1TN9A

The solution structure of tn916 integrase n-terminal domain/dna complex
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
b'EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDAISLREKIAELQKDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*AP*GP*TP*AP*GP*TP*AP*AP*AP*TP*TP*C)-3')
molecule tags Integrase/dna
source organism Enterococcus faecalis
publication title NMR structure of the Tn916 integrase-DNA complex.
pubmed doi rcsb
total genus 7
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1999-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tn9A00
2EOZA 2EMFA 1UBDC 1P47A 2EN6A 2EOQA 2EJ4A 3UK3C 2EOOA 1B69A 2HGHA 2EMLA 2MDGA 4IS1C 4F2JC 1JK1A 2YTJA 2WBUA 4R2DA 2EMZA 2EOIA 4F6NA 2EMBA 4M9VC 1X5WA 1X3CA 2EM6A 2LT7A 4F6MA 1KJKA 2ENCA 1Z1BA 2I13A 2E72A 1DGCA 2R1FA 2YTIA 1TF6A 3MHSC 2EOSA 2ENHA 2EE8A 1TF3A 2LCEA 2RSIA 2GLIA 2EOYA 2A25A 2NABA 4R2SA 4R2EA 2YTFA 2YTGA 2WCC3 2LO3A 2YTDA 2PRTA 5KL7A 1ZAAC 2YRKA 2EMGA 2EM5A 4IJDA 2D9HA 4FK5C 4R2AA 3VHTB 2EMWA 2BB8A 2EMKA 1A1GA 2MKNA 1A1JA 2EOEA 2EL4A 3EPHA 2MKDA 2EQ3A 5KL6A 2YRMA 1G2DC 2EOFA 2EPCA 3M99B 5KL2A 2EOXA 4X9JA 2WBSA 2EMAA 2EMCA 2VRDA 2M9AA 2DGCA 2EPZA 2EM7A 1ZU1A 1YUJA 1A1LA 4WSGA 2YSPA 5KL3A 2CTDA 1F2IG 3MHHC 2DMIA 2EOJA 2YTEA 2JP9A 2EMXA 2EPRA 4R2QA 2EM0A 2EOMA 2EL5A 2YTPA 3EPLA 2JPAA 4GZNC 1X6HA 1WJPA 2EN2A 1MEYC 1RMDA 1X6EA 2EPXA 2EP3A 2YU5A 2LV2A 1LLMC 1BBOA 2J7JA 2YSOA 1A1FA 3EPJA 2YTOA 2EM3A 1JK2A 2EM9A 2EM2A 2DLQA 2YTNA 2EPPA 1G2FC 1YUIA 2EM8A 2DRPA 2CT1A 2EMHA 2WBTA 2YU8A 2ADRA 2EN3A 2LVHA 2EMYA 1UN6B 5KL5A 2EQ1A 5KL4A 1A1IA 1AAYA 4R2RA 2EN1A 1A1HA 2CSHA 4R2PA 2EM4A 2ELZA 1ZR9A 2EPAA 4R2CA 2EMIA 2YRHA 1TN9A 1X6FA 3EPKA 2EN8A 2ENAA 2GHFA 2EPUA 1YSAC 2DLKA 2RPCA 2EORA 2EOHA 1NCSA 1BB8A 2EQ0A 2ELYA 2EN4A 2YTQA 1A1KA 2EN7A 2EL6A
chains in the Genus database with same CATH superfamily
