1TN9A

The solution structure of tn916 integrase n-terminal domain/dna complex
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDAISLREKIAELQKDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*AP*GP*TP*AP*GP*TP*AP*AP*AP*TP*TP*C)-3')
publication title NMR structure of the Tn916 integrase-DNA complex.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Integrase/dna
total genus 7
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1999-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tn9A00
2YTQA 4WSGA 2YRMA 3EPLA 2GLIA 1X6HA 2YSOA 4R2SA 2LT7A 2ENCA 2LO3A 2NABA 2YTDA 1KJKA 5KL3A 2ELYA 2EPAA 3M99B 4IJDA 2WBUA 1X6FA 2ENAA 2YTOA 1YUJA 1A1IA 1AAYA 4M9VC 2EM5A 4IS1C 2HGHA 2EPXA 2JP9A 2LVHA 2CSHA 2EM4A 1RMDA 2E72A 2M9AA 2EOEA 2EQ0A 2ADRA 2DRPA 2EMYA 1A1LA 4R2PA 3UK3C 2EN8A 2PRTA 5KL6A 2YTNA 1YUIA 2YTEA 2EN2A 5KL2A 1B69A 1A1KA 4R2CA 1UBDC 2EOYA 2EL6A 4F2JC 2EMXA 2D9HA 2EMKA 2EM3A 2EPCA 2ENHA 3MHHC 2LV2A 2EM0A 1JK2A 2WBSA 5KL5A 1X6EA 2EOMA 2YSPA 2RSIA 2EMCA 2YU5A 2EM7A 2MKDA 3EPJA 4F6NA 2EN7A 2DGCA 2EL4A 2EMWA 2EQ3A 1BB8A 2YTFA 2BB8A 2EN6A 2I13A 2MDGA 2EM2A 2R1FA 2EPRA 1ZAAC 1NCSA 1MEYC 1G2FC 1TN9A 2YTGA 2EQ1A 2EL5A 1A1JA 1BBOA 1F2IG 1JK1A 2YRKA 2EMIA 2EM8A 2RPCA 2EOQA 3EPKA 1X5WA 2EOOA 2DLKA 1LLMC 2WBTA 4GZNC 2GHFA 2EM9A 2EE8A 1A1GA 4F6MA 2EOJA 1P47A 2EMZA 2EJ4A 1YSAC 4R2RA 2EMFA 2EOXA 5KL4A 2ELZA 4R2DA 2WCC3 2DMIA 2EOIA 2EMBA 2YRHA 2YTIA 1UN6B 2LCEA 5KL7A 3MHSC 2EP3A 1TF3A 2A25A 1ZR9A 2CTDA 1A1FA 4X9JA 2EM6A 2EOFA 2EMLA 2VRDA 2CT1A 2YTPA 4R2AA 2EMGA 1ZU1A 2YU8A 1WJPA 4R2QA 1G2DC 2EPZA 1X3CA 2EORA 2J7JA 2DLQA 2EN4A 3EPHA 2EMAA 2EOSA 4R2EA 2JPAA 3VHTB 1Z1BA 2YTJA 2EPUA 2EN1A 2EMHA 1DGCA 2EN3A 2MKNA 1A1HA 1TF6A 2EOZA 2EOHA 2EPPA 4FK5C
chains in the Genus database with same CATH superfamily
