2DMYA

Solution structure of dsrm domain in spermatid perinuclear rna-bind protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
97
structure length
97
Chain Sequence
GSSGSSGRKILDSKAIDLMNALMRLNQIRPGLQYKLLSQSGPVHAPVFTMSVDVDGTTYEASGPSKKTAKLHVAVKVLQAMGYPTGFDADISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermatid perinuclear RNA-binding protein
publication title Solution structure of DSRM domain in Spermatid perinuclear RNA-bind protein
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 12
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2dmyA00
4OX9E 4JI7E 4DUZE 4YY3E 5LMUE 2L2KB 1YYKA 2N3HA 3ADGA 1EKZA 3HTXA 2MDRA 1XNRE 2UXCE 2UU9E 2LBSB 2B7VA 2L2MA 2NUFA 1T4NA 2LTSA 4JI1E 3LLHA 1HNZE 4X8WA 2VQFE 2LRSA 1J5EE 2UXBE 4LF9E 1ZBTA 1N32E 2B3TB 2L3JA 2RSMA 1YZ9A 1PKPA 4M30A 1N33E 4JI0E 1UILA 4LFAE 4DV2E 1XMOE 4B3TE 2RTXA 2UUAE 4KHPE 2VQEE 4B3ME 1WHQA 4DV3E 4DR7E 1GQEA 1J26A 1O0WA 4JI8E 2DB2A 2EZ6A 1XNQE 4LF7E 4JV5E 4AQYE 1DI2A 4WYQB 4YHHE 2LUQA 4DV6E 4JYAE 5IWAE 3OTOE 4JI4E 4DR4E 3ADJA 4X64E 2DIXA 4B3SE 5CFFE 1IBLE 2LTRA 4X65E 3VYYA 1YYWA 1IBKE 4JI6E 3J7Yp 2UXDE 4DR2E 1STUA 4DR1E 1HR0E 4GKJE 4DR3E 1N36E 1N34E 2DMYA 4DV5E 2RS7A 4DV1E 4LF5E 4M2ZA 2F4VE 2B7TA 4DV4E 1IBME 2UUBE 5BR8E 2L33A 2NA2A 2HHHE 2NUEA 4OOGC 2ZM6E 3T1HE 4JI2E 1FJGE 1HNWE 4LFCE 1HNXE 2LUPB 4LF6E 1T4OA 4NXNE 2L3CA 1UHZA 1WHNA 3ADLA 3C4BA 4NXME 3VYXA 4K0KE 1X48A 3P1XA 2E5LE 4JI3E 4LF8E 3T1YE 4LF4E 3C4TA 1X47A 4GKKE 1T4LB 5LMNE 1YYOA 3ADIA 4X66E 4DR5E 2IHR1 2UUCE 4B3RE 2YT4A 4WFTA 2L2NA 4DUYE 1RC7A 2NUGA 4LFBE 2JY9A 1FKAE 2LJHA 2CPNA 4DV7E 4DV0E 4X62E 2N3GA 1I94E 1X49A 2RS6A 4JI5E 2KHXA 2JVAA 1RQ0A 4DR6E 1QU6A 4DKKA 1XMQE
chains in the Genus database with same CATH superfamily
4OX9E 4JI7E 2EWLA 3ADGA 1A1LA 2A25A 2MDRA 2UXCE 3KZYA 2ELZA 1HNZE 4HEIA 2YTEA 3M99B 1ZBTA 2RQLA 4NHRA 1TN9A 2EM8A 1PKPA 1WXRA 2M4IA 3IWCA 4M30A 2L92A 2MKNA 4O24A 2EOEA 3MSWA 4B3TE 1WHQA 2YRMA 2EOHA 4JI8E 4IJDA 2DB2A 5A6KA 5AE1A 3H09A 3HPSA 3VHTB 4GEQB 2EE8A 5A2QC 4JYAE 4JI4E 3OTOE 4X64E 4MLVA 2R76A 1IBLE 2DGCA 4RHBB 1EH8A 2EPMX 3THOB 1IBKE 2HC5A 2WBTA 4DR2E 1GTKA 2EM3A 2ENAA 1N36E 4TUGA 4WX9A 