2DGCA

Gcn4 basic domain, leucine zipper complexed with atf/creb site dna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
49
structure length
49
Chain Sequence
b'ALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*TP*GP*GP*AP*GP*AP*TP*GP*AP*CP*GP*TP*CP*AP*TP*CP*T
publication title Crystal structure of a bZIP/DNA complex at 2.2 A: determinants of DNA specific recognition.
pubmed doi rcsb
molecule tags Transcription/dna
total genus 23
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 1995-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2dgcA00
2YTPA 2MKNA 4R2DA 2WCC3 1G2FC 5KL7A 1ZR9A 2EN8A 2EOSA 5KL2A 2A25A 1A1JA 1X3CA 2EOXA 2EMYA 2EPXA 1A1LA 2EM9A 2MKDA 1X6HA 1ZAAC 2R1FA 1BB8A 4IS1C 2LV2A 1G2DC 2EM2A 1A1KA 1X5WA 2EOMA 2YU8A 1A1HA 3MHHC 2PRTA 2ELYA 2EM0A 2EP3A 2EQ0A 1LLMC 4R2CA 1TN9A 2GHFA 2EPAA 2EL4A 4R2PA 1A1IA 1UBDC 3EPLA 2JP9A 2YTEA 1X6EA 2YTFA 2EPPA 1P47A 3UK3C 2YTQA 4F6NA 4M9VC 1Z1BA 2RSIA 2YTGA 1TF6A 2ENCA 2EJ4A 5KL3A 2EOOA 2MDGA 2EOZA 5KL5A 2EMFA 2YTJA 2CSHA 2RPCA 4GZNC 1MEYC 3EPJA 1DGCA 2EOIA 2ENAA 2LVHA 2EMIA 2YTOA 5KL6A 1JK2A 2EMAA 1YSAC 2EMLA 2EL6A 2YRMA 2E72A 4IJDA 2EPZA 2YTIA 4R2EA 2EN1A 1UN6B 2DRPA 1YUJA 1BBOA 4X9JA 2YSPA 1NCSA 2EM6A 5KL4A 1AAYA 2BB8A 4FK5C 2YU5A 2EMHA 2EN7A 2EM3A 1KJKA 4WSGA 2EM8A 2EOEA 2EPRA 2EMCA 2EOYA 2DLKA 2EOJA 2ENHA 2EPUA 2CTDA 2M9AA 1RMDA 4R2AA 2EMBA 1X6FA 3EPKA 2WBTA 2YRHA 2LT7A 2EORA 4F6MA 2EL5A 3VHTB 1A1FA 2JPAA 2EN6A 2ADRA 2ELZA 2DMIA 2NABA 2YSOA 2EQ3A 1F2IG 2J7JA 2GLIA 2EMZA 2HGHA 2EN4A 2EMGA 4R2RA 2VRDA 2WBUA 2EN2A 1ZU1A 2YRKA 2DLQA 2D9HA 2EE8A 2YTDA 2EMXA 2EQ1A 4R2QA 2YTNA 4F2JC 2EN3A 1B69A 1TF3A 2DGCA 2EM4A 1YUIA 2EPCA 2WBSA 2EOQA 2LCEA 2CT1A 2EM7A 3MHSC 2EMKA 2EMWA 2EOHA 2I13A 2EOFA 3EPHA 4R2SA 1JK1A 2EM5A 1A1GA 3M99B 1WJPA 2LO3A
chains in the Genus database with same CATH superfamily
