2L8TA

Staphylococcus aureus pathogenicity island 1 protein gp6, an internal scaffold in size determination
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
ETKYELNNTKKVANAFGLNEEDTNLLINAVDLDIKNNMQEISSELQQSEQSKQKQYGTTLQNLAKQNRIIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Staphylococcus aureus Pathogenicity Island 1 Protein gp6 Functions as an Internal Scaffold during Capsid Size Determination.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Structural protein
molecule keywords Transposon Tn557 toxic shock syndrome toxin-1
total genus 11
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.410 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l8tA00
2L8TA
chains in the Genus database with same CATH superfamily
3AUZA 4I8OA 2EN6A 2V85A 2ZM6E 2EMYA 1P47A 2FV4B 5A6BA 1GZ6A 2EOMA 4DMIA 4DV0E 3THOB 1TF6A 2WZOA 1J26A 4F9BB 2LJUA 1GTKA 2EPLX 3HPSA 2UUBE 2EPAA 4N4RB 1X6FA 2L3JA 4R2CA 5LL6R 2V88A 4B3SE 2EMGA 2R1FA 2YRMA 2EMKA 3IWDA 2EOHA 2YU5A 1X6EA 1XNQE 2NABA 2YRKA 2EN7A 1IBKE 3MHHC 2E1MA 1EKZA 3TQMA 4F6NA 1SFEA 1X5WA 2EN4A 2N3GA 2ENHA 4KZSA 3EPLA 3AV0A 4BBYA 1LLMC 2EJ4A 4JV5E 2CT1A 4WXDA 4BC7A 4JI7E 1HNZE 1YSAC 1A1HA 4R2AA 2EPKX 3KZZA 2EL6A 2F4VE 2EM9A 1N3GA 2VQEE 2G7HA 2H36X 2YTGA 2YTQA 1GQEA 4B3RE 1BB8A 2YSPA 2VQFE 3HQ1A 4GEQB 2EM2A 4JI4E 5AE3A 4F2JC 1TN9A 4LF7E 4DR7E 2LCEA 1JK2A 4NXNE 2HC5A 2L33A 3ZOQB 4BCAA 1F2IG 3VK6A 4JI3E 2EL5A 3JU0A 1A1JA 1JK1A 2FGGA 1IBLE 2EMZA 2WBUA 3MHSC 2YTOA 4M2ZA 4DR4E 3ADJA 2JYAA 1X49A 2YT4A 1UN6B 1G2DC 5DNYA 4YY3E 1N36E 4NZVA 2ODRC 5A2QC 2LVHA 2UUCE 5AC5A 2N3HA 4DUZE 2VE7C 5IXMB 4DV6E 2EZ6A 4IS1C 2M4IA 2MDRA 2EORA 3RMPA 1RC7A 2EPOA 4GKJE 4P7DA 4WFTA 2EPZA 2DMIA 4DV5E 4X64E 2NUEA 2JWOA 3OMLA 3IWCA 4LFCE 2YTNA 1A1IA 2JOXA 2DB2A 4BC9A 1XNRE 2BBGA 4X9JA 1YZ9A 4NXME 4RHBB 2ENAA 2V8QB 4B3ME 4Q35B 1N32E 2HHHE 4BMJA 2ADRA 5KL6A 1A1KA 3T1HE 1IQOA 3K6QA 5A6AA 1ZBQA 4JI5E 1YFHA 3BGHA 4R2SA 2L3CA 4BHBA 5CFFE 2EN3A 3ADIA 1WXRA 2EMXA 1T39A 4DR6E 3C6MA 5KL7A 3J80C 2FTXB 1DGCA 4NHRA 2J7JA 1ZR9A 4TUGA 1PJTA 5AE2A 4LF5E 2EPRA 4ZYDA 2A25A 2L92A 4X65E 