1N34E 2EMGA 2EPAA 2MC6A 1IBME 2WZOA 4R2EA 3UK3C 2YRHA 4WXDA 2I13A 2ZM6E 2KOUA 2EN8A 2V8QB 1T39A 3FIGA 1IMUA 1HNWE 1HNXE 4F6MA 1N3GA 4R2AA 1A1FA 1X6FA 4LF6E 1T4OA 4NXNE 2ADRA 3JTZA 2LMZA 3DF6A 3P1XA 2KONA 2V86A 4JI3E 3T1YE 1X47A 2FV4B 2Q8UA 2FGGA 4X66E 4M9VC 2IHR1 1X6EA 2EM9A 5IXMB 2MC5A 4M0VA 2L8TA 2NUGA 2JXPA 2JY9A 2LJHA 2EM7A 4BHBA 2EMAA 4DV0E 2LVHA 4DMIA 1AAYA 1YFHA 5AASA 1I94E 2EL5A 3HQ1A 2LT7A 2EMBA 2BB8A 2JVAA 1G2DC 2JYAA 4DKKA 4R2DA 1YUIA 4DUZE 2RPCA 3JAMC 4F9AB 2N3HA 4TUIA 4R2CA 2G7HA 2EOYA 2EP3A 2UU9E 2B7VA 2NUFA 2LV2A 2EMZA 2UXBE 3EPJA 2EMWA 4LF9E 4KWYA 2YSPA 2MKDA 5IV8B 2CT1A 2EPXA 3EPLA 3ZOQB 4LFAE 2YTNA 5FLXC 4KZSA 2LE2A 4R8OA 4F9CB 4GZNC 3JU0A 1X3CA 5KL6A 4RH8A 1O0WA 1YUJA 1PJSA 3F6GA 2EZ6A 4N4RB 1EH7A 1YPNA 4WYQB 2M9AA 4DR4E 1A1IA 2DIXA 5F3WA 4B3SE 5DNYA 2F8BA 2EPKX 3EPHA 4JI6E 2WCC3 4BBYA 4MLQA 3THNA 4DR3E 3VK6A 2EPRA 5KL7A 2RS7A 4L8NA 2ODRC 4DV1E 5ADZA 4M2ZA 2B7TA 4I8OA 2E72A 4P78A 1X6HA 5BR8E 2D9HA 2NA2A 5AE2A 3MHSC 1NCSA 3C6MA 2LUPB 2E1MA 3KZZA 1WHNA 2YSOA 4K0KE 1A1GA 1X48A 1T38A 5T6JA 2E5LE 1GZ6A 2EMYA 1RMDA 2YTOA 2EPZA 1T4LB 2EPUA 1UN6B 4F6NA 2EM5A 2EMFA 2UUCE 1WRJA 2YT4A 2DMIA 2L2NA 4BCAA 1A1KA 4NZVA 1RC7A 3OMLA 4LFBE 4FK5C 2JOXA 1Z1BA 2RSIA 4X9JA 2BBGA 5KL4A 1LLMC 2K7IA 2JP9A 1X49A 2EPCA 3BF2A 2I9IA 2KHXA 2EMHA 2CTDA 1QU6A 1XMQE 1BBOA 2EL6A 4YY3E 1A1HA 5LMUE 2L2KB 2CSHA 1MEYC 2JR1A 2EORA 2V89A 3C6KA 1UBDC 2L2MA 1T4NA 4R2PA 3AUZA 4X8WA 2VQFE 1J5EE 2EN7A 1IQSA 4J8ZA 2ODRD 1N32E 2EM4A 2EMLA 2RSMA 2L3JA 3K6QA 2V87A 4WSPA 5A6BA 4JI0E 2EMKA 2EPOA 1KJKA 1TF3A 4DV2E 1XMOE 2EQ0A 2UUAE 2EPLX 2EOMA 4KHPE 4B3ME 5LLQA 1J26A 2YPNA 4LF7E 3KWRA 2YTJA 4YHHE 2LUQA 5TSEA 4DV6E 2J7JA 1IQOA 2JPAA 4BS9A 2EOJA 1QNTA 2DSYA 4Q35B 5CFFE 2EMIA 2M1SA 1PJTA 2YTPA 4X65E 2YWQA 3VYYA 4BC9A 2UXDE 1STUA 2EMCA 2YTQA 5A6AA 2EOOA 2YU5A 2EOIA 2JOBA 2WBUA 4GKJE 2DMYA 2EN6A 4HTGA 4F9BB 1DQ3A 2ELYA 2F4VE 1YSAC 2LJUA 3J80C 2NUEA 3BGHA 5IT9C 2HGHA 2HHHE 4OOGC 3L00A 4BHCA 4JI2E 3DJWA 3ADLA 1UHZA 3C4BA 4BMJA 4NXME 5A69A 2EN1A 3HXLA 2EM2A 5LL6R 5KL3A 3RMPA 2HJJA 1KYQA 1ZU1A 4GKKE 1MGTA 5AE3A 3ADIA 4DR5E 2EN3A 2EPPA 2YTDA 3HPZA 4R03A 2ENHA 2H36X 4B3RE 2EOQA 