2L8TA

Staphylococcus aureus pathogenicity island 1 protein gp6, an internal scaffold in size determination
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
ETKYELNNTKKVANAFGLNEEDTNLLINAVDLDIKNNMQEISSELQQSEQSKQKQYGTTLQNLAKQNRIIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Transposon Tn557 toxic shock syndrome toxin-1
publication title The Staphylococcus aureus Pathogenicity Island 1 Protein gp6 Functions as an Internal Scaffold during Capsid Size Determination.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 11
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.410 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l8tA00
2L8TA
chains in the Genus database with same CATH superfamily
4RH8A 2HJJA 1BBOA 4JI0E 3F6HA 4LU9A 4N4RB 1A1HA 4X64E 1X5WA 4LF9E 2GHFA 2EM7A 2JVAA 3MHSC 2PRTA 2UXBE 1WRJA 2NA2A 4YY3E 4F9AB 1UBDC 2EN4A 3MSWA 5AC5A 2YU5A 4OOGC 2NUEA 4TUIA 5LL6R 4MLVA 2YTDA 4ZYEA 2CSHA 2EMBA 3L00A 3EPKA 1WHNA 4WSPA 1YYKA 1X6FA 3EPLA 4X8WA 1EKZA 2EOFA 2EM5A 2EM2A 5TSEA 4DR2E 2RTXA 4K0KE 2Q8UA 2GLIA 1GTKA 1IQSA 1JK1A 4DR3E 4DV1E 4DKKA 5A6BA 4GZNC 2EZ6A 2EOYA 2MC6A 2EM8A 4KZSA 2EPMX 3LLHA 3JU0A 2E5LE 4DR5E 3TQMA 2VF1A 4BBYA 4DMIA 2YTIA 2R76A 2EJ4A 2EM3A 2JR1A 4LF5E 3VYXA 2EOSA 4GKJE 2EQ1A 4ZYHA 1Z1BA 4X62E 2YSOA 1X47A 2EPCA 1F2IG 2DB2A 3AV0A 1PJSA 2EM4A 2EN7A 2LTSA 4X9JA 2CT1A 2MDRA 2EOHA 2RQLA 3HQ1A 3P1XA 5A6KA 1GZ6A 4YHHE 3HXLA 3VYYA 2LVHA 3H09A 1SR9A 2EOQA 1T39A 3VHTB 2DLKA 4HEIA 2VQFE 1A1GA 2EN6A 3OMLA 1IBKE 3RMPA 4DR4E 2V85A 4F54A 4NXME 2B9DA 4WSGA 1DI2A 2LMZA 2N3GA 4AQYE 2K4VA 2LUPB 4JI5E 4DUYE 1T4OA 2YSPA 2B7TA 2LJHA 4BHCA 2NUGA 4F9CB 2EOXA 4ZYDA 2B3TB 2YPNA 2YRKA 4X65E 2KOUA 2BBGA 1N33E 5T6JA 1PDAA 5AC4A 2EOOA 3K6QA 4B3ME 3BF2A 5F3WA 4R2QA 3J7AG 2YTQA 4LF8E 5ADZA 2I9IA 2EMHA 2M1SA 1X6EA 1DQ3A 2E1MA 2EL5A 1G2DC 1QNTA 4J8ZA 4IS1C 2DIXA 3J81C 3ADIA 3IWDA 1NCSA 4GKKE 5A6JA 1BB8A 2EMZA 1UHZA 1X6HA 2L92A 5A6AA 2DMIA 2MC5A 4JYAE 2YTNA 1ZAAC 4MLQA 1MGTA 3ADJA 1GQEA 4LFAE 1N3GA 2L3JA 3JAMC 2JWOA 2HGHA 1X49A 3J80C 1ZBQA 1PJTA 2NUFA 2YZTA 1DGCA 3C6KA 4LFBE 2YU8A 