1G2FC 2JVAA 3F6HA 4IJDA 1FJGE 5ADZA 4ZYEA 2VRDA 4DKKA 2EQ0A 2EPUA 2N8XA 3MSWA 1QNTA 2LUQA 3QG5C 4BS9A 2UUAE 2UXBE 3J81C 3H09A 1T4LB 4R8OA 5AE1A 4DV3E 1T4NA 2DGCA 1RQ0A 3THNA 2RTXA 2EQ3A 2MKNA 4LF8E 4JYAE 2M9AA 4WX9A 2M1SA 1YYKA 5AC4A 2EOFA 1UILA 2LV2A 2EMIA 2YWQA 3HTXA 1EH8A 3J7AG 2YTEA 2EN2A 2KONA 1HR0E 1KJKA 4P78A 2DLQA 3EPHA 3ADLA 2YRHA 1X48A 1QU6A 1XMOE 2B7TA 5A69A 4DR2E 3IWBA 1Z1BA 3ADGA 3M99B 1T4OA 5A6BD 1WHNA 3BBGA 2EM3A 2EOJA 3JTZA 1J5EE 4LF9E 2RS6A 2B3TB 1T38A 2V86A 1IMUA 1RMDA 5IT9C 1I94E 2WCC3 5TSEA 5A6JA 4WYQB 2EPXA 2EOQA 1A1FA 4X62E 4O5GA 1YPNA 4X8WA 3J7Yp 2EN8A 4WXCA 4DV7E 1AAYA 2EWLA 5KL4A 1N34E 4J8ZA 4WSGA 1UHZA 1YYWA 4OOGC 2EOYA 3HPZA 2EE8A 4ZYHA 1UBDC 2JOBA 2RS7A 1PKPA 1AH5A 2EPCA 4BHCA 1IQSA 3VYYA 1A1GA 4JI2E 4Q28A 2M7QA 2MDGA 2NUFA 2Q8UA 2YSOA 3KWRA 2GLIA 4F9AB 4KWYA 2I9IA 2EN1A 4DR1E 4HEIA 2RQLA 2EP3A 2YPNA 1KYQA 2HGHA 1TF3A 3F6GA 2YTDA 2K7IA 2E72A 2PRTA 2HJJA 1FKAE 1DI2A 4LF6E 4F6MA 4L5NC 4O43A 1BBGA 2L8TA 2EPNA 4R2PA 4K0KE 3P1XA 5AASA 1PJQA 1EH7A 3T1YE 3BF2A 2EQ1A 2RPCA 3EPJA 2V89A 4ZYGA 2EOIA 2ENCA 4LU9A 2I13A 1WHQA 3C4TA 5FLXC 1MEYC 4F54A 1NEIA 2MC6A 2BB8A 2E5LE 2B7VA 3JAMC 4LTYA 1X3CA 1X6HA 2EM7A 2LTSA 5A6KA 2B9DA 2UU9E 2L6MA 2EL4A 2V83A 2EM6A 4X66E 5KL3A 2LMZA 4FK5C 4O4KA 1HNXE 2DIXA 5KL2A 1B69A 2RSIA 2KOUA 2YU8A 1X47A 4L8NA 5IV8B 2L2NA 1N33E 4TUIA 1A1LA 3EQ1A 2JPAA 4M9VC 1PDAA 2GHFA 1ZAAC 5IWAE 2LTRA 1YUIA 5KL5A 3OTOE 2EM5A 1DQ3A 4DR5E 2EOEA 2L2KB 2YTIA 1IBME 4OX9E 2EOOA 5F3WA 4MLVA 4JI1E 1STUA 4M0VA 2WBTA 2EOXA 2UXCE 2NA2A 3VHTB 4LFBE 3BIDA 5BR8E 2JP9A 3KZYA 2V87A 2ELZA 2JR1A 1XMQE 4JI6E 4R03A 2DLKA 3HXLA 3DJWA 4WSPA 2LT7A 3VYXA 4GKKE 1PJSA 2EMCA 2R76A 3UK3C 4JI0E 2VF1A 2EM4A 2LUPB 2EPPA 2CTDA 4JI8E 4DV4E 2ELYA 2WBSA 2LRSA 4O24A 1HNWE 2CPNA 2EMBA 2CSHA 4F9CB 2JY9A 4R2EA 2EMHA 1EH6A 2ODRD 4GZNC 2RSMA 5T6JA 2LO3A 1YYOA 2DMYA 3LMLA 2LE2A 4KHPE 1O0WA 3ECRA 2YTFA 1MGTA 2IHR1 2EMFA 1YUJA 2DRPA 2DSYA 2EOSA 4WPYA 2EM0A 2GPIA 4YHHE 2EMLA 2LJHA 5LMUE 4DR3E 1ZBTA 2LBSB 1ZU1A 2YTJA 4B3TE 3DF6A 3FIGA 4R2QA 2MC5A 2EOZA 1L4SA 2JXPA 3L00A 4M30A 2EMAA 2YTPA 3EPKA 4DV2E 2F8BA 3LLHA 3C6KA 2L2MA 2MKDA 4HTGA 2D9HA 2NUGA 4RH8A 4LF4E 1WJPA 5LMNE 4R2RA 2KHXA 2EM8A 4LFAE 1BBOA 2K4VA 4AQYE 1NCSA 3C4BA 4MLQA 4DUYE 2UXDE 2EMWA 2YZTA 5LLQA 2EPMX 4R2DA 4DV1E 1WRJA 1SR9A