4WSGA 2EPOA 2V87A 2UUAE 3HQ1A 2B9DA 3EPLA 4DR6E 1X6HA 3KZYA 5AC5A 1PJTA 2LO3A 2NABA 2G7HA 5A2QC 4IJDA 2JOBA 1A1IA 1NEIA 4K0KE 2HGHA 3AUZA 2MC5A 2JP9A 2V85A 4BCAA 2CSHA 2M9AA 2LJUA 1RQ0A 2ADRA 2DRPA 1SFEA 2EMYA 4X65E 2PRTA 3IWBA 4LTYA 4TUIA 2F8BA 1YUIA 4N4RB 1PJQA 4R2CA 2B7TA 2RQLA 3FIGA 1UBDC 2EOYA 4Q35B 2EPCA 2L8TA 1XMQE 3MHHC 2RS7A 3BF2A 2LMZA 2EOMA 2VQFE 2EPLX 5A6AA 4LF4E 2EL4A 1WRJA 2MDRA 2YTFA 2EN6A 4DR1E 2EWLA 1PJSA 2JOXA 4Q28A 5AE2A 4BC9A 4KZSA 4B3SE 1MEYC 1J26A 2YTGA 2V86A 3OMLA 3EQ1A 1X47A 1A1JA 1IQSA 4LFBE 2JWOA 4WXDA 2EMIA 2L33A 2EOOA 2DLKA 3VK6A 4X66E 1X49A 3RMPA 5F3WA 2GHFA 2EM9A 4JV5E 2M7QA 1YPNA 4BBYA 1YFHA 2EOXA 4R2DA 2DMYA 2WCC3 2VE7C 4DUZE 2YRHA 1EH6A 1UN6B 3T1YE 3MHSC 4M30A 3KZZA 2CTDA 1A1FA 5A69A 4X9JA 4TUGA 2YTPA 4R2AA 2GPIA 2YU8A 4B3ME 1WJPA 4R2QA 1G2DC 3T1HE 1UILA 2L2NA 3J81C 1YYWA 2LE2A 2EORA 4GKJE 2DLQA 1XNRE 3C6MA 2EMAA 4JI5E 4R2EA 4LF8E 1Z1BA 2EPUA 3MSWA 1DGCA 2H36X 4KWYA 4FK5C 2RSMA 4DMIA 5A6BD 2YTQA 2EPMX 1FJGE 4JI4E 3LMLA 1IMUA 2VF1A 2ENCA 4DV0E 4L8NA 2ELYA 3M99B 1X6FA 1AH5A 2YTOA 1N32E 1AAYA 1YZ9A 2N3HA 2EM5A 1N34E 4LF9E 1SR9A 2F4VE 3JU0A 3IWCA 2E72A 3HPZA 3ADJA 5T6JA 4DV1E 4L5NC 4DR4E 2EQ0A 1HR0E 4R8OA 1A1LA 4R2PA 2V88A 2E5LE 2E1MA 5A6JA 2HHHE 2YTNA 1J5EE 1PDAA 4WSPA 3AV0A 3VYXA 4X62E 2NUGA 2EM3A 2ENHA 1JK2A 4ZYEA 1X6EA 4DV4E 5CFFE 2CPNA 1EH8A 1EKZA 2RSIA 2DSYA 2EMCA 4GEQB 5TSEA 1XMOE 3F6GA 2L2MA 2HJJA 3K6QA 2EMWA 3BGHA 3THNA 1QU6A 1BB8A 1T39A 4DKKA 2R1FA 1T4LB 1ZAAC 1G2FC 1TN9A 2NUFA 2EPKX 2EQ1A 2EM8A 2RPCA 1HNZE 2EOQA 1X5WA 1T4NA 4LU9A 4JI2E 2N8XA 2WBTA 2UUBE 2DB2A 4MLQA 3TQMA 2EE8A 1A1GA 4F6MA 2EOJA 2EMZA 1WXRA 2VQEE 2ELZA 2DMIA 4HTGA 2Q8UA 2YTIA 5LMUE 1DQ3A 1UHZA 1TF3A 2A25A 3JTZA 1EH7A 5IXMB 2EMGA 1ZU1A 4DV7E 2JY9A 3LLHA 4OX9E 1N33E 2NUEA 3BBGA 2J7JA 2EN4A 4JI6E 5DNYA 3EPHA 2EOSA 3F6HA 2UXCE 2LUQA 3J7Yp 2EMHA 3VYYA 2L3JA 2NA2A 2KOUA 1TF6A 1ZBQA 2K7IA 4JI8E 2GLIA 4R2SA 1GZ6A 2YTDA 4OOGC 5KL3A 2WBUA 4LFCE 2KONA 2LUPB 4O4KA 2FV4B 2JXPA 1O0WA 4IS1C 5A6KA 1ZBTA 3J80C 4X8WA 2N3GA 1PKPA 5IT9C 4X64E 2EOEA 4HEIA 4ZYHA 3UK3C 2EN8A 1IBLE 5KL6A 2YTEA 2EN2A 5KL2A 1B69A 4P78A 1BBGA 1GTKA 4LFAE 1QNTA 4BHBA 2L6MA 3L00A 2YT4A 2BBGA 1HNWE 2LV2A 3H09A 