2CSHA

Solution structure of tandem repeat of the zf-c2h2 domains of human zinc finger protein 297b
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
110
structure length
110
Chain Sequence
b'GSSGSSGDKLYPCQCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIHTGIKPYECNICAKRFMWRDSFHRHVTSCTKSYEAAKAEQNTTEASGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 297B
publication title Solution structure of tandem repeat of the zf-C2H2 domains of human zinc finger protein 297B
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 21
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2005-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2cshA01
1X6FA 2YTNA 1AAYA 1TF6A 2EM5A 1ZR9A 2EMXA 2ENHA 2M9AA 2YRKA 1A1LA 3MHSC 1UN6B 2EPZA 4FK5C 2MKDA 2YTFA 2EOXA 2E72A 2EQ3A 1X5WA 2EOOA 2LCEA 2CSHA 2JP9A 2EN2A 1ZU1A 2BB8A 1X6HA 2GHFA 2YU5A 2LV2A 2EL4A 4WSGA 2EM6A 2EPXA 2EOSA 1F2IG 2EM0A 2EQ1A 5KL3A 2ENAA 2HGHA 1A1FA 2DMIA 3EPKA 1TN9A 2EOYA 2A25A 1DGCA 2WBSA 5KL6A 2EL6A 2EMGA 2DLQA 2EOQA 1P47A 2EE8A 2EL5A 2EMZA 1JK1A 2RPCA 2YRHA 1BB8A 2YTGA 1G2DC 2EMHA 2ELYA 2EMAA 2EQ0A 2EN1A 4IS1C 5KL7A 2WBUA 1A1GA 4X9JA 2EN7A 4F6MA 2EORA 2D9HA 2EMYA 2EPAA 2LO3A 5KL2A 1RMDA 2EM8A 2ADRA 2EMLA 1TF3A 4R2CA 2EOZA 2EOMA 2WCC3 3M99B 2ENCA 4F6NA 2EPCA 2RSIA 1ZAAC 2EN4A 2DGCA 1KJKA 2YTJA 1YUJA 1BBOA 2EMIA 2NABA 2EMWA 2EM4A 2YTPA 2R1FA 4M9VC 2YTQA 2EM9A 1MEYC 2CTDA 3UK3C 2EM2A 2EN6A 2EOEA 2MDGA 1LLMC 1A1IA 3EPLA 2YTIA 2EOIA 4R2RA 2EM3A 2EMKA 2EPPA 2EM7A 4GZNC 1B69A 2DLKA 1JK2A 2J7JA 2EOFA 1X3CA 1X6EA 2EP3A 2LVHA 4IJDA 1G2FC 3VHTB 2EPRA 1UBDC 1YSAC 4R2DA 2PRTA 2GLIA 2YSPA 4R2SA 5KL4A 2MKNA 2EJ4A 2CT1A 2EMFA 2YTDA 2YTOA 4F2JC 2EOJA 1YUIA 2YTEA 1Z1BA 2EN3A 2EOHA 2EN8A 1WJPA 4R2AA 3EPHA 2EPUA 4R2EA 1A1KA 1A1JA 1A1HA 2DRPA 2YU8A 3MHHC 1NCSA 2EMBA 2VRDA 2I13A 2ELZA 5KL5A 2YRMA 2LT7A 2JPAA 4R2PA 2WBTA 4R2QA 2EMCA 3EPJA 2YSOA
chains in the Genus database with same CATH superfamily