chains in the Genus database with same CATH topology
2LTRA 1T4OA 3AUZA 4I8OA 3RMPA 1RC7A 1WHNA 4JI3E 3OTOE 2V85A 2ZM6E 4GKJE 3JTZA 2FV4B 4P7DA 4WFTA 1DQ3A 1J5EE 4LF9E 1GZ6A 2RS6A 4DMIA 2B3TB 4DV0E 4DV5E 4DR5E 2V86A 4X64E 2UUAE 2NUEA 2JWOA 3OMLA 3IWCA 2WZOA 2L2KB 2LBSB 4LFCE 5IT9C 1I94E 1J26A 4F9BB 1IBME 4WYQB 4OX9E 2JOXA 2DB2A 4BC9A 4X62E 4X8WA 5F3WA 1XNRE 4JI1E 3HPSA 3J7Yp 2UUBE 1STUA 4M0VA 1YZ9A 2UXCE 4DV7E 2NA2A 4LFBE 2EWLA 4NXME 2L3JA 5BR8E 1N34E 4J8ZA 1UHZA 1YYWA 4OOGC 2V87A 2JR1A 2V8QB 1XMQE 4JI6E 5LL6R 3HPZA 4B3ME 2V88A 4B3SE 4R03A 2HHHE 1N32E 3HXLA 3DJWA 2JOBA 2RS7A 4WSPA 1PKPA 3IWDA 4BMJA 4JI2E 3VYYA 1XNQE 3VYXA 3T1HE 5LMUE 4GKKE 3K6QA 4Q28A 1ZBQA 1IBKE 4JI5E 4JI0E 2M7QA 2L3CA 2NUFA 2VF1A 2E1MA 2LUPB 5CFFE 1EKZA 3KWRA 4JI8E 4DV4E 4F9AB 2LRSA 4DR1E 2N3GA 4KZSA 2CPNA 1HNWE 4F9CB 3ADIA 1WXRA 2JY9A 3AV0A 4BBYA 4DR6E 3F6GA 3J80C 4JV5E 2ODRD 2FTXB 2RSMA 5T6JA 4BC7A 4JI7E 1HNZE 4TUGA 1YYOA 2DMYA 5AE2A 1FKAE 1DI2A 3LMLA 2LE2A 4LF5E 4KHPE 2F4VE 4LF6E 1O0WA 4L5NC 2VQEE 2G7HA 2L8TA 2L92A 2H36X 2IHR1 4X65E 4K0KE 1GQEA 3P1XA 5AASA 4DR3E 4B3RE 2JVAA 3F6HA 2DSYA 3T1YE 1FJGE 5ADZA 2VQFE 3HQ1A 4GEQB 4WPYA 2V89A 4DKKA 5AE3A 4JI4E 4LF7E 4DR7E 4NXNE 2UXBE 4YHHE 4LU9A 3MSWA 1WHQA 2L33A 2LJHA 1ZBTA 2LUQA 3C4TA 3ZOQB 3VK6A 4BCAA 4F54A 5FLXC 4B3TE 2MC6A 3DF6A 3FIGA 4BS9A 3J81C 3H09A 3JU0A 1T4LB 4R8OA 5AE1A 4DV3E 2E5LE 2B7VA 1T4NA 2MC5A 3JAMC 4LTYA 1RQ0A 4M30A 2LTSA 2FGGA 1IBLE 4DV2E 2B9DA 2F8BA 3LLHA 2UU9E 2RTXA 2L2MA 4M2ZA 2L6MA 2NUGA 4DR4E 3ADJA 4LF8E 4JYAE 2V83A 4LF4E 1X49A 2M1SA 2YT4A 4X66E 5LMNE 2LMZA 5DNYA 1YYKA 2KHXA 1UILA 1HNXE 4YY3E 2DIXA 1N36E 4LFAE 3HTXA 3J7AG 2ODRC 2KOUA 5A2QC 1X47A 2K4VA 4L8NA 3ADGA 4AQYE 2L2NA 3C4BA 2KONA 2UUCE 4DUYE 1HR0E 1N33E 2UXDE 2N3HA 2YZTA 2VE7C 4P78A 4TUIA 4DUZE 4DV6E 2EZ6A 3ADLA 1X48A 4DV1E 1QU6A 1XMOE 1SR9A 2B7TA 2M4IA 4DR2E 3IWBA 5IWAE 2MDRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L8T A; 