4DV5E 1XNQE 2UUBE 2BB8A 1B69A 2RS7A 2UU9E 2VRDA 4M30A 2J7JA 2YTGA 1T38A 2NABA 1YPNA 4DR7E 2RSMA 3C6MA 4ZYGA 5A2QC 2EPUA 3BBGA 1KJKA 4R2CA 3M99B 1AH5A 2HC5A 3DJWA 3VK6A 4IJDA 1IBLE 3J7Yp 3ECRA 2EMIA 1EH8A 2EMLA 2KHXA 3BGHA 5KL2A 5BR8E 3ADGA 4LFCE 1RMDA 2JOBA 1QU6A 4F2JC 3EQ1A 4LF7E 1IQOA 2LBSB 1T4NA 1I94E 4R2SA 1YSAC 2L33A 2EMWA 2EPNA 2UXCE 2EOJA 2L8TA 4NZVA 2LT7A 2LUQA 2CTDA 2N3HA 2EL6A 5CFFE 4Q35B 1JK2A 3AUZA 2FV4B 2EOMA 2A25A 2EMGA 1A1LA 3KZYA 1AAYA 4KHPE 4DV0E 5LMUE 2L2MA 5IXMB 4B3RE 4JI1E 2DRPA 2IHR1 2EMXA 2EP3A 2FGGA 2EPPA 1IMUA 2K7IA 1G2FC 4BC9A 2ENHA 1EH7A 4NXNE 5A6BD 2DLQA 4O5GA 2EMFA 1KYQA 4R2PA 2EN3A 2WCC3 2V87A 2B7VA 2RSIA 2YRHA 5AASA 2L3CA 2EM6A 1YZ9A 4R8OA 3FIGA 1X3CA 2EQ0A 5KL7A 4M2ZA 2CPNA 2ODRD 5IV8B 4F9BB 2EN2A 2M7QA 1RQ0A 2EM0A 2EL4A 2EMYA 2JPAA 2LE2A 4P78A 2L2KB 4F6NA 4R2EA 2UUAE 4WPYA 2EN8A 4DUZE 4WXCA 4BCAA 4DR6E 4GEQB 3HTXA 5LMNE 2EN1A 1YYOA 2YTOA 3THOB 2I13A 2WBTA 3EPHA 1YUJA 3ZOQB 4LTYA 4DV3E 2EPLX 1YUIA 3HPZA 4P7DA 2EM9A 2RS6A 1UILA 1STUA 4L8NA 1WHQA 2V86A 4LF6E 2N8XA 2LV2A 2JXPA 1XMQE 1UN6B 4JI7E 1ZU1A 4DR1E 2EOEA 2VE7C 3UK3C 3DF6A 2FTXB 4BS9A 3ADLA 1N34E 4O24A 2JP9A 2H36X 3BIDA 2WBSA 1FKAE 2DSYA 4JI8E 2M9AA 2UUCE 5AE2A 2YTEA 3OTOE 3F6GA 2F8BA 5A69A 4M0VA 2RPCA 4I8OA 1A1JA 2DMYA 3MHHC 5KL3A 4F6MA 1A1IA 2LRSA 1HNXE 2WBUA 1X48A 2MDGA 2EPZA 2MKDA 1YYWA 4BC7A 2GPIA 2YT4A 1A1FA 2ADRA 2ODRC 3T1HE 4HTGA 4DV7E 2EWLA 2UXDE 2M4IA 2VQEE 1ZR9A 1PKPA 2LCEA 2YTFA 4WX9A 1XMOE 1WXRA 4JV5E 2EPAA 4JI6E 1YFHA 1XNRE 1L4SA 4OX9E 1NEIA 2YWQA 2EORA 4BHBA 4B3SE 2YTPA 3QG5C 2KONA 4FK5C 1MEYC 3IWBA 1BBGA 1ZBTA 5KL4A 3LMLA 2V83A 2G7HA 2ENAA 2JY9A 4RHBB 5AE1A 2L6MA 4WXDA 4TUGA 2E72A 5FLXC 1IBME 4R2AA 2ELYA 4JI2E 2JOXA 2YTJA 1EH6A 2V8QB 5DNYA 4R2DA 1T4LB 4B3TE 2YRMA 1HNZE 4WYQB 2V88A 1PJQA 4X66E 2EE8A 3IWCA 4NHRA 2EPXA 2V89A 1A1KA 5IWAE 2LTRA 2EMCA 2EQ3A 2ELZA 5IT9C 3C4BA 1TF3A 3THNA 2ZM6E 3KZZA 1SFEA 2ENCA 2R1FA 1TF6A 1FJGE 4R03A 4M9VC 1LLMC 3HPSA 1HR0E 4DV4E 3C4TA 4WFTA 4LF4E 4DV6E 4KWYA 4DV2E 4BMJA 3T1YE 2EPRA 2EOIA 1WJPA 2WZOA 1N36E 1N32E 1HNWE 4JI4E 2F4VE 2EMAA 4L5NC 5LLQA 1J26A 3JTZA 4JI3E 2D9HA 4O43A 4O4KA 2L2NA 1J5EE 2EPKX 3EPJA 2EMKA 2JYAA 1RC7A 5KL6A 1TN9A 2MKNA 4Q28A 2EOZA 2LO3A 1O0WA 5AE3A 4R2RA 2EPOA 2DGCA 5KL5A 1P47A 3KWRA 2HHHE 2LJUA
