2DGCA

Gcn4 basic domain, leucine zipper complexed with atf/creb site dna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
49
structure length
49
Chain Sequence
ALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*TP*GP*GP*AP*GP*AP*TP*GP*AP*CP*GP*TP*CP*AP*TP*CP*T
publication title Crystal structure of a bZIP/DNA complex at 2.2 A: determinants of DNA specific recognition.
pubmed doi rcsb
molecule tags Transcription/dna
total genus 23
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 1995-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dgcA00
1P47A 2EMXA 2EOYA 2YTPA 4R2CA 1A1JA 2EN8A 2DMIA 2YTOA 2R1FA 1A1HA 1ZU1A 2EOQA 4GZNC 2ELZA 2EPRA 2YU8A 2CTDA 3VHTB 3EPKA 1A1KA 2MKNA 2EMKA 2EMZA 2M9AA 2YTDA 4R2DA 5KL2A 2J7JA 2EOSA 5KL3A 2EOIA 5KL5A 5KL4A 2EM5A 4IS1C 2RSIA 2PRTA 1X3CA 2MKDA 2YSOA 3M99B 2YTFA 1TF6A 3EPHA 2YTIA 2WBUA 2EN7A 1A1GA 2EM0A 2YTNA 4R2SA 2MDGA 1JK2A 2ELYA 2EP3A 2JPAA 2EM7A 2YTEA 2EOEA 1UN6B 2EMBA 2NABA 2EJ4A 2EQ0A 2E72A 1WJPA 5KL6A 1YUJA 2YRHA 4R2RA 2EN6A 1RMDA 2YTQA 2GLIA 1ZR9A 2EOXA 1X6HA 2YRKA 1BBOA 2EOJA 2I13A 2ADRA 4WSGA 2ENHA 2LVHA 2EN1A 2ENAA 2ENCA 2WBTA 2A25A 4FK5C 2EPPA 4F6MA 2WBSA 2EOHA 1A1LA 1TF3A 2EOFA 2EOZA 2EM9A 2EE8A 2DLKA 2LO3A 2YTGA 2EORA 2JP9A 4R2QA 2EMWA 2EPXA 2YU5A 2EL6A 2YRMA 2EPUA 2GHFA 1B69A 5KL7A 1X6EA 2DLQA 2EL4A 1ZAAC 1A1IA 2HGHA 2D9HA 2EMCA 2EQ3A 2LT7A 2VRDA 1AAYA 2YTJA 2EN2A 4R2AA 1G2DC 2EMGA 2EOOA 1KJKA 2RPCA 2EQ1A 2CSHA 2EM8A 3MHHC 2EMIA 1F2IG 2WCC3 1A1FA 1MEYC 2EM2A 2EM3A 4M9VC 1BB8A 2EMFA 2EN3A 4IJDA 4F2JC 2LV2A 3MHSC 2EMLA 2EMYA 4X9JA 1LLMC 1DGCA 2DGCA 2EMAA 1X6FA 2LCEA 1G2FC 4R2EA 3EPLA 4F6NA 1JK1A 1TN9A 1Z1BA 2CT1A 2EM6A 2EM4A 1UBDC 3EPJA 2YSPA 1X5WA 2EPAA 4R2PA 2BB8A 3UK3C 2EL5A 1YUIA 2EPCA 2EOMA 2EMHA 2DRPA 1NCSA 1YSAC 2EN4A 2EPZA
chains in the Genus database with same CATH superfamily