2MDRA 2V89A 4F54A 5A69A 1AAYA 2EM5A 2UXBE 2ENHA 3BGHA 1IQSA 4BBYA 3H09A 4JV5E 2MKDA 2B3TB 3F6HA 2H36X 5AC4A 4HEIA 2YU5A 2LV2A 2EL4A 2G7HA 2LJUA 2EPXA 1EH7A 2EOSA 3HXLA 1ZBTA 2LBSB 4WXCA 2ENAA 5LL6R 1A1FA 4GKJE 4F9CB 1WHQA 4B3ME 2HC5A 4DR3E 1DGCA 4RH8A 1HNXE 2EE8A 2EL5A 1BB8A 2RPCA 2YTGA 2EMHA 1GZ6A 2E1MA 2EMAA 2JOBA 2E5LE 2EZ6A 5A6AA 3DF6A 2WBUA 4DUYE 5IXMB 1PJSA 4WYQB 2EN7A 4F6MA 2HHHE 4DR4E 1IQOA 4DV1E 2EPAA 1KYQA 4LFAE 4L5NC 2CPNA 2EM8A 4DV2E 2EMLA 3T1HE 1TF3A 2LE2A 2EOZA 3BBGA 2WCC3 3M99B 2EPCA 4P7DA 1ZAAC 2EN4A 2JYAA 4JI3E 2NABA 4DV6E 2UU9E 2EM4A 4JI8E 1XNQE 4DV7E 1PJQA 2HJJA 1HNZE 1MEYC 1O0WA 2MDGA 1A1IA 4O5GA 4F9AB 4X62E 4HTGA 2EM3A 2EMKA 2DLKA 4I8OA 3J81C 2EP3A 5CFFE 2LVHA 2ZM6E 3P1XA 4DR1E 5FLXC 2EJ4A 3JU0A 4MLVA 1NEIA 2UUAE 4BC9A 2YTEA 1Z1BA 1FKAE 2EOHA 4R2AA 4R2EA 1J26A 1A1JA 3MHHC 2EMBA 2K4VA 2VRDA 2I13A 4J8ZA 2JVAA 1EKZA 4R2PA 4R2QA 1IBME 2EPLX 2YTNA 4K0KE 4AQYE 1TF6A 4BC7A 3HQ1A 3THNA 2N8XA 3QG5C 4FK5C 4ZYEA 2L2NA 4LF9E 2EOXA 2E72A 1X49A 2EQ3A 1EH8A 2LCEA 1ZBQA 1T4OA 2EPKX 1N33E 4DV3E 2EWLA 1ZU1A 4BHBA 1N3GA 2BB8A 1SR9A 1X6HA 4OOGC 3KWRA 2V83A 4ZYDA 2DSYA 4TUIA 5IT9C 1QU6A 4KWYA 1RQ0A 5KL3A 2HGHA 2DMIA 1WHNA 3EPKA 2ODRC 3THOB 1TN9A 2FTXB 2RTXA 3ADGA 3HPSA 4X64E 4B3RE 3C6MA 2EMZA 5AASA 2EPNA 3AUZA 4F9BB 1G2DC 3IWDA 2L2KB 1N36E 2EQ0A 3KZYA 4P78A 2GPIA 3VYXA 2V86A 2UUBE 4X9JA 2V88A 2N3GA 2IHR1 4DR7E 4LU9A 5TSEA 2M7QA 1IBKE 2ADRA 5DNYA 4MLQA 2B7TA 2Q8UA 3ZOQB 5ADZA 2ENCA 2RSIA 3VK6A 1KJKA 3FIGA 4LF8E 2JY9A 4WPYA 1BBOA 2EMIA 3LLHA 4NHRA 2R1FA 2YZTA 3UK3C 4B3SE 1LLMC 3ADIA 5AE1A 4BMJA 2EOIA 4YHHE 2EPPA 3HPZA 2EPMX 2LJHA 2VQEE 4NZVA 2J7JA 1UHZA 1X3CA 2EOFA 1G2FC 4JI6E 1UILA 1GQEA 4WX9A 3VHTB 2EPRA 2FV4B 1T4NA 5LLQA 4R2SA 4M0VA 4LF6E 2MKNA 3C4BA 4JI0E 4JI2E 3K6QA 5AE2A 1YUIA 4N4RB 2EN3A 1WJPA 1YYWA 2EPUA 1A1HA 2DIXA 3JAMC 4O43A 5KL5A 4JI4E 4ZYGA 2L8TA 2M1SA 1YFHA 2EMCA 4DR6E 3IWCA 1GTKA 3OMLA 2VE7C 4JI1E 1X48A 1ZR9A 2EPOA 4OX9E 2YRKA 1A1LA 2JR1A 1UN6B 3HTXA 5AC5A 4RHBB 2F8BA 4DR5E 1STUA 1X5WA 3C6KA 2UXCE 3ECRA 2LUPB 4LF7E 2GHFA 2DB2A 1X47A 3LMLA 4LFBE 