2DGCA

Gcn4 basic domain, leucine zipper complexed with atf/creb site dna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
49
structure length
49
Chain Sequence
ALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*GP*GP*AP*GP*AP*TP*GP*AP*CP*GP*TP*CP*AP*TP*CP*T
publication title Crystal structure of a bZIP/DNA complex at 2.2 A: determinants of DNA specific recognition.
pubmed doi rcsb
total genus 23
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 1995-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dgcA00
2LT7A 4F2JC 1TF6A 2I13A 3EPJA 2EM6A 2JPAA 2RPCA 2MKDA 2EMKA 1TN9A 2EM2A 1RMDA 4WSGA 5KL7A 2JP9A 2RSIA 1X6FA 4R2CA 2CSHA 2MDGA 2EOIA 2EMIA 4M9VC 4IJDA 2EOMA 2EMFA 2EM9A 2DLQA 1G2DC 3VHTB 1X5WA 2R1FA 2WCC3 2M9AA 2EN6A 2YTNA 2EMBA 2YTGA 2MKNA 2YTIA 2WBTA 2EOYA 2EMLA 2WBSA 2EOFA 1A1GA 2EN7A 5KL3A 2EQ3A 2EJ4A 2E72A 2EMGA 1A1FA 2EM5A 4F6MA 1YSAC 2CT1A 1F2IG 3EPHA 1JK2A 2HGHA 2EPCA 4F6NA 2EOJA 1MEYC 2EM7A 2J7JA 4GZNC 1NCSA 2ELZA 2NABA 2EOQA 3MHSC 1G2FC 1YUJA 2ENAA 2ENHA 2EM4A 2LO3A 5KL2A 2BB8A 2EL4A 2EL5A 1X6EA 2YTEA 1A1HA 2EOSA 2EN8A 2EL6A 2EMYA 2EPUA 1P47A 2EMAA 1BB8A 2DLKA 2EN4A 3M99B 2DRPA 5KL4A 4R2DA 1UBDC 2EM0A 2YTPA 3MHHC 1DGCA 4R2AA 4R2PA 2YU8A 2YTDA 2EP3A 2YSPA 2YTOA 2EPAA 2DGCA 2EOOA 2EQ1A 5KL5A 1A1JA 2GLIA 2ENCA 2VRDA 2YRMA 2EMHA 1ZU1A 2EM8A 2EMWA 2EM3A 3EPKA 4IS1C 2EPRA 2LV2A 2YU5A 4X9JA 4R2SA 2A25A 2EPZA 2EOXA 1X3CA 2YTJA 1JK1A 2EN1A 2EOZA 2YRKA 2D9HA 2EOHA 1A1KA 1B69A 2EPXA 1YUIA 2PRTA 2YTFA 2GHFA 2EPPA 2CTDA 2YRHA 2EMXA 4R2EA 2EQ0A 1AAYA 2EN3A 4R2RA 2LVHA 2DMIA 1TF3A 4R2QA 3UK3C 2EORA 2YTQA 1LLMC 1X6HA 2EE8A 2ADRA 2EN2A 2WBUA 2EMZA 2EMCA 1BBOA 1KJKA 2LCEA 1A1IA 1ZAAC 2ELYA 1UN6B 1WJPA 5KL6A 1Z1BA 1A1LA 3EPLA 4FK5C 2YSOA 1ZR9A 2EOEA
chains in the Genus database with same CATH superfamily