1YZ9A 4WPYA 1KYQA 2UUCE 4WX9A 3HTXA 2FGGA 1XNRE 2YTOA 2Q8UA 2R1FA 3ADLA 5ADZA 2GPIA 1X49A 4B3RE 3THNA 2CTDA 3VHTB 2LE2A 4JI3E 1IMUA 1A1KA 3ADJA 3K6QA 2KOUA 2HJJA 4R03A 3C6MA 4WYQB 2EM5A 3JU0A 4GKJE 1TF6A 2MC6A 1N32E 2EM0A 1JK2A 2ELYA 2EP3A 2JPAA 1UN6B 2KHXA 2EQ0A 2E72A 4BHBA 5KL6A 3HPSA 2YRHA 2EN6A 1RMDA 2YTQA 2RTXA 3J7AG 1QNTA 1DI2A 2JOXA 2L2NA 1WRJA 2I13A 2B3TB 3IWCA 2ENHA 2JYAA 4RHBB 2L33A 4KHPE 3BGHA 4X64E 4N4RB 4JI6E 3L00A 2EM9A 2NUEA 1ZBQA 2YTGA 2LO3A 3BBGA 4OX9E 2JP9A 1EH8A 4JI8E 3IWBA 2E1MA 4ZYHA 2EPUA 2VQFE 4GEQB 2M1SA 3THOB 5IWAE 1ZAAC 5LL6R 5AE2A 1T4LB 3AUZA 2YTJA 4X8WA 2M4IA 1G2DC 2EOOA 2FV4B 4O24A 2EQ1A 4DUZE 2EMIA 1MEYC 4DR3E 2JY9A 4IJDA 2YZTA 2LBSB 2B9DA 3KWRA 4LFCE 5IXMB 2EMAA 2LCEA 1STUA 4MLVA 2CPNA 2MC5A 2CT1A 1GTKA 1XMQE 2BB8A 4O43A 1L4SA 2N3GA 2DRPA 4LFAE 1NCSA 2EN2A 2NA2A 4DR4E 4P7DA 2V86A 2YTPA 2DMIA 3HXLA 4TUIA 1ZBTA 3F6HA 1ZU1A 4LF6E 2EOQA 4JI7E 1O0WA 2LMZA 2V8QB 2ELZA 2L2MA 2YU8A 4AQYE 2MKNA 2EMKA 4DV5E 4R2DA 5KL2A 4DV2E 2I9IA 3C6KA 1HNZE 2EOSA 1EH7A 3ADIA 2EPLX 4KWYA 2RSIA 1X3CA 2MKDA 2JXPA 2B7VA 4WSPA 2LRSA 3M99B 2YTFA 4M0VA 1PKPA 2L92A 3C4TA 2K4VA 4R2SA 1N36E 2HC5A 2EM7A 4F54A 1SFEA 2EOEA 3FIGA 2NABA 4Q35B 1N34E 4HTGA 2RQLA 2V88A 2L3CA 4R2RA 5A6BA 2GLIA 2KONA 4B3ME 4BC7A 5BR8E 1X6HA 2VE7C 4KZSA 2EOJA 4WSGA 2EZ6A 2DSYA 2LVHA 2E5LE 2A25A 2RS6A 4M30A 4F6MA 1TF3A 4YY3E 4JI0E 5AC4A 2K7IA 2LUPB 4O4KA 4F9CB 2V89A 5LMUE 5LMNE 4DV7E 4R2QA 2EMWA 2LTSA 2EL6A 2LUQA 1WHQA 2GHFA 1IBME 3JAMC 1X6EA 2DLQA 4DUYE 1A1IA 2HGHA 2D9HA 2F8BA 2EQ3A 5AE3A 4HEIA 1DQ3A 3BF2A 2H36X 4R2AA 4JYAE 1KJKA 2RPCA 4K0KE 3ECRA 1A1FA 2L8TA 2EM2A 2EM3A 4M9VC 4F2JC 5A6JA 2LV2A 3RMPA 4X9JA 1SR9A 4J8ZA 1DGCA 4LF9E 2DGCA 1X6FA 1G2FC 1TN9A 3F6GA 1YFHA 1AH5A 1WHNA 4L5NC 2EM6A 2V87A 1IQOA 3ADGA 2UXCE 1X48A 1X5WA 2EPAA 1PDAA 2L3JA 3VYXA 2EL5A 1YPNA 2EOMA 3DF6A 5F3WA 1YUIA 4LF5E 2YT4A 4LF7E 2UXBE 1EH6A 3J80C 4OOGC 4M2ZA 3LMLA 1RQ0A 1P47A 2EOYA 1A1JA 2LTRA 1PJTA 2EN8A 2LJHA 4NZVA 4LU9A 4JI4E 1A1HA 1FJGE 2ODRC 2L2KB 4BHCA 5TSEA 5LLQA 3KZZA 3J7Yp 2DIXA 4O5GA 4DV1E 2R76A 1RC7A 4JI2E 4F9BB 1I94E 3HQ1A 2VQEE 2EMZA 2M9AA 2YTDA 3VYYA 2J7JA 4R8OA 2V85A 2EOIA 