2DMYA

Solution structure of dsrm domain in spermatid perinuclear rna-bind protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
97
structure length
97
Chain Sequence
GSSGSSGRKILDSKAIDLMNALMRLNQIRPGLQYKLLSQSGPVHAPVFTMSVDVDGTTYEASGPSKKTAKLHVAVKVLQAMGYPTGFDADISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Spermatid perinuclear RNA-binding protein
publication title Solution structure of DSRM domain in Spermatid perinuclear RNA-bind protein
rcsb
source organism Homo sapiens
total genus 12
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2dmyA00
4OOGC 4DV5E 1IBLE 4DV6E 4WYQB 2UUCE 1N32E 2RS6A 5LMNE 4YY3E 1IBME 2RS7A 4M30A 1J5EE 4X62E 1FKAE 5IWAE 2LBSB 2DB2A 2ZM6E 2NUGA 1HNWE 1UILA 5LMUE 4JI2E 2KHXA 2YT4A 4DUYE 2UUAE 4X66E 2UXBE 4DR5E 4DUZE 1T4OA 2LRSA 4JI4E 4B3RE 1YYOA 4NXME 1J26A 4LF5E 2CPNA 2N3HA 1PKPA 4LF9E 4LF8E 3T1HE 1XMQE 4JI0E 3ADJA 4WFTA 4B3SE 1RQ0A 4DV2E 1QU6A 2LTRA 2DIXA 1RC7A 3HTXA 2UUBE 4DV7E 1N36E 2VQEE 1IBKE 3ADGA 2B7VA 4DV0E 4B3TE 1YZ9A 4JI8E 2LUPB 4K0KE 4JV5E 4B3ME 4LF4E 1T4NA 2RTXA 3C4TA 1X49A 2B3TB 2RSMA 3T1YE 4X8WA 2L3JA 4JYAE 4DV4E 2JVAA 2IHR1 2JY9A 1HNZE 1T4LB 1XMOE 4JI3E 1EKZA 4DR1E 4DR4E 4OX9E 2MDRA 2L2NA 4JI5E 4M2ZA 1N33E 1X47A 4JI1E 2N3GA 2NA2A 2NUEA 4YHHE 3OTOE 4JI6E 2E5LE 1WHQA 4DR6E 1YYKA 4LFBE 3VYXA 4GKJE 1XNQE 4KHPE 2VQFE 1I94E 4DR2E 1FJGE 1XNRE 4DR3E 4DV3E 4LFCE 3C4BA 4AQYE 1YYWA 1HNXE 3ADIA 2F4VE 1DI2A 2B7TA 3P1XA 1UHZA 2UU9E 2L3CA 2LTSA 5CFFE 4DR7E 1GQEA 1ZBTA 2UXCE 2DMYA 2L2MA 5BR8E 1O0WA 4JI7E 2L2KB 2EZ6A 3LLHA 1STUA 3VYYA 1N34E 4LFAE 4NXNE 2NUFA 4LF7E 2UXDE 4X64E 4DV1E 2LJHA 4X65E 4LF6E 2HHHE 3ADLA 1X48A 2LUQA 4DKKA 2L33A 4GKKE 1HR0E 1WHNA 3J7Yp
chains in the Genus database with same CATH superfamily
4DV5E 4BMJA 2UUCE 2EPMX 2EL6A 5AASA 3K6QA 4M30A 2EPKX 2YTDA 2DB2A 4O24A 2YRKA 1MGTA 2MC5A 1X6EA 2EOIA 5IV8B 1KYQA 2RSIA 4WSPA 4IS1C 4BS9A 5ADZA 2UXBE 2L6MA 1PJSA 2CSHA 2EL5A 2JWOA 4JI4E 3LMLA 2EMIA 5LLQA 4B3RE 5KL7A 4HTGA 3OMLA 4BHBA 1B69A 1ZR9A 5AE1A 4LF9E 1XMQE 2KOUA 4Q35B 2EOOA 2R1FA 2J7JA 1QU6A 2LTRA 2YPNA 1RC7A 4DV7E 5A6KA 3MSWA 2B7VA 1PJQA 2Q8UA 1A1HA 4LF4E 3THOB 3C4TA 4R2RA 1A1IA 2L3JA 4BC9A 