5KL5A 4JI1E 2YSPA 2L2KB 2UXBE 2EM7A 2MKDA 2DIXA 2M1SA 4AQYE 3ADGA 4DR5E 1DI2A 1YYOA 4ZYDA 5AE3A 1T38A 2V8QB 4M2ZA 2BB8A 1HNXE 1IBME 2YZTA 2MDGA 4RH8A 2EM2A 4O5GA 2EPRA 1NCSA 3IWDA 3KWRA 2EL5A 4B3RE 1BBOA 1F2IG 3HXLA 4F54A 2JVAA 1FKAE 4YY3E 4DV2E 1XNQE 1LLMC 2UUCE 2R76A 4DR7E 4GZNC 3C4BA 1YSAC 4BC7A 2B3TB 2EJ4A 4KHPE 5A6BA 3BIDA 4R2RA 4LF6E 4O43A 2EOIA 2EMBA 4B3TE 5LMNE 2ODRC 5KL7A 2EP3A 2JR1A 2EMLA 2VRDA 2CT1A 5LLQA 2EZ6A 5LL6R 4J8ZA 2EPZA 1X48A 2MC6A 1WHQA 4F9AB 1L4SA 2EPNA 4GKKE 2B7VA 4NXME 5AE1A 2RTXA 5IV8B 1IBKE 2EN1A 2MKNA 2UU9E 2EOHA 2EPPA 4DV5E 2YWQA 2LBSB 4P7DA 2YRMA 3THOB 2YSOA 2LT7A 2ODRD 2IHR1 4JYAE 2LTSA 1KJKA 2HC5A 1WHNA 2EPAA 4DV3E 4JI3E 2ENAA 4WYQB 4M0VA 1YUJA 4BMJA 4BS9A 4M9VC 5AASA 4JI7E 2FGGA 2FTXB 2EPXA 5FLXC 2LVHA 2EM4A 1RMDA 4JI0E 3ZOQB 2L3CA 4DR2E 3C4TA 1A1KA 1STUA 2EL6A 4F2JC 2EMXA 2D9HA 2LRSA 2EMKA 4DR3E 1GQEA 2RS6A 3DJWA 2EM0A 2WZOA 2WBSA 4WXCA 5ADZA 2YU5A 4RHBB 4R03A 3EPJA 4F6NA 2EN7A 2DGCA 4WFTA 4DV6E 4LF7E 1N36E 2M4IA 2EQ3A 4NHRA 4I8OA 4DUYE 2I13A 3ADLA 2JYAA 1I94E 2V83A 3P1XA 5IWAE 2L92A 2I9IA 1T4OA 2YRKA 1JK1A 2LJHA 2YPNA 3EPKA 2LTRA 3QG5C 4MLVA 1MGTA 5BR8E 4WX9A 1YYKA 1RC7A 1P47A 2EMFA 4O24A 5KL4A 4ZYGA 4F9CB 4NXNE 1N3GA 5AC4A 2K4VA 2LCEA 3C6KA 2ZM6E 3HTXA 1ZR9A 2EM6A 2EOFA 3DF6A 4F9BB 1KYQA 4YHHE 2V89A 3ADIA 4NZVA 1X3CA 2KHXA 3JAMC 2JPAA 3J7AG 3VHTB 4BHCA 2YTJA 3ECRA 3OTOE 4WPYA 2UXDE 2EN3A 4LF5E 1A1HA 2EOZA 1IQOA 3HPSA
chains in the Genus database with same CATH topology
2YTQA 4WSGA 2YRMA 3EPLA 2GLIA 1X6HA 2YSOA 4R2SA 2LT7A 2ENCA 2LO3A 2NABA 2YTDA 1KJKA 5KL3A 2ELYA 2EPAA 3M99B 4IJDA 2WBUA 1X6FA 2ENAA 2YTOA 1YUJA 1A1IA 1AAYA 4M9VC 2EM5A 4IS1C 2HGHA 2EPXA 2JP9A 2LVHA 2CSHA 2EM4A 1RMDA 2E72A 2M9AA 2EOEA 2EQ0A 2ADRA 2DRPA 2EMYA 1A1LA 4R2PA 3UK3C 2EN8A 2PRTA 5KL6A 2YTNA 1YUIA 2YTEA 2EN2A 5KL2A 1B69A 1A1KA 4R2CA 1UBDC 2EOYA 2EL6A 4F2JC 2EMXA 2D9HA 2EMKA 2EM3A 2EPCA 2ENHA 3MHHC 2LV2A 2EM0A 1JK2A 2WBSA 5KL5A 1X6EA 2EOMA 2YSPA 2RSIA 2EMCA 2YU5A 2EM7A 2MKDA 3EPJA 