4P7DA 2EOZA 1P47A 4LF4E 2EJ4A 3F6HA 2YTJA 4JI0E 2FV4B 1YZ9A 1PJTA 2EMZA 4R2DA 2L6MA 2EMBA 5LL6R 4MLVA 4DUYE 2ZM6E 3H09A 2R1FA 1TF6A 1PKPA 2L2NA 4HTGA 2EE8A 1WXRA 2M4IA 2B9DA 2VE7C 2RSIA 2GLIA 2EPNA 4M2ZA 5LMUE 1O0WA 2NABA 4R2SA 2JOXA 2V87A 2DIXA 4ZYHA 2LO3A 1ZAAC 1RC7A 4O43A 3AUZA 1EH7A 1T39A 2EMWA 5AE3A 1QNTA 1IBLE 2EOEA 2EL4A 2YT4A 3BIDA 4LF7E 1G2DC 2YRMA 2EOXA 4WXCA 3J7AG 3KWRA 4X9JA 2LUQA 3IWBA 1EH6A 2DGCA 3OTOE 4DV3E 2EM7A 1ZU1A 2K7IA 2YSPA 5KL3A 3EQ1A 2L3CA 4LF5E 2EPKX 2EOJA 2YTEA 2E1MA 2F8BA 4BBYA 2JPAA 4GZNC 1X6HA 4JI4E 2EN2A 4GEQB 1MEYC 4F9AB 1RMDA 4DUZE 3ECRA 2G7HA 2YSOA 2YTOA 1JK2A 1N34E 1HNZE 2EM9A 2MDRA 2EM2A 2V85A 1IQSA 3JU0A 2YTNA 1YUIA 2YWQA 2EM8A 4BHBA 2ADRA 2EN3A 1UN6B 2EQ1A 1A1IA 3ADLA 4R8OA 3AV0A 4OOGC 2EPAA 2RTXA 4DV4E 1X6FA 3EPKA 2GHFA 2EPUA 3T1HE 2LTSA 2UUCE 2E5LE 4DR1E 5IXMB 4I8OA 1MGTA 1HR0E 2JYAA 2EMFA 3HQ1A 3KZZA 2IHR1 1PDAA 2EN6A 3UK3C 3VYYA 2EOOA 2HGHA 1N32E 4F2JC 2KONA 1N36E 3KZYA 2EOIA 4F6NA 3JTZA 4M9VC 1X3CA 1X5WA 5AASA 2JWOA 1UHZA 1KJKA 4F54A 1STUA 1Z1BA 3MHSC 4JI7E 2EOSA 4B3ME 2LCEA 4YHHE 4DR6E 5FLXC 1PJSA 2A25A 2H36X 4WXDA 4DV7E 4R2EA 4DMIA 2YTFA 3THOB 2JR1A 2YTGA 2WCC3 4B3TE 1FJGE 2KOUA 4BS9A 1GZ6A 2EM5A 4HEIA 2MC6A 1BBGA 3C4BA 4KZSA 2BB8A 1A1GA 2MKNA 2Q8UA 2KHXA 2MKDA 5KL6A 2NUGA 5T6JA 2EPCA 1EH8A 5KL2A 4X8WA 1T38A 4NHRA 2WBSA 2VQEE 5A6BA 4F9BB 4K0KE 1YUJA 2V88A 1A1LA 3DJWA 2LBSB 2RQLA 4WSGA 5A6BD 5A6KA 5A2QC 2VQFE 1XNRE 2LRSA 3DF6A 1X49A 3OMLA 4DR4E 3HTXA 2EMXA 2EPRA 4JI3E 1HNXE 2EOMA 2YPNA 2EL5A 3EPLA 4AQYE 3L00A 2NA2A 1QU6A 2YU5A 2LV2A 2WZOA 5AC4A 1N3GA 5TSEA 4NXNE 4DV6E 1BBOA 5ADZA 2B3TB 2FTXB 4BC9A 4GKJE 2HC5A 4P78A 2R76A 5LMNE 1PJQA 2DLQA 2EPPA 4F9CB 2L3JA 3C6KA 4JV5E 4DV2E 3VK6A 2WBTA 3BBGA 2LVHA 2EMYA 3JAMC 5KL5A 1AAYA 1KYQA 3K6QA 2JY9A 1A1HA 4LFBE 2CSHA 4R2PA 2EM4A 1N33E 2V86A 2HHHE 2DLKA 2ELYA 3LMLA 1XMQE 4LTYA 2EN7A 2EL6A 4LFAE 4DR2E 3HPZA 2EMLA 2MDGA 4YY3E 4DV0E 1JK1A 1WHNA 4MLQA 2UXBE 2UXDE 2EM6A 2LT7A 4LFCE 1X48A 2F4VE 1DGCA 5LLQA 2DMYA 2ENHA 4BCAA 4BMJA 1TF3A 3C6MA 3VYXA 2K4VA 2EOYA 2UU9E 4RHBB 3LLHA 1HNWE 2JXPA 4BC7A 2DB2A 1YYOA 4M30A 4KHPE 3ADGA 2YTDA 3T1YE 2EZ6A 