2DGCA

Gcn4 basic domain, leucine zipper complexed with atf/creb site dna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
49
structure length
49
Chain Sequence
ALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*TP*GP*GP*AP*GP*AP*TP*GP*AP*CP*GP*TP*CP*AP*TP*CP*T
publication title Crystal structure of a bZIP/DNA complex at 2.2 A: determinants of DNA specific recognition.
pubmed doi rcsb
molecule tags Transcription/dna
total genus 23
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 1995-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dgcA00
2EM3A 2LCEA 5KL5A 2YU5A 4WSGA 1BBOA 1X6HA 5KL4A 1A1JA 2EJ4A 1WJPA 2EMHA 2EOQA 2ELZA 2E72A 4IJDA 1MEYC 1TN9A 4R2SA 1TF3A 2ENAA 2YRHA 1UBDC 4F2JC 2EPZA 2EM6A 2EQ0A 2EL4A 2YTGA 2JPAA 2WCC3 2YSOA 2EL6A 3EPJA 3UK3C 2ENHA 4R2CA 2EOIA 1A1HA 2EMYA 1A1KA 2EOJA 2EM4A 2DGCA 2EM8A 2EOFA 1ZAAC 2EOSA 2EMZA 2YRMA 2MDGA 2EL5A 2EN4A 2EOHA 1ZU1A 2EPXA 2LVHA 4FK5C 1A1IA 2MKNA 4R2EA 2ELYA 2YTNA 2EORA 2GLIA 2EM9A 2EN2A 2EM5A 2I13A 2DLKA 2EPUA 1Z1BA 2EOXA 2DLQA 2YTOA 1A1GA 5KL7A 2EMBA 2HGHA 1JK1A 2EE8A 1RMDA 2ADRA 2YTIA 4R2QA 2EMFA 2EMGA 2WBUA 1X6EA 4F6MA 2EMXA 4M9VC 2EMKA 2YRKA 1X5WA 2PRTA 1DGCA 2EPRA 3VHTB 2YTFA 1LLMC 2YTQA 2A25A 2EQ1A 1P47A 1X3CA 2D9HA 2GHFA 2ENCA 3EPHA 2EOYA 2YTDA 2BB8A 2RSIA 1G2FC 2CSHA 1A1FA 1UN6B 2YU8A 2EOZA 2EMIA 2EOEA 2CTDA 4R2PA 4R2RA 5KL6A 2YTJA 2EMWA 2LV2A 2EMLA 2YSPA 4R2AA 1AAYA 1JK2A 5KL3A 2LT7A 2EPCA 1BB8A 2EN1A 5KL2A 2J7JA 3MHSC 2EN6A 1NCSA 1YUJA 4GZNC 1ZR9A 2EM0A 4X9JA 1F2IG 2YTPA 1B69A 1X6FA 2M9AA 1TF6A 2LO3A 2DMIA 1G2DC 2EM2A 2EPAA 2EQ3A 2R1FA 2JP9A 2EMAA 4R2DA 2MKDA 4IS1C 2EN3A 2WBSA 1YSAC 2YTEA 2EMCA 2CT1A 1YUIA 1A1LA 2NABA 3EPKA 3EPLA 2EM7A 3M99B 3MHHC 2EOMA 2EN7A 4F6NA 2DRPA 2WBTA 2EP3A 2RPCA 2VRDA 2EOOA 2EPPA 1KJKA 2EN8A
chains in the Genus database with same CATH superfamily