#chains in the Genus database with same CATH topology
 3AUZ A;  4I8O A;  2EN6 A;  2V85 A;  2ZM6 E;  2EMY A;  1P47 A;  2FV4 B;  5A6B A;  1GZ6 A;  2EOM A;  4DMI A;  4DV0 E;  3THO B;  1TF6 A;  2WZO A;  1J26 A;  4F9B B;  2LJU A;  1GTK A;  2EPL X;  3HPS A;  2UUB E;  2EPA A;  4N4R B;  1X6F A;  2L3J A;  4R2C A;  5LL6 R;  2V88 A;  4B3S E;  2EMG A;  2R1F A;  2YRM A;  2EMK A;  3IWD A;  2EOH A;  2YU5 A;  1X6E A;  1XNQ E;  2NAB A;  2YRK A;  2EN7 A;  1IBK E;  3MHH C;  2E1M A;  1EKZ A;  3TQM A;  4F6N A;  1SFE A;  1X5W A;  2EN4 A;  2N3G A;  2ENH A;  4KZS A;  3EPL A;  3AV0 A;  4BBY A;  1LLM C;  2EJ4 A;  4JV5 E;  2CT1 A;  4WXD A;  4BC7 A;  4JI7 E;  1HNZ E;  1YSA C;  1A1H A;  4R2A A;  2EPK X;  3KZZ A;  2EL6 A;  2F4V E;  2EM9 A;  1N3G A;  2VQE E;  2G7H A;  2H36 X;  2YTG A;  2YTQ A;  1GQE A;  4B3R E;  1BB8 A;  2YSP A;  2VQF E;  3HQ1 A;  4GEQ B;  2EM2 A;  4JI4 E;  5AE3 A;  4F2J C;  1TN9 A;  4LF7 E;  4DR7 E;  2LCE A;  1JK2 A;  4NXN E;  2HC5 A;  2L33 A;  3ZOQ B;  4BCA A;  1F2I G;  3VK6 A;  4JI3 E;  2EL5 A;  3JU0 A;  1A1J A;  1JK1 A;  2FGG A;  1IBL E;  2EMZ A;  2WBU A;  3MHS C;  2YTO A;  4M2Z A;  4DR4 E;  3ADJ A;  2JYA A;  1X49 A;  2YT4 A;  1UN6 B;  1G2D C;  5DNY A;  4YY3 E;  1N36 E;  4NZV A;  2ODR C;  5A2Q C;  2LVH A;  2UUC E;  5AC5 A;  2N3H A;  4DUZ E;  2VE7 C;  5IXM B;  4DV6 E;  2EZ6 A;  4IS1 C;  2M4I A;  2MDR A;  2EOR A;  3RMP A;  1RC7 A;  2EPO A;  4GKJ E;  4P7D A;  4WFT A;  2EPZ A;  2DMI A;  4DV5 E;  4X64 E;  2NUE A;  2JWO A;  3OML A;  3IWC A;  4LFC E;  2YTN A;  1A1I A;  2JOX A;  2DB2 A;  4BC9 A;  1XNR E;  2BBG A;  4X9J A;  1YZ9 A;  4NXM E;  4RHB B;  2ENA A;  2V8Q B;  4B3M E;  4Q35 B;  1N32 E;  2HHH E;  4BMJ A;  2ADR A;  5KL6 A;  1A1K A;  3T1H E;  1IQO A;  3K6Q A;  5A6A A;  1ZBQ A;  4JI5 E;  1YFH A;  3BGH A;  4R2S A;  2L3C A;  4BHB A;  5CFF E;  2EN3 A;  3ADI A;  1WXR A;  2EMX A;  1T39 A;  4DR6 E;  3C6M A;  5KL7 A;  3J80 C;  2FTX B;  1DGC A;  4NHR A;  2J7J A;  1ZR9 A;  4TUG A;  1PJT A;  5AE2 A;  4LF5 E;  2EPR A;  4ZYD A;  2A25 A;  2L92 A;  4X65 E;  1G2F