2PRTA 5KL7A 2YRKA 2EMGA 1ZBTA 2B7VA 4IJDA 5A6JA 4FK5C 2RS6A 4R2AA 4GKKE 4ZYEA 3VHTB 1X47A 3THNA 1A1JA 1SFEA 2EQ3A 2L2KB 3M99B 4NXME 1RQ0A 4DKKA 1WRJA 1UILA 5BR8E 2VRDA 2M9AA 2RSMA 2EPZA 5DNYA 3RMPA 2JOBA 2LTRA 5IT9C 4LF8E 4X65E 2YTPA 3ADIA 2N3GA 1WJPA 4O24A 1XMOE 4B3RE 1X6EA 1IBME 2EPLX 1LLMC 4JYAE 2J7JA 4JI5E 4B3SE 1A1FA 1T4NA 3EPJA 1T4LB 5AE1A 2VF1A 3IWDA 4JI8E 2EPMX 3ADJA 1YPNA 1XNQE 4TUGA 1G2FC 4X66E 2YU8A 2EMHA 4JI6E 1IQOA 2LMZA 1AH5A 5KL4A 2HJJA 4R2RA 2EN1A 3J81C 2DSYA 1ZR9A 2UUBE 4OX9E 2EMIA 2YRHA 4JI1E 1YSAC 2ENAA 1L4SA 2RPCA 2EORA 1NCSA 1BB8A 3HPSA 4O5GA 2MC5A 2JVAA 1FKAE 2BBGA 2I9IA 1UBDC 2EOQA 2LUPB 4DR7E 1I94E 1B69A 4DR5E 5AE2A 4IS1C 1ZBQA 4RH8A 3FIGA 2WBUA 4O4KA 4N4RB 4F6MA 2N8XA 2M7QA 1YFHA 4LF6E 2YZTA 2ENCA 2I13A 2E72A 1YYWA 2YTIA 5A6AA 2ODRC 2LE2A 4BHCA 4L5NC 1IMUA 1NEIA 2UUAE 3MSWA 4DV1E 5F3WA 1GQEA 4DR3E 3P1XA 4ZYDA 4LU9A 3TQMA 4WFTA 1IBKE 4X64E 2D9HA 2CPNA 2LJHA 4WSPA 2EMKA 2N3HA 3EPHA 2FGGA 4WX9A 5IV8B 4TUIA 2EOFA 2GPIA 2L2MA 2EMAA 2EMCA 2L33A 4LF9E 1YYKA 1DQ3A 2EPOA 1SR9A 2CTDA 1F2IG 3MHHC 2LJUA 2ODRD 2V8QB 2DMIA 3C4TA 5CFFE 4R03A 4DV5E 2JP9A 4R2QA 2EM0A 3BGHA 4X62E 3QG5C 1T4OA 1DI2A 2EPXA 4KWYA 2EP3A 1GTKA 2V89A 3IWCA 4JI2E 4Q28A 2NUEA 4WYQB 2L92A 2EM3A 3F6GA 2L8TA 3J7Yp 5AC5A 4L8NA 4WPYA 1EKZA 2UXCE 2DRPA 2CT1A 1J5EE 4ZYGA 4J8ZA 3J80C 4M0VA 4NZVA 3HXLA 4Q35B 2ELZA 2B7TA 4R2CA 2EWLA 2V83A 3ZOQB 1TN9A 5IWAE 3BF2A 2EN8A 1J26A 5A69A 2EOHA 2RS7A 2NUFA 2EQ0A 1WHQA 2M1SA 2EN4A 2YTQA 1A1KA
chains in the Genus database with same CATH topology
2EOZA 2EMFA 1UBDC 1P47A 2EN6A 2EOQA 2EJ4A 3UK3C 2EOOA 1B69A 2HGHA 2EMLA 2MDGA 4IS1C 4F2JC 1JK1A 2YTJA 2WBUA 4R2DA 2EMZA 2EOIA 4F6NA 2EMBA 4M9VC 1X5WA 1X3CA 2EM6A 2LT7A 4F6MA 1KJKA 2ENCA 1Z1BA 2I13A 2E72A 1DGCA 2R1FA 2YTIA 1TF6A 3MHSC 2EOSA 2ENHA 2EE8A 1TF3A 2LCEA 2RSIA 2GLIA 2EOYA 2A25A 2NABA 4R2SA 4R2EA 2YTFA 2YTGA 2WCC3 2LO3A 2YTDA 2PRTA 5KL7A 1ZAAC 2YRKA 2EMGA 2EM5A 4IJDA 2D9HA 4FK5C 4R2AA 3VHTB 2EMWA 2BB8A 2EMKA 1A1GA 2MKNA 1A1JA 2EOEA 