2NUEA 3DJWA 4F9BB 2I13A 2HJJA 4O4KA 1XNRE 4JI2E 2EM6A 2EMKA 2DMYA 2EM2A 4OOGC 5BR8E 4WSGA 1X6FA 4R2CA 4M9VC 2MDGA 2EMIA 1ZBTA 2EOMA 2N8XA 3IWCA 3VHTB 2Q8UA 2R1FA 5DNYA 4BMJA 1SFEA 4X62E 5A2QC 2WBSA 2EOFA 2VE7C 5A6BA 4DMIA 3OTOE 2EN7A 4F9CB 1A1FA 4LF7E 1F2IG 5A69A 4ZYGA 5IXMB 2EM7A 1MEYC 4GZNC 2L2NA 4M2ZA 4R8OA 3MHSC 3BGHA 2M7QA 1G2FC 1YUJA 4DV4E 4M0VA 2LO3A 2ODRC 2EL4A 1X6EA 2B7VA 2K7IA 1O0WA 3ADJA 1J26A 3OMLA 1HNWE 3KWRA 3JAMC 2EMYA 3P1XA 1BB8A 4B3SE 1EKZA 4LFAE 4R2DA 1UBDC 3MHHC 4JI6E 1DGCA 4R2AA 2F4VE 3THNA 4LF8E 2YSPA 2V8QB 4R03A 1HR0E 2EMHA 2EM8A 4WYQB 2EMWA 2EM3A 3C6MA 2M1SA 4Q28A 4R2SA 4O24A 5AE2A 1BBGA 4B3ME 3VYXA 1X47A 2KOUA 2EN1A 2EOHA 2L2KB 2PRTA 3C6KA 2CTDA 2EPKX 2RS6A 2V83A 2G7HA 2EMXA 4RH8A 3LMLA 2JOBA 4JI1E 3HPSA 1YZ9A 2ADRA 4WX9A 2FV4B 3AV0A 1BBOA 2LCEA 2EZ6A 1GZ6A 2E1MA 1ZAAC 1XNQE 5IV8B 3EPLA 3J80C 3K6QA 5AC4A 2LT7A 5ADZA 2L8TA 3QG5C 2DIXA 4TUGA 2BBGA 3EPJA 2JPAA 4MLVA 4DR7E 2MKDA 5A6JA 1RMDA 3BIDA 4B3RE 3HXLA 3VK6A 2CSHA 2LBSB 4IJDA 2L3JA 2EMFA 2ODRD 2DLQA 2EMBA 4DUZE 2MKNA 5A6KA 4MLQA 2B9DA 2M4IA 3T1HE 1A1GA 2EJ4A 2E72A 2EMGA 2EM5A 4F6MA 2H36X 2CT1A 2RSMA 4WXCA 1T39A 4LFBE 1YYWA 4F6NA 2LRSA 4J8ZA 4DR1E 2ELZA 2UXBE 2R76A 2UUBE 2EM4A 5KL2A 1PJSA 5TSEA 5F3WA 2NUGA 1X49A 4YHHE 5LMUE 4X64E 1P47A 2EMAA 5IT9C 1QU6A 4NXNE 4M30A 5AE1A 3M99B 4HEIA 2DRPA 1DQ3A 5KL4A 1IBME 2EM0A 4JI7E 4O43A 2L2MA 3THOB 1XMOE 4ZYDA 4GKKE 1EH7A 3HTXA 2DSYA 3IWBA 2JYAA 4NZVA 2YTDA 2YTOA 2DGCA 1GTKA 1N33E 2EQ1A 5KL5A 4Q35B 1A1JA 2ENCA 2VRDA 1PDAA 2L33A 4AQYE 4BHBA 4LF4E 3FIGA 2A25A 1N3GA 2V86A 2YTJA 2V87A 2MDRA 1IQOA 4JI3E 1ZBQA 1B69A 2EPXA 2EPNA 4DV0E 2YTFA 3C4BA 2EPPA 2YRHA 1HNZE 4I8OA 2GPIA 2LE2A 3UK3C 1X6HA 2EN2A 2WBUA 1KYQA 2EMCA 1KJKA 4F9AB 1A1IA 2ELYA 4ZYHA 2UXDE 2YSOA 5FLXC 5AE3A 2UUCE 1TF6A 1IBKE 3KZZA 2EPOA 1QNTA 1T38A 2RSIA 4NHRA 4N4RB 2RQLA 1PJTA 2EM9A 4JI0E 1X5WA 2WCC3 1IBLE 2EN6A 1NEIA 2YTNA 2RS7A 2YTIA 2WBTA 5AC5A 4JYAE 2EMLA 5LLQA 4OX9E 4KHPE 1I94E 2YT4A 5IWAE 3LLHA 3EPHA 1MGTA 2EOJA 1FKAE 4LF9E 4LFCE 1RQ0A 2NABA 1SR9A 3ADLA 2EOQA 4GEQB 2ENAA 2ZM6E 2BB8A 3BBGA 1IMUA 2EOSA 2VQEE 1HNXE 1YFHA 1AH5A 2EPUA 4WFTA 5A6AA 2K4VA 1IQSA 2B7TA 4LTYA 4HTGA 4BBYA 3JU0A 