2L8TA

Staphylococcus aureus pathogenicity island 1 protein gp6, an internal scaffold in size determination
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
ETKYELNNTKKVANAFGLNEEDTNLLINAVDLDIKNNMQEISSELQQSEQSKQKQYGTTLQNLAKQNRIIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transposon Tn557 toxic shock syndrome toxin-1
publication title The Staphylococcus aureus Pathogenicity Island 1 Protein gp6 Functions as an Internal Scaffold during Capsid Size Determination.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Structural protein
total genus 11
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.410 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l8tA00
2L8TA
chains in the Genus database with same CATH superfamily
2DRPA 4GEQB 3KWRA 2DB2A 2EM7A 2EPZA 2YRMA 4IS1C 1T39A 2E1MA 2RQLA 4I8OA 2EJ4A 5CFFE 2G7HA 3C4TA 1RMDA 2HGHA 3M99B 4R2QA 2LV2A 2LJUA 3MHSC 2EOEA 2N3GA 4N4RB 3HTXA 4TUGA 2MDRA 2YTNA 3JTZA 1X48A 2YPNA 1DI2A 2GPIA 1N34E 2EPXA 5ADZA 2FV4B 4P78A 4JI8E 4WFTA 4DR4E 4HTGA 2EZ6A 4F9CB 2FGGA 2LO3A 4KHPE 1A1FA 1PKPA 1X49A 3L00A 2EMFA 4NZVA 4BMJA 2ENAA 1MEYC 4F9BB 2EPNA 3C6KA 4DV3E 1UBDC 5AC4A 2NUEA 4MLVA 1MGTA 3ECRA 2CPNA 2EOYA 2YRKA 1WXRA 4B3TE 1LLMC 2VF1A 4BHCA 3EPLA 2F4VE 4FK5C 2J7JA 4ZYEA 2JOBA 4B3ME 4DMIA 5A69A 1EH8A 2ELYA 2DMYA 2NUGA 1A1LA 1Z1BA 4L8NA 1YPNA 4L5NC 2EOMA 1IBLE 1XNQE 1HNXE 2L33A 2N8XA 1EH7A 5DNYA 2MKNA 4WXDA 1WHNA 5KL2A 2NUFA 1ZBQA 2EQ0A 4R2EA 2DGCA 2H36X 4RH8A 2EOIA 2EN7A 2V88A 3BGHA 1YUJA 4R2PA 1XMOE 2KONA 1GQEA 3MSWA 4X65E 1AAYA 5IV8B 4Q28A 3J7Yp 4JI5E 1IMUA 2V83A 2V85A 5KL3A 5KL7A 2EPMX 5KL4A 3QG5C 3THNA 2EL4A 1YFHA 2LJHA 2PRTA 4BHBA 4R2SA 2CTDA 2E72A 2EE8A 2N3HA 3ADJA 2DMIA 2HHHE 2KHXA 4TUIA 4DV2E 1A1IA 4F6NA 3HXLA 1N32E 2JY9A 1TN9A 1ZR9A 2ELZA 4DR1E 4ZYDA 2WCC3 3J80C 2EPLX 2UUCE 3ADLA 2LUQA 4WYQB 2EL6A 1TF3A 4DV5E 5A6BD 2RSIA 3IWBA 1HNZE 2EN8A 2EOZA 2VRDA 3H09A 4R8OA 4LF6E 4LF8E 2RS6A 1N3GA 1NCSA 3OMLA 4JI0E 1YYKA 3AV0A 2DLKA 2LBSB 4YHHE 3JU0A 2L6MA 2EMKA 4WSGA 2EPPA 3C6MA 4BBYA 5AE2A 2EMIA 1X5WA 4O24A 2YTJA 1RQ0A 2EWLA 4F6MA 3TQMA 