C;  2JVA A;  3F6H A;  4IJD A;  1FJG E;  5ADZ A;  4ZYE A;  2VRD A;  4DKK A;  2EQ0 A;  2EPU A;  2N8X A;  3MSW A;  1QNT A;  2LUQ A;  3QG5 C;  4BS9 A;  2UUA E;  2UXB E;  3J81 C;  3H09 A;  1T4L B;  4R8O A;  5AE1 A;  4DV3 E;  1T4N A;  2DGC A;  1RQ0 A;  3THN A;  2RTX A;  2EQ3 A;  2MKN A;  4LF8 E;  4JYA E;  2M9A A;  4WX9 A;  2M1S A;  1YYK A;  5AC4 A;  2EOF A;  1UIL A;  2LV2 A;  2EMI A;  2YWQ A;  3HTX A;  1EH8 A;  3J7A G;  2YTE A;  2EN2 A;  2KON A;  1HR0 E;  1KJK A;  4P78 A;  2DLQ A;  3EPH A;  3ADL A;  2YRH A;  1X48 A;  1QU6 A;  1XMO E;  2B7T A;  5A69 A;  4DR2 E;  3IWB A;  1Z1B A;  3ADG A;  3M99 B;  1T4O A;  5A6B D;  1WHN A;  3BBG A;  2EM3 A;  2EOJ A;  3JTZ A;  1J5E E;  4LF9 E;  2RS6 A;  2B3T B;  1T38 A;  2V86 A;  1IMU A;  1RMD A;  5IT9 C;  1I94 E;  2WCC 3;  5TSE A;  5A6J A;  4WYQ B;  2EPX A;  2EOQ A;  1A1F A;  4X62 E;  4O5G A;  1YPN A;  4X8W A;  3J7Y p;  2EN8 A;  4WXC A;  4DV7 E;  1AAY A;  2EWL A;  5KL4 A;  1N34 E;  4J8Z A;  4WSG A;  1UHZ A;  1YYW A;  4OOG C;  2EOY A;  3HPZ A;  2EE8 A;  4ZYH A;  1UBD C;  2JOB A;  2RS7 A;  1PKP A;  1AH5 A;  2EPC A;  4BHC A;  1IQS A;  3VYY A;  1A1G A;  4JI2 E;  4Q28 A;  2M7Q A;  2MDG A;  2NUF A;  2Q8U A;  2YSO A;  3KWR A;  2GLI A;  4F9A B;  4KWY A;  2I9I A;  2EN1 A;  4DR1 E;  4HEI A;  2RQL A;  2EP3 A;  2YPN A;  1KYQ A;  2HGH A;  1TF3 A;  3F6G A;  2YTD A;  2K7I A;  2E72 A;  2PRT A;  2HJJ A;  1FKA E;  1DI2 A;  4LF6 E;  4F6M A;  4L5N C;  4O43 A;  1BBG A;  2L8T A;  2EPN A;  4R2P A;  4K0K E;  3P1X A;  5AAS A;  1PJQ A;  1EH7 A;  3T1Y E;  3BF2 A;  2EQ1 A;  2RPC A;  3EPJ A;  2V89 A;  4ZYG A;  2EOI A;  2ENC A;  4LU9 A;  2I13 A;  1WHQ A;  3C4T A;  5FLX C;  1MEY C;  4F54 A;  1NEI A;  2MC6 A;  2BB8 A;  2E5L E;  2B7V A;  3JAM C;  4LTY A;  1X3C A;  1X6H A;  2EM7 A;  2LTS A;  5A6K A;  2B9D A;  2UU9 E;  2L6M A;  2EL4 A;  2V83 A;  2EM6 A;  4X66 E;  5KL3 A;  2LMZ A;  4FK5 C;  4O4K A;  1HNX E;  2DIX A;  5KL2 A;  1B69 A;  2RSI A;  2KOU A;  2YU8 A;  1X47 A;  4L8N A;  5IV8 B;  2L2N A;  1N33 E;  4TUI A;  1A1L A;  3EQ1 A;  2JPA A;  4M9V C;  1PDA A;  2GHF A;  1ZAA C;  5IWA E;  