4F6NA 2EN7A 2DGCA 2EL4A 2EMWA 2EQ3A 1BB8A 2YTFA 2BB8A 2EN6A 2I13A 2MDGA 2EM2A 2R1FA 2EPRA 1ZAAC 1NCSA 1MEYC 1G2FC 1TN9A 2YTGA 2EQ1A 2EL5A 1A1JA 1BBOA 1F2IG 1JK1A 2YRKA 2EMIA 2EM8A 2RPCA 2EOQA 3EPKA 1X5WA 2EOOA 2DLKA 1LLMC 2WBTA 4GZNC 2GHFA 2EM9A 2EE8A 1A1GA 4F6MA 2EOJA 1P47A 2EMZA 2EJ4A 1YSAC 4R2RA 2EMFA 2EOXA 5KL4A 2ELZA 4R2DA 2WCC3 2DMIA 2EOIA 2EMBA 2YRHA 2YTIA 1UN6B 2LCEA 5KL7A 3MHSC 2EP3A 1TF3A 2A25A 1ZR9A 2CTDA 1A1FA 4X9JA 2EM6A 2EOFA 2EMLA 2VRDA 2CT1A 2YTPA 4R2AA 2EMGA 1ZU1A 2YU8A 1WJPA 4R2QA 1G2DC 2EPZA 1X3CA 2EORA 2J7JA 2DLQA 2EN4A 3EPHA 2EMAA 2EOSA 4R2EA 2JPAA 3VHTB 1Z1BA 2YTJA 2EPUA 2EN1A 2EMHA 1DGCA 2EN3A 2MKNA 1A1HA 1TF6A 2EOZA 2EOHA 2EPPA 4FK5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTQ A;  4WSG A;  2YRM A;  3EPL A;  2GLI A;  1X6H A;  2YSO A;  4R2S A;  2LT7 A;  2ENC A;  2LO3 A;  2NAB A;  2YTD A;  1KJK A;  5KL3 A;  2ELY A;  2EPA A;  3M99 B;  4IJD A;  2WBU A;  1X6F A;  2ENA A;  2YTO A;  1YUJ A;  1A1I A;  1AAY A;  4M9V C;  2EM5 A;  4IS1 C;  2HGH A;  2EPX A;  2JP9 A;  2LVH A;  2CSH A;  2EM4 A;  1RMD A;  2E72 A;  2M9A A;  2EOE A;  2EQ0 A;  2ADR A;  2DRP A;  2EMY A;  1A1L A;  4R2P A;  3UK3 C;  2EN8 A;  2PRT A;  5KL6 A;  2YTN A;  1YUI A;  2YTE A;  2EN2 A;  5KL2 A;  1B69 A;  1A1K A;  4R2C A;  1UBD C;  2EOY A;  2EL6 A;  4F2J C;  2EMX A;  2D9H A;  2EMK A;  2EM3 A;  2EPC A;  2ENH A;  3MHH C;  2LV2 A;  2EM0 A;  1JK2 A;  2WBS A;  5KL5 A;  1X6E A;  2EOM A;  2YSP A;  2RSI A;  2EMC A;  2YU5 A;  2EM7 A;  2MKD A;  3EPJ A;  4F6N A;  2EN7 A;  2DGC A;  2EL4 A;  2EMW A;  2EQ3 A;  1BB8 A;  2YTF A;  2BB8 A;  2EN6 A;  2I13 A;  2MDG A;  2EM2 A;  2R1F A;  2EPR A;  1ZAA C;  1NCS A;  1MEY C;  1G2F C;  1TN9 A;  2YTG A;  2EQ1 A;  2EL5 A;  1A1J A;  1BBO A;  1F2I G;  1JK1 A;  2YRK A;  2EMI A;  2EM8 A;  2RPC A;  2EOQ A;  3EPK A;  1X5W A;  2EOO A;  2DLK A;  1LLM C;  2WBT A;  4GZN C;  2GHF A;  2EM9 A;  2EE8 A;  1A1G A;  4F6M A;  2EOJ A;  1P47 A;  2EMZ A;  2EJ4 A;  1YSA C;  4R2R A;  2EMF A;  