2DMYA

Solution structure of dsrm domain in spermatid perinuclear rna-bind protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
97
structure length
97
Chain Sequence
GSSGSSGRKILDSKAIDLMNALMRLNQIRPGLQYKLLSQSGPVHAPVFTMSVDVDGTTYEASGPSKKTAKLHVAVKVLQAMGYPTGFDADISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermatid perinuclear RNA-binding protein
publication title Solution structure of DSRM domain in Spermatid perinuclear RNA-bind protein
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 12
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2dmyA00
1IBLE 4DV6E 2NUEA 2VQFE 4B3RE 1RC7A 2DB2A 3OTOE 4B3TE 2UUBE 4X8WA 4OX9E 4LF4E 2NUFA 2B3TB 2L33A 2UUCE 1GQEA 5BR8E 2DMYA 3ADJA 1J26A 3ADLA 2L3CA 2NUGA 4M2ZA 4GKJE 1EKZA 3C4BA 4DV5E 4WYQB 2LRSA 2RS7A 4JI5E 4OOGC 4DR2E 1N32E 4WFTA 3VYXA 1DI2A 4X65E 1RQ0A 3VYYA 4KHPE 1QU6A 4JI4E 2UU9E 2B7TA 4JI8E 4NXME 4B3SE 4AQYE 1X47A 2JVAA 2KHXA 1XNRE 4DR1E 3T1HE 3ADIA 4JI2E 1J5EE 2RSMA 4X62E 2L3JA 2L2KB 2LJHA 4DKKA 1T4OA 1WHNA 2B7VA 1UHZA 1XMOE 5LMUE 2UXCE 2UXDE 1PKPA 1N33E 4DV1E 1IBKE 1YYWA 4NXNE 4YHHE 2UXBE 4LFCE 2N3GA 1O0WA 1HNWE 2LBSB 1T4NA 1XNQE 1HNXE 2YT4A 4DV7E 2L2MA 4GKKE 1I94E 4M30A 3LLHA 1XMQE 1WHQA 4LF7E 3ADGA 1UILA 1HR0E 1ZBTA 2RS6A 1N36E 4JV5E 2CPNA 4DR7E 1STUA 2LUQA 2HHHE 4JI0E 4DR5E 4DV2E 1T4LB 4DUZE 4DV3E 4DV4E 3P1XA 4DR3E 4LF9E 2ZM6E 4DR6E 2MDRA 4DV0E 3J7Yp 4JI7E 2LUPB 4JI3E 4JYAE 5IWAE 4JI1E 2N3HA 3C4TA 2E5LE 4LFAE 3T1YE 1X48A 2EZ6A 4LF5E 4JI6E 2VQEE 1N34E 2F4VE 4LFBE 4LF6E 4X64E 2JY9A 2RTXA 4LF8E 4B3ME 1FJGE 4YY3E 5LMNE 2LTRA 1YYKA 1YZ9A 4X66E 1IBME 1YYOA 1HNZE 2DIXA 2LTSA 1FKAE 2UUAE 5CFFE 1X49A 3HTXA 4DUYE 2IHR1 4K0KE 4DR4E 2NA2A 2L2NA
chains in the Genus database with same CATH superfamily
4M0VA 1UBDC 4DV6E 4B3RE 4HTGA 1BB8A 4IJDA 2NUFA 2EE8A 3MSWA 4BCAA 2EOIA 3UK3C 2EN3A 1J26A 2K4VA 3AUZA 3ECRA 2RS7A 2EPUA 4BHCA 4DR2E 1KJKA 1DI2A 2EMHA 2EPNA 2YTPA 2RSIA 2M7QA 2D9HA 1NEIA 3LMLA 2YPNA 1X47A 5ADZA 2M9AA 2EN8A 1QNTA 2ENAA 3L00A 4JI2E 3JTZA 4O24A 2EN2A 2RSMA 2LCEA 2EOSA 2JP9A 2LO3A 2YTEA 1WHNA 2B7VA 3BGHA 2YTDA 1XMOE 2UXCE 2V88A 1N33E 4NZVA 2EMCA 1IBKE 4P7DA 1EH8A 1YPNA 2H36X 2LBSB 