2LTR A;  1YUI A;  5KL5 A;  3OTO E;  2EM5 A;  1DQ3 A;  4DR5 E;  2EOE A;  2L2K B;  2YTI A;  1IBM E;  4OX9 E;  2EOO A;  5F3W A;  4MLV A;  4JI1 E;  1STU A;  4M0V A;  2WBT A;  2EOX A;  2UXC E;  2NA2 A;  3VHT B;  4LFB E;  3BID A;  5BR8 E;  2JP9 A;  3KZY A;  2V87 A;  2ELZ A;  2JR1 A;  1XMQ E;  4JI6 E;  4R03 A;  2DLK A;  3HXL A;  3DJW A;  4WSP A;  2LT7 A;  3VYX A;  4GKK E;  1PJS A;  2EMC A;  2R76 A;  3UK3 C;  4JI0 E;  2VF1 A;  2EM4 A;  2LUP B;  2EPP A;  2CTD A;  4JI8 E;  4DV4 E;  2ELY A;  2WBS A;  2LRS A;  4O24 A;  1HNW E;  2CPN A;  2EMB A;  2CSH A;  4F9C B;  2JY9 A;  4R2E A;  2EMH A;  1EH6 A;  2ODR D;  4GZN C;  2RSM A;  5T6J A;  2LO3 A;  1YYO A;  2DMY A;  3LML A;  2LE2 A;  4KHP E;  1O0W A;  3ECR A;  2YTF A;  1MGT A;  2IHR 1;  2EMF A;  1YUJ A;  2DRP A;  2DSY A;  2EOS A;  4WPY A;  2EM0 A;  2GPI A;  4YHH E;  2EML A;  2LJH A;  5LMU E;  4DR3 E;  1ZBT A;  2LBS B;  1ZU1 A;  2YTJ A;  4B3T E;  3DF6 A;  3FIG A;  4R2Q A;  2MC5 A;  2EOZ A;  1L4S A;  2JXP A;  3L00 A;  4M30 A;  2EMA A;  2YTP A;  3EPK A;  4DV2 E;  2F8B A;  3LLH A;  3C6K A;  2L2M A;  2MKD A;  4HTG A;  2D9H A;  2NUG A;  4RH8 A;  4LF4 E;  1WJP A;  5LMN E;  4R2R A;  2KHX A;  2EM8 A;  4LFA E;  1BBO A;  2K4V A;  4AQY E;  1NCS A;  3C4B A;  4MLQ A;  4DUY E;  2UXD E;  2EMW A;  2YZT A;  5LLQ A;  2EPM X;  4R2D A;  4DV1 E;  1WRJ A;  1SR9 A; 
#chains in the Genus database with same CATH homology
 2LTR A;  1T4O A;  3AUZ A;  4I8O A;  3RMP A;  1RC7 A;  1WHN A;  4JI3 E;  3OTO E;  2V85 A;  2ZM6 E;  4GKJ E;  3JTZ A;  2FV4 B;  4P7D A;  4WFT A;  1DQ3 A;  1J5E E;  4LF9 E;  1GZ6 A;  2RS6 A;  4DMI A;  2B3T B;  4DV0 E;  4DV5 E;  4DR5 E;  2V86 A;  4X64 E;  2UUA E;  2NUE A;  2JWO A;  3OML A;  3IWC A;  2WZO A;  2L2K B;  2LBS B;  4LFC E;  5IT9 C;  1I94 E;  1J26 A;  4F9B B;  1IBM E;  4WYQ B;  4OX9 E;  2JOX A;  2DB2 A;  4BC9 A;  4X62 E;  4X8W A;  5F3W A;  1XNR E;  4JI1 E;  3HPS A;  3J7Y p;  2UUB E;  1STU A;  4M0V A;  1YZ9 A;  2UXC E;  4DV7 E;  2NA2 A;  4LFB E;  2EWL A;  4NXM E;  2L3J A;  5BR8 E;  1N34 E;  4J8Z A;  1UHZ A;  1YYW A;  4OOG C;  2V87 A;  2JR1 A;  