2DLKA 1F2IG 2EQ3A 4DUYE 3IWBA 4R2SA 2WBSA 2EOXA 2MDGA 1A1JA 2DLQA 1BB8A 1EH6A 2PRTA 2R1FA 2GLIA 3BBGA 2RS6A 4JI5E 1TF6A 4DR6E 1GQEA 5AC4A 2LO3A 1G2FC 4F2JC 1BBGA 2JWOA 1P47A 2EJ4A 2NABA 4WPYA 1YYKA 2EN2A 2ENCA 3HTXA 1EKZA 1DGCA 1XNRE 2FTXB 2LBSB 5KL5A 1ZBQA 3ECRA 2LTSA 4JI1E 3LLHA 4R2QA 2VF1A 2LRSA 2EM6A 2B3TB 4O43A 2YRKA 3J7AG 3BIDA 4L5NC 1YZ9A 2EOFA 2YTFA 1N33E 1UILA 2EOZA 3EQ1A 3MHHC 2V88A 2RTXA 2VQEE 4DR7E 4LU9A 2EN4A 4DV3E 4O5GA 4IS1C 1XNQE 4JV5E 2YTIA 4ZYEA 5AC5A 4AQYE 3LMLA 2VE7C 1DI2A 5IWAE 3ADJA 4Q28A 2LTRA 4ZYDA 1YYWA 3J7Yp 1B69A 4P7DA 1HR0E 4DR1E 1JK2A 2EMXA 1AH5A 3EPKA 4DV5E 4WXCA 4LF5E 4WSGA 4DV4E 4BC7A 2UUBE 2GHFA 2L33A 2V85A 2GPIA 3T1HE 4R2RA 2K4VA 2EM0A 1FJGE 1PDAA 4LTYA 4LFCE 1SFEA 3TQMA 4F54A 2L3CA 3F6HA 3J81C 3VYXA 1NEIA 1X5WA 5A6JA 3AV0A 4ZYGA 4LF8E 4LF4E 3C4TA 2DRPA 5LMNE 2EQ1A 1YYOA 1L4SA 3IWDA 2EPNA 2EL4A 2B9DA 4ZYHA 4O4KA 2L6MA 2LCEA 4WFTA 2V83A 3QG5C 1PJQA 1FKAE 2N8XA 2VRDA 5KL2A 1SR9A 2CPNA 4DV7E 1ZAAC 5A6BD 4X62E 2N3GA 2YZTA 2EOSA 2YU8A 1WJPA 1RQ0A 1ZR9A 2YTGA 1JK1A 2M7QA
chains in the Genus database with same CATH topology
4OX9E 4JI7E 4DUZE 3JAMC 2JWOA 2EWLA 4YY3E 5LMUE 2L2KB 4WPYA 4F9AB 1YYKA 2N3HA 2JR1A 4TUIA 3ADGA 1EKZA 3HTXA 2MDRA 1XNRE 2G7HA 2FTXB 2V89A 2UU9E 2LBSB 2B7VA 2L2MA 1ZBQA 1T4NA 2LTSA 2NUFA 3LLHA 1HNZE 4JI1E 3AUZA 2VF1A 2UXCE 4X8WA 2VQFE 2LRSA 1J5EE 2UXBE 4J8ZA 2ODRD 4LF9E 1ZBTA 1N32E 2B3TB 3J7AG 4L5NC 2RSMA 2L3JA 1YZ9A 3K6QA 2V87A 1PKPA 1WXRA 2M4IA 3IWCA 4M30A 2L92A 4WSPA 1N33E 4JI0E 1UILA 3ZOQB 4LFAE 3MSWA 4DV2E 1XMOE 2V88A 4B3TE 2RTXA 2UUAE 5FLXC 4KZSA 2LE2A 4R8OA 1WHQA 4LU9A 4F9CB 2VQEE 3JU0A 4DV3E 4B3ME 4DR7E 1J26A 1O0WA 4JI8E 3F6GA 2DB2A 2EZ6A 5AE1A 3H09A 3HPSA 1XNQE 4LF7E 4JV5E 4GEQB 4AQYE 3LMLA 2VE7C 1DI2A 3KWRA 4WYQB 4YHHE 2LUQA 5A2QC 4DV6E 4LF8E 4JYAE 5IWAE 3OTOE 4JI4E 4DR4E 3ADJA 4BS9A 4X64E 2DIXA 5F3WA 2DSYA 4B3SE 4Q28A 5DNYA 5CFFE 3ADLA 1IBLE 2M1SA 2LTRA 2F8BA 4X65E 3VYYA 1YYWA 4BC9A 1IBKE 3J7Yp 4JI6E 2UXDE 4DR2E 4P7DA 4BBYA 1STUA 4DR1E 1HR0E 2JOBA 4DR3E 1N36E 4TUGA 3VK6A 1N34E 4GKJE 2DMYA 4DV5E 2RS7A 4L8NA 2ODRC 4F9BB 5ADZA 4DV1E 4LF5E 2MC6A 4M2ZA 1DQ3A 2F4VE 2B7TA 4I8OA 4DV4E 4BC7A 