1XNQE 1HNXE 4O5GA 2GPIA 4M30A 2EM7A 2R76A 2EOHA 3ZOQB 4BS9A 2DMIA 2EL4A 2EMWA 4RHBB 5KL7A 1ZR9A 1UILA 2M1SA 4WX9A 1N36E 2CTDA 4DR5E 4DV2E 1T4LB 4DUZE 4R2QA 1PDAA 2ODRD 3KWRA 4I8OA 2YU8A 5A2QC 2DGCA 1YUJA 1KYQA 1EH6A 3AV0A 5IWAE 2EPKX 1X3CA 3C4TA 1X48A 4LTYA 4LFBE 2JXPA 4X64E 1P47A 4LF8E 4B3ME 4O4KA 2L8TA 5LMNE 1G2FC 2LTRA 3DF6A 2VRDA 1YYKA 2EPLX 5KL6A 4MLQA 1IBME 1HNZE 2LTSA 2L92A 2FTXB 1LLMC 1X49A 3HQ1A 2WBSA 1PJTA 2V89A 1IBLE 2NUEA 1RC7A 2LMZA 4B3TE 5AE3A 2UUBE 4X8WA 4OX9E 1BBOA 4F2JC 4F54A 2EPRA 2VF1A 3DJWA 4F9CB 4ZYHA 2DMYA 2EMXA 2L6MA 3C4BA 1A1JA 2EQ3A 5KL4A 4L5NC 4JI5E 2EM3A 4WFTA 1RQ0A 3IWDA 1UN6B 2YZTA 1B69A 1F2IG 4JI4E 3OMLA 4JI8E 4B3SE 3HPZA 5LL6R 3EQ1A 4DR1E 2K7IA 3BBGA 2JR1A 1DQ3A 1J5EE 2KONA 1X5WA 2L3JA 2L2KB 1A1HA 2R1FA 4DKKA 1X6FA 2EPCA 1YSAC 1T39A 2EPAA 2UXDE 1PKPA 2V87A 3QG5C 4NXNE 4YHHE 4KZSA 2UXBE 2EM0A 4ZYGA 2EMZA 1T4NA 2YT4A 4DV7E 2YWQA 2EM2A 2EMYA 5IV8B 4WPYA 2EOZA 3LLHA 1WHQA 2EM6A 4R2AA 5F3WA 3J80C 1NCSA 1WJPA 4JI0E 2EMBA 5AE2A 4DV3E 3C6KA 3M99B 1IQOA 5LLQA 1EH7A 2EN4A 4DR6E 5A6BD 1A1KA 2BBGA 2LVHA 5DNYA 1JK2A 1BBGA 1YUIA 3J7Yp 4WXCA 4R8OA 2M4IA 2EOMA 4FK5C 3J81C 3RMPA 2ELYA 1SR9A 2E5LE 4LFAE 1JK1A 2EZ6A 1N34E 4Q35B 2EOFA 2MC5A 2RQLA 4F6NA 2YTIA 1FJGE 2JOBA 2EL5A 1AAYA 2WCC3 3EPKA 5TSEA 4X66E 2EL6A 1A1IA 1FKAE 2UUAE 2I13A 5T6JA 3HPSA 2HC5A 5KL2A 2NA2A 2L2NA 1L4SA 2LE2A 3BF2A 4BBYA 2VQFE 5AASA 1A1GA 3IWBA 2EOQA 4LF4E 2MKNA 2FV4B 2DRPA 2UUCE 5A6JA 3ADJA 2GLIA 3ADLA 2KOUA 2NUGA 4M2ZA 4GKJE 2HJJA 2LRSA 4OOGC 1N32E 4P78A 1QU6A 1ZAAC 4BHBA 3EPHA 3FIGA 2UU9E 2B7TA 3K6QA 2YRMA 5A69A 4AQYE 4O43A 1SFEA 4ZYDA 2EPMX 1MEYC 5IT9C 2BB8A 3T1HE 2EPXA 3F6HA 2J7JA 2EMLA 2YSPA 2EOEA 4X62E 1A1FA 2YTNA 2LJHA 2LT7A 5KL3A 2EMFA 4RH8A 4DV1E 4TUIA 2EM5A 2ENCA 2YTJA 1HNWE 4ZYEA 3KZYA 4Q28A 2L2MA 4GKKE 1TF6A 2YTOA 2EM9A 2EPPA 1XMQE 2G7HA 4LF7E 3ADGA 2EWLA 2EN7A 2EN6A 1HR0E 4R03A 1DGCA 2RS6A 4HEIA 4JV5E 1ZBQA 2V86A 4DR7E 1STUA 2MKDA 2HHHE 2CT1A 2JOXA 4DMIA 3VHTB 1IMUA 2Q8UA 4DV4E 3P1XA 2A25A 4DR3E 1PJSA 2EJ4A 4F9AB 4DV0E 2EOYA 2RPCA 2WBUA 2V8QB 4JYAE 1WXRA 2HGHA 2ENHA 2JWOA 2YTQA 4JI1E 5A6AA 2YSOA 2EP3A 1N3GA 1A1LA 2LJUA 5AE1A 2EMKA 1X6EA 