2JVAA 2EPRA 2IHR1 2M4IA 5A6BD 2EMHA 2A25A 4DR4E 4GEQB 2EMXA 2EMZA 4M2ZA 1A1JA 4KWYA 2FTXB 1X47A 1X6HA 1UBDC 2NA2A 2V87A 4RH8A 1MEYC 2EOHA 5KL2A 2EMWA 1WHQA 1G2FC 2EM6A 1YYKA 3VYXA 4KHPE 4I8OA 2WBTA 2EPCA 4DR2E 1X6FA 1XNRE 2EN8A 2CTDA 1JK1A 3C4BA 4AQYE 1DI2A 2WBUA 1GZ6A 2B7TA 1UHZA 4R2AA 3DF6A 2YTJA 2MKDA 1TN9A 1AH5A 3J80C 5CFFE 1GQEA 2LT7A 2DMYA 2M1SA 2V85A 4WX9A 1A1KA 1KJKA 2EMYA 5LL6R 1DGCA 1EH7A 2YTNA 5F3WA 1YUJA 3THNA 4LF7E 3HPSA 3QG5C 2EN2A 2HJJA 4GKKE 2L33A 2YTIA 3J7Yp 3F6GA 2RQLA 2JOXA 4OOGC 2EPNA 1IBLE 2YTOA 4R2PA 2EM7A 5KL4A 4BHCA 4O4KA 4X9JA 5LMNE 2WCC3 4YY3E 1J5EE 1WJPA 1FKAE 2EM2A 4R2SA 2NUGA 3EPLA 4F54A 2LO3A 3KZYA 4O43A 2EOQA 4R2CA 4F9BB 2DLKA 2YT4A 2UUAE 2ODRC 4BCAA 4BC7A 4X66E 4DR5E 1AAYA 2WBSA 2EM4A 2BB8A 2LRSA 1N3GA 2LMZA 5FLXC 2HGHA 1YYOA 5A2QC 5KL6A 2EN7A 2N3HA 4M9VC 1IQSA 3ADJA 1RQ0A 2ODRD 2EMBA 3JAMC 1EH8A 1IQOA 2N8XA 4K0KE 2EOYA 3M99B 2RSMA 2EPXA 2F8BA 4JYAE 3ZOQB 2DMIA 2H36X 4DV4E 1A1FA 4F6MA 1NCSA 1L4SA 1XMOE 2EN3A 1EKZA 3EPHA 4OX9E 2LVHA 1LLMC 2JR1A 3C6MA 1YFHA 3L00A 3HQ1A 2VF1A 2YSOA 3MHHC 2ELYA 2YZTA 4JI1E 2N3GA 2VRDA 3AUZA 2E5LE 2ADRA 4DR6E 2LV2A 1XNQE 2VQFE 5AE3A 1I94E 2YWQA 5TSEA 5IXMB 2PRTA 3EPKA 2EM9A 2EMGA 1FJGE 4DR3E 5AC5A 3EPJA 3BBGA 1UN6B 1ZU1A 1YYWA 1A1LA 1HNXE 3P1XA 2BBGA 1SFEA 2VE7C 2LTSA 2UXCE 1ZBTA 2EPAA 3RMPA 2CT1A 2L2MA 2K7IA 2D9HA 4MLVA 2EOJA 1SR9A 1O0WA 2L2KB 2ENHA 2HC5A 4LFAE 1N34E 2LJHA 2MDGA 2NABA 5IT9C 1YPNA 3HXLA 3IWDA 2YTEA 4DV6E 4WYQB 3HPZA 4R03A 2RS6A 2EPUA 2RS7A 4LU9A 4X62E 2EM3A 2EORA 1IMUA 4FK5C 4RHBB 2YU8A 1UILA 2R76A 5KL5A 1YUIA 2WZOA 3VK6A 4JI2E 2LE2A 4NHRA 2EWLA 5KL3A 4WPYA 2B9DA 4J8ZA 2CPNA 3EQ1A 4LF8E 2MKNA 1YSAC 4WFTA 2V86A 5DNYA 2M7QA 2EOZA 4L8NA 3HTXA 3IWBA 2M9AA 2EPZA 1PJTA 3ADGA 3VHTB 4B3TE 4JV5E 4JI8E 2LUPB 2EM0A 2YTQA 2RTXA 1X49A 2B3TB 3T1YE 1WRJA 2E72A 2JPAA 1T39A 2EQ1A 2JY9A 5AC4A 1HNZE 1T4LB 2MC6A 2GPIA 2I13A 4JI3E 4F9CB 4DR1E 2DRPA 2MDRA 2EOFA 2L2NA 1WXRA 4JI5E 1N33E 1JK2A 4TUIA 1TF6A 4KZSA 2NUEA 1T38A 2LJUA 1RMDA 3OTOE 1BBOA 4JI6E 1EH6A 4P7DA 1PDAA 2YTFA 3FIGA 2EMAA 4GZNC 5A6AA 3J81C 4ZYGA 4ZYDA 2EOMA 4DMIA 2EJ4A 2L92A 4R8OA 3JTZA 4DV3E 2G7HA 4LTYA 3ADIA 2F4VE 