1UILA 2JR1A 2NA2A 2DIXA 2MKNA 1STUA 1G2FC 5KL7A 5AE3A 1ZR9A 2H36X 1L4SA 3LMLA 5AC4A 1A1LA 3TQMA 2EM9A 1HNZE 1ZAAC 2R1FA 1SFEA 2LBSB 4DUYE 3ADJA 1G2DC 1EH7A 2LUQA 1GQEA 1HR0E 1RQ0A 1LLMC 2EM0A 2EQ0A 1TN9A 1IBLE 2EPAA 2DMYA 1A1IA 1UBDC 2JP9A 1X6EA 1WRJA 3BF2A 4WXCA 1P47A 4JI7E 4LF4E 2K7IA 1Z1BA 4P7DA 2LTRA 1PJSA 3F6GA 4DV3E 5KL3A 3ADIA 4KWYA 4JV5E 2MDGA 2M4IA 4MLVA 2CPNA 2L33A 4GZNC 2K4VA 2E1MA 1DGCA 2LVHA 2ENAA 5KL6A 1IMUA 2YTOA 2LUPB 2MC5A 2EMAA 2EMLA 2RSMA 2YRMA 4DR5E 4IJDA 3IWBA 4LFCE 1UN6B 1IBKE 1AAYA 2YU5A 2EM3A 2I9IA 4WSGA 3C4BA 1YYKA 2EPRA 2EMCA 2KONA 5F3WA 2DLKA 3KZZA 1X48A 2CTDA 1BBGA 5BR8E 4F9AB 3EPKA 2E5LE 2DB2A 4DV5E 4LTYA 2V89A 2M7QA 1FKAE 2YPNA 2J7JA 2LE2A 2HGHA 3KWRA 3JAMC 3IWCA 2B9DA 2EN2A 1ZU1A 5A69A 2YRKA 1WHNA 1B69A 2YZTA 2UUAE 4GEQB 4DV6E 1ZBTA 4DV4E 4LF6E 2CT1A 2EMKA 4WFTA 2EPLX 2JY9A 4MLQA 2EOFA 4DV1E 5AE1A 2BBGA 1T4LB 4P78A 4GKKE 4N4RB 3L00A 4LF9E 3C6MA 4GKJE 2B3TB 2R76A 2EN8A 3FIGA 4DR4E 1T4NA 2JYAA 1HNXE 1IQSA 5IXMB 3OTOE 3HXLA 4DV7E 1A1KA 3J80C 1KYQA 4BMJA 1A1HA 4F9CB 2UU9E 4R2CA 4KHPE 4O5GA 4R2PA 2YTEA 2YTFA 5IV8B 3F6HA 4JI3E 4HTGA 2RSIA 1N32E 2YTGA 4LU9A 4TUIA 1XNRE 2EJ4A 2LJHA 2EOOA 4WX9A 2L3JA 5IWAE 2IHR1 2CSHA 2YTJA 1WXRA 3QG5C 2M1SA 2EOIA 1JK2A 1QU6A 2WZOA 4JI0E 2EL6A 5LMUE 4B3SE 4M30A 3BBGA 4I8OA 2YTIA 4R2EA 2EN1A 1YUJA 4X9JA 2EM6A 5KL4A 2BB8A 4FK5C 4B3TE 2EN7A 2B7TA 3J7Yp 1KJKA 4LF8E 2F8BA 2ENHA 2EPUA 4JI8E 2L2KB 2ZM6E 3EQ1A 2JWOA 2YRHA 4RH8A 2EORA 4F6MA 3VYXA 3VHTB 2EWLA 1XNQE 2EN6A 2DMIA 3AUZA 5TSEA 5LMNE 2EMZA 5AE2A 4X64E 2EN4A 2EMGA 2VQEE 1SR9A 4X65E 1YZ9A 2EQ1A 4R2QA 2DGCA 3RMPA 2EM4A 5FLXC 1IQOA 1DI2A 2EPCA 2HHHE 3MSWA 3VYYA 5AASA 2LCEA 4BBYA 2EM7A 4WPYA 1I94E 2EOHA 3DF6A 2I13A 4LFAE 3K6QA 4R2SA 5LLQA 3ADLA 4X66E 2VE7C 4J8ZA 4ZYDA 2EPMX 2YTPA 2L2MA 4JI5E 2WCC3 2NUGA 5AC5A 4ZYEA 2EPNA 2EOSA 1A1JA 5IT9C 5CFFE 4M2ZA 5A6BA 2MKDA 1X6HA 2UUBE 1BB8A 4L8NA 4IS1C 2N3HA 2ODRD 4JI2E 1X5WA 2EOMA 2ODRC 2ELYA 2V87A 4OOGC 2JVAA 2MDRA 3LLHA 3THNA 2EZ6A 4KZSA 2UXDE 4JI4E 1N3GA 1T38A 1TF6A 5A6BD 4OX9E 4DR2E 2ENCA 4WYQB 1J26A 3HPZA 2V8QB 3ZOQB 4K0KE 2EMFA 4DR6E 2RPCA 1MEYC 4BC9A 2RTXA 1HNWE 3JTZA 3HTXA 1UHZA 