1IBME 2UUBE 2WZOA 4P78A 5BR8E 3J80C 2L33A 2NA2A 5IT9C 2HHHE 2NUEA 5AE2A 4OOGC 2V85A 2ZM6E 2KOUA 3T1HE 2K4VA 2V8QB 3FIGA 4JI2E 1FJGE 4LTYA 1HNWE 4LFCE 3DJWA 1HNXE 2LUPB 2E1MA 4LF6E 4F54A 1T4OA 4NXNE 2L3CA 1UHZA 1WHNA 3JTZA 3C4BA 2LMZA 3F6HA 4BMJA 3J81C 4NXME 3VYXA 1X48A 4K0KE 3HXLA 5T6JA 3AV0A 3DF6A 3P1XA 2KONA 2V86A 5LL6R 4DKKA 3RMPA 1GZ6A 3T1YE 2E5LE 3C4TA 2FV4B 1X47A 4JI3E 4LF4E 1T4LB 5LMNE 4GKKE 5AE3A 1YYOA 2FGGA 3IWDA 3ADIA 4X66E 2B9DA 4DR5E 2IHR1 3HPZA 2UUCE 4R03A 2L6MA 2H36X 4B3RE 2YT4A 2MC5A 4M0VA 4WFTA 2L2NA 4BCAA 4DUYE 2V83A 3IWBA 2L8TA 1RC7A 3OMLA 2NUGA 4LFBE 2JY9A 1FKAE 2LJHA 1SR9A 2CPNA 4DV7E 4DV0E 4DMIA 2JOXA 4X62E 2N3GA 2YZTA 1I94E 5AASA 1X49A 3HQ1A 2RS6A 4JI5E 2KHXA 4KHPE 2JVAA 1RQ0A 4DR6E 1QU6A 1GQEA 1XMQE 2M7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OX9 E;  4JI7 E;  4DUZ E;  4YY3 E;  5LMU E;  2L2K B;  1YYK A;  2N3H A;  3ADG A;  1EKZ A;  3HTX A;  2MDR A;  1XNR E;  2UXC E;  2UU9 E;  2LBS B;  2B7V A;  2L2M A;  2NUF A;  1T4N A;  2LTS A;  4JI1 E;  3LLH A;  1HNZ E;  4X8W A;  2VQF E;  2LRS A;  1J5E E;  2UXB E;  4LF9 E;  1ZBT A;  1N32 E;  2B3T B;  2L3J A;  2RSM A;  1YZ9 A;  1PKP A;  4M30 A;  1N33 E;  4JI0 E;  1UIL A;  4LFA E;  4DV2 E;  1XMO E;  4B3T E;  2RTX A;  2UUA E;  4KHP E;  2VQE E;  4B3M E;  1WHQ A;  4DV3 E;  4DR7 E;  1GQE A;  1J26 A;  1O0W A;  4JI8 E;  2DB2 A;  2EZ6 A;  1XNQ E;  4LF7 E;  4JV5 E;  4AQY E;  1DI2 A;  4WYQ B;  4YHH E;  2LUQ A;  4DV6 E;  4JYA E;  5IWA E;  3OTO E;  4JI4 E;  4DR4 E;  3ADJ A;  4X64 E;  2DIX A;  4B3S E;  5CFF E;  1IBL E;  2LTR A;  4X65 E;  3VYY A;  1YYW A;  1IBK E;  4JI6 E;  3J7Y p;  2UXD E;  4DR2 E;  1STU A;  4DR1 E;  1HR0 E;  4GKJ E;  4DR3 E;  1N36 E;  1N34 E;  2DMY A;  4DV5 E;  2RS7 A;  4DV1 E;  4LF5 E;  4M2Z A;  2F4V E;  2B7T A;  4DV4 E;  1IBM E;  2UUB E;  5BR8 E;  2L33 A;  2NA2 A;  2HHH E;  2NUE A;  4OOG C;  2ZM6 E;  3T1H E;  4JI2 E;  1FJG E;  1HNW E;  4LFC E;  1HNX E;  2LUP B;  4LF6 E;  1T4O A;  4NXN E;  2L3C A;  1UHZ A;  1WHN A;  3ADL A;  3C4B A;  4NXM E;  3VYX A;  4K0K E;  1X48 A;  3P1X A;  2E5L E;  4JI3 E;  4LF8 E;  3T1Y E;  4LF4 E;  3C4T A;  1X47 A;  4GKK E;  1T4L B;  5LMN E;  1YYO A;  3ADI A;  4X66 E;  4DR5 E;  2IHR 1;  2UUC E;  4B3R E;  2YT4 A;  4WFT A;  2L2N A;  4DUY E;  1RC7 A;  2NUG A;  4LFB E;  2JY9 A;  1FKA E;  2LJH A;  2CPN A;  4DV7 E;  4DV0 E;  4X62 E;  2N3G A;  1I94 E;  1X49 A;  2RS6 A;  4JI5 E;  2KHX A;  2JVA A;  1RQ0 A;  4DR6 E;  1QU6 A;  4DKK A;  1XMQ E; 