4N4RB 3THNA 1YZ9A 2WBTA 4R2CA 1MGTA 4L8NA 5CFFE 2EMGA 2EM8A 2JYAA 4J8ZA 2EMAA 4R2SA 4DR4E 3MHSC 2DSYA 5AC4A 2DB2A 2LV2A 3OTOE 1TF3A 2EN1A 2ODRC 4WSGA 4BC9A 2JPAA 2B3TB 2L33A 4TUGA 4LU9A 1GQEA 2N8XA 5BR8E 2ELZA 4GZNC 1PJQA 2L3CA 4BMJA 2EM4A 1EKZA 2EOOA 4DV5E 4WYQB 2YTFA 1X6HA 4R2DA 3C6MA 3VYXA 4X65E 3VYYA 4KHPE 1G2DC 2NABA 3H09A 3KZZA 4F6MA 2CSHA 3MHHC 4NXME 2V85A 2E1MA 2JVAA 2EQ0A 2KHXA 1XNRE 2I9IA 1TN9A 2DLKA 3ADIA 3THOB 1YFHA 3EPLA 4R2RA 3TQMA 2ADRA 4WXDA 2WZOA 4F9BB 2YTGA 2VE7C 1T4OA 1UHZA 4X9JA 4IS1C 5LMUE 2EMIA 3JAMC 2EQ1A 1YYWA 4LFCE 2N3GA 1O0WA 3HXLA 1WRJA 5IXMB 2EOXA 4R2EA 3EPJA 2E72A 4WSPA 2YRHA 1RMDA 2F8BA 4GEQB 1I94E 4M9VC 3BIDA 2YU5A 3F6GA 1ZBTA 5A6KA 4MLVA 2B9DA 2DLQA 2GHFA 2CPNA 2EPOA 2MDGA 3J7AG 2YRKA 2LUQA 5AC5A 3JU0A 2PRTA 1T38A 1GTKA 1ZU1A 4NHRA 4LF9E 2ZM6E 2MDRA 2MC6A 4R2PA 4JI7E 2LUPB 5KL5A 4JI3E 3IWCA 4KWYA 5FLXC 2EOJA 2N3HA 1AH5A 2V83A 3T1YE 2EORA 4LF5E 4JI6E 2VQEE 2F4VE 4LF6E 1GZ6A 2JY9A 2RTXA 3VK6A 4YY3E 5A6BA 1YYOA 2DIXA 1Z1BA 4BC7A 3HTXA 2FGGA 4DUYE 2EPZA 2IHR1 4K0KE 1IQSA
chains in the Genus database with same CATH topology
4M0VA 1IBLE 2LE2A 4DV6E 2NUEA 4BBYA 2VQFE 4B3RE 1RC7A 5AASA 2DB2A 2LMZA 3OTOE 4B3TE 5AE3A 2UUBE 3IWBA 4X8WA 2ODRC 4OX9E 4LF4E 2NUFA 3MSWA 2FV4B 4BC9A 4BCAA 2B3TB 2L33A 4F54A 2UUCE 4TUGA 2VF1A 4LU9A 1GQEA 3DJWA 4F9CB 4JYAE 5BR8E 2DMYA 3ADJA 1J26A 3ADLA 2KOUA 2L3CA 2K4VA 4BMJA 4JI3E 2NUGA 4M2ZA 3AUZA 4GKJE 1EKZA 2L6MA 3C4BA 4DV5E 4WYQB 2LRSA 2RS7A 4L5NC 4JI5E 4OOGC 4DR2E 1N32E 4WFTA 3VYXA 1DI2A 4P78A 1RQ0A 3IWDA 4X65E 3VYYA 4KHPE 2YZTA 1QU6A 2M7QA 3H09A 3FIGA 4JI4E 2UU9E 2B7TA 3K6QA 3LMLA 3OMLA 4JI8E 4NXME 4B3SE 2V85A 2E1MA 4AQYE 1X47A 5ADZA 2JVAA 3HPZA 2KHXA 5LL6R 1XNRE 4DR1E 5IT9C 3T1HE 3ADIA 2JR1A 3JTZA 4JI2E 1DQ3A 2RSMA 1J5EE 3F6HA 2KONA 4X62E 2L3JA 4F9BB 2LJHA 2WZOA 2L2KB 2VE7C 4DKKA 1T4OA 1WHNA 2B7VA 1UHZA 1XMOE 5LMUE 2UXCE 2V88A 2UXDE 1PKPA 2V87A 3JAMC 1N33E 4DV1E 4TUIA 1IBKE 4P7DA 4NXNE 1YYWA 4YHHE 4KZSA 2UXBE 4LFCE 2N3GA 1O0WA 3HXLA 2H36X 1HNWE 2LBSB 1T4NA 1XNQE 1HNXE 4Q28A 2YT4A 4DV7E 2L2MA 4GKKE 4WSPA 4GEQB 4WPYA 2F8BA 4M30A 3ZOQB 4BS9A 3LLHA 1XMQE 1I94E 1WHQA 2G7HA 4LF7E 3ADGA 2EWLA 