2ADRA 2MC6A 2UUAE 1T4NA 1JK2A 3VK6A 2JPAA 4BC9A 1ZAAC 5A6BA 1DQ3A 2LE2A 1WRJA 4M2ZA 2KOUA 2LVHA 5LLQA 1PJTA 2EN1A 4GKJE 1T4LB 5BR8E 4BCAA 1NEIA 2RPCA 3VYXA 2EMAA 2YTIA 3KZZA 2M9AA 4LF4E 2EOXA 4WPYA 2JP9A 3AUZA 2L8TA 4X9JA 2ZM6E 3ADIA 2RS7A 2E5LE 4DR6E 2UXCE 4DV6E 2YTEA 1JK1A 2A25A 1YYOA 4JI7E 1YSAC 4JI3E 1QNTA 1N36E 4Q35B 1G2DC 1X6FA 3T1YE 2M1SA 5F3WA 3VHTB 2BBGA 2L2NA 2NABA 1GTKA 5AC5A 2EM3A 1X3CA 3HQ1A 4JI1E 1A1KA 2JYAA 2K7IA 1WHQA 2IHR1 3C4BA 2L2MA 2YTPA 3IWDA 2EM2A 4RHBB 2UXBE 4X62E 1SR9A 4J8ZA 4X64E 4ZYGA 1KJKA 2WZOA 4LF5E 4WX9A 4GKKE 2EM0A 2YZTA 4M30A 2NA2A 1F2IG 4DR3E 4DUYE 2EMWA 4DUZE 4GZNC 4K0KE 2D9HA 2K4VA 4M0VA 5IWAE 4KWYA 2R76A 2DLQA 2EM5A 2ENCA 2ODRD 2V87A 2YTGA 3BF2A 2EM4A 5IXMB 2M4IA 4B3SE 2ODRC 2EN4A 4O43A 4X8WA 2YSPA 2LUPB 1UHZA 3FIGA 1G2FC 2EN6A 2RSMA 2EPCA 1PJQA 1STUA 2EMCA 1O0WA 2EMBA 2EM9A 3HPZA 4R2AA 2ENHA 1X6HA 4DR2E 2YSOA 2EM8A 2LCEA 2LTRA 4NXNE 4LF9E 1BBGA 2LRSA 2L3JA 1N33E 4MLQA 2EOHA 2BB8A 4LFCE 4P7DA 2JVAA 2GLIA 3EPJA 2YTOA 2EOFA 4M9VC 4JYAE 4ZYHA 2WBTA 2EMLA 1RC7A 1WJPA 1ZU1A 2MC5A 1AH5A 2EMZA 2CT1A 3P1XA 5A6KA 1PDAA 2EORA 1YYWA 3ADGA 2EL5A 1UILA 2VE7C 4DV1E 3EPKA 2YWQA 1EKZA 2YRHA 4WXCA 2VQFE 4KZSA 3THOB 1GZ6A 4R03A 2EP3A 2YT4A 4NHRA 4DKKA 4WSPA 2L3CA 4DV4E 1FKAE 5KL5A 5A2QC 2EN2A 2LTSA 1J26A 1IQSA 5LMUE 5TSEA 1ZBTA 2YTFA 3DF6A 2MDGA 5AASA 3KZYA 2I9IA 1QU6A 4R2DA 4F9AB 2LT7A 2EM6A 3RMPA 2EMGA 4LU9A 1EH6A 2EMHA 2RTXA 4JI2E 1BB8A 2B7TA 2MKDA 1IBKE 1DGCA 1T38A 5KL6A 2EOSA 4LTYA 4DR7E 1J5EE 2EPAA 1HR0E 2WBSA 3UK3C 1T4OA 4OOGC 2EQ3A 5AE3A 5A6AA 5AE1A 3MHHC 3VYYA 2JWOA 2CSHA 4F2JC 4JI6E 2EPOA 1P47A 2EOQA 3ZOQB 2HJJA 2VQEE 1TF6A 4B3RE 5LMNE 1FJGE 2YU5A 1XNRE 2DIXA 4O4KA 1X6EA 2L2KB 2JR1A 2UUBE 2B9DA 1SFEA 2R1FA 4BS9A 2I13A 2EQ1A 1I94E 2YTDA 2Q8UA 1IQOA 4X66E 1PJSA 2EN3A 2HC5A 5A6JA 2V89A 4LFBE 3J7AG 1A1JA 3J81C 1BBOA 3F6HA 3F6GA 2JXPA 2M7QA 4OX9E 4AQYE 4HEIA 1XMQE 1HNWE 5LL6R 2GHFA 2YTQA 3BIDA 4JI4E 1YUIA 4JV5E 3IWCA 2EOOA 4IJDA 3JAMC 4F54A 2V86A 2EMXA 2EMYA 3T1HE 4O5GA 1UN6B 1YZ9A 2FTXB 3BBGA 5FLXC 2V8QB 3EQ1A 4LFAE 3OTOE 3LLHA 2YU8A 3DJWA 4DV7E 5IT9C 1IBME 2L92A 2WBUA 1L4SA 3HPSA 2EPKX 2B7VA 4YY3E 4NXME 2B3TB 4R2CA 2EPUA 1A1HA 3LMLA 4DR5E 5T6JA 2UU9E 2F8BA 2DSYA 3K6QA 3EPHA 4R2RA 1KYQA 4DV0E 1B69A 4LF7E 2EOJA 2JOXA 4BC7A 1A1GA 1X47A 2EPRA 2UXDE 2LMZA
