3A 2JP9A 2YTGA 2YU8A 4DKKA 4JI8E 2EPPA 2CSHA 1Z1BA 4BCAA 3ADJA 2RSMA 4DUYE 1N36E 2M1SA 4Q35B 1GQEA 4F9CB 4I8OA 2EPXA 3LLHA 1KYQA 4NZVA 3HTXA 4K0KE 4DR1E 2EN4A 4FK5C 2EPRA 5CFFE 3IWBA 4R2QA 5IWAE 1WJPA 4OOGC 2E5LE 5A6BD 2LTSA 1HNWE 4X66E 2EOZA 2LCEA 4LF9E 2JY9A 5A6JA 2NUFA 1YYWA 2EM2A 1EH6A 2VF1A 5KL6A 2H36X 1HR0E 5KL3A 1IBLE 2YTNA 1YZ9A 2RS6A 1RMDA 2JOXA 4X9JA 1DQ3A 1N34E 2EMXA 1WRJA 2EMIA 4RHBB 1A1KA
chains in the Genus database with same CATH topology
2ENHA 4R2EA 2YTPA 2EL4A 2PRTA 2EM8A 1A1JA 2YTJA 2J7JA 4F2JC 2EOFA 2YTOA 2YSPA 1JK2A 2LT7A 4R2AA 2EOHA 2EM5A 2EOSA 3M99B 2EOXA 2GHFA 1ZU1A 2RSIA 2VRDA 2EORA 5KL2A 1G2FC 1TN9A 2EM3A 2YTIA 1JK1A 1ZAAC 2EPUA 2EN3A 2EE8A 2LV2A 2MKNA 1UBDC 2EQ1A 2WBSA 2RPCA 3EPKA 2LO3A 3MHHC 2A25A 2YTDA 2EN2A 2EOIA 2ELYA 3MHSC 4WSGA 1YSAC 1A1GA 2NABA 1BB8A 1ZR9A 2EMHA 1F2IG 5KL4A 2DGCA 1YUJA 4R2CA 1KJKA 2EJ4A 1BBOA 2E72A 1TF6A 2EMLA 1A1HA 3EPJA 2ADRA 1A1KA 1A1LA 1TF3A 2EM9A 2WBTA 2YTQA 4M9VC 2EMGA 1X6EA 2EPAA 2EN7A 3EPLA 2JPAA 2WBUA 2YTFA 2BB8A 2EP3A 2EM7A 4IS1C 4F6NA 2EN1A 2YTEA 4F6MA 2CT1A 2EQ3A 5KL7A 2JP9A 2YTGA 2YU8A 2EPPA 2CSHA 1Z1BA 3VHTB 1A1FA 2YRHA 2I13A 2HGHA 2EOQA 1MEYC 2YRKA 2EMBA 2EMZA 2EMKA 2EPCA 2GLIA 3EPHA 4R2RA 1X3CA 2YU5A 2WCC3 2YRMA 2M9AA 2R1FA 2EPXA 4R2PA 2EQ0A 2MDGA 2EM4A 1AAYA 2DRPA 2EN4A 1B69A 2EMCA 4FK5C 2EOEA 2EPRA 4R2QA 2DLQA 1X5WA 1WJPA 1NCSA 2YSOA 2EMAA 2EM0A 2EOOA 2EOZA 3UK3C 2LCEA 1G2DC 4R2SA 2EN6A 1P47A 2EPZA 1UN6B 2EMFA 2EM2A 2EOMA 2EL6A 4GZNC 5KL6A 5KL3A 2YTNA 2ENAA 2DLKA 1LLMC 4R2DA 1YUIA 2EMWA 1A1IA 2EN8A 2LVHA 2ENCA 5KL5A 1RMDA 4X9JA 2MKDA 1X6FA 2D9HA 2EM6A 2EMXA 2ELZA 2CTDA 2EL5A 2EOJA 2EMYA 1DGCA 2EMIA 2DMIA 4IJDA 2EOYA 1X6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ENH A;  4R2E A;  2YTP A;  2EL4 A;  2PRT A;  2EM8 A;  1A1J A;  2YTJ A;  2J7J A;  4F2J C;  2EOF A;  2YTO A;  2YSP A;  1JK2 A;  2LT7 A;  4R2A A;  2EOH A;  2EM5 A;  2EOS A;  3M99 B;  2EOX A;  2GHF A;  1ZU1 A;  2RSI A;  2VRD A;  2EOR A;  5KL2 A;  1G2F C;  1TN9 A;  2EM3 A;  2YTI A;  1JK1 A;  1ZAA C;  2EPU A;  2EN3 A;  2EE8 A;  2LV2 A;  2MKN A;  1UBD C;  2EQ1 A;  2WBS A;  2RPC A;  3EPK A;  2LO3 A;  3MHH C;  2A25 A;  2YTD A;  2EN2 A;  2EOI