2EL4A 3EPHA 2MKDA 2EQ3A 5KL6A 2YRMA 1G2DC 2EOFA 2EPCA 3M99B 5KL2A 2EOXA 4X9JA 2WBSA 2EMAA 2EMCA 2VRDA 2M9AA 2DGCA 2EPZA 2EM7A 1ZU1A 1YUJA 1A1LA 4WSGA 2YSPA 5KL3A 2CTDA 1F2IG 3MHHC 2DMIA 2EOJA 2YTEA 2JP9A 2EMXA 2EPRA 4R2QA 2EM0A 2EOMA 2EL5A 2YTPA 3EPLA 2JPAA 4GZNC 1X6HA 1WJPA 2EN2A 1MEYC 1RMDA 1X6EA 2EPXA 2EP3A 2YU5A 2LV2A 1LLMC 1BBOA 2J7JA 2YSOA 1A1FA 3EPJA 2YTOA 2EM3A 1JK2A 2EM9A 2EM2A 2DLQA 2YTNA 2EPPA 1G2FC 1YUIA 2EM8A 2DRPA 2CT1A 2EMHA 2WBTA 2YU8A 2ADRA 2EN3A 2LVHA 2EMYA 1UN6B 5KL5A 2EQ1A 5KL4A 1A1IA 1AAYA 4R2RA 2EN1A 1A1HA 2CSHA 4R2PA 2EM4A 2ELZA 1ZR9A 2EPAA 4R2CA 2EMIA 2YRHA 1TN9A 1X6FA 3EPKA 2EN8A 2ENAA 2GHFA 2EPUA 1YSAC 2DLKA 2RPCA 2EORA 2EOHA 1NCSA 1BB8A 2EQ0A 2ELYA 2EN4A 2YTQA 1A1KA 2EN7A 2EL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOZ A;  2EMF A;  1UBD C;  1P47 A;  2EN6 A;  2EOQ A;  2EJ4 A;  3UK3 C;  2EOO A;  1B69 A;  2HGH A;  2EML A;  2MDG A;  4IS1 C;  4F2J C;  1JK1 A;  2YTJ A;  2WBU A;  4R2D A;  2EMZ A;  2EOI A;  4F6N A;  2EMB A;  4M9V C;  1X5W A;  1X3C A;  2EM6 A;  2LT7 A;  4F6M A;  1KJK A;  2ENC A;  1Z1B A;  2I13 A;  2E72 A;  1DGC A;  2R1F A;  2YTI A;  1TF6 A;  3MHS C;  2EOS A;  2ENH A;  2EE8 A;  1TF3 A;  2LCE A;  2RSI A;  2GLI A;  2EOY A;  2A25 A;  2NAB A;  4R2S A;  4R2E A;  2YTF A;  2YTG A;  2WCC 3;  2LO3 A;  2YTD A;  2PRT A;  5KL7 A;  1ZAA C;  2YRK A;  2EMG A;  2EM5 A;  4IJD A;  2D9H A;  4FK5 C;  4R2A A;  3VHT B;  2EMW A;  2BB8 A;  2EMK A;  1A1G A;  2MKN A;  1A1J A;  2EOE A;  2EL4 A;  3EPH A;  2MKD A;  2EQ3 A;  5KL6 A;  2YRM A;  1G2D C;  2EOF A;  2EPC A;  3M99 B;  5KL2 A;  2EOX A;  4X9J A;  2WBS A;  2EMA A;  2EMC A;  2VRD A;  2M9A A;  2DGC A;  2EPZ A;  2EM7 A;  1ZU1 A;  1YUJ A;  1A1L A;  4WSG A;  2YSP A;  5KL3 A;  2CTD A;  1F2I G;  3MHH C;  2DMI A;  2EOJ A;  2YTE A;  2JP9 A;  2EMX A;  2EPR A;  4R2Q A;  2EM0 A;  2EOM A;  2EL5 A;  2YTP A;  3EPL A;  2JPA A;  4GZN C;  1X6H A;  1WJP A;  2EN2 A;  1MEY C;  1RMD A;  1X6E A;  2EPX A;  2EP3 A;  2YU5 A;  2LV2 A;  1LLM C;  