2EOX A;  5KL4 A;  2ELZ A;  4R2D A;  2WCC 3;  2DMI A;  2EOI A;  2EMB A;  2YRH A;  2YTI A;  1UN6 B;  2LCE A;  5KL7 A;  3MHS C;  2EP3 A;  1TF3 A;  2A25 A;  1ZR9 A;  2CTD A;  1A1F A;  4X9J A;  2EM6 A;  2EOF A;  2EML A;  2VRD A;  2CT1 A;  2YTP A;  4R2A A;  2EMG A;  1ZU1 A;  2YU8 A;  1WJP A;  4R2Q A;  1G2D C;  2EPZ A;  1X3C A;  2EOR A;  2J7J A;  2DLQ A;  2EN4 A;  3EPH A;  2EMA A;  2EOS A;  4R2E A;  2JPA A;  3VHT B;  1Z1B A;  2YTJ A;  2EPU A;  2EN1 A;  2EMH A;  1DGC A;  2EN3 A;  2MKN A;  1A1H A;  1TF6 A;  2EOZ A;  2EOH A;  2EPP A;  4FK5 C; 
#chains in the Genus database with same CATH topology
 4WSG A;  2EPO A;  2V87 A;  2UUA E;  3HQ1 A;  2B9D A;  3EPL A;  4DR6 E;  1X6H A;  3KZY A;  5AC5 A;  1PJT A;  2LO3 A;  2NAB A;  2G7H A;  5A2Q C;  4IJD A;  2JOB A;  1A1I A;  1NEI A;  4K0K E;  2HGH A;  3AUZ A;  2MC5 A;  2JP9 A;  2V85 A;  4BCA A;  2CSH A;  2M9A A;  2LJU A;  1RQ0 A;  2ADR A;  2DRP A;  1SFE A;  2EMY A;  4X65 E;  2PRT A;  3IWB A;  4LTY A;  4TUI A;  2F8B A;  1YUI A;  4N4R B;  1PJQ A;  4R2C A;  2B7T A;  2RQL A;  3FIG A;  1UBD C;  2EOY A;  4Q35 B;  2EPC A;  2L8T A;  1XMQ E;  3MHH C;  2RS7 A;  3BF2 A;  2LMZ A;  2EOM A;  2VQF E;  2EPL X;  5A6A A;  4LF4 E;  2EL4 A;  1WRJ A;  2MDR A;  2YTF A;  2EN6 A;  4DR1 E;  2EWL A;  1PJS A;  2JOX A;  4Q28 A;  5AE2 A;  4BC9 A;  4KZS A;  4B3S E;  1MEY C;  1J26 A;  2YTG A;  2V86 A;  3OML A;  3EQ1 A;  1X47 A;  1A1J A;  1IQS A;  4LFB E;  2JWO A;  4WXD A;  2EMI A;  2L33 A;  2EOO A;  2DLK A;  3VK6 A;  4X66 E;  1X49 A;  3RMP A;  5F3W A;  2GHF A;  2EM9 A;  4JV5 E;  2M7Q A;  1YPN A;  4BBY A;  1YFH A;  2EOX A;  4R2D A;  2DMY A;  2WCC 3;  2VE7 C;  4DUZ E;  2YRH A;  1EH6 A;  1UN6 B;  3T1Y E;  3MHS C;  4M30 A;  3KZZ A;  2CTD A;  1A1F A;  5A69 A;  4X9J A;  4TUG A;  2YTP A;  4R2A A;  2GPI A;  2YU8 A;  4B3M E;  1WJP A;  4R2Q A;  1G2D C;  3T1H E;  1UIL A;  2L2N A;  3J81 C;  1YYW A;  2LE2 A;  2EOR A;  4GKJ E;  2DLQ A;  1XNR E;  3C6M A;  2EMA A;  4JI5 E;  4R2E A;  4LF8 E;  1Z1B