1PKPA 3C6KA 4RHBB 3T1YE 1QNTA 3J81C 1X49A 2JOXA 2VF1A 4B3ME 3THOB 4LFBE 3DJWA 1GTKA 1XMOE 1BBOA 2YSPA 3AV0A 2LMZA 1NCSA 5A2QC 1YYWA 2EOEA 3JU0A 3BIDA 2EOYA 2EOJA 2KHXA 4R2AA 2EMBA 5A6AA 2YWQA 1N33E 2WBTA 2LT7A 4HEIA 4O4KA 4DR7E 4ZYGA 2EL5A 4DUZE 1A1FA 2JPAA 1YPNA 1T39A 2ADRA 2ELZA 3T1HE 2EQ3A 2L3CA 1F2IG 2YT4A 2V83A 2GLIA 3BGHA 2VRDA 2L92A 2V85A 2HC5A 2B7VA 2DLQA 2EE8A 2L6MA 2RQLA 4Q35B 4DKKA 2YTNA 3J7AG 2EN3A 1TF3A 2UXCE 3HQ1A 1YUIA 2N3GA 5A6JA 3P1XA 2EPKX 3KZYA 2EOQA 4WSPA 1EH8A 4ZYHA 1JK1A 4O43A 3M99B 5DNYA 2LO3A 1DQ3A 4R2DA 5T6JA 4AQYE 5ADZA 1X47A 3C4TA 5KL2A 2A25A 3OMLA 4NZVA 1X3CA 2EOXA 2EMYA 2EPXA 3VK6A 1MGTA 2DSYA 4O24A 2LTSA 2RS6A 1YFHA 1WHQA 2F4VE 2LV2A 4M0VA 4JI1E 2EM2A 2YU8A 1IBME 2UXBE 3MHHC 2PRTA 4NHRA 2EP3A 1XMQE 2GPIA 1N36E 4BHBA 1EH6A 4NXME 1PJTA 2GHFA 4X8WA 1T4OA 2EL4A 4DV0E 2KOUA 2HJJA 3EPLA 2EPPA 2L2NA 3UK3C 2RS7A 2YTQA 4DMIA 4F6NA 4BHCA 4M9VC 1J5EE 2N8XA 1FJGE 4F9BB 2LRSA 2G7HA 2FV4B 2EOZA 5KL5A 2LJUA 2UUCE 3EPJA 2EMIA 2MC6A 1ZBQA 1YSAC 2FGGA 2VQFE 4B3RE 1PJQA 2E72A 4YY3E 4R8OA 2EPZA 1RC7A 4JYAE 2DRPA 4X62E 3IWDA 2EMHA 4BCAA 2EM8A 2NUEA 2M9AA 1RMDA 3HPSA 2L8TA 1X6FA 1GZ6A 4TUGA 4DR3E 3ECRA 2Q8UA 3H09A 4NXNE 4R03A 1N34E 2NABA 4L5NC 2YSOA 4F54A 4YHHE 2V88A 4JI6E 2FTXB 4BC7A 5A6KA 4R2RA 3ADGA 4WXDA 4DV2E 1EKZA 2WBUA 4DR1E 4LF5E 2EPOA 2YTDA 2D9HA 2EMXA 1AH5A 4F2JC 1O0WA 4BS9A 1PDAA 2NUFA 2WBSA 2V86A 3MHSC 2EMWA 4Q28A 5LL6R 3EPHA 1NEIA 2EM5A 1A1GA 2JOBA 1WJPA 1YYOA 2JXPA 4LF7E
chains in the Genus database with same CATH topology
2YTPA 2MKNA 4R2DA 2WCC3 1G2FC 5KL7A 1ZR9A 2EN8A 2EOSA 5KL2A 2A25A 1A1JA 1X3CA 2EOXA 2EMYA 2EPXA 1A1LA 2EM9A 2MKDA 1X6HA 1ZAAC 2R1FA 1BB8A 4IS1C 2LV2A 1G2DC 2EM2A 1A1KA 1X5WA 2EOMA 2YU8A 1A1HA 3MHHC 2PRTA 2ELYA 2EM0A 2EP3A 2EQ0A 1LLMC 4R2CA 1TN9A 2GHFA 2EPAA 2EL4A 4R2PA 1A1IA 1UBDC 3EPLA 2JP9A 2YTEA 1X6EA 2YTFA 2EPPA 1P47A 3UK3C 2YTQA 4F6NA 4M9VC 1Z1BA 2RSIA 2YTGA 1TF6A 2ENCA 2EJ4A 5KL3A 2EOOA 2MDGA 2EOZA 5KL5A 2EMFA 2YTJA 2CSHA 2RPCA 4GZNC 1MEYC 