chains in the Genus database with same CATH topology
2KONA 1GQEA 3MSWA 4GEQB 4X65E 2L3CA 3KWRA 4DV4E 1YYOA 4Q28A 4JI7E 1FKAE 2DB2A 5A2QC 3J7Yp 4JI5E 2LTSA 4JI3E 5LMUE 1J26A 1ZBTA 3DF6A 2V83A 2V85A 5AASA 1N36E 2E1MA 1QU6A 4F9AB 4I8OA 2LJHA 3RMPA 5CFFE 2G7HA 3T1YE 2M1SA 3C4TA 5F3WA 4LU9A 2RTXA 4JI2E 2L2NA 2B7TA 1IBKE 2N3HA 2N3GA 3HQ1A 4LTYA 3ADJA 4JI1E 3HTXA 2HHHE 1J5EE 2KHXA 4TUIA 4DR7E 4DV2E 1HR0E 3HXLA 2MDRA 4TUGA 3JTZA 1WHQA 1X48A 2IHR1 1T4OA 3C4BA 1DI2A 2L2MA 4OOGC 1N34E 3IWDA 5ADZA 1N32E 2UXBE 4X62E 1SR9A 4J8ZA 5AE1A 5AE3A 2FV4B 4P78A 4X64E 4JI8E 2JY9A 3VYYA 4WFTA 4DR1E 4DR4E 2JWOA 2WZOA 3J80C 4LF5E 4JI6E 2EZ6A 4GKKE 4F9CB 2UUCE 2YZTA 2FGGA 2NA2A 4M30A 3ZOQB 2VQEE 3ADLA 4KHPE 1PKPA 1X49A 2LUQA 4WYQB 5LMNE 4DUYE 4DUZE 4DR3E 4DV5E 4B3RE 4BMJA 1FJGE 1XNRE 3IWBA 2K4VA 1HNZE 4F9BB 4K0KE 3H09A 2DIXA 4M0VA 4R8OA 5IWAE 4DV3E 4LF6E 2ODRD 4LF8E 2NUEA 2V87A 2RS6A 2L2KB 2JR1A 2CPNA 3OMLA 4JI0E 1YYKA 2UUBE 2B9DA 2M4IA 4B3SE 3AV0A 2LBSB 2ODRC 3JU0A 4YHHE 2L6MA 4X8WA 4BS9A 1I94E 1WXRA 2LUPB 1UHZA 3FIGA 4B3TE 2RSMA 4X66E 4BBYA 1STUA 2V89A 5AE2A 1O0WA 4LFBE 2VF1A 3J7AG 3HPZA 3J81C 4DR2E 1RQ0A 3F6HA 3F6GA 2EWLA 2LTRA 2F4VE 4NXNE 4LF9E 2LRSA 2M7QA 2JOBA 4B3ME 2L3JA 4AQYE 1XMQE 4DMIA 2MC6A 4OX9E 5LL6R 2UUAE 1HNWE 1N33E 1T4NA 3VK6A 4LFCE 4P7DA 4JI4E 4JV5E 2DMYA 2JVAA 3IWCA 3JAMC 4F54A 2V86A 2NUGA 4JYAE 3T1HE 4L8NA 1YZ9A 2FTXB 4L5NC 5FLXC 4BC9A 1RC7A 1IBLE 2V8QB 1XNQE 4LFAE 1HNXE 2MC5A 3OTOE 1DQ3A 2LE2A 3LLHA 3P1XA 2KOUA 3DJWA 2L33A 4DV7E 5IT9C 4M2ZA 1IBME 2L92A 1YYWA 5DNYA 3HPSA 3ADGA 2B7VA 4YY3E 1WHNA 1UILA 2VE7C 4DV1E 5BR8E 1T4LB 2B3TB 4BCAA 4NXME 4GKJE 2NUFA 3VYXA 3LMLA 4DR5E 1EKZA 1ZBQA 2VQFE 4KZSA 5T6JA 2F8BA 2DSYA 3K6QA 2UU9E 4LF4E 1GZ6A 2H36X 4WPYA 4R03A 4DV0E 4LF7E 3AUZA 2JOXA 2V88A 4BC7A 2L8TA 2ZM6E 3ADIA 2YT4A 2RS7A 1X47A 2E5LE 4DR6E 2UXCE 4DKKA 2UXDE 4DV6E 2LMZA 4WSPA 1XMOE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L8T A; 