5KL4A 2UUBE 1N3GA 2PRTA 2B7TA 1IBKE 2RSMA 2YTIA 2WBUA 1YYOA 1N33E 1A1GA 1UILA 2YTNA 1WXRA 5T6JA 4ZYEA 1HR0E 4WXDA 2EJ4A 2JWOA 1WJPA 4MLQA 4ZYDA 1YUJA 4DR6E 2DMYA 2EOXA 4X66E 4GKKE 4WXCA 4NXME 2UUAE 4FK5C 2WZOA 1T4OA 3H09A 2N3HA 5IT9C 2EE8A 3JTZA 2MDRA 2EORA 1T38A 2YRMA 2YU5A 1HNWE 4NHRA 5KL7A 2EL4A 4WFTA 3TQMA 1PJSA 4JI1E 2LT7A 2VRDA 1AAYA 4LTYA 3C4BA 2M7QA 2EMGA 2YPNA 2CSHA 2EM8A 1F2IG 2EPMX 2EWLA 5FLXC 2WCC3 4X65E 4B3SE 2EMFA 5DNYA 1YYKA 2V83A 2EMYA 1LLMC 4BMJA 1J5EE 2N8XA 3EPLA 4F6NA 1GQEA 4YHHE 1EKZA 2EM4A 2HHHE 1IBLE 2VF1A 5IV8B 1XNQE 2EPCA 4JV5E 1GZ6A 2EMHA 3OTOE 1YSAC 2EN4A 1BB8A 2EPNA 2UXDE 2ODRD 2EMXA 4R2CA 4BCAA 1MGTA 2JVAA 3QG5C 3ZOQB 2EPKX 4F9AB 5A6AA 4BBYA 5AE1A 2EPRA 4GZNC 4BS9A 4LF8E 4DMIA 3EPKA 1PJQA 2DB2A 1J26A 4DR2E 4B3TE 4ZYGA 4NXNE 4DKKA 5KL3A 5KL5A 1T39A 3HPZA 4P78A 4IS1C 3KZYA 2YSOA 4Q28A 4DV0E 3EPHA 1XMOE 2EN7A 2F4VE 1FKAE 2JR1A 2MDGA 2YTEA 3P1XA 2EMBA 3T1HE 2L6MA 2RS7A 4DR1E 2UU9E 3T1YE 1ZR9A 5A6KA 4X62E 4DV6E 1BBOA 1X47A 2YRKA 2ADRA 4LFBE 2JOBA 1IQSA 2EN1A 2ENAA 2ENCA 2WBTA 3LLHA 5A2QC 2ZM6E 4DV3E 2NUGA 1A1LA 2EPPA 2WBSA 2EOHA 3MSWA 4JI5E 2EOFA 1NEIA 2EOZA 5AC5A 2G7HA 2DLKA 2BBGA 3OMLA 4RH8A 2LJUA 4DR7E 2EPXA 1B69A 2NUFA 3IWDA 3J81C 1YYWA 4BC9A 2EMCA 3BIDA 5A6BD 1UHZA 3MHHC 2YWQA 2EN3A 3MHSC 1T4NA 2EMLA 4TUGA 5AASA 1HNXE 3AV0A 2IHR1 1QU6A 4R2EA 4LF4E 1JK1A 1Z1BA 4I8OA 4L8NA 3EQ1A 1UBDC 4DV4E 3EPJA 2EPOA 5A69A 2YSPA 5CFFE 4DR5E 3DJWA 4R2PA 3UK3C 3VK6A 1BBGA 2FTXB 2EPZA
chains in the Genus database with same CATH topology
1P47A 2EMXA 2EOYA 2YTPA 4R2CA 1A1JA 2EN8A 2DMIA 2YTOA 2R1FA 1A1HA 1ZU1A 2EOQA 4GZNC 2ELZA 2EPRA 2YU8A 2CTDA 3VHTB 3EPKA 1A1KA 2MKNA 2EMKA 2EMZA 2M9AA 2YTDA 4R2DA 5KL2A 2J7JA 2EOSA 5KL3A 2EOIA 5KL5A 5KL4A 2EM5A 4IS1C 2RSIA 2PRTA 1X3CA 2MKDA 2YSOA 3M99B 2YTFA 1TF6A 3EPHA 2YTIA 2WBUA 2EN7A 1A1GA 2EM0A 2YTNA 4R2SA 2MDGA 1JK2A 2ELYA 2EP3A 2JPAA 2EM7A 2YTEA 2EOEA 1UN6B 2EMBA 2NABA 2EJ4A 2EQ0A 2E72A 1WJPA 5KL6A 1YUJA 2YRHA 4R2RA 2EN6A 1RMDA 2YTQA 2GLIA 1ZR9A 