3F6GA 1UILA 2M1SA 1HR0E 1ZBTA 4R03A 5F3WA 2RS6A 2B9DA 3J80C 1N36E 1ZBQA 2CPNA 4JV5E 3J7AG 2V86A 4DR7E 1STUA 2LUQA 2HHHE 4JI0E 2JOXA 3JU0A 4DV2E 4DMIA 4DR5E 5AE2A 1T4LB 4DUZE 4DV3E 4DV4E 3P1XA 2ODRD 3KWRA 4DR3E 4I8OA 5A2QC 4LF9E 2ZM6E 4DR6E 2MDRA 5DNYA 4F9AB 4DV0E 2MC6A 2V8QB 3AV0A 4JI7E 1WXRA 4R8OA 5IWAE 2M4IA 3J81C 3J7Yp 2JWOA 2LUPB 3IWCA 3RMPA 4JI1E 5FLXC 2N3HA 1SR9A 3C4TA 2E5LE 4LFAE 2V83A 2DSYA 3T1YE 1X48A 2EZ6A 4LF5E 4LTYA 2VQEE 1N34E 4JI6E 2F4VE 2MC5A 4LF6E 4LFBE 1GZ6A 2JY9A 4X64E 2RTXA 4LF8E 4B3ME 3VK6A 1FJGE 2JOBA 2L8TA 5AE1A 4YY3E 5LMNE 2LTRA 3DF6A 1YYKA 1YZ9A 4X66E 1IBME 1YYOA 4DR4E 1HNZE 2DIXA 2LTSA 1FKAE 4L8NA 2L92A 4BC7A 2FTXB 5CFFE 1X49A 3HQ1A 2UUAE 5T6JA 2FGGA 4DUYE 3HTXA 2IHR1 3HPSA 4J8ZA 4K0KE 2V89A 2NA2A 2L2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBL E;  4DV6 E;  2NUE A;  2VQF E;  4B3R E;  1RC7 A;  2DB2 A;  3OTO E;  4B3T E;  2UUB E;  4X8W A;  4OX9 E;  4LF4 E;  2NUF A;  2B3T B;  2L33 A;  2UUC E;  1GQE A;  5BR8 E;  2DMY A;  3ADJ A;  1J26 A;  3ADL A;  2L3C A;  2NUG A;  4M2Z A;  4GKJ E;  1EKZ A;  3C4B A;  4DV5 E;  4WYQ B;  2LRS A;  2RS7 A;  4JI5 E;  4OOG C;  4DR2 E;  1N32 E;  4WFT A;  3VYX A;  1DI2 A;  4X65 E;  1RQ0 A;  3VYY A;  4KHP E;  1QU6 A;  4JI4 E;  2UU9 E;  2B7T A;  4JI8 E;  4NXM E;  4B3S E;  4AQY E;  1X47 A;  2JVA A;  2KHX A;  1XNR E;  4DR1 E;  3T1H E;  3ADI A;  4JI2 E;  1J5E E;  2RSM A;  4X62 E;  2L3J A;  2L2K B;  2LJH A;  4DKK A;  1T4O A;  1WHN A;  2B7V A;  1UHZ A;  1XMO E;  5LMU E;  2UXC E;  2UXD E;  1PKP A;  1N33 E;  4DV1 E;  1IBK E;  1YYW A;  4NXN E;  4YHH E;  2UXB E;  4LFC E;  2N3G A;  1O0W A;  1HNW E;  2LBS B;  1T4N A;  1XNQ E;  1HNX E;  2YT4 A;  4DV7 E;  2L2M A;  4GKK E;  1I94 E;  4M30 A;  3LLH A;  1XMQ E;  1WHQ A;  4LF7 E;  3ADG A;  1UIL A;  1HR0 E;  1ZBT A;  2RS6 A;  1N36 E;  4JV5 E;  2CPN A;  4DR7 E;  1STU A;  2LUQ A;  2HHH E;  4JI0 E;  4DR5 E;  4DV2 E;  1T4L B;  4DUZ E;  4DV3 E;  4DV4 E;  3P1X A;  4DR3 E;  4LF9 E;  2ZM6 E;  4DR6 E;  2MDR A;  4DV0 E;  3J7Y p;  4JI7 E;  2LUP B;  4JI3 E;  4JYA E;  5IWA E;  4JI1 E;  2N3H A;  3C4T A;  2E5L E;  4LFA E;  3T1Y E;  1X48 A;  2EZ6 A;  4LF5 E;  4JI6 E;  2VQE E;  1N34 E;  2F4V E;  4LFB E;  4LF6 E;  4X64 E;  2JY9 A;  2RTX A;  4LF8 E;  4B3M E;  1FJG E;  4YY3 E;  5LMN E;  2LTR A;  1YYK A;  1YZ9 A;  4X66 E;  1IBM E;  1YYO A;  1HNZ E;  2DIX A;  2LTS A;  1FKA E;  2UUA E;  5CFF E;  1X49 A;  3HTX A;  4DUY E;  2IHR 1;  4K0K E;  4DR4 E;  2NA2 A;  2L2N A; 