#chains in the Genus database with same CATH topology
 2DRP A;  4GEQ B;  3KWR A;  2DB2 A;  2EM7 A;  2EPZ A;  2YRM A;  4IS1 C;  1T39 A;  2E1M A;  2RQL A;  4I8O A;  2EJ4 A;  5CFF E;  2G7H A;  3C4T A;  1RMD A;  2HGH A;  3M99 B;  4R2Q A;  2LV2 A;  2LJU A;  3MHS C;  2EOE A;  2N3G A;  4N4R B;  3HTX A;  4TUG A;  2MDR A;  2YTN A;  3JTZ A;  1X48 A;  2YPN A;  1DI2 A;  2GPI A;  1N34 E;  2EPX A;  5ADZ A;  2FV4 B;  4P78 A;  4JI8 E;  4WFT A;  4DR4 E;  4HTG A;  2EZ6 A;  4F9C B;  2FGG A;  2LO3 A;  4KHP E;  1A1F A;  1PKP A;  1X49 A;  3L00 A;  2EMF A;  4NZV A;  4BMJ A;  2ENA A;  1MEY C;  4F9B B;  2EPN A;  3C6K A;  4DV3 E;  1UBD C;  5AC4 A;  2NUE A;  4MLV A;  1MGT A;  3ECR A;  2CPN A;  2EOY A;  2YRK A;  1WXR A;  4B3T E;  1LLM C;  2VF1 A;  4BHC A;  3EPL A;  2F4V E;  4FK5 C;  2J7J A;  4ZYE A;  2JOB A;  4B3M E;  4DMI A;  5A69 A;  1EH8 A;  2ELY A;  2DMY A;  2NUG A;  1A1L A;  1Z1B A;  4L8N A;  1YPN A;  4L5N C;  2EOM A;  1IBL E;  1XNQ E;  1HNX E;  2L33 A;  2N8X A;  1EH7 A;  5DNY A;  2MKN A;  4WXD A;  1WHN A;  5KL2 A;  2NUF A;  1ZBQ A;  2EQ0 A;  4R2E A;  2DGC A;  2H36 X;  4RH8 A;  2EOI A;  2EN7 A;  2V88 A;  3BGH A;  1YUJ A;  4R2P A;  1XMO E;  2KON A;  1GQE A;  3MSW A;  4X65 E;  1AAY A;  5IV8 B;  4Q28 A;  3J7Y p;  4JI5 E;  1IMU A;  2V83 A;  2V85 A;  5KL3 A;  5KL7 A;  2EPM X;  5KL4 A;  3QG5 C;  3THN A;  2EL4 A;  1YFH A;  2LJH A;  2PRT A;  4BHB A;  4R2S A;  2CTD A;  2E72 A;  2EE8 A;  2N3H A;  3ADJ A;  2DMI A;  2HHH E;  2KHX A;  4TUI A;  4DV2 E;  1A1I A;  4F6N A;  3HXL A;  1N32 E;  2JY9 A;  1TN9 A;  1ZR9 A;  2ELZ A;  4DR1 E;  4ZYD A;  2WCC 3;  3J80 C;  2EPL X;  2UUC E;  3ADL A;  2LUQ A;  4WYQ B;  2EL6 A;  1TF3 A;  4DV5 E;  5A6B D;  2RSI A;  3IWB A;  1HNZ E;  2EN8 A;  2EOZ A;  2VRD A;  3H09 A;  4R8O A;  4LF6 E;  4LF8 E;  2RS6 A;  1N3G A;  1NCS A;  3OML A;  4JI0 E;  1YYK A;  3AV0 A;  2DLK A;  2LBS B;  4YHH E;  3JU0 A;  2L6M A;  2EMK A;  4WSG A;  2EPP A;  3C6M A;  4BBY A;  5AE2 A;  2EMI A;  1X5W A;  4O24 A;  2YTJ A;  1RQ0 A;  2EWL A;  4F6M A;  3TQM A;  2ADR A;  2MC6 