3F6HA 2MC6A 1X6HA 5KL4A 4DR3E 3DJWA 1N36E 3TQMA 1A1JA 4BBYA 1MEYC 1TN9A 4R2SA 3HPSA 3EQ1A 2ENAA 2DMYA 2WZOA 1UBDC 2LUQA 5LL6R 2EQ0A 2V83A 3EPJA 4GEQB 4R2CA 2EOIA 2HHHE 5AASA 5LMUE 2EM4A 2RSMA 5AE3A 2EOFA 1ZAAC 3JU0A 5T6JA 2EMZA 2RQLA 2UUCE 4OX9E 2EN4A 1A1IA 4DV5E 2MKNA 1IBME 2ELYA 5A6KA 2F4VE 2FTXB 1XNQE 4MLQA 5LLQA 2EPLX 5IXMB 1SR9A 2EWLA 4DKKA 4NHRA 4TUGA 4LF7E 3ADJA 1RMDA 2ADRA 4R2QA 4X64E 1IBLE 4BMJA 1X6EA 4F6MA 4BHCA 4RH8A 4F9CB 2M7QA 1X5WA 4X66E 1XMQE 2EQ1A 2MDRA 1P47A 3THNA 1GQEA 2UXCE 3H09A 3OMLA 3L00A 2GHFA 4R03A 4NXME 2ENCA 2NA2A 4O43A 2L8TA 2EOYA 3ZOQB 1G2FC 2BBGA 1A1FA 3BIDA 2YU8A 2EMIA 4R2RA 5KL6A 4AQYE 4OOGC 2L6MA 1QNTA 4WFTA 2V88A 2L3JA 1BB8A 4GKJE 4DV1E 3AV0A 4GZNC 2EM0A 2V8QB 1F2IG 2YTPA 4WX9A 3RMPA 1X48A 2M1SA 2L3CA 3HTXA 4ZYEA 2DMIA 4JI0E 2EM2A 2Q8UA 1SFEA 2JYAA 4DV4E 1YYOA 4R2DA 1BBGA 1N32E 4KWYA 2MKDA 2RS7A 1UHZA 2CT1A 4DV2E 1YUIA 3J81C 2B7VA 3EPKA 2EM7A 1YFHA 4RHBB 4DMIA 2JWOA 2RPCA 4F54A 5KL5A 2I9IA 1WJPA 1RQ0A 2E72A 1DQ3A 4IJDA 1TF3A 4JI7E 4F2JC 2EPZA 2L2MA 4KZSA 4JI3E 1NEIA 2UU9E 4NXNE 5ADZA 2JPAA 1STUA 1PJQA 2DB2A 1A1HA 2EMYA 1DI2A 2DGCA 1EH6A 4B3RE 4JI2E 2L2KB 4DV7E 2YRMA 4BHBA 2MDGA 2EL5A 5LMNE 1ZU1A 3C4TA 2FGGA 4LF6E 2GPIA 2EM9A 2GLIA 2EM5A 2EPUA 2EOXA 2E5LE 2VQEE 4DR2E 4B3TE 3ADLA 2EMBA 4O24A 4O4KA 1JK1A 3BGHA 4JI1E 2EMFA 2L33A 1IMUA 1XNRE 4M9VC 3IWCA 4M2ZA 2RS6A 1XMOE 4L5NC 4JI5E 1LLMC 4MLVA 2LJUA 2JVAA 2YTQA 1IQSA 4DR1E 3LLHA 4HEIA 2CPNA 4DV0E 3EPHA 2RSIA 1O0WA 3VK6A 2EOZA 2CTDA 3ADGA 4DV3E 2EMWA 2LV2A 2YSPA 2M4IA 2YPNA 2EPCA 4LTYA 5KL2A 2EN6A 2MC5A 1NCSA 4X9JA 1N34E 1B69A 3C6MA 2M9AA 3OTOE 4X62E 3VYXA 2LO3A 1T4OA 4YY3E 1IBKE 2EQ3A 1ZBQA 2R1FA 2JP9A 4X65E 4IS1C 2IHR1 2WBSA 2LRSA 1WHQA 2V87A 2YTEA 2EMCA 5DNYA 2KOUA 4P7DA 5TSEA 3MHHC 2K7IA 1MGTA 2UUBE 4N4RB 2YU5A 4WSGA 2LTRA 1BBOA 3DF6A 2EOQA 1EH8A 2ELZA 5A6BD 4ZYHA 4LF4E 2YRHA 5AC5A 3QG5C 2EM6A 3C6KA 3LMLA 2EL4A 2YSOA 2NUFA 3UK3C 2ENHA 1T38A 1HR0E 2VQFE 4M0VA 1A1KA 4JI6E 4JI4E 2EOJA 4YHHE 2RTXA 4BCAA 3C4BA 4NZVA 4WXCA 5A6JA 4LFBE 3J7AG 1WRJA 2ZM6E 4J8ZA 1UILA 2EPXA 3HXLA 4R2EA 3K6QA 2YTNA 2EORA 2JXPA 4B3SE 1QU6A 2ODRD 2B9DA 2I13A 1Z1BA 4DR4E 2DLQA 