#chains in the Genus database with same CATH topology
 4OX9 E;  4JI7 E;  2EWL A;  3ADG A;  1A1L A;  2A25 A;  2MDR A;  2UXC E;  3KZY A;  2ELZ A;  1HNZ E;  4HEI A;  2YTE A;  3M99 B;  1ZBT A;  2RQL A;  4NHR A;  1TN9 A;  2EM8 A;  1PKP A;  1WXR A;  2M4I A;  3IWC A;  4M30 A;  2L92 A;  2MKN A;  4O24 A;  2EOE A;  3MSW A;  4B3T E;  1WHQ A;  2YRM A;  2EOH A;  4JI8 E;  4IJD A;  2DB2 A;  5A6K A;  5AE1 A;  3H09 A;  3HPS A;  3VHT B;  4GEQ B;  2EE8 A;  5A2Q C;  4JYA E;  4JI4 E;  3OTO E;  4X64 E;  4MLV A;  2R76 A;  1IBL E;  2DGC A;  4RHB B;  1EH8 A;  2EPM X;  3THO B;  1IBK E;  2HC5 A;  2WBT A;  4DR2 E;  1GTK A;  2EM3 A;  2ENA A;  1N36 E;  4TUG A;  4WX9 A;  1N34 E;  2EMG A;  2EPA A;  2MC6 A;  1IBM E;  2WZO A;  4R2E A;  3UK3 C;  2YRH A;  4WXD A;  2I13 A;  2ZM6 E;  2KOU A;  2EN8 A;  2V8Q B;  1T39 A;  3FIG A;  1IMU A;  1HNW E;  1HNX E;  4F6M A;  1N3G A;  4R2A A;  1A1F A;  1X6F A;  4LF6 E;  1T4O A;  4NXN E;  2ADR A;  3JTZ A;  2LMZ A;  3DF6 A;  3P1X A;  2KON A;  2V86 A;  4JI3 E;  3T1Y E;  1X47 A;  2FV4 B;  2Q8U A;  2FGG A;  4X66 E;  4M9V C;  2IHR 1;  1X6E A;  2EM9 A;  5IXM B;  2MC5 A;  4M0V A;  2L8T A;  2NUG A;  2JXP A;  2JY9 A;  2LJH A;  2EM7 A;  4BHB A;  2EMA A;  4DV0 E;  2LVH A;  4DMI A;  1AAY A;  1YFH A;  5AAS A;  1I94 E;  2EL5 A;  3HQ1 A;  2LT7 A;  2EMB A;  2BB8 A;  2JVA A;  1G2D C;  2JYA A;  4DKK A;  4R2D A;  1YUI A;  4DUZ E;  2RPC A;  3JAM C;  4F9A B;  2N3H A;  4TUI A;  4R2C A;  2G7H A;  2EOY A;  2EP3 A;  2UU9 E;  2B7V A;  2NUF A;  2LV2 A;  2EMZ A;  2UXB E;  3EPJ A;  2EMW A;  4LF9 E;  4KWY A;  2YSP A;  2MKD A;  5IV8 B;  2CT1 A;  2EPX A;  3EPL A;  3ZOQ B;  4LFA E;  2YTN A;  5FLX C;  4KZS A;  2LE2 A;  4R8O A;  4F9C B;  4GZN C;  3JU0 A;  1X3C A;  5KL6 A;  4RH8 A;  1O0W A;  1YUJ A;  1PJS A;  3F6G A;  2EZ6 A;  4N4R B;  1EH7 A;  1YPN A;  4WYQ B;  2M9A A;  4DR4 E;  1A1I