3EPJA 1DGCA 2EOIA 2ENAA 2LVHA 2EMIA 2YTOA 5KL6A 1JK2A 2EMAA 1YSAC 2EMLA 2EL6A 2YRMA 2E72A 4IJDA 2EPZA 2YTIA 4R2EA 2EN1A 1UN6B 2DRPA 1YUJA 1BBOA 4X9JA 2YSPA 1NCSA 2EM6A 5KL4A 1AAYA 2BB8A 4FK5C 2YU5A 2EMHA 2EN7A 2EM3A 1KJKA 4WSGA 2EM8A 2EOEA 2EPRA 2EMCA 2EOYA 2DLKA 2EOJA 2ENHA 2EPUA 2CTDA 2M9AA 1RMDA 4R2AA 2EMBA 1X6FA 3EPKA 2WBTA 2YRHA 2LT7A 2EORA 4F6MA 2EL5A 3VHTB 1A1FA 2JPAA 2EN6A 2ADRA 2ELZA 2DMIA 2NABA 2YSOA 2EQ3A 1F2IG 2J7JA 2GLIA 2EMZA 2HGHA 2EN4A 2EMGA 4R2RA 2VRDA 2WBUA 2EN2A 1ZU1A 2YRKA 2DLQA 2D9HA 2EE8A 2YTDA 2EMXA 2EQ1A 4R2QA 2YTNA 4F2JC 2EN3A 1B69A 1TF3A 2DGCA 2EM4A 1YUIA 2EPCA 2WBSA 2EOQA 2LCEA 2CT1A 2EM7A 3MHSC 2EMKA 2EMWA 2EOHA 2I13A 2EOFA 3EPHA 4R2SA 1JK1A 2EM5A 1A1GA 3M99B 1WJPA 2LO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTP A;  2MKN A;  4R2D A;  2WCC 3;  1G2F C;  5KL7 A;  1ZR9 A;  2EN8 A;  2EOS A;  5KL2 A;  2A25 A;  1A1J A;  1X3C A;  2EOX A;  2EMY A;  2EPX A;  1A1L A;  2EM9 A;  2MKD A;  1X6H A;  1ZAA C;  2R1F A;  1BB8 A;  4IS1 C;  2LV2 A;  1G2D C;  2EM2 A;  1A1K A;  1X5W A;  2EOM A;  2YU8 A;  1A1H A;  3MHH C;  2PRT A;  2ELY A;  2EM0 A;  2EP3 A;  2EQ0 A;  1LLM C;  4R2C A;  1TN9 A;  2GHF A;  2EPA A;  2EL4 A;  4R2P A;  1A1I A;  1UBD C;  3EPL A;  2JP9 A;  2YTE A;  1X6E A;  2YTF A;  2EPP A;  1P47 A;  3UK3 C;  2YTQ A;  4F6N A;  4M9V C;  1Z1B A;  2RSI A;  2YTG A;  1TF6 A;  2ENC A;  2EJ4 A;  5KL3 A;  2EOO A;  2MDG A;  2EOZ A;  5KL5 A;  2EMF A;  2YTJ A;  2CSH A;  2RPC A;  4GZN C;  1MEY C;  3EPJ A;  1DGC A;  2EOI A;  2ENA A;  2LVH A;  2EMI A;  2YTO A;  5KL6 A;  1JK2 A;  2EMA A;  1YSA C;  2EML A;  2EL6 A;  2YRM A;  2E72 A;  4IJD A;  2EPZ A;  2YTI A;  4R2E A;  2EN1 A;  1UN6 B;  2DRP A;  1YUJ A;  1BBO A;  4X9J A;  2YSP A;  1NCS A;  2EM6 A;  5KL4 A;  1AAY A;  2BB8 A;  4FK5 C;  2YU5 A;  2EMH A;  2EN7 A;  2EM3 A;  1KJK A;  4WSG A;  2EM8 A;  2EOE A;  2EPR A;  2EMC A;  2EOY A;  2DLK A;  2EOJ A;  2ENH A;  2EPU A;  2CTD A;  2M9A A;  1RMD A;  4R2A A;  2EMB A;  1X6F A;  3EPK A;  2WBT