2EOXA 1X6HA 2YRKA 1BBOA 2EOJA 2I13A 2ADRA 4WSGA 2ENHA 2LVHA 2EN1A 2ENAA 2ENCA 2WBTA 2A25A 4FK5C 2EPPA 4F6MA 2WBSA 2EOHA 1A1LA 1TF3A 2EOFA 2EOZA 2EM9A 2EE8A 2DLKA 2LO3A 2YTGA 2EORA 2JP9A 4R2QA 2EMWA 2EPXA 2YU5A 2EL6A 2YRMA 2EPUA 2GHFA 1B69A 5KL7A 1X6EA 2DLQA 2EL4A 1ZAAC 1A1IA 2HGHA 2D9HA 2EMCA 2EQ3A 2LT7A 2VRDA 1AAYA 2YTJA 2EN2A 4R2AA 1G2DC 2EMGA 2EOOA 1KJKA 2RPCA 2EQ1A 2CSHA 2EM8A 3MHHC 2EMIA 1F2IG 2WCC3 1A1FA 1MEYC 2EM2A 2EM3A 4M9VC 1BB8A 2EMFA 2EN3A 4IJDA 4F2JC 2LV2A 3MHSC 2EMLA 2EMYA 4X9JA 1LLMC 1DGCA 2DGCA 2EMAA 1X6FA 2LCEA 1G2FC 4R2EA 3EPLA 4F6NA 1JK1A 1TN9A 1Z1BA 2CT1A 2EM6A 2EM4A 1UBDC 3EPJA 2YSPA 1X5WA 2EPAA 4R2PA 2BB8A 3UK3C 2EL5A 1YUIA 2EPCA 2EOMA 2EMHA 2DRPA 1NCSA 1YSAC 2EN4A 2EPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P47 A;  2EMX A;  2EOY A;  2YTP A;  4R2C A;  1A1J A;  2EN8 A;  2DMI A;  2YTO A;  2R1F A;  1A1H A;  1ZU1 A;  2EOQ A;  4GZN C;  2ELZ A;  2EPR A;  2YU8 A;  2CTD A;  3VHT B;  3EPK A;  1A1K A;  2MKN A;  2EMK A;  2EMZ A;  2M9A A;  2YTD A;  4R2D A;  5KL2 A;  2J7J A;  2EOS A;  5KL3 A;  2EOI A;  5KL5 A;  5KL4 A;  2EM5 A;  4IS1 C;  2RSI A;  2PRT A;  1X3C A;  2MKD A;  2YSO A;  3M99 B;  2YTF A;  1TF6 A;  3EPH A;  2YTI A;  2WBU A;  2EN7 A;  1A1G A;  2EM0 A;  2YTN A;  4R2S A;  2MDG A;  1JK2 A;  2ELY A;  2EP3 A;  2JPA A;  2EM7 A;  2YTE A;  2EOE A;  1UN6 B;  2EMB A;  2NAB A;  2EJ4 A;  2EQ0 A;  2E72 A;  1WJP A;  5KL6 A;  1YUJ A;  2YRH A;  4R2R A;  2EN6 A;  1RMD A;  2YTQ A;  2GLI A;  1ZR9 A;  2EOX A;  1X6H A;  2YRK A;  1BBO A;  2EOJ A;  2I13 A;  2ADR A;  4WSG A;  2ENH A;  2LVH A;  2EN1 A;  2ENA A;  2ENC A;  2WBT A;  2A25 A;  4FK5 C;  2EPP A;  4F6M A;  2WBS A;  2EOH A;  1A1L A;  1TF3 A;  2EOF A;  2EOZ A;  2EM9 A;  2EE8 A;  2DLK A;  2LO3 A;  2YTG A;  2EOR A;  2JP9 A;  4R2Q A;  2EMW A;  2EPX A;  2YU5 A;  2EL6 A;  2YRM A;  2EPU A;  2GHF A;  1B69 A;  5KL7 A;  1X6E A;  2DLQ A;  2EL4 A;  1ZAA C;  1A1I A;  2HGH A;  2D9H A;  2EMC A;  2EQ3 A;  2LT7 A;  2VRD A;  1AAY A;  2YTJ A;  