2LTSA 4JI5E 4WXDA 2YTPA 2YZTA 3H09A 4R2PA 4BCAA 1WHQA 4KZSA 4DR4E 2DB2A 3ADIA 2EP3A 3ZOQB 2EPAA 4DUYE 2EOOA 1UILA 1YYKA 4NXME 4DV5E 2GLIA 4K0KE 2KONA 1ZU1A 4IS1C 2EPRA 4DV3E 2YU5A 3TQMA 4X9JA 2EPZA 1X3CA 2EPMX 1YPNA 3T1YE 1JK1A 2B3TB 2FTXB 2D9HA 2YRKA 4TUIA 2KHXA 4BC9A 3F6GA 2WZOA 3BF2A 4DR6E 2LUPB 1AAYA 2EN3A 3RMPA 2DMIA 3ECRA 1TF3A 1L4SA 2CPNA 2EORA 2YTQA 1PJQA 4RHBB 1EH6A 5LL6R 1YYOA 2EMZA 4BS9A 1GQEA 3ADGA 3HQ1A 2VQFE 1N36E 4B3TE 5KL6A 1Z1BA 1EH8A 2YWQA 1ZR9A 3AUZA 2MC5A 2MC6A 4F2JC 2JR1A 2JWOA 2IHR1 1STUA 1WRJA 4KWYA 2RPCA 5AASA 2F8BA 3J7AG 1TN9A 4JI4E 4DV2E 4L8NA 2LUQA 5KL7A 2E5LE 2JP9A 1RC7A 2EOIA 4LF5E 4X8WA 1G2DC 2L6MA 2FGGA 2M9AA 5CFFE 4F54A 2JVAA 2YTGA 2EOYA 2YPNA 4DV7E 2L3CA 3MSWA 3JTZA 1WHNA 2EQ3A 5KL3A 2LTRA 1YSAC 2I9IA 2UU9E 2LJUA 1JK2A 5T6JA 2V88A 2HGHA 2EPCA 3DF6A 2NA2A 4GKJE 2J7JA 3VYYA 1NCSA 3F6HA 3EQ1A 2NUFA 3HPZA 2UUAE 1T4LB 2ENHA 4P7DA 2JOXA 4LF6E 5A6BD 2EL5A 2YTEA 1A1HA 3C4TA 2EN8A 2V89A 4O5GA 1FJGE 2EL6A 2L92A 2DLKA 4WPYA 4X65E 2EN4A 1J5EE 1DI2A 5LMNE 1XMQE 2VF1A 1UHZA 2UXCE 4DR3E 1N34E 2YU8A 3L00A 4LU9A 2HC5A 2YRMA 3EPKA 2V85A 2LV2A 4DKKA 4DR5E 2N3GA 2N3HA 1T4OA 4BHCA 4DV1E 2EOXA 4L5NC 4X66E 3J7Yp 2EPLX 3J81C 2EOZA 4P78A 1A1KA 1T4NA 1YUIA 2HHHE 4BC7A 2GHFA 4JV5E 4R2EA 2EQ0A 4R2RA 2JXPA 2LVHA 4R2QA 1LLMC 4DR2E 2EE8A 2LJHA 3KZYA 2RTXA 1WXRA 2JY9A 4JI8E 1N32E 3IWDA 1PKPA 4YY3E 2EWLA 1UN6B 4ZYEA 1WJPA 4DV6E 1A1LA 4FK5C 4WSPA 2EOEA 1X48A 2LMZA
chains in the Genus database with same CATH topology
2LT7A 4F2JC 1TF6A 2I13A 3EPJA 2EM6A 2JPAA 2RPCA 2MKDA 2EMKA 1TN9A 2EM2A 1RMDA 4WSGA 5KL7A 2JP9A 2RSIA 1X6FA 4R2CA 2CSHA 2MDGA 2EOIA 2EMIA 4M9VC 4IJDA 2EOMA 2EMFA 2EM9A 2DLQA 1G2DC 3VHTB 1X5WA 2R1FA 2WCC3 2M9AA 2EN6A 2YTNA 2EMBA 2YTGA 2MKNA 2YTIA 2WBTA 2EOYA 2EMLA 2WBSA 2EOFA 1A1GA 2EN7A 5KL3A 2EQ3A 2EJ4A 2E72A 2EMGA 1A1FA 2EM5A 4F6MA 1YSAC 2CT1A 1F2IG 3EPHA 1JK2A 2HGHA 2EPCA 4F6NA 2EOJA 1MEYC 2EM7A 2J7JA 4GZNC 1NCSA 2ELZA 2NABA 2EOQA 3MHSC 1G2FC 1YUJA 2ENAA 2ENHA 2EM4A 