chains in the Genus database with same CATH topology
3K6QA 4B3ME 4DV7E 2EWLA 4BC9A 4JI0E 5F3WA 3F6HA 4LU9A 2UXDE 2M4IA 2VQEE 1PKPA 3J7AG 4X64E 4LF8E 5ADZA 2M1SA 4NXNE 4LF9E 1XMOE 2UXBE 2JVAA 1WXRA 4JV5E 1DQ3A 2NA2A 4YY3E 4F9AB 2E1MA 4JI6E 3MSWA 1XNRE 4OX9E 4J8ZA 2V87A 4OOGC 2NUEA 2B7VA 2DIXA 5AASA 4TUIA 4B3SE 5LL6R 3J81C 2KONA 2L3CA 3ADIA 3IWDA 1WHNA 4WSPA 1YZ9A 4R8OA 1YYKA 3IWBA 3FIGA 4GKKE 1UHZA 2L92A 4X8WA 1EKZA 4M2ZA 1ZBTA 2MC5A 2CPNA 2RTXA 2V83A 2G7HA 2JY9A 2ODRD 3LMLA 4DR2E 4JYAE 4F9BB 5AE1A 2M7QA 2L6MA 1RQ0A 4DR3E 4TUGA 4DV1E 3ADJA 4DKKA 5FLXC 1GQEA 4LFAE 2L3JA 2EZ6A 3JAMC 1IBME 2MC6A 4JI2E 2LE2A 2JOXA 2JWOA 4P78A 2V8QB 5DNYA 2L2KB 1X49A 1T4LB 4KZSA 4B3TE 3J80C 1ZBQA 1HNZE 2NUFA 4WYQB 2UUAE 3LLHA 2V88A 4WPYA 4X66E 2YZTA 3JU0A 2E5LE 4DR5E 3IWCA 4DUZE 2VF1A 4BCAA 4DR6E 4BBYA 2V89A 4GEQB 4DMIA 4DV5E 1XNQE 2UUBE 3HTXA 5IWAE 4LFBE 2JR1A 2RS7A 2LTRA 5LMNE 2UU9E 4LF5E 1YYOA 3VYXA 4M30A 4K0KE 4GKJE 5IT9C 4X62E 3C4BA 3ZOQB 4LTYA 4DV3E 1X47A 4DR7E 2DB2A 2RSMA 3AV0A 3HPZA 2ZM6E 4P7DA 5A2QC 2RS6A 2LTSA 1UILA 1FJGE 4R03A 1STUA 3HPSA 3DJWA 1HR0E 4L8NA 2MDRA 1WHQA 4DV4E 2V86A 4LF6E 3VK6A 3HQ1A 3P1XA 1IBLE 1GZ6A 3C4TA 4YHHE 3HXLA 3J7Yp 4WFTA 3VYYA 2KHXA 4DV6E 4LF4E 4DV2E 5BR8E 1XMQE 4BMJA 3H09A 3T1YE 1SR9A 4JI7E 4DR1E 3ADGA 4LFCE 2WZOA 2VE7C 3DF6A 1N36E 2JOBA 2FTXB 1QU6A 4LF7E 1N32E 4BS9A 2LBSB 3ADLA 1HNWE 2VQFE 1T4NA 1I94E 4JI4E 2F4VE 3OMLA 2L33A 1N34E 4L5NC 1IBKE 2H36X 3RMPA 2V85A 4F54A 4NXME 2B9DA 1FKAE 2DSYA 4DR4E 2UXCE 3JTZA 2L8TA 4JI8E 4JI3E 1J26A 2LUQA 1DI2A 2LMZA 2N3GA 4AQYE 2K4VA 2UUCE 2L2NA 5AE2A 3OTOE 2LUPB 1J5EE 4JI5E 3F6GA 2F8BA 2N3HA 4DUYE 4M0VA 1T4OA 4I8OA 2B7TA 2LJHA 5CFFE 2DMYA 1RC7A 2NUGA 4F9CB 3AUZA 2FV4B 4Q28A 2LRSA 1HNXE 1O0WA 5AE3A 1X48A 2B3TB 4KHPE 4DV0E 5LMUE 2L2MA 1YYWA 4B3RE 4BC7A 4X65E 4JI1E 2KOUA 2YT4A 2IHR1 3KWRA 2HHHE 2ODRC 1N33E 3T1HE 5T6JA 2FGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L8T A; 