2EN2 A;  4R2A A;  1G2D C;  2EMG A;  2EOO A;  1KJK A;  2RPC A;  2EQ1 A;  2CSH A;  2EM8 A;  3MHH C;  2EMI A;  1F2I G;  2WCC 3;  1A1F A;  1MEY C;  2EM2 A;  2EM3 A;  4M9V C;  1BB8 A;  2EMF A;  2EN3 A;  4IJD A;  4F2J C;  2LV2 A;  3MHS C;  2EML A;  2EMY A;  4X9J A;  1LLM C;  1DGC A;  2DGC A;  2EMA A;  1X6F A;  2LCE A;  1G2F C;  4R2E A;  3EPL A;  4F6N A;  1JK1 A;  1TN9 A;  1Z1B A;  2CT1 A;  2EM6 A;  2EM4 A;  1UBD C;  3EPJ A;  2YSP A;  1X5W A;  2EPA A;  4R2P A;  2BB8 A;  3UK3 C;  2EL5 A;  1YUI A;  2EPC A;  2EOM A;  2EMH A;  2DRP A;  1NCS A;  1YSA C;  2EN4 A;  2EPZ A; 
#chains in the Genus database with same CATH topology
 1YZ9 A;  4WPY A;  1KYQ A;  2UUC E;  4WX9 A;  3HTX A;  2FGG A;  1XNR E;  2YTO A;  2Q8U A;  2R1F A;  3ADL A;  5ADZ A;  2GPI A;  1X49 A;  4B3R E;  3THN A;  2CTD A;  3VHT B;  2LE2 A;  4JI3 E;  1IMU A;  1A1K A;  3ADJ A;  3K6Q A;  2KOU A;  2HJJ A;  4R03 A;  3C6M A;  4WYQ B;  2EM5 A;  3JU0 A;  4GKJ E;  1TF6 A;  2MC6 A;  1N32 E;  2EM0 A;  1JK2 A;  2ELY A;  2EP3 A;  2JPA A;  1UN6 B;  2KHX A;  2EQ0 A;  2E72 A;  4BHB A;  5KL6 A;  3HPS A;  2YRH A;  2EN6 A;  1RMD A;  2YTQ A;  2RTX A;  3J7A G;  1QNT A;  1DI2 A;  2JOX A;  2L2N A;  1WRJ A;  2I13 A;  2B3T B;  3IWC A;  2ENH A;  2JYA A;  4RHB B;  2L33 A;  4KHP E;  3BGH A;  4X64 E;  4N4R B;  4JI6 E;  3L00 A;  2EM9 A;  2NUE A;  1ZBQ A;  2YTG A;  2LO3 A;  3BBG A;  4OX9 E;  2JP9 A;  1EH8 A;  4JI8 E;  3IWB A;  2E1M A;  4ZYH A;  2EPU A;  2VQF E;  4GEQ B;  2M1S A;  3THO B;  5IWA E;  1ZAA C;  5LL6 R;  5AE2 A;  1T4L B;  3AUZ A;  2YTJ A;  4X8W A;  2M4I A;  1G2D C;  2EOO A;  2FV4 B;  4O24 A;  2EQ1 A;  4DUZ E;  2EMI A;  1MEY C;  4DR3 E;  2JY9 A;  4IJD A;  2YZT A;  2LBS B;  2B9D A;  3KWR A;  4LFC E;  5IXM B;  2EMA A;  2LCE A;  1STU A;  4MLV A;  2CPN A;  2MC5 A;  2CT1 A;  1GTK A;  1XMQ E;  2BB8 A;  4O43 A;  1L4S A;  2N3G A;  2DRP A;  4LFA E;  1NCS A;  2EN2 A;  2NA2 A;  4DR4 E;  4P7D A;  2V86 A;  2YTP A;  2DMI A;  3HXL A;  4TUI A;  1ZBT A;  3F6H A;  1ZU1 A;  