A;  2EPU A;  3MSW A;  1DGC A;  2H36 X;  4KWY A;  4FK5 C;  2RSM A;  4DMI A;  5A6B D;  2YTQ A;  2EPM X;  1FJG E;  4JI4 E;  3LML A;  1IMU A;  2VF1 A;  2ENC A;  4DV0 E;  4L8N A;  2ELY A;  3M99 B;  1X6F A;  1AH5 A;  2YTO A;  1N32 E;  1AAY A;  1YZ9 A;  2N3H A;  2EM5 A;  1N34 E;  4LF9 E;  1SR9 A;  2F4V E;  3JU0 A;  3IWC A;  2E72 A;  3HPZ A;  3ADJ A;  5T6J A;  4DV1 E;  4L5N C;  4DR4 E;  2EQ0 A;  1HR0 E;  4R8O A;  1A1L A;  4R2P A;  2V88 A;  2E5L E;  2E1M A;  5A6J A;  2HHH E;  2YTN A;  1J5E E;  1PDA A;  4WSP A;  3AV0 A;  3VYX A;  4X62 E;  2NUG A;  2EM3 A;  2ENH A;  1JK2 A;  4ZYE A;  1X6E A;  4DV4 E;  5CFF E;  2CPN A;  1EH8 A;  1EKZ A;  2RSI A;  2DSY A;  2EMC A;  4GEQ B;  5TSE A;  1XMO E;  3F6G A;  2L2M A;  2HJJ A;  3K6Q A;  2EMW A;  3BGH A;  3THN A;  1QU6 A;  1BB8 A;  1T39 A;  4DKK A;  2R1F A;  1T4L B;  1ZAA C;  1G2F C;  1TN9 A;  2NUF A;  2EPK X;  2EQ1 A;  2EM8 A;  2RPC A;  1HNZ E;  2EOQ A;  1X5W A;  1T4N A;  4LU9 A;  4JI2 E;  2N8X A;  2WBT A;  2UUB E;  2DB2 A;  4MLQ A;  3TQM A;  2EE8 A;  1A1G A;  4F6M A;  2EOJ A;  2EMZ A;  1WXR A;  2VQE E;  2ELZ A;  2DMI A;  4HTG A;  2Q8U A;  2YTI A;  5LMU E;  1DQ3 A;  1UHZ A;  1TF3 A;  2A25 A;  3JTZ A;  1EH7 A;  5IXM B;  2EMG A;  1ZU1 A;  4DV7 E;  2JY9 A;  3LLH A;  4OX9 E;  1N33 E;  2NUE A;  3BBG A;  2J7J A;  2EN4 A;  4JI6 E;  5DNY A;  3EPH A;  2EOS A;  3F6H A;  2UXC E;  2LUQ A;  3J7Y p;  2EMH A;  3VYY A;  2L3J A;  2NA2 A;  2KOU A;  1TF6 A;  1ZBQ A;  2K7I A;  4JI8 E;  2GLI A;  4R2S A;  1GZ6 A;  2YTD A;  4OOG C;  5KL3 A;  2WBU A;  4LFC E;  2KON A;  2LUP B;  4O4K A;  2FV4 B;  2JXP A;  1O0W A;  4IS1 C;  5A6K A;  1ZBT A;  3J80 C;  4X8W A;  2N3G A;  1PKP A;  5IT9 C;  4X64 E;  2EOE A;  4HEI A;  4ZYH A;  3UK3 C;  2EN8 A;  1IBL E;  5KL6 A;  2YTE A;  2EN2 A;  5KL2 A;  1B69 A;  4P78 A;  1BBG A;  1GTK A;  4LFA E;  1QNT A;  4BHB A;  2L6M A;  3L00 A;  2YT4 A;  2BBG A;  1HNW E;  2LV2 A;  3H09 A;  5KL5 A;  4JI1 E;  2YSP A;  2L2K B;  2UXB E;  2EM7 A;  2MKD A;  2DIX A;  2M1S