1A1GA 5KL7A 2JR1A 3VYYA 2LUPB 2HGHA 5IT9C 3JTZA 4F9BB 2UXDE 4DUZE 2E1MA 2YTIA 4DR5E 2N3GA 2WBUA 2EMXA 3F6GA 3IWDA 3BF2A 2EMKA 4JV5E 4M30A 2EPRA 4ZYDA 2LTSA 1HNZE 2V85A 1X3CA 1PJTA 2L2NA 1FKAE 4GKKE 2DIXA 2H36X 1EKZA 2CSHA 4R2PA 4LFCE 1JK2A 5KL3A 3MSWA 2UXBE 2EN1A 2EPKX 3THOB 3MHSC 4DR7E 1YUJA 5AC4A 1ZR9A 3J80C 2N3HA 1X6FA 2G7HA 1T4LB 2EPAA 1G2DC 2UUAE 1YZ9A 4BS9A 5IWAE 3BBGA 4P78A 1GZ6A 3HPZA 2EN3A 4DUYE 1YSAC 2LE2A 1I94E 4WPYA 5A69A 2VF1A 4L8NA 5CFFE 1X49A 2EPMX 1HNXE 5FLXC 1PJSA 1A1LA 2KONA 3T1HE 2YZTA 3M99B 5AE1A 2EN7A 2WBTA 2F8BA 2DSYA 2B7TA 4X8WA 2EOOA 1KJKA 2L92A 2EZ6A 2EN8A 2EM3A 2LCEA 4I8OA 1AH5A 2EJ4A 1J26A 2EMHA 3J7Yp 4LU9A 2ODRC 4O5GA 2B3TB 1KYQA 3KZZA 2JOBA 1IQOA 2YTGA 2WCC3 2EL6A 1L4SA 2EPNA 1PKPA 4BC7A 5F3WA 2EM8A 1J5EE 4JYAE 2EOSA 2KHXA 1WXRA 1YYKA 2EOHA 2LVHA 4FK5C 3P1XA 4WSPA 5BR8E 2HC5A 2EN2A 2DLKA 2EPOA 2FV4B 2YTOA 4LF5E 1EH7A 5A6BA 5IV8B 2EE8A 1ZBTA 4TUIA 2EMGA 1GTKA 2LBSB 4DV6E 4DR6E 4F9AB 2JOXA 2HJJA 2YRKA 3JAMC 5A2QC 2PRTA 1DGCA 2LMZA 4LF8E 4BC9A 1X47A 3VHTB 2YTFA 3FIGA 2A25A 2V86A 4KHPE 1N33E 2LJHA 1YPNA 2D9HA 5AE2A 4ZYGA 4LFAE 2JY9A 2YTDA 2BB8A 1UN6B 2EOEA 2NUGA 1N3GA 2YWQA 3ECRA 3T1YE 2NUEA 2YTJA 1HNWE 3KWRA 4R2AA 1PDAA 2EMLA 1AAYA 4R8OA 2R76A 4B3ME 2LT7A 4K0KE 3KZYA 4WXDA 3HQ1A 2J7JA 2K4VA 3AUZA 1TF6A 2V89A 4Q28A 2EMAA 2N8XA 2YT4A 1WHNA 4JI8E 4LF9E 2VE7C 3IWBA 4HTGA 4WYQB 2NABA 3ADIA 1YYWA 3EPLA 2EOMA 4F6NA 2DRPA 5A6AA 2EP3A 1T4NA 2VRDA 4Q35B 1RC7A 1FJGE 2EPPA 1T39A
chains in the Genus database with same CATH topology
2EM3A 2LCEA 5KL5A 2YU5A 4WSGA 1BBOA 1X6HA 5KL4A 1A1JA 2EJ4A 1WJPA 2EMHA 2EOQA 2ELZA 2E72A 4IJDA 1MEYC 1TN9A 4R2SA 1TF3A 2ENAA 2YRHA 1UBDC 4F2JC 2EPZA 2EM6A 2EQ0A 2EL4A 2YTGA 2JPAA 2WCC3 2YSOA 2EL6A 3EPJA 3UK3C 2ENHA 4R2CA 2EOIA 1A1HA 2EMYA 1A1KA 2EOJA 2EM4A 2DGCA 2EM8A 2EOFA 1ZAAC 2EOSA 2EMZA 2YRMA 2MDGA 2EL5A 2EN4A 2EOHA 1ZU1A 2EPXA 2LVHA 4FK5C 1A1IA 2MKNA 4R2EA 2ELYA 2YTNA 2EORA 2GLIA 2EM9A 2EN2A 2EM5A 2I13A 2DLKA 2EPUA 1Z1BA 2EOXA 2DLQA 2YTOA 1A1GA 