4LF6 E;  2EOQ A;  4JI7 E;  1O0W A;  2LMZ A;  2V8Q B;  2ELZ A;  2L2M A;  2YU8 A;  4AQY E;  2MKN A;  2EMK A;  4DV5 E;  4R2D A;  5KL2 A;  4DV2 E;  2I9I A;  3C6K A;  1HNZ E;  2EOS A;  1EH7 A;  3ADI A;  2EPL X;  4KWY A;  2RSI A;  1X3C A;  2MKD A;  2JXP A;  2B7V A;  4WSP A;  2LRS A;  3M99 B;  2YTF A;  4M0V A;  1PKP A;  2L92 A;  3C4T A;  2K4V A;  4R2S A;  1N36 E;  2HC5 A;  2EM7 A;  4F54 A;  1SFE A;  2EOE A;  3FIG A;  2NAB A;  4Q35 B;  1N34 E;  4HTG A;  2RQL A;  2V88 A;  2L3C A;  4R2R A;  5A6B A;  2GLI A;  2KON A;  4B3M E;  4BC7 A;  5BR8 E;  1X6H A;  2VE7 C;  4KZS A;  2EOJ A;  4WSG A;  2EZ6 A;  2DSY A;  2LVH A;  2E5L E;  2A25 A;  2RS6 A;  4M30 A;  4F6M A;  1TF3 A;  4YY3 E;  4JI0 E;  5AC4 A;  2K7I A;  2LUP B;  4O4K A;  4F9C B;  2V89 A;  5LMU E;  5LMN E;  4DV7 E;  4R2Q A;  2EMW A;  2LTS A;  2EL6 A;  2LUQ A;  1WHQ A;  2GHF A;  1IBM E;  3JAM C;  1X6E A;  2DLQ A;  4DUY E;  1A1I A;  2HGH A;  2D9H A;  2F8B A;  2EQ3 A;  5AE3 A;  4HEI A;  1DQ3 A;  3BF2 A;  2H36 X;  4R2A A;  4JYA E;  1KJK A;  2RPC A;  4K0K E;  3ECR A;  1A1F A;  2L8T A;  2EM2 A;  2EM3 A;  4M9V C;  4F2J C;  5A6J A;  2LV2 A;  3RMP A;  4X9J A;  1SR9 A;  4J8Z A;  1DGC A;  4LF9 E;  2DGC A;  1X6F A;  1G2F C;  1TN9 A;  3F6G A;  1YFH A;  1AH5 A;  1WHN A;  4L5N C;  2EM6 A;  2V87 A;  1IQO A;  3ADG A;  2UXC E;  1X48 A;  1X5W A;  2EPA A;  1PDA A;  2L3J A;  3VYX A;  2EL5 A;  1YPN A;  2EOM A;  3DF6 A;  5F3W A;  1YUI A;  4LF5 E;  2YT4 A;  4LF7 E;  2UXB E;  1EH6 A;  3J80 C;  4OOG C;  4M2Z A;  3LML A;  1RQ0 A;  1P47 A;  2EOY A;  1A1J A;  2LTR A;  1PJT A;  2EN8 A;  2LJH A;  4NZV A;  4LU9 A;  4JI4 E;  1A1H A;  1FJG E;  2ODR C;  2L2K B;  4BHC A;  5TSE A;  5LLQ A;  3KZZ A;  3J7Y p;  2DIX A;  4O5G A;  4DV1 E;  2R76 A;  1RC7 A;  4JI2 E;  4F9B B;  1I94 E;  3HQ1 A;  2VQE E;  2EMZ A;  2M9A A;  2YTD A;  3VYY A;  2J7J A;  4R8O A;  2V85 A;  2EOI A;  5KL4 A;  2UUB E;  1N3G A;  2PRT A;  2B7T A;  1IBK E;  2RSM A;  2YTI A;  2WBU A;  1YYO A;  1N33 E;  1A1G A;  1UIL A;  2YTN