#chains in the Genus database with same CATH topology
 4M0V A;  1UBD C;  4DV6 E;  4B3R E;  4HTG A;  1BB8 A;  4IJD A;  2NUF A;  2EE8 A;  3MSW A;  4BCA A;  2EOI A;  3UK3 C;  2EN3 A;  1J26 A;  2K4V A;  3AUZ A;  3ECR A;  2RS7 A;  2EPU A;  4BHC A;  4DR2 E;  1KJK A;  1DI2 A;  2EMH A;  2EPN A;  2YTP A;  2RSI A;  2M7Q A;  2D9H A;  1NEI A;  3LML A;  2YPN A;  1X47 A;  5ADZ A;  2M9A A;  2EN8 A;  1QNT A;  2ENA A;  3L00 A;  4JI2 E;  3JTZ A;  4O24 A;  2EN2 A;  2RSM A;  2LCE A;  2EOS A;  2JP9 A;  2LO3 A;  2YTE A;  1WHN A;  2B7V A;  3BGH A;  2YTD A;  1XMO E;  2UXC E;  2V88 A;  1N33 E;  4NZV A;  2EMC A;  1IBK E;  4P7D A;  1EH8 A;  1YPN A;  2H36 X;  2LBS B;  1XNQ E;  1HNX E;  4O5G A;  2GPI A;  4M30 A;  2EM7 A;  2R76 A;  2EOH A;  3ZOQ B;  4BS9 A;  2DMI A;  2EL4 A;  2EMW A;  4RHB B;  5KL7 A;  1ZR9 A;  1UIL A;  2M1S A;  4WX9 A;  1N36 E;  2CTD A;  4DR5 E;  4DV2 E;  1T4L B;  4DUZ E;  4R2Q A;  1PDA A;  2ODR D;  3KWR A;  4I8O A;  2YU8 A;  5A2Q C;  2DGC A;  1YUJ A;  1KYQ A;  1EH6 A;  3AV0 A;  5IWA E;  2EPK X;  1X3C A;  3C4T A;  1X48 A;  4LTY A;  4LFB E;  2JXP A;  4X64 E;  1P47 A;  4LF8 E;  4B3M E;  4O4K A;  2L8T A;  5LMN E;  1G2F C;  2LTR A;  3DF6 A;  2VRD A;  1YYK A;  2EPL X;  5KL6 A;  4MLQ A;  1IBM E;  1HNZ E;  2LTS A;  2L92 A;  2FTX B;  1LLM C;  1X49 A;  3HQ1 A;  2WBS A;  1PJT A;  2V89 A;  1IBL E;  2NUE A;  1RC7 A;  2LMZ A;  4B3T E;  5AE3 A;  2UUB E;  4X8W A;  4OX9 E;  1BBO A;  4F2J C;  4F54 A;  2EPR A;  2VF1 A;  3DJW A;  4F9C B;  4ZYH A;  2DMY A;  2EMX A;  2L6M A;  3C4B A;  1A1J A;  2EQ3 A;  5KL4 A;  4L5N C;  4JI5 E;  2EM3 A;  4WFT A;  1RQ0 A;  3IWD A;  1UN6 B;  2YZT A;  1B69 A;  1F2I G;  4JI4 E;  3OML A;  4JI8 E;  4B3S E;  3HPZ A;  5LL6 R;  3EQ1 A;  4DR1 E;  2K7I A;  3BBG A;  2JR1 A;  1DQ3 A;  1J5E E;  2KON A;  1X5W A;  2L3J A;  2L2K B;  1A1H A;  2R1F A;  4DKK A;  1X6F