1BBO A;  2J7J A;  2YSO A;  1A1F A;  3EPJ A;  2YTO A;  2EM3 A;  1JK2 A;  2EM9 A;  2EM2 A;  2DLQ A;  2YTN A;  2EPP A;  1G2F C;  1YUI A;  2EM8 A;  2DRP A;  2CT1 A;  2EMH A;  2WBT A;  2YU8 A;  2ADR A;  2EN3 A;  2LVH A;  2EMY A;  1UN6 B;  5KL5 A;  2EQ1 A;  5KL4 A;  1A1I A;  1AAY A;  4R2R A;  2EN1 A;  1A1H A;  2CSH A;  4R2P A;  2EM4 A;  2ELZ A;  1ZR9 A;  2EPA A;  4R2C A;  2EMI A;  2YRH A;  1TN9 A;  1X6F A;  3EPK A;  2EN8 A;  2ENA A;  2GHF A;  2EPU A;  1YSA C;  2DLK A;  2RPC A;  2EOR A;  2EOH A;  1NCS A;  1BB8 A;  2EQ0 A;  2ELY A;  2EN4 A;  2YTQ A;  1A1K A;  2EN7 A;  2EL6 A; 
#chains in the Genus database with same CATH topology
 4P7D A;  2EOZ A;  1P47 A;  4LF4 E;  2EJ4 A;  3F6H A;  2YTJ A;  4JI0 E;  2FV4 B;  1YZ9 A;  1PJT A;  2EMZ A;  4R2D A;  2L6M A;  2EMB A;  5LL6 R;  4MLV A;  4DUY E;  2ZM6 E;  3H09 A;  2R1F A;  1TF6 A;  1PKP A;  2L2N A;  4HTG A;  2EE8 A;  1WXR A;  2M4I A;  2B9D A;  2VE7 C;  2RSI A;  2GLI A;  2EPN A;  4M2Z A;  5LMU E;  1O0W A;  2NAB A;  4R2S A;  2JOX A;  2V87 A;  2DIX A;  4ZYH A;  2LO3 A;  1ZAA C;  1RC7 A;  4O43 A;  3AUZ A;  1EH7 A;  1T39 A;  2EMW A;  5AE3 A;  1QNT A;  1IBL E;  2EOE A;  2EL4 A;  2YT4 A;  3BID A;  4LF7 E;  1G2D C;  2YRM A;  2EOX A;  4WXC A;  3J7A G;  3KWR A;  4X9J A;  2LUQ A;  3IWB A;  1EH6 A;  2DGC A;  3OTO E;  4DV3 E;  2EM7 A;  1ZU1 A;  2K7I A;  2YSP A;  5KL3 A;  3EQ1 A;  2L3C A;  4LF5 E;  2EPK X;  2EOJ A;  2YTE A;  2E1M A;  2F8B A;  4BBY A;  2JPA A;  4GZN C;  1X6H A;  4JI4 E;  2EN2 A;  4GEQ B;  1MEY C;  4F9A B;  1RMD A;  4DUZ E;  3ECR A;  2G7H A;  2YSO A;  2YTO A;  1JK2 A;  1N34 E;  1HNZ E;  2EM9 A;  2MDR A;  2EM2 A;  2V85 A;  1IQS A;  3JU0 A;  2YTN A;  1YUI A;  2YWQ A;  2EM8 A;  4BHB A;  2ADR A;  2EN3 A;  1UN6 B;  2EQ1 A;  1A1I A;  3ADL A;  4R8O A;  3AV0 A;  4OOG C;  2EPA A;  2RTX A;  4DV4 E;  1X6F A;  3EPK A;  2GHF A;  2EPU A;  3T1H E;  2LTS A;  2UUC E;  2E5L E;  4DR1 E;  5IXM B;  4I8O A;  1MGT A;  1HR0 E;  2JYA A;  2EMF A;  3HQ1 A;  3KZZ A;  2IHR 1;  1PDA