4ZYEA 1ZBQA 2EN1A 2EM5A 1QNTA 4P78A 3MHSC 2EOXA 5BR8E 4JI7E 2YRMA 3LLHA 1STUA 3VYYA 2NUFA 2EMCA 2UXDE 4X64E 4X65E 3ECRA 2V89A 2JXPA 3KWRA 2EMFA 3ADLA 1ZAAC 2LUQA 2ENCA 2KONA 5AE2A 2GLIA 2EPPA 1DQ3A 1F2IG 1N32E 2EL4A 1IBME 5T6JA 2EOSA 5IWAE 2LBSB 2ZM6E 3H09A 1HNWE 4F2JC 2V88A 5LMUE 2DGCA 3IWCA 2EN6A 2GHFA 2KHXA 4DUYE 3UK3C 2JYAA 3BF2A 2YTGA 4DUZE 1T4OA 4NZVA 2LCEA 2YTPA 1G2DC 4BBYA 2ELZA 1J26A 4NXME 1X5WA 3F6HA 4ZYHA 4LF5E 1PKPA 3T1HE 4JI0E 2DSYA 4B3SE 4DV2E 2E1MA 2DIXA 2FGGA 4R2EA 2UUBE 2K4VA 2EM8A 1GTKA 3BIDA 3AV0A 2VQEE 1N36E 1IBKE 4DV0E 1YZ9A 1BBGA 2EOEA 4R2DA 4WXCA 1Z1BA 4B3ME 1T4NA 2DLQA 2EQ0A 4X8WA 2V8QB 4F6NA 3C6KA 4Q28A 5A6BA 3JU0A 2RPCA 2JOBA 1BB8A 4YHHE 1P47A 4WSGA 2EN4A 2V83A 2YSPA 2EPLX 4WXDA 1TF3A 4LFBE 2YRHA 4GKJE 2EPOA 4TUGA 2L8TA 2JP9A 3BGHA 4MLQA 4LFCE 3J7AG 2I9IA 1NEIA 2FV4B 5A69A 2UU9E 5A6JA 1A1GA 2YU5A 2L3CA 4DR7E 3KZZA 2EMKA 2EQ3A 4M0VA 2EP3A 4O5GA 2EZ6A 4L5NC 4IJDA 4NXNE 2ENAA 2EE8A 3DJWA 4DV1E 3TQMA 4F9AB 4LF6E 2HHHE 4R2QA 4N4RB 1X48A 4DKKA 1HR0E 4HEIA 1WHNA 1X3CA 2EMLA
chains in the Genus database with same CATH topology
2JOXA 4OOGC 4DV5E 1IBLE 4BMJA 4DV6E 1DQ3A 4WYQB 2UUCE 3HPZA 1N32E 4R03A 2RS6A 5AASA 5LMNE 4YY3E 1IBME 2RS7A 3K6QA 4M30A 4LU9A 4X62E 5T6JA 1J5EE 1FKAE 5IWAE 2LBSB 2DB2A 2ZM6E 3H09A 2NUGA 1HNWE 1UILA 4F54A 2V88A 5LMUE 2MC5A 3IWCA 4F9BB 2WZOA 2KHXA 2YT4A 3VK6A 4JI2E 4WSPA 4DUYE 2UUAE 2LE2A 2ODRC 4BCAA 4BS9A 5ADZA 4BC7A 4X66E 2L6MA 4DR5E 2UXBE 2EWLA 4DUZE 2JWOA 1T4OA 2LRSA 4JI4E 3LMLA 4B3RE 4WPYA 2LMZA 4BBYA 5FLXC 1YYOA 4NXME 1J26A 5A2QC 2B9DA 3F6HA 3OMLA 4LF5E 4J8ZA 2CPNA 5AE1A 2N3HA 1PKPA 4LF9E 4LF8E 3T1HE 2KOUA 1XMQE 4B3SE 4JI0E 3ADJA 2DSYA 2V86A 1RQ0A 4WFTA 1QU6A 2E1MA 4L8NA 2M7QA 2LTRA 5DNYA 2DIXA 2FGGA 4DV2E 3IWBA 1RC7A 2ODRD 2UUBE 3HTXA 4DV7E 2K4VA 3MSWA 3JAMC 2VQEE 3AV0A 1N36E 1IBKE 3ADGA 2B7VA 4DV0E 4B3TE 1YZ9A 4JI8E 2LUPB 4K0KE 4JV5E 4B3ME 4LF4E 1T4NA 2RTXA 3C4TA 1X49A 2B3TB 2RSMA 3T1YE 2F8BA 4X8WA 2L3JA 4JYAE 3ZOQB 4BC9A 2V8QB 2H36X 4DV4E 2JVAA 2IHR1 2M4IA 2JY9A 1HNZE 1T4LB 2MC6A 1XMOE 3J7Yp 4JI3E 1EKZA 4F9CB 4DR1E 4DR4E 4GEQB 4Q28A 4OX9E 2MDRA 2L2NA 1WXRA 4JI5E 4M2ZA 1N33E 2FTXB 2JR1A 1X47A 