A;  2YRH A;  2LT7 A;  2EOR A;  4F6M A;  2EL5 A;  3VHT B;  1A1F A;  2JPA A;  2EN6 A;  2ADR A;  2ELZ A;  2DMI A;  2NAB A;  2YSO A;  2EQ3 A;  1F2I G;  2J7J A;  2GLI A;  2EMZ A;  2HGH A;  2EN4 A;  2EMG A;  4R2R A;  2VRD A;  2WBU A;  2EN2 A;  1ZU1 A;  2YRK A;  2DLQ A;  2D9H A;  2EE8 A;  2YTD A;  2EMX A;  2EQ1 A;  4R2Q A;  2YTN A;  4F2J C;  2EN3 A;  1B69 A;  1TF3 A;  2DGC A;  2EM4 A;  1YUI A;  2EPC A;  2WBS A;  2EOQ A;  2LCE A;  2CT1 A;  2EM7 A;  3MHS C;  2EMK A;  2EMW A;  2EOH A;  2I13 A;  2EOF A;  3EPH A;  4R2S A;  1JK1 A;  2EM5 A;  1A1G A;  3M99 B;  1WJP A;  2LO3 A; 
#chains in the Genus database with same CATH topology
 1UIL A;  2JR1 A;  2NA2 A;  2DIX A;  2MKN A;  1STU A;  1G2F C;  5KL7 A;  5AE3 A;  1ZR9 A;  2H36 X;  1L4S A;  3LML A;  5AC4 A;  1A1L A;  3TQM A;  2EM9 A;  1HNZ E;  1ZAA C;  2R1F A;  1SFE A;  2LBS B;  4DUY E;  3ADJ A;  1G2D C;  1EH7 A;  2LUQ A;  1GQE A;  1HR0 E;  1RQ0 A;  1LLM C;  2EM0 A;  2EQ0 A;  1TN9 A;  1IBL E;  2EPA A;  2DMY A;  1A1I A;  1UBD C;  2JP9 A;  1X6E A;  1WRJ A;  3BF2 A;  4WXC A;  1P47 A;  4JI7 E;  4LF4 E;  2K7I A;  1Z1B A;  4P7D A;  2LTR A;  1PJS A;  3F6G A;  4DV3 E;  5KL3 A;  3ADI A;  4KWY A;  4JV5 E;  2MDG A;  2M4I A;  4MLV A;  2CPN A;  2L33 A;  4GZN C;  2K4V A;  2E1M A;  1DGC A;  2LVH A;  2ENA A;  5KL6 A;  1IMU A;  2YTO A;  2LUP B;  2MC5 A;  2EMA A;  2EML A;  2RSM A;  2YRM A;  4DR5 E;  4IJD A;  3IWB A;  4LFC E;  1UN6 B;  1IBK E;  1AAY A;  2YU5 A;  2EM3 A;  2I9I A;  4WSG A;  3C4B A;  1YYK A;  2EPR A;  2EMC A;  2KON A;  5F3W A;  2DLK A;  3KZZ A;  1X48 A;  2CTD A;  1BBG A;  5BR8 E;  4F9A B;  3EPK A;  2E5L E;  2DB2 A;  4DV5 E;  4LTY A;  2V89 A;  2M7Q A;  1FKA E;  2YPN A;  2J7J A;  2LE2 A;  2HGH A;  3KWR A;  3JAM C;  3IWC A;  2B9D A;  2EN2 A;  1ZU1 A;  5A69 A;  2YRK A;  1WHN A;  1B69 A;  2YZT A;  2UUA E;  4GEQ B;  4DV6 E;  1ZBT A;  4DV4 E;  4LF6 E;  2CT1 A;  2EMK A;  4WFT A;  2EPL X;  2JY9 A;  4MLQ A;  2EOF A;  4DV1 E;  5AE1 A;  2BBG A;  1T4L B;  4P78 A;  4GKK E;  