A;  2EPC A;  1YSA C;  1T39 A;  2EPA A;  2UXD E;  1PKP A;  2V87 A;  3QG5 C;  4NXN E;  4YHH E;  4KZS A;  2UXB E;  2EM0 A;  4ZYG A;  2EMZ A;  1T4N A;  2YT4 A;  4DV7 E;  2YWQ A;  2EM2 A;  2EMY A;  5IV8 B;  4WPY A;  2EOZ A;  3LLH A;  1WHQ A;  2EM6 A;  4R2A A;  5F3W A;  3J80 C;  1NCS A;  1WJP A;  4JI0 E;  2EMB A;  5AE2 A;  4DV3 E;  3C6K A;  3M99 B;  1IQO A;  5LLQ A;  1EH7 A;  2EN4 A;  4DR6 E;  5A6B D;  1A1K A;  2BBG A;  2LVH A;  5DNY A;  1JK2 A;  1BBG A;  1YUI A;  3J7Y p;  4WXC A;  4R8O A;  2M4I A;  2EOM A;  4FK5 C;  3J81 C;  3RMP A;  2ELY A;  1SR9 A;  2E5L E;  4LFA E;  1JK1 A;  2EZ6 A;  1N34 E;  4Q35 B;  2EOF A;  2MC5 A;  2RQL A;  4F6N A;  2YTI A;  1FJG E;  2JOB A;  2EL5 A;  1AAY A;  2WCC 3;  3EPK A;  5TSE A;  4X66 E;  2EL6 A;  1A1I A;  1FKA E;  2UUA E;  2I13 A;  5T6J A;  3HPS A;  2HC5 A;  5KL2 A;  2NA2 A;  2L2N A;  1L4S A;  2LE2 A;  3BF2 A;  4BBY A;  2VQF E;  5AAS A;  1A1G A;  3IWB A;  2EOQ A;  4LF4 E;  2MKN A;  2FV4 B;  2DRP A;  2UUC E;  5A6J A;  3ADJ A;  2GLI A;  3ADL A;  2KOU A;  2NUG A;  4M2Z A;  4GKJ E;  2HJJ A;  2LRS A;  4OOG C;  1N32 E;  4P78 A;  1QU6 A;  1ZAA C;  4BHB A;  3EPH A;  3FIG A;  2UU9 E;  2B7T A;  3K6Q A;  2YRM A;  5A69 A;  4AQY E;  4O43 A;  1SFE A;  4ZYD A;  2EPM X;  1MEY C;  5IT9 C;  2BB8 A;  3T1H E;  2EPX A;  3F6H A;  2J7J A;  2EML A;  2YSP A;  2EOE A;  4X62 E;  1A1F A;  2YTN A;  2LJH A;  2LT7 A;  5KL3 A;  2EMF A;  4RH8 A;  4DV1 E;  4TUI A;  2EM5 A;  2ENC A;  2YTJ A;  1HNW E;  4ZYE A;  3KZY A;  4Q28 A;  2L2M A;  4GKK E;  1TF6 A;  2YTO A;  2EM9 A;  2EPP A;  1XMQ E;  2G7H A;  4LF7 E;  3ADG A;  2EWL A;  2EN7 A;  2EN6 A;  1HR0 E;  4R03 A;  1DGC A;  2RS6 A;  4HEI A;  4JV5 E;  1ZBQ A;  2V86 A;  4DR7 E;  1STU A;  2MKD A;  2HHH E;  2CT1 A;  2JOX A;  4DMI A;  3VHT B;  1IMU A;  2Q8U A;  4DV4 E;  3P1X A;  2A25 A;  4DR3 E;  1PJS A;  2EJ4 A;  4F9A B;  4DV0 E;  2EOY A;  2RPC A;  2WBU A;  2V8Q B;  4JYA E;  1WXR A;  2HGH A;  2ENH A;  2JWO A;  2YTQ A;  4JI1 E;  5A6A A;  2YSO A;  2EP3 A;  1N3G A;  1A1L A;  2LJU A;  5AE1 A;  2EMK A;  1X6E A;  4N4R B;  3THN A;  1YZ9 A;  2WBT A;  4R2C A;  1MGT A;  4L8N A;  5CFF E;  2EMG A;  2EM8 A;  2JYA A;  