3BIDA 2RS7A 2EM0A 2KONA 3TQMA 2N3HA 4YY3E 3AV0A 2A25A 2EMGA 1HR0E 2RS6A 2EOQA 1P47A 4NXME 2YRHA 4X66E 2ELYA 2NA2A 3DJWA 5KL7A 2DMYA 3J80C 2LUQA 2EMYA 2YWQA 4LF5E 2LO3A 5KL2A 1RMDA 4GEQB 3OTOE 2LTSA 3J7Yp 2RQLA 2LMZA 2EOMA 4F6NA 2MC6A 2DGCA 1DI2A 4R8OA 4Q28A 2EMWA 2YTQA 2EM9A 1WXRA 2VQFE 2ODRD 4KZSA 2EN6A 5A6BA 3EPLA 4LTYA 1YYKA 1EH6A 4TUGA 2EM7A 4GZNC 5T6JA 1B69A 2NUGA 4IJDA 1X6EA 2I9IA 4DV4E 5IV8B 4DUZE 5A6KA 1YSAC 4R2DA 2PRTA 2YSPA 1XMOE 3ADJA 2CT1A 2K7IA 2YTDA 4LFCE 2YTOA 4BHCA 4ZYHA 4GKKE 3EQ1A 1BBGA 2DRPA 4M30A 2ELZA 2LT7A 2YRMA 4Q35B 1N34E 1N32E 1XMQE 3IWBA 3EPJA 2YSOA 3MSWA 1I94E 5AE3A 4BS9A 1X6FA 3BF2A 4BCAA 1T4LB 1MGTA 1WRJA 2EMXA 3F6GA 2M9AA 3MHSC 2EPZA 2YPNA 2V85A 2LTRA 2YTFA 4M2ZA 4WSPA 2EOOA 2UXDE 2CSHA 2YT4A 4DMIA 2JP9A 2EN2A 4X8WA 4O24A 1HNWE 1YPNA 1SFEA 4WSGA 4JI7E 4DR2E 1PDAA 2EM6A 3C4TA 1F2IG 2RSMA 2EQ1A 2KHXA 1PKPA 2EOYA 5A6BD 4DV5E 2WBSA 5KL6A 2EL6A 2DLQA 1JK1A 2MC5A 2NUEA 1YZ9A 2EN1A 4IS1C 2NUFA 5A6JA 4B3TE 1A1GA 2EORA 5LMUE 2D9HA 3KZZA 1PJTA 5IWAE 4WXDA 1RC7A 4R2CA 4X65E 2R76A 4DV0E 4DKKA 3ADLA 2B9DA 2L2MA 2L33A 2L6MA 1T39A 2YTJA 1YUJA 2F4VE 1AH5A 2YTPA 1IMUA 4JYAE 4M9VC 4O4KA 2FGGA 3T1YE 2B7VA 2CTDA 5F3WA 2EM2A 2EOEA 3JTZA 2L3JA 1FJGE 2JOXA 1J5EE 3VYYA 2L3CA 2YTIA 4R2RA 2JXPA 1DQ3A 1QNTA 5BR8E 1JK2A 3J7AG 4WFTA 4JI5E 1UBDC 4L8NA 1YYOA 2GLIA 2VF1A 5KL4A 2M4IA 1T38A 2EMFA 3L00A 1IBLE 2EOJA 2BBGA 3EPHA 2EN8A 4LF4E 1L4SA 2KOUA 4R03A 1A1KA 2L92A 2YU8A 1NCSA 4KHPE 2UUCE 2V87A 1XNRE 2JPAA 5LMNE 4NXNE 2V8QB 2JWOA 3RMPA 2WBTA 5A2QC 2LRSA 2WZOA 4F2JC
chains in the Genus database with same CATH topology
1X6FA 2YTNA 1AAYA 1TF6A 2EM5A 1ZR9A 2EMXA 2ENHA 2M9AA 2YRKA 1A1LA 3MHSC 1UN6B 2EPZA 4FK5C 2MKDA 2YTFA 2EOXA 2E72A 2EQ3A 1X5WA 2EOOA 2LCEA 2CSHA 2JP9A 2EN2A 1ZU1A 2BB8A 1X6HA 2GHFA 2YU5A 2LV2A 2EL4A 4WSGA 2EM6A 2EPXA 2EOSA 1F2IG 2EM0A 2EQ1A 5KL3A 2ENAA 2HGHA 1A1FA 2DMIA 3EPKA 1TN9A 2EOYA 2A25A 1DGCA 2WBSA 5KL6A 2EL6A 2EMGA 2DLQA 2EOQA 1P47A 2EE8A 2EL5A 2EMZA 1JK1A 2RPCA 2YRHA 1BB8A 2YTGA 1G2DC 