A;  1WXR A;  5T6J A;  4ZYE A;  1HR0 E;  4WXD A;  2EJ4 A;  2JWO A;  1WJP A;  4MLQ A;  4ZYD A;  1YUJ A;  4DR6 E;  2DMY A;  2EOX A;  4X66 E;  4GKK E;  4WXC A;  4NXM E;  2UUA E;  4FK5 C;  2WZO A;  1T4O A;  3H09 A;  2N3H A;  5IT9 C;  2EE8 A;  3JTZ A;  2MDR A;  2EOR A;  1T38 A;  2YRM A;  2YU5 A;  1HNW E;  4NHR A;  5KL7 A;  2EL4 A;  4WFT A;  3TQM A;  1PJS A;  4JI1 E;  2LT7 A;  2VRD A;  1AAY A;  4LTY A;  3C4B A;  2M7Q A;  2EMG A;  2YPN A;  2CSH A;  2EM8 A;  1F2I G;  2EPM X;  2EWL A;  5FLX C;  2WCC 3;  4X65 E;  4B3S E;  2EMF A;  5DNY A;  1YYK A;  2V83 A;  2EMY A;  1LLM C;  4BMJ A;  1J5E E;  2N8X A;  3EPL A;  4F6N A;  1GQE A;  4YHH E;  1EKZ A;  2EM4 A;  2HHH E;  1IBL E;  2VF1 A;  5IV8 B;  1XNQ E;  2EPC A;  4JV5 E;  1GZ6 A;  2EMH A;  3OTO E;  1YSA C;  2EN4 A;  1BB8 A;  2EPN A;  2UXD E;  2ODR D;  2EMX A;  4R2C A;  4BCA A;  1MGT A;  2JVA A;  3QG5 C;  3ZOQ B;  2EPK X;  4F9A B;  5A6A A;  4BBY A;  5AE1 A;  2EPR A;  4GZN C;  4BS9 A;  4LF8 E;  4DMI A;  3EPK A;  1PJQ A;  2DB2 A;  1J26 A;  4DR2 E;  4B3T E;  4ZYG A;  4NXN E;  4DKK A;  5KL3 A;  5KL5 A;  1T39 A;  3HPZ A;  4P78 A;  4IS1 C;  3KZY A;  2YSO A;  4Q28 A;  4DV0 E;  3EPH A;  1XMO E;  2EN7 A;  2F4V E;  1FKA E;  2JR1 A;  2MDG A;  2YTE A;  3P1X A;  2EMB A;  3T1H E;  2L6M A;  2RS7 A;  4DR1 E;  2UU9 E;  3T1Y E;  1ZR9 A;  5A6K A;  4X62 E;  4DV6 E;  1BBO A;  1X47 A;  2YRK A;  2ADR A;  4LFB E;  2JOB A;  1IQS A;  2EN1 A;  2ENA A;  2ENC A;  2WBT A;  3LLH A;  5A2Q C;  2ZM6 E;  4DV3 E;  2NUG A;  1A1L A;  2EPP A;  2WBS A;  2EOH A;  3MSW A;  4JI5 E;  2EOF A;  1NEI A;  2EOZ A;  5AC5 A;  2G7H A;  2DLK A;  2BBG A;  3OML A;  4RH8 A;  2LJU A;  4DR7 E;  2EPX A;  1B69 A;  2NUF A;  3IWD A;  3J81 C;  1YYW A;  4BC9 A;  2EMC A;  3BID A;  5A6B D;  1UHZ A;  3MHH C;  2YWQ A;  2EN3 A;  3MHS C;  1T4N A;  2EML A;  4TUG A;  5AAS A;  1HNX E;  3AV0 A;  2IHR 1;  1QU6 A;  4R2E A;  4LF4 E;  1JK1 A;  1Z1B A;  4I8O A;  4L8N A;  3EQ1 A;  1UBD C;  4DV4 E;  3EPJ A;  2EPO A;  5A69 A;  2YSP A;  5CFF E;  4DR5 E;  3DJW A;  4R2P A;  3UK3 C;  3VK6 A;  1BBG A;  2FTX B;  2EPZ A; 