4J8Z A;  2EMA A;  4R2S A;  4DR4 E;  3MHS C;  2DSY A;  5AC4 A;  2DB2 A;  2LV2 A;  3OTO E;  1TF3 A;  2EN1 A;  2ODR C;  4WSG A;  4BC9 A;  2JPA A;  2B3T B;  2L33 A;  4TUG A;  4LU9 A;  1GQE A;  2N8X A;  5BR8 E;  2ELZ A;  4GZN C;  1PJQ A;  2L3C A;  4BMJ A;  2EM4 A;  1EKZ A;  2EOO A;  4DV5 E;  4WYQ B;  2YTF A;  1X6H A;  4R2D A;  3C6M A;  3VYX A;  4X65 E;  3VYY A;  4KHP E;  1G2D C;  2NAB A;  3H09 A;  3KZZ A;  4F6M A;  2CSH A;  3MHH C;  4NXM E;  2V85 A;  2E1M A;  2JVA A;  2EQ0 A;  2KHX A;  1XNR E;  2I9I A;  1TN9 A;  2DLK A;  3ADI A;  3THO B;  1YFH A;  3EPL A;  4R2R A;  3TQM A;  2ADR A;  4WXD A;  2WZO A;  4F9B B;  2YTG A;  2VE7 C;  1T4O A;  1UHZ A;  4X9J A;  4IS1 C;  5LMU E;  2EMI A;  3JAM C;  2EQ1 A;  1YYW A;  4LFC E;  2N3G A;  1O0W A;  3HXL A;  1WRJ A;  5IXM B;  2EOX A;  4R2E A;  3EPJ A;  2E72 A;  4WSP A;  2YRH A;  1RMD A;  2F8B A;  4GEQ B;  1I94 E;  4M9V C;  3BID A;  2YU5 A;  3F6G A;  1ZBT A;  5A6K A;  4MLV A;  2B9D A;  2DLQ A;  2GHF A;  2CPN A;  2EPO A;  2MDG A;  3J7A G;  2YRK A;  2LUQ A;  5AC5 A;  3JU0 A;  2PRT A;  1T38 A;  1GTK A;  1ZU1 A;  4NHR A;  4LF9 E;  2ZM6 E;  2MDR A;  2MC6 A;  4R2P A;  4JI7 E;  2LUP B;  5KL5 A;  4JI3 E;  3IWC A;  4KWY A;  5FLX C;  2EOJ A;  2N3H A;  1AH5 A;  2V83 A;  3T1Y E;  2EOR A;  4LF5 E;  4JI6 E;  2VQE E;  2F4V E;  4LF6 E;  1GZ6 A;  2JY9 A;  2RTX A;  3VK6 A;  4YY3 E;  5A6B A;  1YYO A;  2DIX A;  1Z1B A;  4BC7 A;  3HTX A;  2FGG A;  4DUY E;  2EPZ A;  2IHR 1;  4K0K E;  1IQS A; 
#chains in the Genus database with same CATH homology
 4M0V A;  1IBL E;  2LE2 A;  4DV6 E;  2NUE A;  4BBY A;  2VQF E;  4B3R E;  1RC7 A;  5AAS A;  2DB2 A;  2LMZ A;  3OTO E;  4B3T E;  5AE3 A;  2UUB E;  3IWB A;  4X8W A;  2ODR C;  4OX9 E;  4LF4 E;  2NUF A;  3MSW A;  2FV4 B;  4BC9 A;  4BCA A;  2B3T B;  2L33 A;  4F54 A;  2UUC E;  4TUG A;  2VF1 A;  4LU9 A;  1GQE A;  3DJW A;  4F9C B;  4JYA E;  5BR8 E;  2DMY A;  3ADJ A;  1J26 A;  3ADL A;  2KOU A;  2L3C A;  2K4V A;  4BMJ A;  4JI3 E;  2NUG A;  4M2Z A;  3AUZ A;  4GKJ E;  1EKZ A;  2L6M A;  3C4B A;  4DV5 E;  4WYQ B;  2LRS A;  2RS7 A;  4L5N C;  4JI5 E;  4OOG C;  4DR2 E;  1N32 E;  4WFT A;  3VYX A;  1DI2 A;  