A;  4AQY E;  3ADG A;  4DR5 E;  1DI2 A;  1YYO A;  4ZYD A;  5AE3 A;  1T38 A;  2V8Q B;  4M2Z A;  2BB8 A;  1HNX E;  1IBM E;  2YZT A;  2MDG A;  4RH8 A;  2EM2 A;  4O5G A;  2EPR A;  1NCS A;  3IWD A;  3KWR A;  2EL5 A;  4B3R E;  1BBO A;  1F2I G;  3HXL A;  4F54 A;  2JVA A;  1FKA E;  4YY3 E;  4DV2 E;  1XNQ E;  1LLM C;  2UUC E;  2R76 A;  4DR7 E;  4GZN C;  3C4B A;  1YSA C;  4BC7 A;  2B3T B;  2EJ4 A;  4KHP E;  5A6B A;  3BID A;  4R2R A;  4LF6 E;  4O43 A;  2EOI A;  2EMB A;  4B3T E;  5LMN E;  2ODR C;  5KL7 A;  2EP3 A;  2JR1 A;  2EML A;  2VRD A;  2CT1 A;  5LLQ A;  2EZ6 A;  5LL6 R;  4J8Z A;  2EPZ A;  1X48 A;  2MC6 A;  1WHQ A;  4F9A B;  1L4S A;  2EPN A;  4GKK E;  2B7V A;  4NXM E;  5AE1 A;  2RTX A;  5IV8 B;  1IBK E;  2EN1 A;  2MKN A;  2UU9 E;  2EOH A;  2EPP A;  4DV5 E;  2YWQ A;  2LBS B;  4P7D A;  2YRM A;  3THO B;  2YSO A;  2LT7 A;  2ODR D;  2IHR 1;  4JYA E;  2LTS A;  1KJK A;  2HC5 A;  1WHN A;  2EPA A;  4DV3 E;  4JI3 E;  2ENA A;  4WYQ B;  4M0V A;  1YUJ A;  4BMJ A;  4BS9 A;  4M9V C;  5AAS A;  4JI7 E;  2FGG A;  2FTX B;  2EPX A;  5FLX C;  2LVH A;  2EM4 A;  1RMD A;  4JI0 E;  3ZOQ B;  2L3C A;  4DR2 E;  3C4T A;  1A1K A;  1STU A;  2EL6 A;  4F2J C;  2EMX A;  2D9H A;  2LRS A;  2EMK A;  4DR3 E;  1GQE A;  2RS6 A;  3DJW A;  2EM0 A;  2WZO A;  2WBS A;  4WXC A;  5ADZ A;  2YU5 A;  4RHB B;  4R03 A;  3EPJ A;  4F6N A;  2EN7 A;  2DGC A;  4WFT A;  4DV6 E;  4LF7 E;  1N36 E;  2M4I A;  2EQ3 A;  4NHR A;  4I8O A;  4DUY E;  2I13 A;  3ADL A;  2JYA A;  1I94 E;  2V83 A;  3P1X A;  5IWA E;  2L92 A;  2I9I A;  1T4O A;  2YRK A;  1JK1 A;  2LJH A;  2YPN A;  3EPK A;  2LTR A;  3QG5 C;  4MLV A;  1MGT A;  5BR8 E;  4WX9 A;  1YYK A;  1RC7 A;  1P47 A;  2EMF A;  4O24 A;  5KL4 A;  4ZYG A;  4F9C B;  4NXN E;  1N3G A;  5AC4 A;  2K4V A;  2LCE A;  3C6K A;  2ZM6 E;  3HTX A;  1ZR9 A;  2EM6 A;  2EOF A;  3DF6 A;  4F9B B;  1KYQ A;  4YHH E;  2V89 A;  3ADI A;  4NZV A;  1X3C A;  2KHX A;  3JAM C;  2JPA A;  3J7A G;  3VHT B;  4BHC A;  2YTJ A;  3ECR A;  3OTO E;  4WPY A;  2UXD E;  2EN3 A;  4LF5 E;  1A1H A;  2EOZ A;  1IQO A;  3HPS A; 