A;  2ELY A;  3MHS C;  4WSG A;  1YSA C;  1A1G A;  2NAB A;  1BB8 A;  1ZR9 A;  2EMH A;  1F2I G;  5KL4 A;  2DGC A;  1YUJ A;  4R2C A;  1KJK A;  2EJ4 A;  1BBO A;  2E72 A;  1TF6 A;  2EML A;  1A1H A;  3EPJ A;  2ADR A;  1A1K A;  1A1L A;  1TF3 A;  2EM9 A;  2WBT A;  2YTQ A;  4M9V C;  2EMG A;  1X6E A;  2EPA A;  2EN7 A;  3EPL A;  2JPA A;  2WBU A;  2YTF A;  2BB8 A;  2EP3 A;  2EM7 A;  4IS1 C;  4F6N A;  2EN1 A;  2YTE A;  4F6M A;  2CT1 A;  2EQ3 A;  5KL7 A;  2JP9 A;  2YTG A;  2YU8 A;  2EPP A;  2CSH A;  1Z1B A;  3VHT B;  1A1F A;  2YRH A;  2I13 A;  2HGH A;  2EOQ A;  1MEY C;  2YRK A;  2EMB A;  2EMZ A;  2EMK A;  2EPC A;  2GLI A;  3EPH A;  4R2R A;  1X3C A;  2YU5 A;  2WCC 3;  2YRM A;  2M9A A;  2R1F A;  2EPX A;  4R2P A;  2EQ0 A;  2MDG A;  2EM4 A;  1AAY A;  2DRP A;  2EN4 A;  1B69 A;  2EMC A;  4FK5 C;  2EOE A;  2EPR A;  4R2Q A;  2DLQ A;  1X5W A;  1WJP A;  1NCS A;  2YSO A;  2EMA A;  2EM0 A;  2EOO A;  2EOZ A;  3UK3 C;  2LCE A;  1G2D C;  4R2S A;  2EN6 A;  1P47 A;  2EPZ A;  1UN6 B;  2EMF A;  2EM2 A;  2EOM A;  2EL6 A;  4GZN C;  5KL6 A;  5KL3 A;  2YTN A;  2ENA A;  2DLK A;  1LLM C;  4R2D A;  1YUI A;  2EMW A;  1A1I A;  2EN8 A;  2LVH A;  2ENC A;  5KL5 A;  1RMD A;  4X9J A;  2MKD A;  1X6F A;  2D9H A;  2EM6 A;  2EMX A;  2ELZ A;  2CTD A;  2EL5 A;  2EOJ A;  2EMY A;  1DGC A;  2EMI A;  2DMI A;  4IJD A;  2EOY A;  1X6H A; 
#chains in the Genus database with same CATH topology
 2ENH A;  4DR7 E;  2EM8 A;  4JI6 E;  2M7Q A;  4F2J C;  2UXD E;  2N3H A;  2FTX B;  3DF6 A;  4R2A A;  4DV2 E;  3OML A;  2EOS A;  2YZT A;  1TN9 A;  4LFB E;  2YPN A;  1ZAA C;  3THN A;  2MKN A;  1QNT A;  4HEI A;  4LF6 E;  1EH8 A;  4ZYE A;  2LO3 A;  4DR4 E;  3RMP A;  1NEI A;  4HTG A;  1YSA C;  1UIL A;  1F2I G;  4WXC A;  4NXN E;  4R2C A;  1T39 A;  1N33 E;  1WHN A;  2JYA A;  2E72 A;  1TF6 A;  4DV7 E;  2ADR A;  2YWQ A;  1A1L A;  2UUC E;  1SFE A;  2EWL A;  4M9V C;  5LLQ A;  1BBG A;  5A6B A;  4F6N A;  2EN1 A;  4LF5 E;  5KL7 A;  1XMQ E;  1HNX E;  1PJQ A;  4ZYG A;  2NUG A;  3J7Y p;  2KOU A;  1A1F A;  2YRH A;  2HGH A;  2L3J A;  1MEY C;  2EMZ A;  2EMK A;  2EPC A;  2GLI A;  5AE3 A;  4R2R A;  1X3C A;  2YU5 A;  2N8X A;  2I9I A;  4LF8 E;  4B3T E;  2L33 A;  2EPK