5KL7A 2EMBA 2HGHA 1JK1A 2EE8A 1RMDA 2ADRA 2YTIA 4R2QA 2EMFA 2EMGA 2WBUA 1X6EA 4F6MA 2EMXA 4M9VC 2EMKA 2YRKA 1X5WA 2PRTA 1DGCA 2EPRA 3VHTB 2YTFA 1LLMC 2YTQA 2A25A 2EQ1A 1P47A 1X3CA 2D9HA 2GHFA 2ENCA 3EPHA 2EOYA 2YTDA 2BB8A 2RSIA 1G2FC 2CSHA 1A1FA 1UN6B 2YU8A 2EOZA 2EMIA 2EOEA 2CTDA 4R2PA 4R2RA 5KL6A 2YTJA 2EMWA 2LV2A 2EMLA 2YSPA 4R2AA 1AAYA 1JK2A 5KL3A 2LT7A 2EPCA 1BB8A 2EN1A 5KL2A 2J7JA 3MHSC 2EN6A 1NCSA 1YUJA 4GZNC 1ZR9A 2EM0A 4X9JA 1F2IG 2YTPA 1B69A 1X6FA 2M9AA 1TF6A 2LO3A 2DMIA 1G2DC 2EM2A 2EPAA 2EQ3A 2R1FA 2JP9A 2EMAA 4R2DA 2MKDA 4IS1C 2EN3A 2WBSA 1YSAC 2YTEA 2EMCA 2CT1A 1YUIA 1A1LA 2NABA 3EPKA 3EPLA 2EM7A 3M99B 3MHHC 2EOMA 2EN7A 4F6NA 2DRPA 2WBTA 2EP3A 2RPCA 2VRDA 2EOOA 2EPPA 1KJKA 2EN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EM3 A;  2LCE A;  5KL5 A;  2YU5 A;  4WSG A;  1BBO A;  1X6H A;  5KL4 A;  1A1J A;  2EJ4 A;  1WJP A;  2EMH A;  2EOQ A;  2ELZ A;  2E72 A;  4IJD A;  1MEY C;  1TN9 A;  4R2S A;  1TF3 A;  2ENA A;  2YRH A;  1UBD C;  4F2J C;  2EPZ A;  2EM6 A;  2EQ0 A;  2EL4 A;  2YTG A;  2JPA A;  2WCC 3;  2YSO A;  2EL6 A;  3EPJ A;  3UK3 C;  2ENH A;  4R2C A;  2EOI A;  1A1H A;  2EMY A;  1A1K A;  2EOJ A;  2EM4 A;  2DGC A;  2EM8 A;  2EOF A;  1ZAA C;  2EOS A;  2EMZ A;  2YRM A;  2MDG A;  2EL5 A;  2EN4 A;  2EOH A;  1ZU1 A;  2EPX A;  2LVH A;  4FK5 C;  1A1I A;  2MKN A;  4R2E A;  2ELY A;  2YTN A;  2EOR A;  2GLI A;  2EM9 A;  2EN2 A;  2EM5 A;  2I13 A;  2DLK A;  2EPU A;  1Z1B A;  2EOX A;  2DLQ A;  2YTO A;  1A1G A;  5KL7 A;  2EMB A;  2HGH A;  1JK1 A;  2EE8 A;  1RMD A;  2ADR A;  2YTI A;  4R2Q A;  2EMF A;  2EMG A;  2WBU A;  1X6E A;  4F6M A;  2EMX A;  4M9V C;  2EMK A;  2YRK A;  1X5W A;  2PRT A;  1DGC A;  2EPR A;  3VHT B;  2YTF A;  1LLM C;  2YTQ A;  2A25 A;  2EQ1 A;  1P47 A;  1X3C A;  2D9H A;  2GHF A;  2ENC A;  3EPH A;  2EOY A;  2YTD A;  2BB8 A;  2RSI A;  1G2F C;  2CSH A;  1A1F A;  1UN6 B;  2YU8 A;  2EOZ A;  2EMI A;  2EOE A;  2CTD A;  4R2P A;  4R2R A;  5KL6 A;  2YTJ A;  2EMW A;  2LV2 A;  2EML A;  