A;  2UUA E;  1T4N A;  1JK2 A;  3VK6 A;  2JPA A;  4BC9 A;  1ZAA C;  5A6B A;  1DQ3 A;  2LE2 A;  1WRJ A;  4M2Z A;  2KOU A;  2LVH A;  5LLQ A;  1PJT A;  2EN1 A;  4GKJ E;  1T4L B;  5BR8 E;  4BCA A;  1NEI A;  2RPC A;  3VYX A;  2EMA A;  2YTI A;  3KZZ A;  2M9A A;  4LF4 E;  2EOX A;  4WPY A;  2JP9 A;  3AUZ A;  2L8T A;  4X9J A;  2ZM6 E;  3ADI A;  2RS7 A;  2E5L E;  4DR6 E;  2UXC E;  4DV6 E;  2YTE A;  1JK1 A;  2A25 A;  1YYO A;  4JI7 E;  1YSA C;  4JI3 E;  1QNT A;  1N36 E;  4Q35 B;  1G2D C;  1X6F A;  3T1Y E;  2M1S A;  5F3W A;  3VHT B;  2BBG A;  2L2N A;  2NAB A;  1GTK A;  5AC5 A;  2EM3 A;  1X3C A;  3HQ1 A;  4JI1 E;  1A1K A;  2JYA A;  2K7I A;  1WHQ A;  2IHR 1;  3C4B A;  2L2M A;  2YTP A;  3IWD A;  2EM2 A;  4RHB B;  2UXB E;  4X62 E;  1SR9 A;  4J8Z A;  4X64 E;  4ZYG A;  1KJK A;  2WZO A;  4LF5 E;  4WX9 A;  4GKK E;  2EM0 A;  2YZT A;  4M30 A;  2NA2 A;  1F2I G;  4DR3 E;  4DUY E;  2EMW A;  4DUZ E;  4GZN C;  4K0K E;  2D9H A;  2K4V A;  4M0V A;  5IWA E;  4KWY A;  2R76 A;  2DLQ A;  2EM5 A;  2ENC A;  2ODR D;  2V87 A;  2YTG A;  3BF2 A;  2EM4 A;  5IXM B;  2M4I A;  4B3S E;  2ODR C;  2EN4 A;  4O43 A;  4X8W A;  2YSP A;  2LUP B;  1UHZ A;  3FIG A;  1G2F C;  2EN6 A;  2RSM A;  2EPC A;  1PJQ A;  1STU A;  2EMC A;  1O0W A;  2EMB A;  2EM9 A;  3HPZ A;  4R2A A;  2ENH A;  1X6H A;  4DR2 E;  2YSO A;  2EM8 A;  2LCE A;  2LTR A;  4NXN E;  4LF9 E;  1BBG A;  2LRS A;  2L3J A;  1N33 E;  4MLQ A;  2EOH A;  2BB8 A;  4LFC E;  4P7D A;  2JVA A;  2GLI A;  3EPJ A;  2YTO A;  2EOF A;  4M9V C;  4JYA E;  4ZYH A;  2WBT A;  2EML A;  1RC7 A;  1WJP A;  1ZU1 A;  2MC5 A;  1AH5 A;  2EMZ A;  2CT1 A;  3P1X A;  5A6K A;  1PDA A;  2EOR A;  1YYW A;  3ADG A;  2EL5 A;  1UIL A;  2VE7 C;  4DV1 E;  3EPK A;  2YWQ A;  1EKZ A;  2YRH A;  4WXC A;  2VQF E;  4KZS A;  3THO B;  1GZ6 A;  4R03 A;  2EP3 A;  2YT4 A;  4NHR A;  4DKK A;  4WSP A;  2L3C A;  4DV4 E;  1FKA E;  5KL5 A;  5A2Q C;  2EN2 A;  2LTS A;  1J26 A;  1IQS A;  5LMU E;  5TSE A;  1ZBT A;  2YTF A;  3DF6 A;  2MDG A;  5AAS A;  3KZY A;  2I9I A;  1QU6 A;  4R2D A;  4F9A B;  2LT7 A;  2EM6 A;  3RMP A;  2EMG A;  4LU9 A;  