X;  2LE2 A;  2EM4 A;  2K7I A;  2DRP A;  1YPN A;  2V89 A;  2EMC A;  5AAS A;  2EOE A;  2R76 A;  4YHH E;  1STU A;  3AV0 A;  4O4K A;  4AQY E;  3FIG A;  4DR5 E;  2EPL X;  4B3S E;  2ZM6 E;  4WYQ B;  3ADI A;  1GTK A;  2EM0 A;  5DNY A;  4DR6 E;  2DB2 A;  4O43 A;  2L2M A;  1UN6 B;  4O24 A;  4LF7 E;  2RTX A;  4GKK E;  3L00 A;  1YFH A;  3JU0 A;  1T38 A;  1PJS A;  2EN8 A;  1ZBQ A;  1I94 E;  2UXC E;  2K4V A;  4L5N C;  3JTZ A;  2MKD A;  2F4V E;  4DV4 E;  2EM6 A;  2ELZ A;  3BF2 A;  1HNZ E;  4BHC A;  2LUQ A;  2KON A;  4BC7 A;  2MDG A;  2L8T A;  2YTP A;  4F9B B;  4TUG A;  2JXP A;  3IWC A;  2J7J A;  2EOF A;  4M30 A;  3HPS A;  3DJW A;  2BBG A;  5BR8 E;  1T4N A;  3T1Y E;  3KWR A;  2EOH A;  1IBM E;  2Q8U A;  4F9A B;  2NUE A;  3KZY A;  2EOX A;  5AC5 A;  4M2Z A;  3F6G A;  1YYK A;  4OX9 E;  4BHB A;  2VRD A;  1G2F C;  2EPU A;  5LMN E;  2IHR 1;  4LF4 E;  1UBD C;  3ECR A;  4F54 A;  4P78 A;  2DMY A;  2ELY A;  4WSG A;  1A1G A;  2NAB A;  3MSW A;  5KL4 A;  4JI5 E;  5A6A A;  2E1M A;  3VK6 A;  3J81 C;  4ZYD A;  4WXD A;  1YYO A;  1TF3 A;  1ZBT A;  4J8Z A;  5AC4 A;  2WBT A;  1XNR E;  2ODR C;  2EN7 A;  1IQS A;  2JPA A;  2YTF A;  2B7T A;  2EM7 A;  2EP3 A;  2MC6 A;  4B3M E;  2CT1 A;  2G7H A;  3IWD A;  1X47 A;  1RQ0 A;  5F3W A;  4JI1 E;  2YRK A;  4JI0 E;  2EMB A;  2FGG A;  3QG5 C;  2WCC 3;  2HJJ A;  4JYA E;  2R1F A;  2EPM X;  3BBG A;  2V87 A;  4LFC E;  1L4S A;  5IXM B;  2HHH E;  4B3R E;  1B69 A;  3C6M A;  4DV1 E;  4BC9 A;  2FV4 B;  5AE1 A;  2EMA A;  1FKA E;  2EOO A;  4GKJ E;  4X64 E;  3UK3 C;  2V85 A;  1G2D C;  2DIX A;  4R2S A;  3OTO E;  2EPZ A;  2EPO A;  3HPZ A;  4BMJ A;  1EKZ A;  2EOM A;  2VE7 C;  2EL6 A;  3ADG A;  4LTY A;  4N4R B;  2UXB E;  2ENA A;  2DLK A;  1LLM C;  1EH7 A;  1A1I A;  2F8B A;  2ENC A;  3THO B;  3EQ1 A;  4O5G A;  4JI7 E;  3ADL A;  4X65 E;  2L2N A;  1X49 A;  3LML A;  5LL6 R;  4DR3 E;  3H09 A;  2CTD A;  1RC7 A;  2EMY A;  4IJD A;  2EOY A;  4RH8 A;  3F6H A;  4R2E A;  2PRT A;  1FJG E;  1MGT A;  2YTJ A;  4KHP E;  3HQ1 A;  2MDR A;  2HC5 A;  5IV8 B;  1JK2 A;  2LTR A;  2GPI A;  2LBS B;  5AE2 A;  2EM5 A;  3M99 B;  2GHF A;  4L8N A;  3T1H E;  3VYY A;  4P7D A;  3KZZ A;  2KHX A;  4DUZ E;  1T4O A;  