A;  2DIX A;  5F3W A;  4B3S E;  5DNY A;  2F8B A;  2EPK X;  3EPH A;  4JI6 E;  2WCC 3;  4BBY A;  4MLQ A;  3THN A;  4DR3 E;  3VK6 A;  2EPR A;  5KL7 A;  2RS7 A;  4L8N A;  2ODR C;  4DV1 E;  5ADZ A;  4M2Z A;  2B7T A;  4I8O A;  2E72 A;  4P78 A;  1X6H A;  5BR8 E;  2D9H A;  2NA2 A;  5AE2 A;  3MHS C;  1NCS A;  3C6M A;  2LUP B;  2E1M A;  3KZZ A;  1WHN A;  2YSO A;  4K0K E;  1A1G A;  1X48 A;  1T38 A;  5T6J A;  2E5L E;  1GZ6 A;  2EMY A;  1RMD A;  2YTO A;  2EPZ A;  1T4L B;  2EPU A;  1UN6 B;  4F6N A;  2EM5 A;  2EMF A;  2UUC E;  1WRJ A;  2YT4 A;  2DMI A;  2L2N A;  4BCA A;  1A1K A;  4NZV A;  1RC7 A;  3OML A;  4LFB E;  4FK5 C;  2JOX A;  1Z1B A;  2RSI A;  4X9J A;  2BBG A;  5KL4 A;  1LLM C;  2K7I A;  2JP9 A;  1X49 A;  2EPC A;  3BF2 A;  2I9I A;  2KHX A;  2EMH A;  2CTD A;  1QU6 A;  1XMQ E;  1BBO A;  2EL6 A;  4YY3 E;  1A1H A;  5LMU E;  2L2K B;  2CSH A;  1MEY C;  2JR1 A;  2EOR A;  2V89 A;  3C6K A;  1UBD C;  2L2M A;  1T4N A;  4R2P A;  3AUZ A;  4X8W A;  2VQF E;  1J5E E;  2EN7 A;  1IQS A;  4J8Z A;  2ODR D;  1N32 E;  2EM4 A;  2EML A;  2RSM A;  2L3J A;  3K6Q A;  2V87 A;  4WSP A;  5A6B A;  4JI0 E;  2EMK A;  2EPO A;  1KJK A;  1TF3 A;  4DV2 E;  1XMO E;  2EQ0 A;  2UUA E;  2EPL X;  2EOM A;  4KHP E;  4B3M E;  5LLQ A;  1J26 A;  2YPN A;  4LF7 E;  3KWR A;  2YTJ A;  4YHH E;  2LUQ A;  5TSE A;  4DV6 E;  2J7J A;  1IQO A;  2JPA A;  4BS9 A;  2EOJ A;  1QNT A;  2DSY A;  4Q35 B;  5CFF E;  2EMI A;  2M1S A;  1PJT A;  2YTP A;  4X65 E;  2YWQ A;  3VYY A;  4BC9 A;  2UXD E;  1STU A;  2EMC A;  2YTQ A;  5A6A A;  2EOO A;  2YU5 A;  2EOI A;  2JOB A;  2WBU A;  4GKJ E;  2DMY A;  2EN6 A;  4HTG A;  4F9B B;  1DQ3 A;  2ELY A;  2F4V E;  1YSA C;  2LJU A;  3J80 C;  2NUE A;  3BGH A;  5IT9 C;  2HGH A;  2HHH E;  4OOG C;  3L00 A;  4BHC A;  4JI2 E;  3DJW A;  3ADL A;  1UHZ A;  3C4B A;  4BMJ A;  4NXM E;  5A69 A;  2EN1 A;  3HXL A;  2EM2 A;  5LL6 R;  5KL3 A;  3RMP A;  2HJJ A;  1KYQ A;  1ZU1 A;  4GKK E;  1MGT A;  5AE3 A;  3ADI A;  4DR5 E;  2EN3 A;  2EPP A;  2YTD A;  3HPZ A;  4R03 A;  2ENH A;  2H36 X;  4B3R E;  2EOQ A;  2DLK A;  1F2I G;  2EQ3 A;  4DUY E;  3IWB A;  4R2S A;  2WBS A;  2EOX A;  2MDG A;  1A1J A;  2DLQ A;  