1EH6 A;  2EMH A;  2RTX A;  4JI2 E;  1BB8 A;  2B7T A;  2MKD A;  1IBK E;  1DGC A;  1T38 A;  5KL6 A;  2EOS A;  4LTY A;  4DR7 E;  1J5E E;  2EPA A;  1HR0 E;  2WBS A;  3UK3 C;  1T4O A;  4OOG C;  2EQ3 A;  5AE3 A;  5A6A A;  5AE1 A;  3MHH C;  3VYY A;  2JWO A;  2CSH A;  4F2J C;  4JI6 E;  2EPO A;  1P47 A;  2EOQ A;  3ZOQ B;  2HJJ A;  2VQE E;  1TF6 A;  4B3R E;  5LMN E;  1FJG E;  2YU5 A;  1XNR E;  2DIX A;  4O4K A;  1X6E A;  2L2K B;  2JR1 A;  2UUB E;  2B9D A;  1SFE A;  2R1F A;  4BS9 A;  2I13 A;  2EQ1 A;  1I94 E;  2YTD A;  2Q8U A;  1IQO A;  4X66 E;  1PJS A;  2EN3 A;  2HC5 A;  5A6J A;  2V89 A;  4LFB E;  3J7A G;  1A1J A;  3J81 C;  1BBO A;  3F6H A;  3F6G A;  2JXP A;  2M7Q A;  4OX9 E;  4AQY E;  4HEI A;  1XMQ E;  1HNW E;  5LL6 R;  2GHF A;  2YTQ A;  3BID A;  4JI4 E;  1YUI A;  4JV5 E;  3IWC A;  2EOO A;  4IJD A;  3JAM C;  4F54 A;  2V86 A;  2EMX A;  2EMY A;  3T1H E;  4O5G A;  1UN6 B;  1YZ9 A;  2FTX B;  3BBG A;  5FLX C;  2V8Q B;  3EQ1 A;  4LFA E;  3OTO E;  3LLH A;  2YU8 A;  3DJW A;  4DV7 E;  5IT9 C;  1IBM E;  2L92 A;  2WBU A;  1L4S A;  3HPS A;  2EPK X;  2B7V A;  4YY3 E;  4NXM E;  2B3T B;  4R2C A;  2EPU A;  1A1H A;  3LML A;  4DR5 E;  5T6J A;  2UU9 E;  2F8B A;  2DSY A;  3K6Q A;  3EPH A;  4R2R A;  1KYQ A;  4DV0 E;  1B69 A;  4LF7 E;  2EOJ A;  2JOX A;  4BC7 A;  1A1G A;  1X47 A;  2EPR A;  2UXD E;  2LMZ A; 
#chains in the Genus database with same CATH homology
 2KON A;  1GQE A;  3MSW A;  4GEQ B;  4X65 E;  2L3C A;  3KWR A;  4DV4 E;  1YYO A;  4Q28 A;  4JI7 E;  1FKA E;  2DB2 A;  5A2Q C;  3J7Y p;  4JI5 E;  2LTS A;  4JI3 E;  5LMU E;  1J26 A;  1ZBT A;  3DF6 A;  2V83 A;  2V85 A;  5AAS A;  1N36 E;  2E1M A;  1QU6 A;  4F9A B;  4I8O A;  2LJH A;  3RMP A;  5CFF E;  2G7H A;  3T1Y E;  2M1S A;  3C4T A;  5F3W A;  4LU9 A;  2RTX A;  4JI2 E;  2L2N A;  2B7T A;  1IBK E;  2N3H A;  2N3G A;  3HQ1 A;  4LTY A;  3ADJ A;  4JI1 E;  3HTX A;  2HHH E;  1J5E E;  2KHX A;  4TUI A;  4DR7 E;  4DV2 E;  1HR0 E;  3HXL A;  2MDR A;  4TUG A;  3JTZ A;  1WHQ A;  1X48 A;  2IHR 1;  1T4O A;  3C4B A;  1DI2 A;  2L2M A;  4OOG C;  1N34 E;  3IWD A;  5ADZ A;  1N32 