A;  2EN6 A;  3UK3 C;  3VYY A;  2EOO A;  2HGH A;  1N32 E;  4F2J C;  2KON A;  1N36 E;  3KZY A;  2EOI A;  4F6N A;  3JTZ A;  4M9V C;  1X3C A;  1X5W A;  5AAS A;  2JWO A;  1UHZ A;  1KJK A;  4F54 A;  1STU A;  1Z1B A;  3MHS C;  4JI7 E;  2EOS A;  4B3M E;  2LCE A;  4YHH E;  4DR6 E;  5FLX C;  1PJS A;  2A25 A;  2H36 X;  4WXD A;  4DV7 E;  4R2E A;  4DMI A;  2YTF A;  3THO B;  2JR1 A;  2YTG A;  2WCC 3;  4B3T E;  1FJG E;  2KOU A;  4BS9 A;  1GZ6 A;  2EM5 A;  4HEI A;  2MC6 A;  1BBG A;  3C4B A;  4KZS A;  2BB8 A;  1A1G A;  2MKN A;  2Q8U A;  2KHX A;  2MKD A;  5KL6 A;  2NUG A;  5T6J A;  2EPC A;  1EH8 A;  5KL2 A;  4X8W A;  1T38 A;  4NHR A;  2WBS A;  2VQE E;  5A6B A;  4F9B B;  4K0K E;  1YUJ A;  2V88 A;  1A1L A;  3DJW A;  2LBS B;  2RQL A;  4WSG A;  5A6B D;  5A6K A;  5A2Q C;  2VQF E;  1XNR E;  2LRS A;  3DF6 A;  1X49 A;  3OML A;  4DR4 E;  3HTX A;  2EMX A;  2EPR A;  4JI3 E;  1HNX E;  2EOM A;  2YPN A;  2EL5 A;  3EPL A;  4AQY E;  3L00 A;  2NA2 A;  1QU6 A;  2YU5 A;  2LV2 A;  2WZO A;  5AC4 A;  1N3G A;  5TSE A;  4NXN E;  4DV6 E;  1BBO A;  5ADZ A;  2B3T B;  2FTX B;  4BC9 A;  4GKJ E;  2HC5 A;  4P78 A;  2R76 A;  5LMN E;  1PJQ A;  2DLQ A;  2EPP A;  4F9C B;  2L3J A;  3C6K A;  4JV5 E;  4DV2 E;  3VK6 A;  2WBT A;  3BBG A;  2LVH A;  2EMY A;  3JAM C;  5KL5 A;  1AAY A;  1KYQ A;  3K6Q A;  2JY9 A;  1A1H A;  4LFB E;  2CSH A;  4R2P A;  2EM4 A;  1N33 E;  2V86 A;  2HHH E;  2DLK A;  2ELY A;  3LML A;  1XMQ E;  4LTY A;  2EN7 A;  2EL6 A;  4LFA E;  4DR2 E;  3HPZ A;  2EML A;  2MDG A;  4YY3 E;  4DV0 E;  1JK1 A;  1WHN A;  4MLQ A;  2UXB E;  2UXD E;  2EM6 A;  2LT7 A;  4LFC E;  1X48 A;  2F4V E;  1DGC A;  5LLQ A;  2DMY A;  2ENH A;  4BCA A;  4BMJ A;  1TF3 A;  3C6M A;  3VYX A;  2K4V A;  2EOY A;  2UU9 E;  4RHB B;  3LLH A;  1HNW E;  2JXP A;  4BC7 A;  2DB2 A;  1YYO A;  4M30 A;  4KHP E;  3ADG A;  2YTD A;  3T1Y E;  2EZ6 A;  2PRT A;  5KL7 A;  2YRK A;  2EMG A;  1ZBT A;  2B7V A;  4IJD A;  5A6J A;  4FK5 C;  2RS6 A;  4R2A A;  4GKK E;  4ZYE A;  3VHT B;  1X47 A;  