3EPK A;  4X62 E;  2A25 A;  2YT4 A;  2EN2 A;  2EOI A;  3MHS C;  3J7A G;  2MC5 A;  1BB8 A;  1GZ6 A;  2DSY A;  1YUJ A;  1IQO A;  1KJK A;  2UUB E;  4NXM E;  2EJ4 A;  1J5E E;  5ADZ A;  2EML A;  2L3C A;  3EPJ A;  2CPN A;  1N32 E;  3BGH A;  2RS7 A;  1IMU A;  2B3T B;  5A2Q C;  1PJT A;  3AUZ A;  2WBU A;  4BBY A;  4M0V A;  2YTE A;  3VYX A;  3BID A;  4DV6 E;  4DV0 E;  2V8Q B;  4R8O A;  1T4L B;  1DI2 A;  1QU6 A;  3VHT B;  2UUA E;  1O0W A;  2I13 A;  2EOQ A;  1N3G A;  3HXL A;  4JV5 E;  3EPH A;  4WSP A;  4BS9 A;  4DMI A;  4R03 A;  5FLX C;  2YRM A;  2M9A A;  4R2P A;  3TQM A;  2EQ0 A;  4ZYH A;  2WZO A;  4GEQ B;  1WHQ A;  1AAY A;  5TSE A;  2ODR D;  3ZOQ B;  4KZS A;  2B7V A;  1SR9 A;  2VQE E;  2DLQ A;  1X5W A;  5IT9 C;  1NCS A;  4Q28 A;  2YSO A;  3C4T A;  2L2K B;  1P47 A;  1AH5 A;  2EN6 A;  5A6K A;  2EMF A;  1PDA A;  1X48 A;  4X8W A;  3JAM C;  1YUI A;  4R2D A;  2EMW A;  2L6M A;  2LVH A;  2L92 A;  4JI2 E;  5KL5 A;  5T6J A;  4DR2 E;  1UHZ A;  1X6F A;  2V86 A;  1XNQ E;  2D9H A;  4DV3 E;  2EL5 A;  1IBK E;  2EOJ A;  2EZ6 A;  1DGC A;  2DMI A;  1X6H A;  4GZN C;  2M4I A;  2LRS A;  2EL4 A;  4NHR A;  3P1X A;  1A1J A;  2V88 A;  4LFA E;  2LJH A;  4MLV A;  2YTO A;  2YSP A;  3J80 C;  2RQL A;  2LT7 A;  2JR1 A;  2EPN A;  3C6K A;  2RSI A;  1ZU1 A;  4WPY A;  5A69 A;  2EOR A;  5KL2 A;  2EM3 A;  2YTI A;  4KWY A;  1JK1 A;  2EN3 A;  2EE8 A;  2LV2 A;  2LUP B;  2EQ1 A;  1WXR A;  4JI4 E;  2WBS A;  2LJU A;  3C4B A;  4WFT A;  2RPC A;  3MHH C;  2YTD A;  1J26 A;  1PKP A;  1XMO E;  1ZR9 A;  2EMH A;  2LMZ A;  2DGC A;  2VQF E;  4YY3 E;  2NA2 A;  1BBO A;  2V83 A;  1A1H A;  3K6Q A;  4LU9 A;  2EM9 A;  2YTQ A;  4TUI A;  2B9D A;  4MLQ A;  2UU9 E;  2EMG A;  4WX9 A;  1X6E A;  2EPA A;  4JI3 E;  4DV5 E;  3EPL A;  2BB8 A;  2JVA A;  2N3G A;  2JOB A;  4IS1 C;  5LMU E;  2JWO A;  4F6M A;  2EQ3 A;  2JP9 A;  2YTG A;  2YU8 A;  4DKK A;  4JI8 E;  2EPP A;  2CSH A;  1Z1B A;  4BCA A;  3ADJ A;  2RSM A;  4DUY E;  1N36 E;  2M1S A;  4Q35 B;  1GQE A;  4F9C B;  4I8O A;  2EPX A;  3LLH A;  1KYQ A;  4NZV A;  3HTX A;  4K0K E;  4DR1 E;  2EN4 A;  4FK5 C;  2EPR A;  5CFF E;  3IWB A;  4R2Q A;  5IWA E;  1WJP A;  4OOG C;  2E5L E;  5A6B D;  2LTS A;  1HNW E;  4X66 E;  2EOZ A;  2LCE A;  4LF9 E;  2JY9 A;  5A6J A;  2NUF A;  1YYW A;  2EM2 A;  1EH6 A;  2VF1 A;  5KL6 A;  2H36 X;  1HR0 E;  5KL3 A;  1IBL E;  2YTN A;  1YZ9 A;  2RS6 A;  1RMD A;  2JOX A;  4X9J A;  1DQ3 A;  1N34 E;  2EMX A;  1WRJ A;  2EMI A;  4RHB B;  1A1K A; 