2LO3A 5KL2A 2BB8A 2EL4A 2EL5A 1X6EA 2YTEA 1A1HA 2EOSA 2EN8A 2EL6A 2EMYA 2EPUA 1P47A 2EMAA 1BB8A 2DLKA 2EN4A 3M99B 2DRPA 5KL4A 4R2DA 1UBDC 2EM0A 2YTPA 3MHHC 1DGCA 4R2AA 4R2PA 2YU8A 2YTDA 2EP3A 2YSPA 2YTOA 2EPAA 2DGCA 2EOOA 2EQ1A 5KL5A 1A1JA 2GLIA 2ENCA 2VRDA 2YRMA 2EMHA 1ZU1A 2EM8A 2EMWA 2EM3A 3EPKA 4IS1C 2EPRA 2LV2A 2YU5A 4X9JA 4R2SA 2A25A 2EPZA 2EOXA 1X3CA 2YTJA 1JK1A 2EN1A 2EOZA 2YRKA 2D9HA 2EOHA 1A1KA 1B69A 2EPXA 1YUIA 2PRTA 2YTFA 2GHFA 2EPPA 2CTDA 2YRHA 2EMXA 4R2EA 2EQ0A 1AAYA 2EN3A 4R2RA 2LVHA 2DMIA 1TF3A 4R2QA 3UK3C 2EORA 2YTQA 1LLMC 1X6HA 2EE8A 2ADRA 2EN2A 2WBUA 2EMZA 2EMCA 1BBOA 1KJKA 2LCEA 1A1IA 1ZAAC 2ELYA 1UN6B 1WJPA 5KL6A 1Z1BA 1A1LA 3EPLA 4FK5C 2YSOA 1ZR9A 2EOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LT7 A;  4F2J C;  1TF6 A;  2I13 A;  3EPJ A;  2EM6 A;  2JPA A;  2RPC A;  2MKD A;  2EMK A;  1TN9 A;  2EM2 A;  1RMD A;  4WSG A;  5KL7 A;  2JP9 A;  2RSI A;  1X6F A;  4R2C A;  2CSH A;  2MDG A;  2EOI A;  2EMI A;  4M9V C;  4IJD A;  2EOM A;  2EMF A;  2EM9 A;  2DLQ A;  1G2D C;  3VHT B;  1X5W A;  2R1F A;  2WCC 3;  2M9A A;  2EN6 A;  2YTN A;  2EMB A;  2YTG A;  2MKN A;  2YTI A;  2WBT A;  2EOY A;  2EML A;  2WBS A;  2EOF A;  1A1G A;  2EN7 A;  5KL3 A;  2EQ3 A;  2EJ4 A;  2E72 A;  2EMG A;  1A1F A;  2EM5 A;  4F6M A;  1YSA C;  2CT1 A;  1F2I G;  3EPH A;  1JK2 A;  2HGH A;  2EPC A;  4F6N A;  2EOJ A;  1MEY C;  2EM7 A;  2J7J A;  4GZN C;  1NCS A;  2ELZ A;  2NAB A;  2EOQ A;  3MHS C;  1G2F C;  1YUJ A;  2ENA A;  2ENH A;  2EM4 A;  2LO3 A;  5KL2 A;  2BB8 A;  2EL4 A;  2EL5 A;  1X6E A;  2YTE A;  1A1H A;  2EOS A;  2EN8 A;  2EL6 A;  2EMY A;  2EPU A;  1P47 A;  2EMA A;  1BB8 A;  2DLK A;  2EN4 A;  3M99 B;  2DRP A;  5KL4 A;  4R2D A;  1UBD C;  2EM0 A;  2YTP A;  3MHH C;  1DGC A;  4R2A A;  4R2P A;  2YU8 A;  2YTD A;  2EP3 A;  2YSP A;  2YTO A;  2EPA A;  2DGC A;  2EOO A;  2EQ1 A;  5KL5 A;  1A1J A;  2GLI A;  2ENC A;  2VRD A;  2YRM A;  2EMH A;  1ZU1 A;  2EM8 A;  2EMW A;  2EM3 A;  3EPK A;  4IS1 C;  2EPR A;  2LV2 A;  2YU5 A;  4X9J A;  4R2S A;  2A25 A;  2EPZ A;  2EOX A;  1X3C A;  2YTJ A;  1JK1 A;  2EN1 A;  2EOZ A;  2YRK A;  2D9H A;  2EOH A;  1A1K A;  1B69 A;  2EPX A;  1YUI A;  2PRT A;  2YTF A;  2GHF A;  2EPP A;  2CTD A;  2YRH A;  2EMX A;  4R2E A;  2EQ0 A;  1AAY A;  2EN3 A;  4R2R A;  2LVH A;  2DMI A;  1TF3 A;  4R2Q A;  3UK3 C;  2EOR A;  2YTQ A;  1LLM C;  1X6H A;  2EE8 A;  2ADR A;  2EN2 A;  2WBU A;  2EMZ A;  2EMC A;  1BBO A;  1KJK A;  2LCE A;  1A1I A;  1ZAA C;  2ELY A;  1UN6 B;  1WJP A;  5KL6 A;  1Z1B A;  1A1L A;  3EPL A;  4FK5 C;  2YSO A;  1ZR9 A;  2EOE A; 
#chains in the Genus database with same CATH topology
 2NUE A;  3DJW A;  4F9B B;  2I13 A;  2HJJ A;  4O4K A;  1XNR E;  4JI2 E;  2EM6 A;  2EMK A;  2DMY A;  2EM2 A;  4OOG C;  5BR8 E;  4WSG A;  1X6F A;  4R2C A;  4M9V C;  2MDG A;  2EMI A;  1ZBT A;  2EOM A;  2N8X A;  3IWC A;  3VHT B;  2Q8U A;  2R1F A;  5DNY A;  4BMJ A;  1SFE A;  4X62 E;  5A2Q C;  2WBS A;  2EOF A;  2VE7 C;  5A6B A;  4DMI A;  3OTO E;  2EN7 A;  4F9C B;  1A1F A;  4LF7 E;  1F2I G;  5A69 A;  4ZYG A;  5IXM B;  2EM7 A;  1MEY C;  4GZN C;  2L2N A;  4M2Z A;  4R8O A;  3MHS C;  3BGH A;  2M7Q A;  1G2F C;  1YUJ A;  4DV4 E;  4M0V A;  2LO3 A;  2ODR C;  2EL4 A;  1X6E A;  2B7V A;  2K7I A;  1O0W A;  3ADJ A;  1J26 A;  3OML A;  1HNW E;  3KWR A;  3JAM C;  2EMY A;  3P1X A;  1BB8 A;  4B3S E;  1EKZ A;  4LFA E;  4R2D A;  1UBD C;  3MHH C;  4JI6 E;  1DGC A;  4R2A A;  2F4V E;  3THN A;  4LF8 E;  2YSP A;  2V8Q B;  4R03 A;  1HR0 E;  2EMH A;  2EM8 A;  4WYQ B;  2EMW A;  2EM3 A;  3C6M A;  2M1S A;  4Q28 A;  4R2S A;  4O24 A;  5AE2 A;  1BBG A;  4B3M E;  3VYX A;  1X47 A;  2KOU A;  2EN1 A;  2EOH A;  2L2K B;  2PRT A;  3C6K A;  2CTD A;  2EPK X;  2RS6 A;  2V83 A;  2G7H A;  2EMX A;  4RH8 A;  3LML A;  2JOB A;  4JI1 E;  3HPS A;  1YZ9 A;  2ADR A;  4WX9 A;  2FV4 B;  3AV0 A;  1BBO A;  2LCE A;  2EZ6 A;  1GZ6 A;  2E1M A;  1ZAA C;  1XNQ E;  5IV8 B;  3EPL A;  3J80 C;  3K6Q A;  5AC4 A;  2LT7 A;  5ADZ A;  2L8T A;  3QG5 C;  2DIX A;  4TUG