2EMHA 2ELYA 2EMAA 2EQ0A 2EN1A 4IS1C 5KL7A 2WBUA 1A1GA 4X9JA 2EN7A 4F6MA 2EORA 2D9HA 2EMYA 2EPAA 2LO3A 5KL2A 1RMDA 2EM8A 2ADRA 2EMLA 1TF3A 4R2CA 2EOZA 2EOMA 2WCC3 3M99B 2ENCA 4F6NA 2EPCA 2RSIA 1ZAAC 2EN4A 2DGCA 1KJKA 2YTJA 1YUJA 1BBOA 2EMIA 2NABA 2EMWA 2EM4A 2YTPA 2R1FA 4M9VC 2YTQA 2EM9A 1MEYC 2CTDA 3UK3C 2EM2A 2EN6A 2EOEA 2MDGA 1LLMC 1A1IA 3EPLA 2YTIA 2EOIA 4R2RA 2EM3A 2EMKA 2EPPA 2EM7A 4GZNC 1B69A 2DLKA 1JK2A 2J7JA 2EOFA 1X3CA 1X6EA 2EP3A 2LVHA 4IJDA 1G2FC 3VHTB 2EPRA 1UBDC 1YSAC 4R2DA 2PRTA 2GLIA 2YSPA 4R2SA 5KL4A 2MKNA 2EJ4A 2CT1A 2EMFA 2YTDA 2YTOA 4F2JC 2EOJA 1YUIA 2YTEA 1Z1BA 2EN3A 2EOHA 2EN8A 1WJPA 4R2AA 3EPHA 2EPUA 4R2EA 1A1KA 1A1JA 1A1HA 2DRPA 2YU8A 3MHHC 1NCSA 2EMBA 2VRDA 2I13A 2ELZA 5KL5A 2YRMA 2LT7A 2JPAA 4R2PA 2WBTA 4R2QA 2EMCA 3EPJA 2YSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X6F A;  2YTN A;  1AAY A;  1TF6 A;  2EM5 A;  1ZR9 A;  2EMX A;  2ENH A;  2M9A A;  2YRK A;  1A1L A;  3MHS C;  1UN6 B;  2EPZ A;  4FK5 C;  2MKD A;  2YTF A;  2EOX A;  2E72 A;  2EQ3 A;  1X5W A;  2EOO A;  2LCE A;  2CSH A;  2JP9 A;  2EN2 A;  1ZU1 A;  2BB8 A;  1X6H A;  2GHF A;  2YU5 A;  2LV2 A;  2EL4 A;  4WSG A;  2EM6 A;  2EPX A;  2EOS A;  1F2I G;  2EM0 A;  2EQ1 A;  5KL3 A;  2ENA A;  2HGH A;  1A1F A;  2DMI A;  3EPK A;  1TN9 A;  2EOY A;  2A25 A;  1DGC A;  2WBS A;  5KL6 A;  2EL6 A;  2EMG A;  2DLQ A;  2EOQ A;  1P47 A;  2EE8 A;  2EL5 A;  2EMZ A;  1JK1 A;  2RPC A;  2YRH A;  1BB8 A;  2YTG A;  1G2D C;  2EMH A;  2ELY A;  2EMA A;  2EQ0 A;  2EN1 A;  4IS1 C;  5KL7 A;  2WBU A;  1A1G A;  4X9J A;  2EN7 A;  4F6M A;  2EOR A;  2D9H A;  2EMY A;  2EPA A;  2LO3 A;  5KL2 A;  1RMD A;  2EM8 A;  2ADR A;  2EML A;  1TF3 A;  4R2C A;  2EOZ A;  2EOM A;  2WCC 3;  3M99 B;  2ENC A;  4F6N A;  2EPC A;  2RSI A;  1ZAA C;  2EN4 A;  2DGC A;  1KJK A;  2YTJ A;  1YUJ A;  1BBO A;  2EMI A;  2NAB A;  2EMW A;  2EM4 A;  2YTP A;  2R1F A;  4M9V C;  2YTQ A;  2EM9 A;  1MEY C;  2CTD A;  3UK3 C;  2EM2 A;  2EN6 A;  2EOE A;  2MDG A;  1LLM C;  1A1I A;  3EPL A;  2YTI