#chains in the Genus database with same CATH homology
 2ENH A;  4R2E A;  2YTP A;  2EL4 A;  2PRT A;  2EM8 A;  1A1J A;  2YTJ A;  2J7J A;  4F2J C;  2EOF A;  2YTO A;  2YSP A;  1JK2 A;  2LT7 A;  4R2A A;  2EOH A;  2EM5 A;  2EOS A;  3M99 B;  2EOX A;  2GHF A;  1ZU1 A;  2RSI A;  2VRD A;  2EOR A;  5KL2 A;  1G2F C;  1TN9 A;  2EM3 A;  2YTI A;  1JK1 A;  1ZAA C;  2EPU A;  2EN3 A;  2EE8 A;  2LV2 A;  2MKN A;  1UBD C;  2EQ1 A;  2WBS A;  2RPC A;  3EPK A;  2LO3 A;  3MHH C;  2A25 A;  2YTD A;  2EN2 A;  2EOI A;  2ELY A;  3MHS C;  4WSG A;  1YSA C;  1A1G A;  2NAB A;  1BB8 A;  1ZR9 A;  2EMH A;  1F2I G;  5KL4 A;  2DGC A;  1YUJ A;  4R2C A;  1KJK A;  2EJ4 A;  1BBO A;  2E72 A;  1TF6 A;  2EML A;  1A1H A;  3EPJ A;  2ADR A;  1A1K A;  1A1L A;  1TF3 A;  2EM9 A;  2WBT A;  2YTQ A;  4M9V C;  2EMG A;  1X6E A;  2EPA A;  2EN7 A;  3EPL A;  2JPA A;  2WBU A;  2YTF A;  2BB8 A;  2EP3 A;  2EM7 A;  4IS1 C;  4F6N A;  2EN1 A;  2YTE A;  4F6M A;  2CT1 A;  2EQ3 A;  5KL7 A;  2JP9 A;  2YTG A;  2YU8 A;  2EPP A;  2CSH A;  1Z1B A;  3VHT B;  1A1F A;  2YRH A;  2I13 A;  2HGH A;  2EOQ A;  1MEY C;  2YRK A;  2EMB A;  2EMZ A;  2EMK A;  2EPC A;  2GLI A;  3EPH A;  4R2R A;  1X3C A;  2YU5 A;  2WCC 3;  2YRM A;  2M9A A;  2R1F A;  2EPX A;  4R2P A;  2EQ0 A;  2MDG A;  2EM4 A;  1AAY A;  2DRP A;  2EN4 A;  1B69 A;  2EMC A;  4FK5 C;  2EOE A;  2EPR A;  4R2Q A;  2DLQ A;  1X5W A;  1WJP A;  1NCS A;  2YSO A;  2EMA A;  2EM0 A;  2EOO A;  2EOZ A;  3UK3 C;  2LCE A;  1G2D C;  4R2S A;  2EN6 A;  1P47 A;  2EPZ A;  1UN6 B;  2EMF A;  2EM2 A;  2EOM A;  2EL6 A;  4GZN C;  5KL6 A;  5KL3 A;  2YTN A;  2ENA A;  2DLK A;  1LLM C;  4R2D A;  1YUI A;  2EMW A;  1A1I A;  2EN8 A;  2LVH A;  2ENC A;  5KL5 A;  1RMD A;  4X9J A;  2MKD A;  1X6F A;  2D9H A;  2EM6 A;  2EMX A;  2ELZ A;  2CTD A;  2EL5 A;  2EOJ A;  2EMY A;  1DGC A;  2EMI A;  2DMI A;  4IJD A;  2EOY A;  1X6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...