4TUIA 3JU0A 3HQ1A 4KZSA 2VF1A 2JOBA 2YZTA 4JI1E 2N3GA 2NA2A 2V87A 4YHHE 2NUEA 3OTOE 4JI6E 3AUZA 2E5LE 2V83A 1WHQA 4P7DA 4DR6E 1YYKA 4LFBE 3VYXA 4GKJE 1XNQE 4KHPE 4I8OA 4TUGA 2VQFE 3FIGA 5AE3A 2L8TA 4DR2E 1I94E 3J81C 1FJGE 1XNRE 4DMIA 4DR3E 2L92A 4R8OA 3JTZA 4DV3E 4LFCE 3C4BA 4AQYE 1YYWA 2G7HA 1HNXE 3J7AG 4LTYA 3ADIA 2F4VE 1DI2A 1GZ6A 1ZBQA 2B7TA 2FV4B 1UHZA 3P1XA 2UU9E 3DF6A 2VE7C 3J80C 2LTSA 5CFFE 2L3CA 1GQEA 1ZBTA 4DR7E 2UXCE 2DMYA 2M1SA 3RMPA 2L2MA 4P78A 2V85A 5BR8E 4M0VA 1SR9A 1O0WA 4JI7E 5LL6R 2L2KB 2EZ6A 4L5NC 3LLHA 5F3WA 1STUA 3VYYA 1N34E 4LFAE 4NXNE 2NUFA 4LF7E 2UXDE 3DJWA 3HPSA 4X64E 4DV1E 2LJHA 4X65E 2V89A 5IT9C 4F9AB 4LF6E 2HHHE 3KWRA 5AE2A 3ADLA 1X48A 2LUQA 4DKKA 2L33A 4GKKE 1HR0E 2KONA 1WHNA 3HXLA 3IWDA 3F6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OOG C;  4DV5 E;  1IBL E;  4DV6 E;  4WYQ B;  2UUC E;  1N32 E;  2RS6 A;  5LMN E;  4YY3 E;  1IBM E;  2RS7 A;  4M30 A;  1J5E E;  4X62 E;  1FKA E;  5IWA E;  2LBS B;  2DB2 A;  2ZM6 E;  2NUG A;  1HNW E;  1UIL A;  5LMU E;  4JI2 E;  2KHX A;  2YT4 A;  4DUY E;  2UUA E;  4X66 E;  2UXB E;  4DR5 E;  4DUZ E;  1T4O A;  2LRS A;  4JI4 E;  4B3R E;  1YYO A;  4NXM E;  1J26 A;  4LF5 E;  2CPN A;  2N3H A;  1PKP A;  4LF9 E;  4LF8 E;  3T1H E;  1XMQ E;  4JI0 E;  3ADJ A;  4WFT A;  4B3S E;  1RQ0 A;  4DV2 E;  1QU6 A;  2LTR A;  2DIX A;  1RC7 A;  3HTX A;  2UUB E;  4DV7 E;  1N36 E;  2VQE E;  1IBK E;  3ADG A;  2B7V A;  4DV0 E;  4B3T E;  1YZ9 A;  4JI8 E;  2LUP B;  4K0K E;  4JV5 E;  4B3M E;  4LF4 E;  1T4N A;  2RTX A;  3C4T A;  1X49 A;  2B3T B;  2RSM A;  3T1Y E;  4X8W A;  2L3J A;  4JYA E;  4DV4 E;  2JVA A;  2IHR 1;  2JY9 A;  1HNZ E;  1T4L B;  1XMO E;  4JI3 E;  1EKZ A;  4DR1 E;  4DR4 E;  4OX9 E;  2MDR A;  2L2N A;  4JI5 E;  4M2Z A;  1N33 E;  1X47 A;  4JI1 E;  2N3G A;  2NA2 A;  2NUE A;  4YHH E;  3OTO E;  4JI6 E;  2E5L E;  1WHQ A;  4DR6 E;  1YYK A;  4LFB E;  3VYX A;  4GKJ E;  1XNQ E;  4KHP E;  2VQF E;  1I94 E;  4DR2 E;  1FJG E;  1XNR E;  4DR3 E;  4DV3 E;  4LFC E;  3C4B A;  4AQY E;  1YYW A;  1HNX E;  3ADI A;  2F4V E;  1DI2 A;  2B7T A;  3P1X A;  1UHZ A;  2UU9 E;  2L3C A;  2LTS A;  5CFF E;  4DR7 E;  1GQE A;  1ZBT A;  2UXC E;  2DMY A;  2L2M A;  5BR8 E;  1O0W A;  4JI7 E;  2L2K B;  2EZ6 A;  3LLH A;  1STU A;  3VYY A;  1N34 E;  4LFA E;  4NXN E;  2NUF A;  4LF7 E;  2UXD E;  4X64 E;  4DV1 E;  2LJH A;  4X65 E;  4LF6 E;  2HHH E;  3ADL A;  1X48 A;  2LUQ A;  4DKK A;  2L33 A;  4GKK E;  1HR0 E;  1WHN A;  3J7Y p; 