A;  2BBG A;  3EPJ A;  2JPA A;  4MLV A;  4DR7 E;  2MKD A;  5A6J A;  1RMD A;  3BID A;  4B3R E;  3HXL A;  3VK6 A;  2CSH A;  2LBS B;  4IJD A;  2L3J A;  2EMF A;  2ODR D;  2DLQ A;  2EMB A;  4DUZ E;  2MKN A;  5A6K A;  4MLQ A;  2B9D A;  2M4I A;  3T1H E;  1A1G A;  2EJ4 A;  2E72 A;  2EMG A;  2EM5 A;  4F6M A;  2H36 X;  2CT1 A;  2RSM A;  4WXC A;  1T39 A;  4LFB E;  1YYW A;  4F6N A;  2LRS A;  4J8Z A;  4DR1 E;  2ELZ A;  2UXB E;  2R76 A;  2UUB E;  2EM4 A;  5KL2 A;  1PJS A;  5TSE A;  5F3W A;  2NUG A;  1X49 A;  4YHH E;  5LMU E;  4X64 E;  1P47 A;  2EMA A;  5IT9 C;  1QU6 A;  4NXN E;  4M30 A;  5AE1 A;  3M99 B;  4HEI A;  2DRP A;  1DQ3 A;  5KL4 A;  1IBM E;  2EM0 A;  4JI7 E;  4O43 A;  2L2M A;  3THO B;  1XMO E;  4ZYD A;  4GKK E;  1EH7 A;  3HTX A;  2DSY A;  3IWB A;  2JYA A;  4NZV A;  2YTD A;  2YTO A;  2DGC A;  1GTK A;  1N33 E;  2EQ1 A;  5KL5 A;  4Q35 B;  1A1J A;  2ENC A;  2VRD A;  1PDA A;  2L33 A;  4AQY E;  4BHB A;  4LF4 E;  3FIG A;  2A25 A;  1N3G A;  2V86 A;  2YTJ A;  2V87 A;  2MDR A;  1IQO A;  4JI3 E;  1ZBQ A;  1B69 A;  2EPX A;  2EPN A;  4DV0 E;  2YTF A;  3C4B A;  2EPP A;  2YRH A;  1HNZ E;  4I8O A;  2GPI A;  2LE2 A;  3UK3 C;  1X6H A;  2EN2 A;  2WBU A;  1KYQ A;  2EMC A;  1KJK A;  4F9A B;  1A1I A;  2ELY A;  4ZYH A;  2UXD E;  2YSO A;  5FLX C;  5AE3 A;  2UUC E;  1TF6 A;  1IBK E;  3KZZ A;  2EPO A;  1QNT A;  1T38 A;  2RSI A;  4NHR A;  4N4R B;  2RQL A;  1PJT A;  2EM9 A;  4JI0 E;  1X5W A;  2WCC 3;  1IBL E;  2EN6 A;  1NEI A;  2YTN A;  2RS7 A;  2YTI A;  2WBT A;  5AC5 A;  4JYA E;  2EML A;  5LLQ A;  4OX9 E;  4KHP E;  1I94 E;  2YT4 A;  5IWA E;  3LLH A;  3EPH A;  1MGT A;  2EOJ A;  1FKA E;  4LF9 E;  4LFC E;  1RQ0 A;  2NAB A;  1SR9 A;  3ADL A;  2EOQ A;  4GEQ B;  2ENA A;  2ZM6 E;  2BB8 A;  3BBG A;  1IMU A;  2EOS A;  2VQE E;  1HNX E;  1YFH A;  1AH5 A;  2EPU A;  4WFT A;  5A6A A;  2K4V A;  1IQS A;  2B7T A;  4LTY A;  4HTG A;  4BBY A;  3JU0 A;  2LTS A;  4JI5 E;  4WXD A;  2YTP A;  2YZT A;  3H09 A;  4R2P A;  4BCA A;  1WHQ A;  4KZS