2YSP A;  4R2A A;  1AAY A;  1JK2 A;  5KL3 A;  2LT7 A;  2EPC A;  1BB8 A;  2EN1 A;  5KL2 A;  2J7J A;  3MHS C;  2EN6 A;  1NCS A;  1YUJ A;  4GZN C;  1ZR9 A;  2EM0 A;  4X9J A;  1F2I G;  2YTP A;  1B69 A;  1X6F A;  2M9A A;  1TF6 A;  2LO3 A;  2DMI A;  1G2D C;  2EM2 A;  2EPA A;  2EQ3 A;  2R1F A;  2JP9 A;  2EMA A;  4R2D A;  2MKD A;  4IS1 C;  2EN3 A;  2WBS A;  1YSA C;  2YTE A;  2EMC A;  2CT1 A;  1YUI A;  1A1L A;  2NAB A;  3EPK A;  3EPL A;  2EM7 A;  3M99 B;  3MHH C;  2EOM A;  2EN7 A;  4F6N A;  2DRP A;  2WBT A;  2EP3 A;  2RPC A;  2VRD A;  2EOO A;  2EPP A;  1KJK A;  2EN8 A; 
#chains in the Genus database with same CATH topology
 3F6H A;  2MC6 A;  1X6H A;  5KL4 A;  4DR3 E;  3DJW A;  1N36 E;  3TQM A;  1A1J A;  4BBY A;  1MEY C;  1TN9 A;  4R2S A;  3HPS A;  3EQ1 A;  2ENA A;  2DMY A;  2WZO A;  1UBD C;  2LUQ A;  5LL6 R;  2EQ0 A;  2V83 A;  3EPJ A;  4GEQ B;  4R2C A;  2EOI A;  2HHH E;  5AAS A;  5LMU E;  2EM4 A;  2RSM A;  5AE3 A;  2EOF A;  1ZAA C;  3JU0 A;  5T6J A;  2EMZ A;  2RQL A;  2UUC E;  4OX9 E;  2EN4 A;  1A1I A;  4DV5 E;  2MKN A;  1IBM E;  2ELY A;  5A6K A;  2F4V E;  2FTX B;  1XNQ E;  4MLQ A;  5LLQ A;  2EPL X;  5IXM B;  1SR9 A;  2EWL A;  4DKK A;  4NHR A;  4TUG A;  4LF7 E;  3ADJ A;  1RMD A;  2ADR A;  4R2Q A;  4X64 E;  1IBL E;  4BMJ A;  1X6E A;  4F6M A;  4BHC A;  4RH8 A;  4F9C B;  2M7Q A;  1X5W A;  4X66 E;  1XMQ E;  2EQ1 A;  2MDR A;  1P47 A;  3THN A;  1GQE A;  2UXC E;  3H09 A;  3OML A;  3L00 A;  2GHF A;  4R03 A;  4NXM E;  2ENC A;  2NA2 A;  4O43 A;  2L8T A;  2EOY A;  3ZOQ B;  1G2F C;  2BBG A;  1A1F A;  3BID A;  2YU8 A;  2EMI A;  4R2R A;  5KL6 A;  4AQY E;  4OOG C;  2L6M A;  1QNT A;  4WFT A;  2V88 A;  2L3J A;  1BB8 A;  4GKJ E;  4DV1 E;  3AV0 A;  4GZN C;  2EM0 A;  2V8Q B;  1F2I G;  2YTP A;  4WX9 A;  3RMP A;  1X48 A;  2M1S A;  2L3C A;  3HTX A;  4ZYE A;  2DMI A;  4JI0 E;  2EM2 A;  2Q8U A;  1SFE A;  2JYA A;  4DV4 E;  1YYO A;  4R2D A;  1BBG A;  1N32 E;  4KWY A;  2MKD A;  2RS7 A;  1UHZ A;  2CT1 A;  4DV2 E;  1YUI A;  