1BB8 A;  1EH6 A;  2PRT A;  2R1F A;  2GLI A;  3BBG A;  2RS6 A;  4JI5 E;  1TF6 A;  4DR6 E;  1GQE A;  5AC4 A;  2LO3 A;  1G2F C;  4F2J C;  1BBG A;  2JWO A;  1P47 A;  2EJ4 A;  2NAB A;  4WPY A;  1YYK A;  2EN2 A;  2ENC A;  3HTX A;  1EKZ A;  1DGC A;  1XNR E;  2FTX B;  2LBS B;  5KL5 A;  1ZBQ A;  3ECR A;  2LTS A;  4JI1 E;  3LLH A;  4R2Q A;  2VF1 A;  2LRS A;  2EM6 A;  2B3T B;  4O43 A;  2YRK A;  3J7A G;  3BID A;  4L5N C;  1YZ9 A;  2EOF A;  2YTF A;  1N33 E;  1UIL A;  2EOZ A;  3EQ1 A;  3MHH C;  2V88 A;  2RTX A;  2VQE E;  4DR7 E;  4LU9 A;  2EN4 A;  4DV3 E;  4O5G A;  4IS1 C;  1XNQ E;  4JV5 E;  2YTI A;  4ZYE A;  5AC5 A;  4AQY E;  3LML A;  2VE7 C;  1DI2 A;  5IWA E;  3ADJ A;  4Q28 A;  2LTR A;  4ZYD A;  1YYW A;  3J7Y p;  1B69 A;  4P7D A;  1HR0 E;  4DR1 E;  1JK2 A;  2EMX A;  1AH5 A;  3EPK A;  4DV5 E;  4WXC A;  4LF5 E;  4WSG A;  4DV4 E;  4BC7 A;  2UUB E;  2GHF A;  2L33 A;  2V85 A;  2GPI A;  3T1H E;  4R2R A;  2K4V A;  2EM0 A;  1FJG E;  1PDA A;  4LTY A;  4LFC E;  1SFE A;  3TQM A;  4F54 A;  2L3C A;  3F6H A;  3J81 C;  3VYX A;  1NEI A;  1X5W A;  5A6J A;  3AV0 A;  4ZYG A;  4LF8 E;  4LF4 E;  3C4T A;  2DRP A;  5LMN E;  2EQ1 A;  1YYO A;  1L4S A;  3IWD A;  2EPN A;  2EL4 A;  2B9D A;  4ZYH A;  4O4K A;  2L6M A;  2LCE A;  4WFT A;  2V83 A;  3QG5 C;  1PJQ A;  1FKA E;  2N8X A;  2VRD A;  5KL2 A;  1SR9 A;  2CPN A;  4DV7 E;  1ZAA C;  5A6B D;  4X62 E;  2N3G A;  2YZT A;  2EOS A;  2YU8 A;  1WJP A;  1RQ0 A;  1ZR9 A;  2YTG A;  1JK1 A;  2M7Q A; 
#chains in the Genus database with same CATH homology
 4OX9 E;  4JI7 E;  4DUZ E;  3JAM C;  2JWO A;  2EWL A;  4YY3 E;  5LMU E;  2L2K B;  4WPY A;  4F9A B;  1YYK A;  2N3H A;  2JR1 A;  4TUI A;  3ADG A;  1EKZ A;  3HTX A;  2MDR A;  1XNR E;  2G7H A;  2FTX B;  2V89 A;  2UU9 E;  2LBS B;  2B7V A;  2L2M A;  1ZBQ A;  1T4N A;  2LTS A;  2NUF A;  3LLH A;  1HNZ E;  4JI1 E;  3AUZ A;  2VF1 A;  2UXC E;  4X8W A;  2VQF E;  2LRS A;  1J5E E;  2UXB E;  4J8Z A;  2ODR D;  4LF9 E;  1ZBT A;  1N32 E;  2B3T B;  3J7A G;  4L5N C;  2RSM A;  2L3J A;  1YZ9 A;  3K6Q A;  2V87 A;  1PKP A;  1WXR A;  2M4I A;  3IWC A;  4M30 A;  2L92 A;  4WSP A;  1N33 E;  4JI0 E;  1UIL A;  3ZOQ B;  