#chains in the Genus database with same CATH topology
 4RH8 A;  2HJJ A;  1BBO A;  4JI0 E;  3F6H A;  4LU9 A;  4N4R B;  1A1H A;  4X64 E;  1X5W A;  4LF9 E;  2GHF A;  2EM7 A;  2JVA A;  3MHS C;  2PRT A;  2UXB E;  1WRJ A;  2NA2 A;  4YY3 E;  4F9A B;  1UBD C;  2EN4 A;  3MSW A;  5AC5 A;  2YU5 A;  4OOG C;  2NUE A;  4TUI A;  5LL6 R;  4MLV A;  2YTD A;  4ZYE A;  2CSH A;  2EMB A;  3L00 A;  3EPK A;  1WHN A;  4WSP A;  1YYK A;  1X6F A;  3EPL A;  4X8W A;  1EKZ A;  2EOF A;  2EM5 A;  2EM2 A;  5TSE A;  4DR2 E;  2RTX A;  4K0K E;  2Q8U A;  2GLI A;  1GTK A;  1IQS A;  1JK1 A;  4DR3 E;  4DV1 E;  4DKK A;  5A6B A;  4GZN C;  2EZ6 A;  2EOY A;  2MC6 A;  2EM8 A;  4KZS A;  2EPM X;  3LLH A;  3JU0 A;  2E5L E;  4DR5 E;  3TQM A;  2VF1 A;  4BBY A;  4DMI A;  2YTI A;  2R76 A;  2EJ4 A;  2EM3 A;  2JR1 A;  4LF5 E;  3VYX A;  2EOS A;  4GKJ E;  2EQ1 A;  4ZYH A;  1Z1B A;  4X62 E;  2YSO A;  1X47 A;  2EPC A;  1F2I G;  2DB2 A;  3AV0 A;  1PJS A;  2EM4 A;  2EN7 A;  2LTS A;  4X9J A;  2CT1 A;  2MDR A;  2EOH A;  2RQL A;  3HQ1 A;  3P1X A;  5A6K A;  1GZ6 A;  4YHH E;  3HXL A;  3VYY A;  2LVH A;  3H09 A;  1SR9 A;  2EOQ A;  1T39 A;  3VHT B;  2DLK A;  4HEI A;  2VQF E;  1A1G A;  2EN6 A;  3OML A;  1IBK E;  3RMP A;  4DR4 E;  2V85 A;  4F54 A;  4NXM E;  2B9D A;  4WSG A;  1DI2 A;  2LMZ A;  2N3G A;  4AQY E;  2K4V A;  2LUP B;  4JI5 E;  4DUY E;  1T4O A;  2YSP A;  2B7T A;  2LJH A;  4BHC A;  2NUG A;  4F9C B;  2EOX A;  4ZYD A;  2B3T B;  2YPN A;  2YRK A;  4X65 E;  2KOU A;  2BBG A;  1N33 E;  5T6J A;  1PDA A;  5AC4 A;  2EOO A;  3K6Q A;  4B3M E;  3BF2 A;  5F3W A;  4R2Q A;  3J7A G;  2YTQ A;  4LF8 E;  5ADZ A;  2I9I A;  2EMH A;  2M1S A;  1X6E A;  1DQ3 A;  2E1M A;  2EL5 A;  1G2D C;  1QNT A;  4J8Z A;  4IS1 C;  2DIX A;  3J81 C;  3ADI A;  3IWD A;  1NCS A;  4GKK E;  5A6J A;  1BB8 A;  2EMZ A;  1UHZ A;  1X6H A;  2L92 A;  5A6A A;  2DMI A;  2MC5 A;  4JYA E;  2YTN A;  1ZAA C;  4MLQ A;  1MGT A;  3ADJ A;  1GQE A;  4LFA E;  1N3G A;  2L3J A;  3JAM C;  2JWO A;  2HGH A;  1X49 A;  3J80 C;  1ZBQ A;  1PJT A;  2NUF A;  2YZT A;  1DGC A;  3C6K