3J81 C;  2B7V A;  3EPK A;  2EM7 A;  1YFH A;  4RHB B;  4DMI A;  2JWO A;  2RPC A;  4F54 A;  5KL5 A;  2I9I A;  1WJP A;  1RQ0 A;  2E72 A;  1DQ3 A;  4IJD A;  1TF3 A;  4JI7 E;  4F2J C;  2EPZ A;  2L2M A;  4KZS A;  4JI3 E;  1NEI A;  2UU9 E;  4NXN E;  5ADZ A;  2JPA A;  1STU A;  1PJQ A;  2DB2 A;  1A1H A;  2EMY A;  1DI2 A;  2DGC A;  1EH6 A;  4B3R E;  4JI2 E;  2L2K B;  4DV7 E;  2YRM A;  4BHB A;  2MDG A;  2EL5 A;  5LMN E;  1ZU1 A;  3C4T A;  2FGG A;  4LF6 E;  2GPI A;  2EM9 A;  2GLI A;  2EM5 A;  2EPU A;  2EOX A;  2E5L E;  2VQE E;  4DR2 E;  4B3T E;  3ADL A;  2EMB A;  4O24 A;  4O4K A;  1JK1 A;  3BGH A;  4JI1 E;  2EMF A;  2L33 A;  1IMU A;  1XNR E;  4M9V C;  3IWC A;  4M2Z A;  2RS6 A;  1XMO E;  4L5N C;  4JI5 E;  1LLM C;  4MLV A;  2LJU A;  2JVA A;  2YTQ A;  1IQS A;  4DR1 E;  3LLH A;  4HEI A;  2CPN A;  4DV0 E;  3EPH A;  2RSI A;  1O0W A;  3VK6 A;  2EOZ A;  2CTD A;  3ADG A;  4DV3 E;  2EMW A;  2LV2 A;  2YSP A;  2M4I A;  2YPN A;  2EPC A;  4LTY A;  5KL2 A;  2EN6 A;  2MC5 A;  1NCS A;  4X9J A;  1N34 E;  1B69 A;  3C6M A;  2M9A A;  3OTO E;  4X62 E;  3VYX A;  2LO3 A;  1T4O A;  4YY3 E;  1IBK E;  2EQ3 A;  1ZBQ A;  2R1F A;  2JP9 A;  4X65 E;  4IS1 C;  2IHR 1;  2WBS A;  2LRS A;  1WHQ A;  2V87 A;  2YTE A;  2EMC A;  5DNY A;  2KOU A;  4P7D A;  5TSE A;  3MHH C;  2K7I A;  1MGT A;  2UUB E;  4N4R B;  2YU5 A;  4WSG A;  2LTR A;  1BBO A;  3DF6 A;  2EOQ A;  1EH8 A;  2ELZ A;  5A6B D;  4ZYH A;  4LF4 E;  2YRH A;  5AC5 A;  3QG5 C;  2EM6 A;  3C6K A;  3LML A;  2EL4 A;  2YSO A;  2NUF A;  3UK3 C;  2ENH A;  1T38 A;  1HR0 E;  2VQF E;  4M0V A;  1A1K A;  4JI6 E;  4JI4 E;  2EOJ A;  4YHH E;  2RTX A;  4BCA A;  3C4B A;  4NZV A;  4WXC A;  5A6J A;  4LFB E;  3J7A G;  1WRJ A;  2ZM6 E;  4J8Z A;  1UIL A;  2EPX A;  3HXL A;  4R2E A;  3K6Q A;  2YTN A;  2EOR A;  2JXP A;  4B3S E;  1QU6 A;  2ODR D;  2B9D A;  2I13 A;  1Z1B A;  4DR4 E;  2DLQ A;  1A1G A;  5KL7 A;  2JR1 A;  3VYY A;  2LUP B;  2HGH A;  5IT9 C;  3JTZ A;  4F9B B;  2UXD E;  4DUZ E;  2E1M A;  2YTI A;  4DR5 