A;  2EOI A;  4R2R A;  2EM3 A;  2EMK A;  2EPP A;  2EM7 A;  4GZN C;  1B69 A;  2DLK A;  1JK2 A;  2J7J A;  2EOF A;  1X3C A;  1X6E A;  2EP3 A;  2LVH A;  4IJD A;  1G2F C;  3VHT B;  2EPR A;  1UBD C;  1YSA C;  4R2D A;  2PRT A;  2GLI A;  2YSP A;  4R2S A;  5KL4 A;  2MKN A;  2EJ4 A;  2CT1 A;  2EMF A;  2YTD A;  2YTO A;  4F2J C;  2EOJ A;  1YUI A;  2YTE A;  1Z1B A;  2EN3 A;  2EOH A;  2EN8 A;  1WJP A;  4R2A A;  3EPH A;  2EPU A;  4R2E A;  1A1K A;  1A1J A;  1A1H A;  2DRP A;  2YU8 A;  3MHH C;  1NCS A;  2EMB A;  2VRD A;  2I13 A;  2ELZ A;  5KL5 A;  2YRM A;  2LT7 A;  2JPA A;  4R2P A;  2WBT A;  4R2Q A;  2EMC A;  3EPJ A;  2YSO A; 
#chains in the Genus database with same CATH topology
 2MDR A;  2V89 A;  4F54 A;  5A69 A;  1AAY A;  2EM5 A;  2UXB E;  2ENH A;  3BGH A;  1IQS A;  4BBY A;  3H09 A;  4JV5 E;  2MKD A;  2B3T B;  3F6H A;  2H36 X;  5AC4 A;  4HEI A;  2YU5 A;  2LV2 A;  2EL4 A;  2G7H A;  2LJU A;  2EPX A;  1EH7 A;  2EOS A;  3HXL A;  1ZBT A;  2LBS B;  4WXC A;  2ENA A;  5LL6 R;  1A1F A;  4GKJ E;  4F9C B;  1WHQ A;  4B3M E;  2HC5 A;  4DR3 E;  1DGC A;  4RH8 A;  1HNX E;  2EE8 A;  2EL5 A;  1BB8 A;  2RPC A;  2YTG A;  2EMH A;  1GZ6 A;  2E1M A;  2EMA A;  2JOB A;  2E5L E;  2EZ6 A;  5A6A A;  3DF6 A;  2WBU A;  4DUY E;  5IXM B;  1PJS A;  4WYQ B;  2EN7 A;  4F6M A;  2HHH E;  4DR4 E;  1IQO A;  4DV1 E;  2EPA A;  1KYQ A;  4LFA E;  4L5N C;  2CPN A;  2EM8 A;  4DV2 E;  2EML A;  3T1H E;  1TF3 A;  2LE2 A;  2EOZ A;  3BBG A;  2WCC 3;  3M99 B;  2EPC A;  4P7D A;  1ZAA C;  2EN4 A;  2JYA A;  4JI3 E;  2NAB A;  4DV6 E;  2UU9 E;  2EM4 A;  4JI8 E;  1XNQ E;  4DV7 E;  1PJQ A;  2HJJ A;  1HNZ E;  1MEY C;  1O0W A;  2MDG A;  1A1I A;  4O5G A;  4F9A B;  4X62 E;  4HTG A;  2EM3 A;  2EMK A;  2DLK A;  4I8O A;  3J81 C;  2EP3 A;  5CFF E;  2LVH A;  2ZM6 E;  3P1X A;  4DR1 E;  5FLX C;  2EJ4 A;  3JU0 A;  4MLV A;  1NEI A;  2UUA E;  4BC9 A;  2YTE A;  1Z1B A;  1FKA E;  2EOH A;  4R2A A;  4R2E A;  1J26 A;  1A1J A;  3MHH C;  2EMB A;  2K4V A;  2VRD A;  2I13 A;  4J8Z A;  2JVA A;  