A;  4LFB E;  2YU8 A;  4DV5 E;  1XNQ E;  2UUB E;  2BB8 A;  1B69 A;  2RS7 A;  2UU9 E;  2VRD A;  4M30 A;  2J7J A;  2YTG A;  1T38 A;  2NAB A;  1YPN A;  4DR7 E;  2RSM A;  3C6M A;  4ZYG A;  5A2Q C;  2EPU A;  3BBG A;  1KJK A;  4R2C A;  3M99 B;  1AH5 A;  2HC5 A;  3DJW A;  3VK6 A;  4IJD A;  1IBL E;  3J7Y p;  3ECR A;  2EMI A;  1EH8 A;  2EML A;  2KHX A;  3BGH A;  5KL2 A;  5BR8 E;  3ADG A;  4LFC E;  1RMD A;  2JOB A;  1QU6 A;  4F2J C;  3EQ1 A;  4LF7 E;  1IQO A;  2LBS B;  1T4N A;  1I94 E;  4R2S A;  1YSA C;  2L33 A;  2EMW A;  2EPN A;  2UXC E;  2EOJ A;  2L8T A;  4NZV A;  2LT7 A;  2LUQ A;  2CTD A;  2N3H A;  2EL6 A;  5CFF E;  4Q35 B;  1JK2 A;  3AUZ A;  2FV4 B;  2EOM A;  2A25 A;  2EMG A;  1A1L A;  3KZY A;  1AAY A;  4KHP E;  4DV0 E;  5LMU E;  2L2M A;  5IXM B;  4B3R E;  4JI1 E;  2DRP A;  2IHR 1;  2EMX A;  2EP3 A;  2FGG A;  2EPP A;  1IMU A;  2K7I A;  1G2F C;  4BC9 A;  2ENH A;  1EH7 A;  4NXN E;  5A6B D;  2DLQ A;  4O5G A;  2EMF A;  1KYQ A;  4R2P A;  2EN3 A;  2WCC 3;  2V87 A;  2B7V A;  2RSI A;  2YRH A;  5AAS A;  2L3C A;  2EM6 A;  1YZ9 A;  4R8O A;  3FIG A;  1X3C A;  2EQ0 A;  5KL7 A;  4M2Z A;  2CPN A;  2ODR D;  5IV8 B;  4F9B B;  2EN2 A;  2M7Q A;  1RQ0 A;  2EM0 A;  2EL4 A;  2EMY A;  2JPA A;  2LE2 A;  4P78 A;  2L2K B;  4F6N A;  4R2E A;  2UUA E;  4WPY A;  2EN8 A;  4DUZ E;  4WXC A;  4BCA A;  4DR6 E;  4GEQ B;  3HTX A;  5LMN E;  2EN1 A;  1YYO A;  2YTO A;  3THO B;  2I13 A;  2WBT A;  3EPH A;  1YUJ A;  3ZOQ B;  4LTY A;  4DV3 E;  2EPL X;  1YUI A;  3HPZ A;  4P7D A;  2EM9 A;  2RS6 A;  1UIL A;  1STU A;  4L8N A;  1WHQ A;  2V86 A;  4LF6 E;  2N8X A;  2LV2 A;  2JXP A;  1XMQ E;  1UN6 B;  4JI7 E;  1ZU1 A;  4DR1 E;  2EOE A;  2VE7 C;  3UK3 C;  3DF6 A;  2FTX B;  4BS9 A;  3ADL A;  1N34 E;  4O24 A;  2JP9 A;  2H36 X;  3BID A;  2WBS A;  1FKA E;  2DSY A;  4JI8 E;  2M9A A;  2UUC E;  5AE2 A;  2YTE A;  3OTO E;  3F6G A;  2F8B A;  5A69 A;  4M0V A;  2RPC A;  4I8O A;  1A1J A;  2DMY A;  3MHH C;  5KL3 A;  4F6M A;  1A1I A;  2LRS A;  1HNX E;  2WBU A;  1X48 A;  2MDG A;  2EPZ A;  2MKD A;  1YYW A;  4BC7 A;  2GPI A;  2YT4 A;  1A1F A;  2ADR