3THN A;  1A1J A;  1SFE A;  2EQ3 A;  2L2K B;  3M99 B;  4NXM E;  1RQ0 A;  4DKK A;  1WRJ A;  1UIL A;  5BR8 E;  2VRD A;  2M9A A;  2RSM A;  2EPZ A;  5DNY A;  3RMP A;  2JOB A;  2LTR A;  5IT9 C;  4LF8 E;  4X65 E;  2YTP A;  3ADI A;  2N3G A;  1WJP A;  4O24 A;  1XMO E;  4B3R E;  1X6E A;  1IBM E;  2EPL X;  1LLM C;  4JYA E;  2J7J A;  4JI5 E;  4B3S E;  1A1F A;  1T4N A;  3EPJ A;  1T4L B;  5AE1 A;  2VF1 A;  3IWD A;  4JI8 E;  2EPM X;  3ADJ A;  1YPN A;  1XNQ E;  4TUG A;  1G2F C;  4X66 E;  2YU8 A;  2EMH A;  4JI6 E;  1IQO A;  2LMZ A;  1AH5 A;  5KL4 A;  2HJJ A;  4R2R A;  2EN1 A;  3J81 C;  2DSY A;  1ZR9 A;  2UUB E;  4OX9 E;  2EMI A;  2YRH A;  4JI1 E;  1YSA C;  2ENA A;  1L4S A;  2RPC A;  2EOR A;  1NCS A;  1BB8 A;  3HPS A;  4O5G A;  2MC5 A;  2JVA A;  1FKA E;  2BBG A;  2I9I A;  1UBD C;  2EOQ A;  2LUP B;  4DR7 E;  1I94 E;  1B69 A;  4DR5 E;  5AE2 A;  4IS1 C;  1ZBQ A;  4RH8 A;  3FIG A;  2WBU A;  4O4K A;  4N4R B;  4F6M A;  2N8X A;  2M7Q A;  1YFH A;  4LF6 E;  2YZT A;  2ENC A;  2I13 A;  2E72 A;  1YYW A;  2YTI A;  5A6A A;  2ODR C;  2LE2 A;  4BHC A;  4L5N C;  1IMU A;  1NEI A;  2UUA E;  3MSW A;  4DV1 E;  5F3W A;  1GQE A;  4DR3 E;  3P1X A;  4ZYD A;  4LU9 A;  3TQM A;  4WFT A;  1IBK E;  4X64 E;  2D9H A;  2CPN A;  2LJH A;  4WSP A;  2EMK A;  2N3H A;  3EPH A;  2FGG A;  4WX9 A;  5IV8 B;  4TUI A;  2EOF A;  2GPI A;  2L2M A;  2EMA A;  2EMC A;  2L33 A;  4LF9 E;  1YYK A;  1DQ3 A;  2EPO A;  1SR9 A;  2CTD A;  1F2I G;  3MHH C;  2LJU A;  2ODR D;  2V8Q B;  2DMI A;  3C4T A;  5CFF E;  4R03 A;  4DV5 E;  2JP9 A;  4R2Q A;  2EM0 A;  3BGH A;  4X62 E;  3QG5 C;  1T4O A;  1DI2 A;  2EPX A;  4KWY A;  2EP3 A;  1GTK A;  2V89 A;  3IWC A;  4JI2 E;  4Q28 A;  2NUE A;  4WYQ B;  2L92 A;  2EM3 A;  3F6G A;  2L8T A;  3J7Y p;  5AC5 A;  4L8N A;  4WPY A;  1EKZ A;  2UXC E;  2DRP A;  2CT1 A;  1J5E E;  4ZYG A;  4J8Z A;  3J80 C;  4M0V A;  4NZV A;  3HXL A;  4Q35 B;  2ELZ A;  2B7T A;  4R2C A;  2EWL A;  2V83 A;  3ZOQ B;  1TN9 A;  5IWA E;  3BF2 A;  2EN8 A;  1J26 A;  5A69 A;  2EOH A;  2RS7 A;  2NUF A;  2EQ0 A;  1WHQ A;  2M1S A;  2EN4 A;  2YTQ A;  1A1K A; 