1EKZ A;  4R2P A;  4R2Q A;  1IBM E;  2EPL X;  2YTN A;  4K0K E;  4AQY E;  1TF6 A;  4BC7 A;  3HQ1 A;  3THN A;  2N8X A;  3QG5 C;  4FK5 C;  4ZYE A;  2L2N A;  4LF9 E;  2EOX A;  2E72 A;  1X49 A;  2EQ3 A;  1EH8 A;  2LCE A;  1ZBQ A;  1T4O A;  2EPK X;  1N33 E;  4DV3 E;  2EWL A;  1ZU1 A;  4BHB A;  1N3G A;  2BB8 A;  1SR9 A;  1X6H A;  4OOG C;  3KWR A;  2V83 A;  4ZYD A;  2DSY A;  4TUI A;  5IT9 C;  1QU6 A;  4KWY A;  1RQ0 A;  5KL3 A;  2HGH A;  2DMI A;  1WHN A;  3EPK A;  2ODR C;  3THO B;  1TN9 A;  2FTX B;  2RTX A;  3ADG A;  3HPS A;  4X64 E;  4B3R E;  3C6M A;  2EMZ A;  5AAS A;  2EPN A;  3AUZ A;  4F9B B;  1G2D C;  3IWD A;  2L2K B;  1N36 E;  2EQ0 A;  3KZY A;  4P78 A;  2GPI A;  3VYX A;  2V86 A;  2UUB E;  4X9J A;  2V88 A;  2N3G A;  2IHR 1;  4DR7 E;  4LU9 A;  5TSE A;  2M7Q A;  1IBK E;  2ADR A;  5DNY A;  4MLQ A;  2B7T A;  2Q8U A;  3ZOQ B;  5ADZ A;  2ENC A;  2RSI A;  3VK6 A;  1KJK A;  3FIG A;  4LF8 E;  2JY9 A;  4WPY A;  1BBO A;  2EMI A;  3LLH A;  4NHR A;  2R1F A;  2YZT A;  3UK3 C;  4B3S E;  1LLM C;  3ADI A;  5AE1 A;  4BMJ A;  2EOI A;  4YHH E;  2EPP A;  3HPZ A;  2EPM X;  2LJH A;  2VQE E;  4NZV A;  2J7J A;  1UHZ A;  1X3C A;  2EOF A;  1G2F C;  4JI6 E;  1UIL A;  1GQE A;  4WX9 A;  3VHT B;  2EPR A;  2FV4 B;  1T4N A;  5LLQ A;  4R2S A;  4M0V A;  4LF6 E;  2MKN A;  3C4B A;  4JI0 E;  4JI2 E;  3K6Q A;  5AE2 A;  1YUI A;  4N4R B;  2EN3 A;  1WJP A;  1YYW A;  2EPU A;  1A1H A;  2DIX A;  3JAM C;  4O43 A;  5KL5 A;  4JI4 E;  4ZYG A;  2L8T A;  2M1S A;  1YFH A;  2EMC A;  4DR6 E;  3IWC A;  1GTK A;  3OML A;  2VE7 C;  4JI1 E;  1X48 A;  1ZR9 A;  2EPO A;  4OX9 E;  2YRK A;  1A1L A;  2JR1 A;  1UN6 B;  3HTX A;  5AC5 A;  4RHB B;  2F8B A;  4DR5 E;  1STU A;  1X5W A;  3C6K A;  2UXC E;  3ECR A;  2LUP B;  4LF7 E;  2GHF A;  2DB2 A;  1X47 A;  3LML A;  4LFB E;  3BID A;  2RS7 A;  2EM0 A;  2KON A;  3TQM A;  2N3H A;  4YY3 E;  3AV0 A;  2A25 A;  2EMG A;  1HR0 E;  2RS6 A;  2EOQ A;  1P47 A;  4NXM E;  2YRH A;  4X66 E;  2ELY A;  2NA2 A;  3DJW A;  5KL7 A;  2DMY A;  3J80 C;  