#chains in the Genus database with same CATH homology
 2YTQ A;  4WSG A;  2YRM A;  3EPL A;  2GLI A;  1X6H A;  2YSO A;  4R2S A;  2LT7 A;  2ENC A;  2LO3 A;  2NAB A;  2YTD A;  1KJK A;  5KL3 A;  2ELY A;  2EPA A;  3M99 B;  4IJD A;  2WBU A;  1X6F A;  2ENA A;  2YTO A;  1YUJ A;  1A1I A;  1AAY A;  4M9V C;  2EM5 A;  4IS1 C;  2HGH A;  2EPX A;  2JP9 A;  2LVH A;  2CSH A;  2EM4 A;  1RMD A;  2E72 A;  2M9A A;  2EOE A;  2EQ0 A;  2ADR A;  2DRP A;  2EMY A;  1A1L A;  4R2P A;  3UK3 C;  2EN8 A;  2PRT A;  5KL6 A;  2YTN A;  1YUI A;  2YTE A;  2EN2 A;  5KL2 A;  1B69 A;  1A1K A;  4R2C A;  1UBD C;  2EOY A;  2EL6 A;  4F2J C;  2EMX A;  2D9H A;  2EMK A;  2EM3 A;  2EPC A;  2ENH A;  3MHH C;  2LV2 A;  2EM0 A;  1JK2 A;  2WBS A;  5KL5 A;  1X6E A;  2EOM A;  2YSP A;  2RSI A;  2EMC A;  2YU5 A;  2EM7 A;  2MKD A;  3EPJ A;  4F6N A;  2EN7 A;  2DGC A;  2EL4 A;  2EMW A;  2EQ3 A;  1BB8 A;  2YTF A;  2BB8 A;  2EN6 A;  2I13 A;  2MDG A;  2EM2 A;  2R1F A;  2EPR A;  1ZAA C;  1NCS A;  1MEY C;  1G2F C;  1TN9 A;  2YTG A;  2EQ1 A;  2EL5 A;  1A1J A;  1BBO A;  1F2I G;  1JK1 A;  2YRK A;  2EMI A;  2EM8 A;  2RPC A;  2EOQ A;  3EPK A;  1X5W A;  2EOO A;  2DLK A;  1LLM C;  2WBT A;  4GZN C;  2GHF A;  2EM9 A;  2EE8 A;  1A1G A;  4F6M A;  2EOJ A;  1P47 A;  2EMZ A;  2EJ4 A;  1YSA C;  4R2R A;  2EMF A;  2EOX A;  5KL4 A;  2ELZ A;  4R2D A;  2WCC 3;  2DMI A;  2EOI A;  2EMB A;  2YRH A;  2YTI A;  1UN6 B;  2LCE A;  5KL7 A;  3MHS C;  2EP3 A;  1TF3 A;  2A25 A;  1ZR9 A;  2CTD A;  1A1F A;  4X9J A;  2EM6 A;  2EOF A;  2EML A;  2VRD A;  2CT1 A;  2YTP A;  4R2A A;  2EMG A;  1ZU1 A;  2YU8 A;  1WJP A;  4R2Q A;  1G2D C;  2EPZ A;  1X3C A;  2EOR A;  2J7J A;  2DLQ A;  2EN4 A;  3EPH A;  2EMA A;  2EOS A;  4R2E A;  2JPA A;  3VHT B;  1Z1B A;  2YTJ A;  2EPU A;  2EN1 A;  2EMH A;  1DGC A;  2EN3 A;  2MKN A;  1A1H A;  1TF6 A;  2EOZ A;  2EOH A;  2EPP A;  4FK5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...