4N4R B;  3L00 A;  4LF9 E;  3C6M A;  4GKJ E;  2B3T B;  2R76 A;  2EN8 A;  3FIG A;  4DR4 E;  1T4N A;  2JYA A;  1HNX E;  1IQS A;  5IXM B;  3OTO E;  3HXL A;  4DV7 E;  1A1K A;  3J80 C;  1KYQ A;  4BMJ A;  1A1H A;  4F9C B;  2UU9 E;  4R2C A;  4KHP E;  4O5G A;  4R2P A;  2YTE A;  2YTF A;  5IV8 B;  3F6H A;  4JI3 E;  4HTG A;  2RSI A;  1N32 E;  2YTG A;  4LU9 A;  4TUI A;  1XNR E;  2EJ4 A;  2LJH A;  2EOO A;  4WX9 A;  2L3J A;  5IWA E;  2IHR 1;  2CSH A;  2YTJ A;  1WXR A;  3QG5 C;  2M1S A;  2EOI A;  1JK2 A;  1QU6 A;  2WZO A;  4JI0 E;  2EL6 A;  5LMU E;  4B3S E;  4M30 A;  3BBG A;  4I8O A;  2YTI A;  4R2E A;  2EN1 A;  1YUJ A;  4X9J A;  2EM6 A;  5KL4 A;  2BB8 A;  4FK5 C;  4B3T E;  2EN7 A;  2B7T A;  3J7Y p;  1KJK A;  4LF8 E;  2F8B A;  2ENH A;  2EPU A;  4JI8 E;  2L2K B;  2ZM6 E;  3EQ1 A;  2JWO A;  2YRH A;  4RH8 A;  2EOR A;  4F6M A;  3VYX A;  3VHT B;  2EWL A;  1XNQ E;  2EN6 A;  2DMI A;  3AUZ A;  5TSE A;  5LMN E;  2EMZ A;  5AE2 A;  4X64 E;  2EN4 A;  2EMG A;  2VQE E;  1SR9 A;  4X65 E;  1YZ9 A;  2EQ1 A;  4R2Q A;  2DGC A;  3RMP A;  2EM4 A;  5FLX C;  1IQO A;  1DI2 A;  2EPC A;  2HHH E;  3MSW A;  3VYY A;  5AAS A;  2LCE A;  4BBY A;  2EM7 A;  4WPY A;  1I94 E;  2EOH A;  3DF6 A;  2I13 A;  4LFA E;  3K6Q A;  4R2S A;  5LLQ A;  3ADL A;  4X66 E;  2VE7 C;  4J8Z A;  4ZYD A;  2EPM X;  2YTP A;  2L2M A;  4JI5 E;  2WCC 3;  2NUG A;  5AC5 A;  4ZYE A;  2EPN A;  2EOS A;  1A1J A;  5IT9 C;  5CFF E;  4M2Z A;  5A6B A;  2MKD A;  1X6H A;  2UUB E;  1BB8 A;  4L8N A;  4IS1 C;  2N3H A;  2ODR D;  4JI2 E;  1X5W A;  2EOM A;  2ODR C;  2ELY A;  2V87 A;  4OOG C;  2JVA A;  2MDR A;  3LLH A;  3THN A;  2EZ6 A;  4KZS A;  2UXD E;  4JI4 E;  1N3G A;  1T38 A;  1TF6 A;  5A6B D;  4OX9 E;  4DR2 E;  2ENC A;  4WYQ B;  1J26 A;  3HPZ A;  2V8Q B;  3ZOQ B;  4K0K E;  2EMF A;  4DR6 E;  2RPC A;  1MEY C;  4BC9 A;  2RTX A;  1HNW E;  3JTZ A;  3HTX A;  1UHZ A;  1PKP A;  3C6K A;  4RHB B;  3T1Y E;  1QNT A;  3J81 C;  1X49 A;  2JOX A;  2VF1 A;  4B3M E;  3THO B;  4LFB E;  3DJW A;  1GTK