E;  2N3G A;  2WBU A;  2EMX A;  3F6G A;  3IWD A;  3BF2 A;  2EMK A;  4JV5 E;  4M30 A;  2EPR A;  4ZYD A;  2LTS A;  1HNZ E;  2V85 A;  1X3C A;  1PJT A;  2L2N A;  1FKA E;  4GKK E;  2DIX A;  2H36 X;  1EKZ A;  2CSH A;  4R2P A;  4LFC E;  1JK2 A;  5KL3 A;  3MSW A;  2UXB E;  2EN1 A;  2EPK X;  3THO B;  3MHS C;  4DR7 E;  1YUJ A;  5AC4 A;  1ZR9 A;  3J80 C;  2N3H A;  1X6F A;  2G7H A;  1T4L B;  2EPA A;  1G2D C;  2UUA E;  1YZ9 A;  4BS9 A;  5IWA E;  3BBG A;  4P78 A;  1GZ6 A;  3HPZ A;  2EN3 A;  4DUY E;  1YSA C;  2LE2 A;  1I94 E;  4WPY A;  5A69 A;  2VF1 A;  4L8N A;  5CFF E;  1X49 A;  2EPM X;  1HNX E;  5FLX C;  1PJS A;  1A1L A;  2KON A;  3T1H E;  2YZT A;  3M99 B;  5AE1 A;  2EN7 A;  2WBT A;  2F8B A;  2DSY A;  2B7T A;  4X8W A;  2EOO A;  1KJK A;  2L92 A;  2EZ6 A;  2EN8 A;  2EM3 A;  2LCE A;  4I8O A;  1AH5 A;  2EJ4 A;  1J26 A;  2EMH A;  3J7Y p;  4LU9 A;  2ODR C;  4O5G A;  2B3T B;  1KYQ A;  3KZZ A;  2JOB A;  1IQO A;  2YTG A;  2WCC 3;  2EL6 A;  1L4S A;  2EPN A;  1PKP A;  4BC7 A;  5F3W A;  2EM8 A;  1J5E E;  4JYA E;  2EOS A;  2KHX A;  1WXR A;  1YYK A;  2EOH A;  2LVH A;  4FK5 C;  3P1X A;  4WSP A;  5BR8 E;  2HC5 A;  2EN2 A;  2DLK A;  2EPO A;  2FV4 B;  2YTO A;  4LF5 E;  1EH7 A;  5A6B A;  5IV8 B;  2EE8 A;  1ZBT A;  4TUI A;  2EMG A;  1GTK A;  2LBS B;  4DV6 E;  4DR6 E;  4F9A B;  2JOX A;  2HJJ A;  2YRK A;  3JAM C;  5A2Q C;  2PRT A;  1DGC A;  2LMZ A;  4LF8 E;  4BC9 A;  1X47 A;  3VHT B;  2YTF A;  3FIG A;  2A25 A;  2V86 A;  4KHP E;  1N33 E;  2LJH A;  1YPN A;  2D9H A;  5AE2 A;  4ZYG A;  4LFA E;  2JY9 A;  2YTD A;  2BB8 A;  1UN6 B;  2EOE A;  2NUG A;  1N3G A;  2YWQ A;  3ECR A;  3T1Y E;  2NUE A;  2YTJ A;  1HNW E;  3KWR A;  4R2A A;  1PDA A;  2EML A;  1AAY A;  4R8O A;  2R76 A;  4B3M E;  2LT7 A;  4K0K E;  3KZY A;  4WXD A;  3HQ1 A;  2J7J A;  2K4V A;  3AUZ A;  1TF6 A;  2V89 A;  4Q28 A;  2EMA A;  2N8X A;  2YT4 A;  1WHN A;  4JI8 E;  4LF9 E;  2VE7 C;  3IWB A;  4HTG A;  4WYQ B;  2NAB A;  3ADI A;  1YYW A;  3EPL A;  2EOM A;  4F6N A;  2DRP A;  5A6A A;  2EP3 A;  1T4N A;  2VRD A;  4Q35 B;  1RC7 A;  1FJG E;  2EPP A;  1T39 A; 