A;  4DR4 E;  2DB2 A;  3ADI A;  2EP3 A;  3ZOQ B;  2EPA A;  4DUY E;  2EOO A;  1UIL A;  1YYK A;  4NXM E;  4DV5 E;  2GLI A;  4K0K E;  2KON A;  1ZU1 A;  4IS1 C;  2EPR A;  4DV3 E;  2YU5 A;  3TQM A;  4X9J A;  2EPZ A;  1X3C A;  2EPM X;  1YPN A;  3T1Y E;  1JK1 A;  2B3T B;  2FTX B;  2D9H A;  2YRK A;  4TUI A;  2KHX A;  4BC9 A;  3F6G A;  2WZO A;  3BF2 A;  4DR6 E;  2LUP B;  1AAY A;  2EN3 A;  3RMP A;  2DMI A;  3ECR A;  1TF3 A;  1L4S A;  2CPN A;  2EOR A;  2YTQ A;  1PJQ A;  4RHB B;  1EH6 A;  5LL6 R;  1YYO A;  2EMZ A;  4BS9 A;  1GQE A;  3ADG A;  3HQ1 A;  2VQF E;  1N36 E;  4B3T E;  5KL6 A;  1Z1B A;  1EH8 A;  2YWQ A;  1ZR9 A;  3AUZ A;  2MC5 A;  2MC6 A;  4F2J C;  2JR1 A;  2JWO A;  2IHR 1;  1STU A;  1WRJ A;  4KWY A;  2RPC A;  5AAS A;  2F8B A;  3J7A G;  1TN9 A;  4JI4 E;  4DV2 E;  4L8N A;  2LUQ A;  5KL7 A;  2E5L E;  2JP9 A;  1RC7 A;  2EOI A;  4LF5 E;  4X8W A;  1G2D C;  2L6M A;  2FGG A;  2M9A A;  5CFF E;  4F54 A;  2JVA A;  2YTG A;  2EOY A;  2YPN A;  4DV7 E;  2L3C A;  3MSW A;  3JTZ A;  1WHN A;  2EQ3 A;  5KL3 A;  2LTR A;  1YSA C;  2I9I A;  2UU9 E;  2LJU A;  1JK2 A;  5T6J A;  2V88 A;  2HGH A;  2EPC A;  3DF6 A;  2NA2 A;  4GKJ E;  2J7J A;  3VYY A;  1NCS A;  3F6H A;  3EQ1 A;  2NUF A;  3HPZ A;  2UUA E;  1T4L B;  2ENH A;  4P7D A;  2JOX A;  4LF6 E;  5A6B D;  2EL5 A;  2YTE A;  1A1H A;  3C4T A;  2EN8 A;  2V89 A;  4O5G A;  1FJG E;  2EL6 A;  2L92 A;  2DLK A;  4WPY A;  4X65 E;  2EN4 A;  1J5E E;  1DI2 A;  5LMN E;  1XMQ E;  2VF1 A;  1UHZ A;  2UXC E;  4DR3 E;  1N34 E;  2YU8 A;  3L00 A;  4LU9 A;  2HC5 A;  2YRM A;  3EPK A;  2V85 A;  2LV2 A;  4DKK A;  4DR5 E;  2N3G A;  2N3H A;  1T4O A;  4BHC A;  4DV1 E;  2EOX A;  4L5N C;  4X66 E;  3J7Y p;  2EPL X;  3J81 C;  2EOZ A;  4P78 A;  1A1K A;  1T4N A;  1YUI A;  2HHH E;  4BC7 A;  2GHF A;  4JV5 E;  4R2E A;  2EQ0 A;  4R2R A;  2JXP A;  2LVH A;  4R2Q A;  1LLM C;  4DR2 E;  2EE8 A;  2LJH A;  3KZY A;  2RTX A;  1WXR A;  2JY9 A;  4JI8 E;  1N32 E;  3IWD A;  1PKP A;  4YY3 E;  2EWL A;  1UN6 B;  4ZYE A;  1WJP A;  4DV6 E;  1A1L A;  4FK5 C;  4WSP A;  2EOE A;  1X48 A;  2LMZ A; 