A;  1XMO E;  1BBO A;  2YSP A;  3AV0 A;  2LMZ A;  1NCS A;  5A2Q C;  1YYW A;  2EOE A;  3JU0 A;  3BID A;  2EOY A;  2EOJ A;  2KHX A;  4R2A A;  2EMB A;  5A6A A;  2YWQ A;  1N33 E;  2WBT A;  2LT7 A;  4HEI A;  4O4K A;  4DR7 E;  4ZYG A;  2EL5 A;  4DUZ E;  1A1F A;  2JPA A;  1YPN A;  1T39 A;  2ADR A;  2ELZ A;  3T1H E;  2EQ3 A;  2L3C A;  1F2I G;  2YT4 A;  2V83 A;  2GLI A;  3BGH A;  2VRD A;  2L92 A;  2V85 A;  2HC5 A;  2B7V A;  2DLQ A;  2EE8 A;  2L6M A;  2RQL A;  4Q35 B;  4DKK A;  2YTN A;  3J7A G;  2EN3 A;  1TF3 A;  2UXC E;  3HQ1 A;  1YUI A;  2N3G A;  5A6J A;  3P1X A;  2EPK X;  3KZY A;  2EOQ A;  4WSP A;  1EH8 A;  4ZYH A;  1JK1 A;  4O43 A;  3M99 B;  5DNY A;  2LO3 A;  1DQ3 A;  4R2D A;  5T6J A;  4AQY E;  5ADZ A;  1X47 A;  3C4T A;  5KL2 A;  2A25 A;  3OML A;  4NZV A;  1X3C A;  2EOX A;  2EMY A;  2EPX A;  3VK6 A;  1MGT A;  2DSY A;  4O24 A;  2LTS A;  2RS6 A;  1YFH A;  1WHQ A;  2F4V E;  2LV2 A;  4M0V A;  4JI1 E;  2EM2 A;  2YU8 A;  1IBM E;  2UXB E;  3MHH C;  2PRT A;  4NHR A;  2EP3 A;  1XMQ E;  2GPI A;  1N36 E;  4BHB A;  1EH6 A;  4NXM E;  1PJT A;  2GHF A;  4X8W A;  1T4O A;  2EL4 A;  4DV0 E;  2KOU A;  2HJJ A;  3EPL A;  2EPP A;  2L2N A;  3UK3 C;  2RS7 A;  2YTQ A;  4DMI A;  4F6N A;  4BHC A;  4M9V C;  1J5E E;  2N8X A;  1FJG E;  4F9B B;  2LRS A;  2G7H A;  2FV4 B;  2EOZ A;  5KL5 A;  2LJU A;  2UUC E;  3EPJ A;  2EMI A;  2MC6 A;  1ZBQ A;  1YSA C;  2FGG A;  2VQF E;  4B3R E;  1PJQ A;  2E72 A;  4YY3 E;  4R8O A;  2EPZ A;  1RC7 A;  4JYA E;  2DRP A;  4X62 E;  3IWD A;  2EMH A;  4BCA A;  2EM8 A;  2NUE A;  2M9A A;  1RMD A;  3HPS A;  2L8T A;  1X6F A;  1GZ6 A;  4TUG A;  4DR3 E;  3ECR A;  2Q8U A;  3H09 A;  4NXN E;  4R03 A;  1N34 E;  2NAB A;  4L5N C;  2YSO A;  4F54 A;  4YHH E;  2V88 A;  4JI6 E;  2FTX B;  4BC7 A;  5A6K A;  4R2R A;  3ADG A;  4WXD A;  4DV2 E;  1EKZ A;  2WBU A;  4DR1 E;  4LF5 E;  2EPO A;  2YTD A;  2D9H A;  2EMX A;  1AH5 A;  4F2J C;  1O0W A;  4BS9 A;  1PDA A;  2NUF A;  2WBS A;  2V86 A;  3MHS C;  2EMW A;  4Q28 A;  5LL6 R;  3EPH A;  1NEI A;  2EM5 A;  1A1G A;  2JOB A;  1WJP A;  1YYO A;  2JXP A;  4LF7 E; 