#chains in the Genus database with same CATH topology
 4DV5 E;  4BMJ A;  2UUC E;  2EPM X;  2EL6 A;  5AAS A;  3K6Q A;  4M30 A;  2EPK X;  2YTD A;  2DB2 A;  4O24 A;  2YRK A;  1MGT A;  2MC5 A;  1X6E A;  2EOI A;  5IV8 B;  1KYQ A;  2RSI A;  4WSP A;  4IS1 C;  4BS9 A;  5ADZ A;  2UXB E;  2L6M A;  1PJS A;  2CSH A;  2EL5 A;  2JWO A;  4JI4 E;  3LML A;  2EMI A;  5LLQ A;  4B3R E;  5KL7 A;  4HTG A;  3OML A;  4BHB A;  1B69 A;  1ZR9 A;  5AE1 A;  4LF9 E;  1XMQ E;  2KOU A;  4Q35 B;  2EOO A;  2R1F A;  2J7J A;  1QU6 A;  2LTR A;  2YPN A;  1RC7 A;  4DV7 E;  5A6K A;  3MSW A;  2B7V A;  1PJQ A;  2Q8U A;  1A1H A;  4LF4 E;  3THO B;  3C4T A;  4R2R A;  1A1I A;  2L3J A;  4BC9 A;  2JVA A;  2EPR A;  2IHR 1;  2M4I A;  5A6B D;  2EMH A;  2A25 A;  4DR4 E;  4GEQ B;  2EMX A;  2EMZ A;  4M2Z A;  1A1J A;  4KWY A;  2FTX B;  1X47 A;  1X6H A;  1UBD C;  2NA2 A;  2V87 A;  4RH8 A;  1MEY C;  2EOH A;  5KL2 A;  2EMW A;  1WHQ A;  1G2F C;  2EM6 A;  1YYK A;  3VYX A;  4KHP E;  4I8O A;  2WBT A;  2EPC A;  4DR2 E;  1X6F A;  1XNR E;  2EN8 A;  2CTD A;  1JK1 A;  3C4B A;  4AQY E;  1DI2 A;  2WBU A;  1GZ6 A;  2B7T A;  1UHZ A;  4R2A A;  3DF6 A;  2YTJ A;  2MKD A;  1TN9 A;  1AH5 A;  3J80 C;  5CFF E;  1GQE A;  2LT7 A;  2DMY A;  2M1S A;  2V85 A;  4WX9 A;  1A1K A;  1KJK A;  2EMY A;  5LL6 R;  1DGC A;  1EH7 A;  2YTN A;  5F3W A;  1YUJ A;  3THN A;  4LF7 E;  3HPS A;  3QG5 C;  2EN2 A;  2HJJ A;  4GKK E;  2L33 A;  2YTI A;  3J7Y p;  3F6G A;  2RQL A;  2JOX A;  4OOG C;  2EPN A;  1IBL E;  2YTO A;  4R2P A;  2EM7 A;  5KL4 A;  4BHC A;  4O4K A;  4X9J A;  5LMN E;  2WCC 3;  4YY3 E;  1J5E E;  1WJP A;  1FKA E;  2EM2 A;  4R2S A;  2NUG A;  3EPL A;  4F54 A;  2LO3 A;  3KZY A;  4O43 A;  2EOQ A;  4R2C A;  4F9B B;  2DLK A;  2YT4 A;  2UUA E;  2ODR C;  4BCA A;  4BC7 A;  4X66 E;  4DR5 E;  1AAY A;  2WBS A;  2EM4 A;  2BB8 A;  2LRS A;  1N3G A;  2LMZ A;  5FLX C;  2HGH A;  1YYO A;  5A2Q C;  5KL6 A;  2EN7 A;  2N3H A;  4M9V C;  1IQS A;  3ADJ A;  1RQ0 A;  2ODR D;  2EMB A;  3JAM C;  1EH8 A;  1IQO A;  2N8X A;  4K0K E;  2EOY A;  3M99 B;  2RSM A;  2EPX A;  2F8B A;  4JYA E;  3ZOQ B;  2DMI A;  2H36 X;  4DV4 E;  1A1F A;  4F6M A;  1NCS A;  1L4S A;  1XMO E;  2EN3 A;  1EKZ A;  3EPH A;  4OX9 E;  2LVH A;  1LLM C;  2JR1 A;  3C6M A;  1YFH A;  3L00 A;  3HQ1 A;  2VF1 A;  2YSO A;  3MHH C;  2ELY A;  2YZT A;  4JI1 E;  2N3G A;  2VRD A;  3AUZ A;  2E5L E;  2ADR A;  4DR6 E;  2LV2 A;  1XNQ E;  2VQF E;  5AE3 A;  1I94 E;  2YWQ A;  5TSE A;  5IXM B;  2PRT A;  3EPK A;  2EM9 A;  2EMG A;  1FJG E;  4DR3 E;  5AC5 A;  3EPJ A;  3BBG A;  1UN6 B;  1ZU1 A;  1YYW A;  1A1L A;  1HNX E;  3P1X A;  2BBG A;  1SFE A;  2VE7 C;  2LTS A;  2UXC E;  1ZBT A;  2EPA A;  3RMP A;  2CT1 A;  2L2M A;  2K7I A;  2D9H A;  4MLV A;  2EOJ A;  1SR9 A;  1O0W A;  2L2K B;  2ENH A;  2HC5 A;  4LFA E;  1N34 E;  2LJH A;  2MDG A;  2NAB A;  5IT9 C;  1YPN A;  3HXL A;  3IWD A;  2YTE A;  4DV6 E;  4WYQ B;  3HPZ A;  4R03 A;  2RS6 A;  2EPU A;  2RS7 A;  4LU9 A;  4X62 E;  2EM3 A;  2EOR A;  1IMU A;  4FK5 C;  4RHB B;  2YU8 A;  1UIL A;  2R76 A;  5KL5 A;  1YUI A;  2WZO A;  3VK6 A;  4JI2 E;  2LE2 A;  4NHR A;  2EWL A;  5KL3 A;  4WPY A;  2B9D A;  4J8Z A;  2CPN A;  3EQ1 A;  4LF8 E;  2MKN A;  1YSA C;  4WFT A;  2V86 A;  5DNY A;  2M7Q A;  2EOZ A;  4L8N A;  3HTX A;  3IWB A;  2M9A A;  2EPZ A;  1PJT A;  3ADG A;  3VHT B;  4B3T E;  4JV5 E;  4JI8 E;  2LUP B;  2EM0 A;  2YTQ A;  2RTX A;  1X49 A;  2B3T B;  3T1Y E;  1WRJ A;  2E72 A;  2JPA A;  1T39 A;  2EQ1 A;  2JY9 A;  5AC4 A;  1HNZ E;  1T4L B;  2MC6 A;  2GPI A;  2I13 A;  4JI3 E;  4F9C B;  4DR1 E;  2DRP A;  2MDR A;  2EOF A;  2L2N A;  1WXR A;  4JI5 E;  1N33 E;  1JK2 A;  4TUI A;  1TF6 A;  4KZS A;  2NUE A;  1T38 A;  2LJU A;  1RMD A;  3OTO E;  1BBO A;  4JI6 E;  1EH6 A;  4P7D A;  1PDA A;  2YTF A;  3FIG A;  2EMA A;  4GZN C;  5A6A A;  3J81 C;  4ZYG A;  4ZYD A;  2EOM A;  4DMI A;  2EJ4 A;  2L92 A;  4R8O A;  3JTZ A;  4DV3 E;  2G7H A;  4LTY A;  3ADI A;  2F4V E;  4ZYE A;  1ZBQ A;  2EN1 A;  2EM5 A;  1QNT A;  4P78 A;  3MHS C;  2EOX A;  5BR8 E;  4JI7 E;  