#chains in the Genus database with same CATH homology
 2EOZ A;  2EMF A;  1UBD C;  1P47 A;  2EN6 A;  2EOQ A;  2EJ4 A;  3UK3 C;  2EOO A;  1B69 A;  2HGH A;  2EML A;  2MDG A;  4IS1 C;  4F2J C;  1JK1 A;  2YTJ A;  2WBU A;  4R2D A;  2EMZ A;  2EOI A;  4F6N A;  2EMB A;  4M9V C;  1X5W A;  1X3C A;  2EM6 A;  2LT7 A;  4F6M A;  1KJK A;  2ENC A;  1Z1B A;  2I13 A;  2E72 A;  1DGC A;  2R1F A;  2YTI A;  1TF6 A;  3MHS C;  2EOS A;  2ENH A;  2EE8 A;  1TF3 A;  2LCE A;  2RSI A;  2GLI A;  2EOY A;  2A25 A;  2NAB A;  4R2S A;  4R2E A;  2YTF A;  2YTG A;  2WCC 3;  2LO3 A;  2YTD A;  2PRT A;  5KL7 A;  1ZAA C;  2YRK A;  2EMG A;  2EM5 A;  4IJD A;  2D9H A;  4FK5 C;  4R2A A;  3VHT B;  2EMW A;  2BB8 A;  2EMK A;  1A1G A;  2MKN A;  1A1J A;  2EOE A;  2EL4 A;  3EPH A;  2MKD A;  2EQ3 A;  5KL6 A;  2YRM A;  1G2D C;  2EOF A;  2EPC A;  3M99 B;  5KL2 A;  2EOX A;  4X9J A;  2WBS A;  2EMA A;  2EMC A;  2VRD A;  2M9A A;  2DGC A;  2EPZ A;  2EM7 A;  1ZU1 A;  1YUJ A;  1A1L A;  4WSG A;  2YSP A;  5KL3 A;  2CTD A;  1F2I G;  3MHH C;  2DMI A;  2EOJ A;  2YTE A;  2JP9 A;  2EMX A;  2EPR A;  4R2Q A;  2EM0 A;  2EOM A;  2EL5 A;  2YTP A;  3EPL A;  2JPA A;  4GZN C;  1X6H A;  1WJP A;  2EN2 A;  1MEY C;  1RMD A;  1X6E A;  2EPX A;  2EP3 A;  2YU5 A;  2LV2 A;  1LLM C;  1BBO A;  2J7J A;  2YSO A;  1A1F A;  3EPJ A;  2YTO A;  2EM3 A;  1JK2 A;  2EM9 A;  2EM2 A;  2DLQ A;  2YTN A;  2EPP A;  1G2F C;  1YUI A;  2EM8 A;  2DRP A;  2CT1 A;  2EMH A;  2WBT A;  2YU8 A;  2ADR A;  2EN3 A;  2LVH A;  2EMY A;  1UN6 B;  5KL5 A;  2EQ1 A;  5KL4 A;  1A1I A;  1AAY A;  4R2R A;  2EN1 A;  1A1H A;  2CSH A;  4R2P A;  2EM4 A;  2ELZ A;  1ZR9 A;  2EPA A;  4R2C A;  2EMI A;  2YRH A;  1TN9 A;  1X6F A;  3EPK A;  2EN8 A;  2ENA A;  2GHF A;  2EPU A;  1YSA C;  2DLK A;  2RPC A;  2EOR A;  2EOH A;  1NCS A;  1BB8 A;  2EQ0 A;  2ELY A;  2EN4 A;  2YTQ A;  1A1K A;  2EN7 A;  2EL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...