2LUQ A;  2EMY A;  2YWQ A;  4LF5 E;  2LO3 A;  5KL2 A;  1RMD A;  4GEQ B;  3OTO E;  2LTS A;  3J7Y p;  2RQL A;  2LMZ A;  2EOM A;  4F6N A;  2MC6 A;  2DGC A;  1DI2 A;  4R8O A;  4Q28 A;  2EMW A;  2YTQ A;  2EM9 A;  1WXR A;  2VQF E;  2ODR D;  4KZS A;  2EN6 A;  5A6B A;  3EPL A;  4LTY A;  1YYK A;  1EH6 A;  4TUG A;  2EM7 A;  4GZN C;  5T6J A;  1B69 A;  2NUG A;  4IJD A;  1X6E A;  2I9I A;  4DV4 E;  5IV8 B;  4DUZ E;  5A6K A;  1YSA C;  4R2D A;  2PRT A;  2YSP A;  1XMO E;  3ADJ A;  2CT1 A;  2K7I A;  2YTD A;  4LFC E;  2YTO A;  4BHC A;  4ZYH A;  4GKK E;  3EQ1 A;  1BBG A;  2DRP A;  4M30 A;  2ELZ A;  2LT7 A;  2YRM A;  4Q35 B;  1N34 E;  1N32 E;  1XMQ E;  3IWB A;  3EPJ A;  2YSO A;  3MSW A;  1I94 E;  5AE3 A;  4BS9 A;  1X6F A;  3BF2 A;  4BCA A;  1T4L B;  1MGT A;  1WRJ A;  2EMX A;  3F6G A;  2M9A A;  3MHS C;  2EPZ A;  2YPN A;  2V85 A;  2LTR A;  2YTF A;  4M2Z A;  4WSP A;  2EOO A;  2UXD E;  2CSH A;  2YT4 A;  4DMI A;  2JP9 A;  2EN2 A;  4X8W A;  4O24 A;  1HNW E;  1YPN A;  1SFE A;  4WSG A;  4JI7 E;  4DR2 E;  1PDA A;  2EM6 A;  3C4T A;  1F2I G;  2RSM A;  2EQ1 A;  2KHX A;  1PKP A;  2EOY A;  5A6B D;  4DV5 E;  2WBS A;  5KL6 A;  2EL6 A;  2DLQ A;  1JK1 A;  2MC5 A;  2NUE A;  1YZ9 A;  2EN1 A;  4IS1 C;  2NUF A;  5A6J A;  4B3T E;  1A1G A;  2EOR A;  5LMU E;  2D9H A;  3KZZ A;  1PJT A;  5IWA E;  4WXD A;  1RC7 A;  4R2C A;  4X65 E;  2R76 A;  4DV0 E;  4DKK A;  3ADL A;  2B9D A;  2L2M A;  2L33 A;  2L6M A;  1T39 A;  2YTJ A;  1YUJ A;  2F4V E;  1AH5 A;  2YTP A;  1IMU A;  4JYA E;  4M9V C;  4O4K A;  2FGG A;  3T1Y E;  2B7V A;  2CTD A;  5F3W A;  2EM2 A;  2EOE A;  3JTZ A;  2L3J A;  1FJG E;  2JOX A;  1J5E E;  3VYY A;  2L3C A;  2YTI A;  4R2R A;  2JXP A;  1DQ3 A;  1QNT A;  5BR8 E;  1JK2 A;  3J7A G;  4WFT A;  4JI5 E;  1UBD C;  4L8N A;  1YYO A;  2GLI A;  2VF1 A;  5KL4 A;  2M4I A;  1T38 A;  2EMF A;  3L00 A;  1IBL E;  2EOJ A;  2BBG A;  3EPH A;  2EN8 A;  4LF4 E;  1L4S A;  2KOU A;  4R03 A;  1A1K A;  2L92 A;  2YU8 A;  1NCS A;  4KHP E;  2UUC E;  2V87 A;  1XNR E;  2JPA A;  5LMN E;  4NXN E;  2V8Q B;  2JWO A;  3RMP A;  2WBT A;  5A2Q C;  2LRS A;  2WZO A;  4F2J C; 