2V8Q B;  1XMQ E;  4JI6 E;  5LL6 R;  3HPZ A;  4B3M E;  2V88 A;  4B3S E;  4R03 A;  2HHH E;  1N32 E;  3HXL A;  3DJW A;  2JOB A;  2RS7 A;  4WSP A;  1PKP A;  3IWD A;  4BMJ A;  4JI2 E;  3VYY A;  1XNQ E;  3VYX A;  3T1H E;  5LMU E;  4GKK E;  3K6Q A;  4Q28 A;  1ZBQ A;  1IBK E;  4JI5 E;  4JI0 E;  2M7Q A;  2L3C A;  2NUF A;  2VF1 A;  2E1M A;  2LUP B;  5CFF E;  1EKZ A;  3KWR A;  4JI8 E;  4DV4 E;  4F9A B;  2LRS A;  4DR1 E;  2N3G A;  4KZS A;  2CPN A;  1HNW E;  4F9C B;  3ADI A;  1WXR A;  2JY9 A;  3AV0 A;  4BBY A;  4DR6 E;  3F6G A;  3J80 C;  4JV5 E;  2ODR D;  2FTX B;  2RSM A;  5T6J A;  4BC7 A;  4JI7 E;  1HNZ E;  4TUG A;  1YYO A;  2DMY A;  5AE2 A;  1FKA E;  1DI2 A;  3LML A;  2LE2 A;  4LF5 E;  4KHP E;  2F4V E;  4LF6 E;  1O0W A;  4L5N C;  2VQE E;  2G7H A;  2L8T A;  2L92 A;  2H36 X;  2IHR 1;  4X65 E;  4K0K E;  1GQE A;  3P1X A;  5AAS A;  4DR3 E;  4B3R E;  2JVA A;  3F6H A;  2DSY A;  3T1Y E;  1FJG E;  5ADZ A;  2VQF E;  3HQ1 A;  4GEQ B;  4WPY A;  2V89 A;  4DKK A;  5AE3 A;  4JI4 E;  4LF7 E;  4DR7 E;  4NXN E;  2UXB E;  4YHH E;  4LU9 A;  3MSW A;  1WHQ A;  2L33 A;  2LJH A;  1ZBT A;  2LUQ A;  3C4T A;  3ZOQ B;  3VK6 A;  4BCA A;  4F54 A;  5FLX C;  4B3T E;  2MC6 A;  3DF6 A;  3FIG A;  4BS9 A;  3J81 C;  3H09 A;  3JU0 A;  1T4L B;  4R8O A;  5AE1 A;  4DV3 E;  2E5L E;  2B7V A;  1T4N A;  2MC5 A;  3JAM C;  4LTY A;  1RQ0 A;  4M30 A;  2LTS A;  2FGG A;  1IBL E;  4DV2 E;  2B9D A;  2F8B A;  3LLH A;  2UU9 E;  2RTX A;  2L2M A;  4M2Z A;  2L6M A;  2NUG A;  4DR4 E;  3ADJ A;  4LF8 E;  4JYA E;  2V83 A;  4LF4 E;  1X49 A;  2M1S A;  2YT4 A;  4X66 E;  5LMN E;  2LMZ A;  5DNY A;  1YYK A;  2KHX A;  1UIL A;  1HNX E;  4YY3 E;  2DIX A;  1N36 E;  4LFA E;  3HTX A;  3J7A G;  2ODR C;  2KOU A;  5A2Q C;  1X47 A;  2K4V A;  4L8N A;  3ADG A;  4AQY E;  2L2N A;  3C4B A;  2KON A;  2UUC E;  4DUY E;  1HR0 E;  1N33 E;  2UXD E;  2N3H A;  2YZT A;  2VE7 C;  4P78 A;  4TUI A;  4DUZ E;  4DV6 E;  2EZ6 A;  3ADL A;  1X48 A;  4DV1 E;  1QU6 A;  1XMO E;  1SR9 A;  2B7T A;  2M4I A;  4DR2 E;  3IWB A;  5IWA E;  2MDR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...