A;  2ODR C;  3T1H E;  4HTG A;  4DV7 E;  2EWL A;  2UXD E;  2M4I A;  2VQE E;  1ZR9 A;  1PKP A;  2LCE A;  2YTF A;  4WX9 A;  1XMO E;  1WXR A;  4JV5 E;  2EPA A;  4JI6 E;  1YFH A;  1XNR E;  1L4S A;  4OX9 E;  1NEI A;  2YWQ A;  2EOR A;  4BHB A;  4B3S E;  2YTP A;  3QG5 C;  2KON A;  4FK5 C;  1MEY C;  3IWB A;  1BBG A;  1ZBT A;  5KL4 A;  3LML A;  2V83 A;  2G7H A;  2ENA A;  2JY9 A;  4RHB B;  5AE1 A;  2L6M A;  4WXD A;  4TUG A;  2E72 A;  5FLX C;  1IBM E;  4R2A A;  2ELY A;  4JI2 E;  2JOX A;  2YTJ A;  1EH6 A;  2V8Q B;  5DNY A;  4R2D A;  1T4L B;  4B3T E;  2YRM A;  1HNZ E;  4WYQ B;  2V88 A;  1PJQ A;  4X66 E;  2EE8 A;  3IWC A;  4NHR A;  2EPX A;  2V89 A;  1A1K A;  5IWA E;  2LTR A;  2EMC A;  2EQ3 A;  2ELZ A;  5IT9 C;  3C4B A;  1TF3 A;  3THN A;  2ZM6 E;  3KZZ A;  1SFE A;  2ENC A;  2R1F A;  1TF6 A;  1FJG E;  4R03 A;  4M9V C;  1LLM C;  3HPS A;  1HR0 E;  4DV4 E;  3C4T A;  4WFT A;  4LF4 E;  4DV6 E;  4KWY A;  4DV2 E;  4BMJ A;  3T1Y E;  2EPR A;  2EOI A;  1WJP A;  2WZO A;  1N36 E;  1N32 E;  1HNW E;  4JI4 E;  2F4V E;  2EMA A;  4L5N C;  5LLQ A;  1J26 A;  3JTZ A;  4JI3 E;  2D9H A;  4O43 A;  4O4K A;  2L2N A;  1J5E E;  2EPK X;  3EPJ A;  2EMK A;  2JYA A;  1RC7 A;  5KL6 A;  1TN9 A;  2MKN A;  4Q28 A;  2EOZ A;  2LO3 A;  1O0W A;  5AE3 A;  4R2R A;  2EPO A;  2DGC A;  5KL5 A;  1P47 A;  3KWR A;  2HHH E;  2LJU A; 
#chains in the Genus database with same CATH homology
 3K6Q A;  4B3M E;  4DV7 E;  2EWL A;  4BC9 A;  4JI0 E;  5F3W A;  3F6H A;  4LU9 A;  2UXD E;  2M4I A;  2VQE E;  1PKP A;  3J7A G;  4X64 E;  4LF8 E;  5ADZ A;  2M1S A;  4NXN E;  4LF9 E;  1XMO E;  2UXB E;  2JVA A;  1WXR A;  4JV5 E;  1DQ3 A;  2NA2 A;  4YY3 E;  4F9A B;  2E1M A;  4JI6 E;  3MSW A;  1XNR E;  4OX9 E;  4J8Z A;  2V87 A;  4OOG C;  2NUE A;  2B7V A;  2DIX A;  5AAS A;  4TUI A;  4B3S E;  5LL6 R;  3J81 C;  2KON A;  2L3C A;  3ADI A;  3IWD A;  1WHN A;  4WSP A;  1YZ9 A;  4R8O A;  1YYK A;  3IWB A;  3FIG A;  4GKK E;  1UHZ A;  2L92 A;  4X8W A;  1EKZ A;  4M2Z A;  1ZBT A;  2MC5 A;  2CPN A;  2RTX A;  2V83 A;  2G7H A;  2JY9 A;  2ODR D;  3LML A;  4DR2 E;  4JYA E;  4F9B