#chains in the Genus database with same CATH homology
 2LT7 A;  4F2J C;  1TF6 A;  2I13 A;  3EPJ A;  2EM6 A;  2JPA A;  2RPC A;  2MKD A;  2EMK A;  1TN9 A;  2EM2 A;  1RMD A;  4WSG A;  5KL7 A;  2JP9 A;  2RSI A;  1X6F A;  4R2C A;  2CSH A;  2MDG A;  2EOI A;  2EMI A;  4M9V C;  4IJD A;  2EOM A;  2EMF A;  2EM9 A;  2DLQ A;  1G2D C;  3VHT B;  1X5W A;  2R1F A;  2WCC 3;  2M9A A;  2EN6 A;  2YTN A;  2EMB A;  2YTG A;  2MKN A;  2YTI A;  2WBT A;  2EOY A;  2EML A;  2WBS A;  2EOF A;  1A1G A;  2EN7 A;  5KL3 A;  2EQ3 A;  2EJ4 A;  2E72 A;  2EMG A;  1A1F A;  2EM5 A;  4F6M A;  1YSA C;  2CT1 A;  1F2I G;  3EPH A;  1JK2 A;  2HGH A;  2EPC A;  4F6N A;  2EOJ A;  1MEY C;  2EM7 A;  2J7J A;  4GZN C;  1NCS A;  2ELZ A;  2NAB A;  2EOQ A;  3MHS C;  1G2F C;  1YUJ A;  2ENA A;  2ENH A;  2EM4 A;  2LO3 A;  5KL2 A;  2BB8 A;  2EL4 A;  2EL5 A;  1X6E A;  2YTE A;  1A1H A;  2EOS A;  2EN8 A;  2EL6 A;  2EMY A;  2EPU A;  1P47 A;  2EMA A;  1BB8 A;  2DLK A;  2EN4 A;  3M99 B;  2DRP A;  5KL4 A;  4R2D A;  1UBD C;  2EM0 A;  2YTP A;  3MHH C;  1DGC A;  4R2A A;  4R2P A;  2YU8 A;  2YTD A;  2EP3 A;  2YSP A;  2YTO A;  2EPA A;  2DGC A;  2EOO A;  2EQ1 A;  5KL5 A;  1A1J A;  2GLI A;  2ENC A;  2VRD A;  2YRM A;  2EMH A;  1ZU1 A;  2EM8 A;  2EMW A;  2EM3 A;  3EPK A;  4IS1 C;  2EPR A;  2LV2 A;  2YU5 A;  4X9J A;  4R2S A;  2A25 A;  2EPZ A;  2EOX A;  1X3C A;  2YTJ A;  1JK1 A;  2EN1 A;  2EOZ A;  2YRK A;  2D9H A;  2EOH A;  1A1K A;  1B69 A;  2EPX A;  1YUI A;  2PRT A;  2YTF A;  2GHF A;  2EPP A;  2CTD A;  2YRH A;  2EMX A;  4R2E A;  2EQ0 A;  1AAY A;  2EN3 A;  4R2R A;  2LVH A;  2DMI A;  1TF3 A;  4R2Q A;  3UK3 C;  2EOR A;  2YTQ A;  1LLM C;  1X6H A;  2EE8 A;  2ADR A;  2EN2 A;  2WBU A;  2EMZ A;  2EMC A;  1BBO A;  1KJK A;  2LCE A;  1A1I A;  1ZAA C;  2ELY A;  1UN6 B;  1WJP A;  5KL6 A;  1Z1B A;  1A1L A;  3EPL A;  4FK5 C;  2YSO A;  1ZR9 A;  2EOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...