4P78 A;  1RQ0 A;  3IWD A;  4X65 E;  3VYY A;  4KHP E;  2YZT A;  1QU6 A;  2M7Q A;  3H09 A;  3FIG A;  4JI4 E;  2UU9 E;  2B7T A;  3K6Q A;  3LML A;  3OML A;  4JI8 E;  4NXM E;  4B3S E;  2V85 A;  2E1M A;  4AQY E;  1X47 A;  5ADZ A;  2JVA A;  3HPZ A;  2KHX A;  5LL6 R;  1XNR E;  4DR1 E;  5IT9 C;  3T1H E;  3ADI A;  2JR1 A;  3JTZ A;  4JI2 E;  1DQ3 A;  2RSM A;  1J5E E;  3F6H A;  2KON A;  4X62 E;  2L3J A;  4F9B B;  2LJH A;  2WZO A;  2L2K B;  2VE7 C;  4DKK A;  1T4O A;  1WHN A;  2B7V A;  1UHZ A;  1XMO E;  5LMU E;  2UXC E;  2V88 A;  2UXD E;  1PKP A;  2V87 A;  3JAM C;  1N33 E;  4DV1 E;  4TUI A;  1IBK E;  4P7D A;  4NXN E;  1YYW A;  4YHH E;  4KZS A;  2UXB E;  4LFC E;  2N3G A;  1O0W A;  3HXL A;  2H36 X;  1HNW E;  2LBS B;  1T4N A;  1XNQ E;  1HNX E;  4Q28 A;  2YT4 A;  4DV7 E;  2L2M A;  4GKK E;  4WSP A;  4GEQ B;  4WPY A;  2F8B A;  4M30 A;  3ZOQ B;  4BS9 A;  3LLH A;  1XMQ E;  1I94 E;  1WHQ A;  2G7H A;  4LF7 E;  3ADG A;  2EWL A;  3F6G A;  1UIL A;  2M1S A;  1HR0 E;  1ZBT A;  4R03 A;  5F3W A;  2RS6 A;  2B9D A;  3J80 C;  1N36 E;  1ZBQ A;  2CPN A;  4JV5 E;  3J7A G;  2V86 A;  4DR7 E;  1STU A;  2LUQ A;  2HHH E;  4JI0 E;  2JOX A;  3JU0 A;  4DV2 E;  4DMI A;  4DR5 E;  5AE2 A;  1T4L B;  4DUZ E;  4DV3 E;  4DV4 E;  3P1X A;  2ODR D;  3KWR A;  4DR3 E;  4I8O A;  5A2Q C;  4LF9 E;  2ZM6 E;  4DR6 E;  2MDR A;  5DNY A;  4F9A B;  4DV0 E;  2MC6 A;  2V8Q B;  3AV0 A;  4JI7 E;  1WXR A;  4R8O A;  5IWA E;  2M4I A;  3J81 C;  3J7Y p;  2JWO A;  2LUP B;  3IWC A;  3RMP A;  4JI1 E;  5FLX C;  2N3H A;  1SR9 A;  3C4T A;  2E5L E;  4LFA E;  2V83 A;  2DSY A;  3T1Y E;  1X48 A;  2EZ6 A;  4LF5 E;  4LTY A;  2VQE E;  1N34 E;  4JI6 E;  2F4V E;  2MC5 A;  4LF6 E;  4LFB E;  1GZ6 A;  2JY9 A;  4X64 E;  2RTX A;  4LF8 E;  4B3M E;  3VK6 A;  1FJG E;  2JOB A;  2L8T A;  5AE1 A;  4YY3 E;  5LMN E;  2LTR A;  3DF6 A;  1YYK A;  1YZ9 A;  4X66 E;  1IBM E;  1YYO A;  4DR4 E;  1HNZ E;  2DIX A;  2LTS A;  1FKA E;  4L8N A;  2L92 A;  4BC7 A;  2FTX B;  5CFF E;  1X49 A;  3HQ1 A;  2UUA E;  5T6J A;  2FGG A;  4DUY E;  3HTX A;  2IHR 1;  3HPS A;  4J8Z A;  4K0K E;  2V89 A;  2NA2 A;  2L2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...