E;  2UXB E;  4X62 E;  1SR9 A;  4J8Z A;  5AE1 A;  5AE3 A;  2FV4 B;  4P78 A;  4X64 E;  4JI8 E;  2JY9 A;  3VYY A;  4WFT A;  4DR1 E;  4DR4 E;  2JWO A;  2WZO A;  3J80 C;  4LF5 E;  4JI6 E;  2EZ6 A;  4GKK E;  4F9C B;  2UUC E;  2YZT A;  2FGG A;  2NA2 A;  4M30 A;  3ZOQ B;  2VQE E;  3ADL A;  4KHP E;  1PKP A;  1X49 A;  2LUQ A;  4WYQ B;  5LMN E;  4DUY E;  4DUZ E;  4DR3 E;  4DV5 E;  4B3R E;  4BMJ A;  1FJG E;  1XNR E;  3IWB A;  2K4V A;  1HNZ E;  4F9B B;  4K0K E;  3H09 A;  2DIX A;  4M0V A;  4R8O A;  5IWA E;  4DV3 E;  4LF6 E;  2ODR D;  4LF8 E;  2NUE A;  2V87 A;  2RS6 A;  2L2K B;  2JR1 A;  2CPN A;  3OML A;  4JI0 E;  1YYK A;  2UUB E;  2B9D A;  2M4I A;  4B3S E;  3AV0 A;  2LBS B;  2ODR C;  3JU0 A;  4YHH E;  2L6M A;  4X8W A;  4BS9 A;  1I94 E;  1WXR A;  2LUP B;  1UHZ A;  3FIG A;  4B3T E;  2RSM A;  4X66 E;  4BBY A;  1STU A;  2V89 A;  5AE2 A;  1O0W A;  4LFB E;  2VF1 A;  3J7A G;  3HPZ A;  3J81 C;  4DR2 E;  1RQ0 A;  3F6H A;  3F6G A;  2EWL A;  2LTR A;  2F4V E;  4NXN E;  4LF9 E;  2LRS A;  2M7Q A;  2JOB A;  4B3M E;  2L3J A;  4AQY E;  1XMQ E;  4DMI A;  2MC6 A;  4OX9 E;  5LL6 R;  2UUA E;  1HNW E;  1N33 E;  1T4N A;  3VK6 A;  4LFC E;  4P7D A;  4JI4 E;  4JV5 E;  2DMY A;  2JVA A;  3IWC A;  3JAM C;  4F54 A;  2V86 A;  2NUG A;  4JYA E;  3T1H E;  4L8N A;  1YZ9 A;  2FTX B;  4L5N C;  5FLX C;  4BC9 A;  1RC7 A;  1IBL E;  2V8Q B;  1XNQ E;  4LFA E;  1HNX E;  2MC5 A;  3OTO E;  1DQ3 A;  2LE2 A;  3LLH A;  3P1X A;  2KOU A;  3DJW A;  2L33 A;  4DV7 E;  5IT9 C;  4M2Z A;  1IBM E;  2L92 A;  1YYW A;  5DNY A;  3HPS A;  3ADG A;  2B7V A;  4YY3 E;  1WHN A;  1UIL A;  2VE7 C;  4DV1 E;  5BR8 E;  1T4L B;  2B3T B;  4BCA A;  4NXM E;  4GKJ E;  2NUF A;  3VYX A;  3LML A;  4DR5 E;  1EKZ A;  1ZBQ A;  2VQF E;  4KZS A;  5T6J A;  2F8B A;  2DSY A;  3K6Q A;  2UU9 E;  4LF4 E;  1GZ6 A;  2H36 X;  4WPY A;  4R03 A;  4DV0 E;  4LF7 E;  3AUZ A;  2JOX A;  2V88 A;  4BC7 A;  2L8T A;  2ZM6 E;  3ADI A;  2YT4 A;  2RS7 A;  1X47 A;  2E5L E;  4DR6 E;  2UXC E;  4DKK A;  2UXD E;  4DV6 E;  2LMZ A;  4WSP A;  1XMO E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...