2YRM A;  3LLH A;  1STU A;  3VYY A;  2NUF A;  2EMC A;  2UXD E;  4X64 E;  4X65 E;  3ECR A;  2V89 A;  2JXP A;  3KWR A;  2EMF A;  3ADL A;  1ZAA C;  2LUQ A;  2ENC A;  2KON A;  5AE2 A;  2GLI A;  2EPP A;  1DQ3 A;  1F2I G;  1N32 E;  2EL4 A;  1IBM E;  5T6J A;  2EOS A;  5IWA E;  2LBS B;  2ZM6 E;  3H09 A;  1HNW E;  4F2J C;  2V88 A;  5LMU E;  2DGC A;  3IWC A;  2EN6 A;  2GHF A;  2KHX A;  4DUY E;  3UK3 C;  2JYA A;  3BF2 A;  2YTG A;  4DUZ E;  1T4O A;  4NZV A;  2LCE A;  2YTP A;  1G2D C;  4BBY A;  2ELZ A;  1J26 A;  4NXM E;  1X5W A;  3F6H A;  4ZYH A;  4LF5 E;  1PKP A;  3T1H E;  4JI0 E;  2DSY A;  4B3S E;  4DV2 E;  2E1M A;  2DIX A;  2FGG A;  4R2E A;  2UUB E;  2K4V A;  2EM8 A;  1GTK A;  3BID A;  3AV0 A;  2VQE E;  1N36 E;  1IBK E;  4DV0 E;  1YZ9 A;  1BBG A;  2EOE A;  4R2D A;  4WXC A;  1Z1B A;  4B3M E;  1T4N A;  2DLQ A;  2EQ0 A;  4X8W A;  2V8Q B;  4F6N A;  3C6K A;  4Q28 A;  5A6B A;  3JU0 A;  2RPC A;  2JOB A;  1BB8 A;  4YHH E;  1P47 A;  4WSG A;  2EN4 A;  2V83 A;  2YSP A;  2EPL X;  4WXD A;  1TF3 A;  4LFB E;  2YRH A;  4GKJ E;  2EPO A;  4TUG A;  2L8T A;  2JP9 A;  3BGH A;  4MLQ A;  4LFC E;  3J7A G;  2I9I A;  1NEI A;  2FV4 B;  5A69 A;  2UU9 E;  5A6J A;  1A1G A;  2YU5 A;  2L3C A;  4DR7 E;  3KZZ A;  2EMK A;  2EQ3 A;  4M0V A;  2EP3 A;  4O5G A;  2EZ6 A;  4L5N C;  4IJD A;  4NXN E;  2ENA A;  2EE8 A;  3DJW A;  4DV1 E;  3TQM A;  4F9A B;  4LF6 E;  2HHH E;  4R2Q A;  4N4R B;  1X48 A;  4DKK A;  1HR0 E;  4HEI A;  1WHN A;  1X3C A;  2EML A; 
#chains in the Genus database with same CATH homology
 2JOX A;  4OOG C;  4DV5 E;  1IBL E;  4BMJ A;  4DV6 E;  1DQ3 A;  4WYQ B;  2UUC E;  3HPZ A;  1N32 E;  4R03 A;  2RS6 A;  5AAS A;  5LMN E;  4YY3 E;  1IBM E;  2RS7 A;  3K6Q A;  4M30 A;  4LU9 A;  4X62 E;  5T6J A;  1J5E E;  1FKA E;  5IWA E;  2LBS B;  2DB2 A;  2ZM6 E;  3H09 A;  2NUG A;  1HNW E;  1UIL A;  4F54 A;  2V88 A;  5LMU E;  2MC5 A;  3IWC A;  4F9B B;  2WZO A;  2KHX A;  2YT4 A;  3VK6 A;  4JI2 E;  4WSP A;  4DUY E;  2UUA E;  2LE2 A;  2ODR C;  4BCA A;  4BS9 A;  5ADZ A;  4BC7 A;  4X66 E;  2L6M A;  4DR5 E;  2UXB E;  2EWL A;  4DUZ E;  2JWO A;  1T4O A;  2LRS A;  4JI4 E;  3LML A;  4B3R E;  4WPY A;  