#chains in the Genus database with same CATH homology
 2EM3 A;  2LCE A;  5KL5 A;  2YU5 A;  4WSG A;  1BBO A;  1X6H A;  5KL4 A;  1A1J A;  2EJ4 A;  1WJP A;  2EMH A;  2EOQ A;  2ELZ A;  2E72 A;  4IJD A;  1MEY C;  1TN9 A;  4R2S A;  1TF3 A;  2ENA A;  2YRH A;  1UBD C;  4F2J C;  2EPZ A;  2EM6 A;  2EQ0 A;  2EL4 A;  2YTG A;  2JPA A;  2WCC 3;  2YSO A;  2EL6 A;  3EPJ A;  3UK3 C;  2ENH A;  4R2C A;  2EOI A;  1A1H A;  2EMY A;  1A1K A;  2EOJ A;  2EM4 A;  2DGC A;  2EM8 A;  2EOF A;  1ZAA C;  2EOS A;  2EMZ A;  2YRM A;  2MDG A;  2EL5 A;  2EN4 A;  2EOH A;  1ZU1 A;  2EPX A;  2LVH A;  4FK5 C;  1A1I A;  2MKN A;  4R2E A;  2ELY A;  2YTN A;  2EOR A;  2GLI A;  2EM9 A;  2EN2 A;  2EM5 A;  2I13 A;  2DLK A;  2EPU A;  1Z1B A;  2EOX A;  2DLQ A;  2YTO A;  1A1G A;  5KL7 A;  2EMB A;  2HGH A;  1JK1 A;  2EE8 A;  1RMD A;  2ADR A;  2YTI A;  4R2Q A;  2EMF A;  2EMG A;  2WBU A;  1X6E A;  4F6M A;  2EMX A;  4M9V C;  2EMK A;  2YRK A;  1X5W A;  2PRT A;  1DGC A;  2EPR A;  3VHT B;  2YTF A;  1LLM C;  2YTQ A;  2A25 A;  2EQ1 A;  1P47 A;  1X3C A;  2D9H A;  2GHF A;  2ENC A;  3EPH A;  2EOY A;  2YTD A;  2BB8 A;  2RSI A;  1G2F C;  2CSH A;  1A1F A;  1UN6 B;  2YU8 A;  2EOZ A;  2EMI A;  2EOE A;  2CTD A;  4R2P A;  4R2R A;  5KL6 A;  2YTJ A;  2EMW A;  2LV2 A;  2EML A;  2YSP A;  4R2A A;  1AAY A;  1JK2 A;  5KL3 A;  2LT7 A;  2EPC A;  1BB8 A;  2EN1 A;  5KL2 A;  2J7J A;  3MHS C;  2EN6 A;  1NCS A;  1YUJ A;  4GZN C;  1ZR9 A;  2EM0 A;  4X9J A;  1F2I G;  2YTP A;  1B69 A;  1X6F A;  2M9A A;  1TF6 A;  2LO3 A;  2DMI A;  1G2D C;  2EM2 A;  2EPA A;  2EQ3 A;  2R1F A;  2JP9 A;  2EMA A;  4R2D A;  2MKD A;  4IS1 C;  2EN3 A;  2WBS A;  1YSA C;  2YTE A;  2EMC A;  2CT1 A;  1YUI A;  1A1L A;  2NAB A;  3EPK A;  3EPL A;  2EM7 A;  3M99 B;  3MHH C;  2EOM A;  2EN7 A;  4F6N A;  2DRP A;  2WBT A;  2EP3 A;  2RPC A;  2VRD A;  2EOO A;  2EPP A;  1KJK A;  2EN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...