B;  5AE1 A;  2M7Q A;  2L6M A;  1RQ0 A;  4DR3 E;  4TUG A;  4DV1 E;  3ADJ A;  4DKK A;  5FLX C;  1GQE A;  4LFA E;  2L3J A;  2EZ6 A;  3JAM C;  1IBM E;  2MC6 A;  4JI2 E;  2LE2 A;  2JOX A;  2JWO A;  4P78 A;  2V8Q B;  5DNY A;  2L2K B;  1X49 A;  1T4L B;  4KZS A;  4B3T E;  3J80 C;  1ZBQ A;  1HNZ E;  2NUF A;  4WYQ B;  2UUA E;  3LLH A;  2V88 A;  4WPY A;  4X66 E;  2YZT A;  3JU0 A;  2E5L E;  4DR5 E;  3IWC A;  4DUZ E;  2VF1 A;  4BCA A;  4DR6 E;  4BBY A;  2V89 A;  4GEQ B;  4DMI A;  4DV5 E;  1XNQ E;  2UUB E;  3HTX A;  5IWA E;  4LFB E;  2JR1 A;  2RS7 A;  2LTR A;  5LMN E;  2UU9 E;  4LF5 E;  1YYO A;  3VYX A;  4M30 A;  4K0K E;  4GKJ E;  5IT9 C;  4X62 E;  3C4B A;  3ZOQ B;  4LTY A;  4DV3 E;  1X47 A;  4DR7 E;  2DB2 A;  2RSM A;  3AV0 A;  3HPZ A;  2ZM6 E;  4P7D A;  5A2Q C;  2RS6 A;  2LTS A;  1UIL A;  1FJG E;  4R03 A;  1STU A;  3HPS A;  3DJW A;  1HR0 E;  4L8N A;  2MDR A;  1WHQ A;  4DV4 E;  2V86 A;  4LF6 E;  3VK6 A;  3HQ1 A;  3P1X A;  1IBL E;  1GZ6 A;  3C4T A;  4YHH E;  3HXL A;  3J7Y p;  4WFT A;  3VYY A;  2KHX A;  4DV6 E;  4LF4 E;  4DV2 E;  5BR8 E;  1XMQ E;  4BMJ A;  3H09 A;  3T1Y E;  1SR9 A;  4JI7 E;  4DR1 E;  3ADG A;  4LFC E;  2WZO A;  2VE7 C;  3DF6 A;  1N36 E;  2JOB A;  2FTX B;  1QU6 A;  4LF7 E;  1N32 E;  4BS9 A;  2LBS B;  3ADL A;  1HNW E;  2VQF E;  1T4N A;  1I94 E;  4JI4 E;  2F4V E;  3OML A;  2L33 A;  1N34 E;  4L5N C;  1IBK E;  2H36 X;  3RMP A;  2V85 A;  4F54 A;  4NXM E;  2B9D A;  1FKA E;  2DSY A;  4DR4 E;  2UXC E;  3JTZ A;  2L8T A;  4JI8 E;  4JI3 E;  1J26 A;  2LUQ A;  1DI2 A;  2LMZ A;  2N3G A;  4AQY E;  2K4V A;  2UUC E;  2L2N A;  5AE2 A;  3OTO E;  2LUP B;  1J5E E;  4JI5 E;  3F6G A;  2F8B A;  2N3H A;  4DUY E;  4M0V A;  1T4O A;  4I8O A;  2B7T A;  2LJH A;  5CFF E;  2DMY A;  1RC7 A;  2NUG A;  4F9C B;  3AUZ A;  2FV4 B;  4Q28 A;  2LRS A;  1HNX E;  1O0W A;  5AE3 A;  1X48 A;  2B3T B;  4KHP E;  4DV0 E;  5LMU E;  2L2M A;  1YYW A;  4B3R E;  4BC7 A;  4X65 E;  4JI1 E;  2KOU A;  2YT4 A;  2IHR 1;  3KWR A;  2HHH E;  2ODR C;  1N33 E;  3T1H E;  5T6J A;  2FGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...