2LMZ A;  4BBY A;  5FLX C;  1YYO A;  4NXM E;  1J26 A;  5A2Q C;  2B9D A;  3F6H A;  3OML A;  4LF5 E;  4J8Z A;  2CPN A;  5AE1 A;  2N3H A;  1PKP A;  4LF9 E;  4LF8 E;  3T1H E;  2KOU A;  1XMQ E;  4B3S E;  4JI0 E;  3ADJ A;  2DSY A;  2V86 A;  1RQ0 A;  4WFT A;  1QU6 A;  2E1M A;  4L8N A;  2M7Q A;  2LTR A;  5DNY A;  2DIX A;  2FGG A;  4DV2 E;  3IWB A;  1RC7 A;  2ODR D;  2UUB E;  3HTX A;  4DV7 E;  2K4V A;  3MSW A;  3JAM C;  2VQE E;  3AV0 A;  1N36 E;  1IBK E;  3ADG A;  2B7V A;  4DV0 E;  4B3T E;  1YZ9 A;  4JI8 E;  2LUP B;  4K0K E;  4JV5 E;  4B3M E;  4LF4 E;  1T4N A;  2RTX A;  3C4T A;  1X49 A;  2B3T B;  2RSM A;  3T1Y E;  2F8B A;  4X8W A;  2L3J A;  4JYA E;  3ZOQ B;  4BC9 A;  2V8Q B;  2H36 X;  4DV4 E;  2JVA A;  2IHR 1;  2M4I A;  2JY9 A;  1HNZ E;  1T4L B;  2MC6 A;  1XMO E;  3J7Y p;  4JI3 E;  1EKZ A;  4F9C B;  4DR1 E;  4DR4 E;  4GEQ B;  4Q28 A;  4OX9 E;  2MDR A;  2L2N A;  1WXR A;  4JI5 E;  4M2Z A;  1N33 E;  2FTX B;  2JR1 A;  1X47 A;  4TUI A;  3JU0 A;  3HQ1 A;  4KZS A;  2VF1 A;  2JOB A;  2YZT A;  4JI1 E;  2N3G A;  2NA2 A;  2V87 A;  4YHH E;  2NUE A;  3OTO E;  4JI6 E;  3AUZ A;  2E5L E;  2V83 A;  1WHQ A;  4P7D A;  4DR6 E;  1YYK A;  4LFB E;  3VYX A;  4GKJ E;  1XNQ E;  4KHP E;  4I8O A;  4TUG A;  2VQF E;  3FIG A;  5AE3 A;  2L8T A;  4DR2 E;  1I94 E;  3J81 C;  1FJG E;  1XNR E;  4DMI A;  4DR3 E;  2L92 A;  4R8O A;  3JTZ A;  4DV3 E;  4LFC E;  3C4B A;  4AQY E;  1YYW A;  2G7H A;  1HNX E;  3J7A G;  4LTY A;  3ADI A;  2F4V E;  1DI2 A;  1GZ6 A;  1ZBQ A;  2B7T A;  2FV4 B;  1UHZ A;  3P1X A;  2UU9 E;  3DF6 A;  2VE7 C;  3J80 C;  2LTS A;  5CFF E;  2L3C A;  1GQE A;  1ZBT A;  4DR7 E;  2UXC E;  2DMY A;  2M1S A;  3RMP A;  2L2M A;  4P78 A;  2V85 A;  5BR8 E;  4M0V A;  1SR9 A;  1O0W A;  4JI7 E;  5LL6 R;  2L2K B;  2EZ6 A;  4L5N C;  3LLH A;  5F3W A;  1STU A;  3VYY A;  1N34 E;  4LFA E;  4NXN E;  2NUF A;  4LF7 E;  2UXD E;  3DJW A;  3HPS A;  4X64 E;  4DV1 E;  2LJH A;  4X65 E;  2V89 A;  5IT9 C;  4F9A B;  4LF6 E;  2HHH E;  3KWR A;  5AE2 A;  3ADL A;  1X48 A;  2LUQ A;  4DKK A;  2L33 A;  4GKK E;  1HR0 E;  2KON A;  1WHN A;  3HXL A;  3IWD A;  3F6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...