#chains in the Genus database with same CATH homology
 2YTP A;  2MKN A;  4R2D A;  2WCC 3;  1G2F C;  5KL7 A;  1ZR9 A;  2EN8 A;  2EOS A;  5KL2 A;  2A25 A;  1A1J A;  1X3C A;  2EOX A;  2EMY A;  2EPX A;  1A1L A;  2EM9 A;  2MKD A;  1X6H A;  1ZAA C;  2R1F A;  1BB8 A;  4IS1 C;  2LV2 A;  1G2D C;  2EM2 A;  1A1K A;  1X5W A;  2EOM A;  2YU8 A;  1A1H A;  3MHH C;  2PRT A;  2ELY A;  2EM0 A;  2EP3 A;  2EQ0 A;  1LLM C;  4R2C A;  1TN9 A;  2GHF A;  2EPA A;  2EL4 A;  4R2P A;  1A1I A;  1UBD C;  3EPL A;  2JP9 A;  2YTE A;  1X6E A;  2YTF A;  2EPP A;  1P47 A;  3UK3 C;  2YTQ A;  4F6N A;  4M9V C;  1Z1B A;  2RSI A;  2YTG A;  1TF6 A;  2ENC A;  2EJ4 A;  5KL3 A;  2EOO A;  2MDG A;  2EOZ A;  5KL5 A;  2EMF A;  2YTJ A;  2CSH A;  2RPC A;  4GZN C;  1MEY C;  3EPJ A;  1DGC A;  2EOI A;  2ENA A;  2LVH A;  2EMI A;  2YTO A;  5KL6 A;  1JK2 A;  2EMA A;  1YSA C;  2EML A;  2EL6 A;  2YRM A;  2E72 A;  4IJD A;  2EPZ A;  2YTI A;  4R2E A;  2EN1 A;  1UN6 B;  2DRP A;  1YUJ A;  1BBO A;  4X9J A;  2YSP A;  1NCS A;  2EM6 A;  5KL4 A;  1AAY A;  2BB8 A;  4FK5 C;  2YU5 A;  2EMH A;  2EN7 A;  2EM3 A;  1KJK A;  4WSG A;  2EM8 A;  2EOE A;  2EPR A;  2EMC A;  2EOY A;  2DLK A;  2EOJ A;  2ENH A;  2EPU A;  2CTD A;  2M9A A;  1RMD A;  4R2A A;  2EMB A;  1X6F A;  3EPK A;  2WBT A;  2YRH A;  2LT7 A;  2EOR A;  4F6M A;  2EL5 A;  3VHT B;  1A1F A;  2JPA A;  2EN6 A;  2ADR A;  2ELZ A;  2DMI A;  2NAB A;  2YSO A;  2EQ3 A;  1F2I G;  2J7J A;  2GLI A;  2EMZ A;  2HGH A;  2EN4 A;  2EMG A;  4R2R A;  2VRD A;  2WBU A;  2EN2 A;  1ZU1 A;  2YRK A;  2DLQ A;  2D9H A;  2EE8 A;  2YTD A;  2EMX A;  2EQ1 A;  4R2Q A;  2YTN A;  4F2J C;  2EN3 A;  1B69 A;  1TF3 A;  2DGC A;  2EM4 A;  1YUI A;  2EPC A;  2WBS A;  2EOQ A;  2LCE A;  2CT1 A;  2EM7 A;  3MHS C;  2EMK A;  2EMW A;  2EOH A;  2I13 A;  2EOF A;  3EPH A;  4R2S A;  1JK1 A;  2EM5 A;  1A1G A;  3M99 B;  1WJP A;  2LO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...