#chains in the Genus database with same CATH homology
 1P47 A;  2EMX A;  2EOY A;  2YTP A;  4R2C A;  1A1J A;  2EN8 A;  2DMI A;  2YTO A;  2R1F A;  1A1H A;  1ZU1 A;  2EOQ A;  4GZN C;  2ELZ A;  2EPR A;  2YU8 A;  2CTD A;  3VHT B;  3EPK A;  1A1K A;  2MKN A;  2EMK A;  2EMZ A;  2M9A A;  2YTD A;  4R2D A;  5KL2 A;  2J7J A;  2EOS A;  5KL3 A;  2EOI A;  5KL5 A;  5KL4 A;  2EM5 A;  4IS1 C;  2RSI A;  2PRT A;  1X3C A;  2MKD A;  2YSO A;  3M99 B;  2YTF A;  1TF6 A;  3EPH A;  2YTI A;  2WBU A;  2EN7 A;  1A1G A;  2EM0 A;  2YTN A;  4R2S A;  2MDG A;  1JK2 A;  2ELY A;  2EP3 A;  2JPA A;  2EM7 A;  2YTE A;  2EOE A;  1UN6 B;  2EMB A;  2NAB A;  2EJ4 A;  2EQ0 A;  2E72 A;  1WJP A;  5KL6 A;  1YUJ A;  2YRH A;  4R2R A;  2EN6 A;  1RMD A;  2YTQ A;  2GLI A;  1ZR9 A;  2EOX A;  1X6H A;  2YRK A;  1BBO A;  2EOJ A;  2I13 A;  2ADR A;  4WSG A;  2ENH A;  2LVH A;  2EN1 A;  2ENA A;  2ENC A;  2WBT A;  2A25 A;  4FK5 C;  2EPP A;  4F6M A;  2WBS A;  2EOH A;  1A1L A;  1TF3 A;  2EOF A;  2EOZ A;  2EM9 A;  2EE8 A;  2DLK A;  2LO3 A;  2YTG A;  2EOR A;  2JP9 A;  4R2Q A;  2EMW A;  2EPX A;  2YU5 A;  2EL6 A;  2YRM A;  2EPU A;  2GHF A;  1B69 A;  5KL7 A;  1X6E A;  2DLQ A;  2EL4 A;  1ZAA C;  1A1I A;  2HGH A;  2D9H A;  2EMC A;  2EQ3 A;  2LT7 A;  2VRD A;  1AAY A;  2YTJ A;  2EN2 A;  4R2A A;  1G2D C;  2EMG A;  2EOO A;  1KJK A;  2RPC A;  2EQ1 A;  2CSH A;  2EM8 A;  3MHH C;  2EMI A;  1F2I G;  2WCC 3;  1A1F A;  1MEY C;  2EM2 A;  2EM3 A;  4M9V C;  1BB8 A;  2EMF A;  2EN3 A;  4IJD A;  4F2J C;  2LV2 A;  3MHS C;  2EML A;  2EMY A;  4X9J A;  1LLM C;  1DGC A;  2DGC A;  2EMA A;  1X6F A;  2LCE A;  1G2F C;  4R2E A;  3EPL A;  4F6N A;  1JK1 A;  1TN9 A;  1Z1B A;  2CT1 A;  2EM6 A;  2EM4 A;  1UBD C;  3EPJ A;  2YSP A;  1X5W A;  2EPA A;  4R2P A;  2BB8 A;  3UK3 C;  2EL5 A;  1YUI A;  2EPC A;  2EOM A;  2EMH A;  2DRP A;  1NCS A;  1YSA C;  2EN4 A;  2EPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...