#chains in the Genus database with same CATH homology
 1X6F A;  2YTN A;  1AAY A;  1TF6 A;  2EM5 A;  1ZR9 A;  2EMX A;  2ENH A;  2M9A A;  2YRK A;  1A1L A;  3MHS C;  1UN6 B;  2EPZ A;  4FK5 C;  2MKD A;  2YTF A;  2EOX A;  2E72 A;  2EQ3 A;  1X5W A;  2EOO A;  2LCE A;  2CSH A;  2JP9 A;  2EN2 A;  1ZU1 A;  2BB8 A;  1X6H A;  2GHF A;  2YU5 A;  2LV2 A;  2EL4 A;  4WSG A;  2EM6 A;  2EPX A;  2EOS A;  1F2I G;  2EM0 A;  2EQ1 A;  5KL3 A;  2ENA A;  2HGH A;  1A1F A;  2DMI A;  3EPK A;  1TN9 A;  2EOY A;  2A25 A;  1DGC A;  2WBS A;  5KL6 A;  2EL6 A;  2EMG A;  2DLQ A;  2EOQ A;  1P47 A;  2EE8 A;  2EL5 A;  2EMZ A;  1JK1 A;  2RPC A;  2YRH A;  1BB8 A;  2YTG A;  1G2D C;  2EMH A;  2ELY A;  2EMA A;  2EQ0 A;  2EN1 A;  4IS1 C;  5KL7 A;  2WBU A;  1A1G A;  4X9J A;  2EN7 A;  4F6M A;  2EOR A;  2D9H A;  2EMY A;  2EPA A;  2LO3 A;  5KL2 A;  1RMD A;  2EM8 A;  2ADR A;  2EML A;  1TF3 A;  4R2C A;  2EOZ A;  2EOM A;  2WCC 3;  3M99 B;  2ENC A;  4F6N A;  2EPC A;  2RSI A;  1ZAA C;  2EN4 A;  2DGC A;  1KJK A;  2YTJ A;  1YUJ A;  1BBO A;  2EMI A;  2NAB A;  2EMW A;  2EM4 A;  2YTP A;  2R1F A;  4M9V C;  2YTQ A;  2EM9 A;  1MEY C;  2CTD A;  3UK3 C;  2EM2 A;  2EN6 A;  2EOE A;  2MDG A;  1LLM C;  1A1I A;  3EPL A;  2YTI A;  2EOI A;  4R2R A;  2EM3 A;  2EMK A;  2EPP A;  2EM7 A;  4GZN C;  1B69 A;  2DLK A;  1JK2 A;  2J7J A;  2EOF A;  1X3C A;  1X6E A;  2EP3 A;  2LVH A;  4IJD A;  1G2F C;  3VHT B;  2EPR A;  1UBD C;  1YSA C;  4R2D A;  2PRT A;  2GLI A;  2YSP A;  4R2S A;  5KL4 A;  2MKN A;  2EJ4 A;  2CT1 A;  2EMF A;  2YTD A;  2YTO A;  4F2J C;  2EOJ A;  1YUI A;  2YTE A;  1Z1B A;  2EN3 A;  2EOH A;  2EN8 A;  1WJP A;  4R2A A;  3EPH A;  2EPU A;  4R2E A;  1A1K A;  1A1J A;  1A1H A;  2DRP A;  2YU8 A;  3MHH C;  1NCS A;  2EMB A;  2VRD A;  2I13 A;  2ELZ A;  5KL5 A;  2YRM A;  2LT7 A;  2JPA A;  4R2P A;  2WBT A;  4R2Q A;  2EMC A;  3EPJ A;  2YSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...