4LFA E;  3MSW A;  4DV2 E;  1XMO E;  2V88 A;  4B3T E;  2RTX A;  2UUA E;  5FLX C;  4KZS A;  2LE2 A;  4R8O A;  1WHQ A;  4LU9 A;  4F9C B;  2VQE E;  3JU0 A;  4DV3 E;  4B3M E;  4DR7 E;  1J26 A;  1O0W A;  4JI8 E;  3F6G A;  2DB2 A;  2EZ6 A;  5AE1 A;  3H09 A;  3HPS A;  1XNQ E;  4LF7 E;  4JV5 E;  4GEQ B;  4AQY E;  3LML A;  2VE7 C;  1DI2 A;  3KWR A;  4WYQ B;  4YHH E;  2LUQ A;  5A2Q C;  4DV6 E;  4LF8 E;  4JYA E;  5IWA E;  3OTO E;  4JI4 E;  4DR4 E;  3ADJ A;  4BS9 A;  4X64 E;  2DIX A;  5F3W A;  2DSY A;  4B3S E;  4Q28 A;  5DNY A;  5CFF E;  3ADL A;  1IBL E;  2M1S A;  2LTR A;  2F8B A;  4X65 E;  3VYY A;  1YYW A;  4BC9 A;  1IBK E;  3J7Y p;  4JI6 E;  2UXD E;  4DR2 E;  4P7D A;  4BBY A;  1STU A;  4DR1 E;  1HR0 E;  2JOB A;  4DR3 E;  1N36 E;  4TUG A;  3VK6 A;  1N34 E;  4GKJ E;  2DMY A;  4DV5 E;  2RS7 A;  4L8N A;  2ODR C;  4F9B B;  5ADZ A;  4DV1 E;  4LF5 E;  2MC6 A;  4M2Z A;  1DQ3 A;  2F4V E;  2B7T A;  4I8O A;  4DV4 E;  4BC7 A;  1IBM E;  2UUB E;  2WZO A;  4P78 A;  5BR8 E;  3J80 C;  2L33 A;  2NA2 A;  5IT9 C;  2HHH E;  2NUE A;  5AE2 A;  4OOG C;  2V85 A;  2ZM6 E;  2KOU A;  3T1H E;  2K4V A;  2V8Q B;  3FIG A;  4JI2 E;  1FJG E;  4LTY A;  1HNW E;  4LFC E;  3DJW A;  1HNX E;  2LUP B;  2E1M A;  4LF6 E;  4F54 A;  1T4O A;  4NXN E;  2L3C A;  1UHZ A;  1WHN A;  3JTZ A;  3C4B A;  2LMZ A;  3F6H A;  4BMJ A;  3J81 C;  4NXM E;  3VYX A;  1X48 A;  4K0K E;  3HXL A;  5T6J A;  3AV0 A;  3DF6 A;  3P1X A;  2KON A;  2V86 A;  5LL6 R;  4DKK A;  3RMP A;  1GZ6 A;  3T1Y E;  2E5L E;  3C4T A;  2FV4 B;  1X47 A;  4JI3 E;  4LF4 E;  1T4L B;  5LMN E;  4GKK E;  5AE3 A;  1YYO A;  2FGG A;  3IWD A;  3ADI A;  4X66 E;  2B9D A;  4DR5 E;  2IHR 1;  3HPZ A;  2UUC E;  4R03 A;  2L6M A;  2H36 X;  4B3R E;  2YT4 A;  2MC5 A;  4M0V A;  4WFT A;  2L2N A;  4BCA A;  4DUY E;  2V83 A;  3IWB A;  2L8T A;  1RC7 A;  3OML A;  2NUG A;  4LFB E;  2JY9 A;  1FKA E;  2LJH A;  1SR9 A;  2CPN A;  4DV7 E;  4DV0 E;  4DMI A;  2JOX A;  4X62 E;  2N3G A;  2YZT A;  1I94 E;  5AAS A;  1X49 A;  3HQ1 A;  2RS6 A;  4JI5 E;  2KHX A;  4KHP E;  2JVA A;  1RQ0 A;  4DR6 E;  1QU6 A;  1GQE A;  1XMQ E;  2M7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...