1TN9A

The solution structure of tn916 integrase n-terminal domain/dna complex
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDAISLREKIAELQKDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*AP*GP*TP*AP*GP*TP*AP*AP*AP*TP*TP*C)-3')
publication title NMR structure of the Tn916 integrase-DNA complex.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Integrase/dna
total genus 7
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1999-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tn9A00
2CTDA 2CSHA 2YTPA 1AAYA 2EOFA 1ZR9A 2EMAA 3M99B 1TF3A 1ZAAC 2EPXA 2EN1A 2WBTA 2EQ0A 2YU5A 2EOSA 4R2EA 1G2DC 2YTGA 2EN7A 1ZU1A 2EN4A 2EMIA 2ADRA 2EP3A 2YTOA 1F2IG 2A25A 2RSIA 1BB8A 2EN8A 2YRHA 2EMWA 2EQ1A 4WSGA 4FK5C 4R2RA 4GZNC 2EPZA 1X6FA 2EM0A 3UK3C 1X5WA 1MEYC 2DMIA 2EMYA 2EN2A 2GHFA 2EMBA 2ELYA 2DLQA 2PRTA 2EJ4A 4R2DA 2EMHA 5KL7A 2EORA 2EOQA 2YTDA 2EM9A 1X6EA 5KL2A 2HGHA 2EMGA 5KL6A 2YTQA 1P47A 4F2JC 4R2PA 2ENAA 2WBSA 1YSAC 1A1GA 3EPHA 3MHSC 1Z1BA 2EOEA 2JPAA 1RMDA 4X9JA 2EM3A 2EMFA 2LO3A 2ENCA 2YRKA 4R2CA 1A1HA 5KL3A 2YTFA 2EOIA 2DLKA 2EPUA 2LCEA 1DGCA 1A1KA 4R2AA 2MDGA 2EPRA 3VHTB 2EOYA 1BBOA 4F6MA 2EOZA 2EMKA 1JK2A 2EOMA 2D9HA 2LV2A 2VRDA 2WCC3 2EPPA 3EPKA 2EMCA 2ELZA 5KL5A 1B69A 3EPJA 2ENHA 4R2QA 1X6HA 2EPCA 3MHHC 1NCSA 2EM4A 2EM7A 2NABA 1YUIA 2M9AA 2EOHA 1UBDC 1KJKA 2EMLA 2WBUA 2EOXA 2YTJA 2J7JA 1TN9A 4IJDA 2MKNA 2EN6A 2R1FA 1YUJA 1WJPA 2EOJA 1TF6A 2EMZA 2BB8A 2YTIA 2DRPA 2I13A 2EL4A 2GLIA 1X3CA 4R2SA 1G2FC 2E72A 2EE8A 2EL5A 2EM6A 2MKDA 1UN6B 2YSOA 3EPLA 2EPAA 4F6NA 2JP9A 2YTEA 1A1FA 2LVHA 4M9VC 2EM2A 2YU8A 2YRMA 2EN3A 5KL4A 1LLMC 2EM8A 1A1JA 2RPCA 2EQ3A 2DGCA 2YSPA 4IS1C 1A1LA 2YTNA 1JK1A 2LT7A 2EL6A 2EMXA 2EM5A 2EOOA 1A1IA 2CT1A
chains in the Genus database with same CATH superfamily
4B3ME 1AAYA 2ODRC 2BBGA 4DV2E 3BIDA 4JI2E 4LU9A 2YU5A 1X47A 4R2EA 2V85A 3ADJA 2M7QA 2RQLA 2ADRA 4F9BB 2RSIA 3K6QA 4B3SE 4WSGA 5T6JA 1PJQA 1J26A 4DMIA 4R03A 4JI6E 4BHCA 4DR6E 2Q8UA 1WRJA 3T1YE 2EZ6A 2EMYA 2EN2A 2ELYA 2L3CA 2L6MA 2EJ4A 1DI2A 2VF1A 4JI3E 1X6EA 2HC5A 5DNYA 4JV5E 5KL6A 1P47A 2LRSA 3HXLA 4R2PA 3F6GA 3L00A 1A1GA 3TQMA 3EPHA 2EPKX 2EOEA 2JPAA 4KHPE 2YT4A 5LLQA 3BBGA 1A1HA 2EMFA 2V83A 2DLKA 4BHBA 2JR1A 1EH7A 4LTYA 1IQSA 3J80C 2EOYA 2B7TA 3DF6A 2EOZA 4DR5E 2UUBE 1FJGE 2V88A 2D9HA 2VRDA 3C6MA 3EPKA 2EMCA 3LLHA 2R76A 4LF5E 4BBYA 3EPJA 1PDAA 3MHHC 4WX9A 2EPLX 4JI5E 2EM4A 5BR8E 2M9AA 1IBLE 1NEIA 2EMLA 3AV0A 5A6AA 2YTJA 1EKZA 3AUZA 3MSWA 2NUEA 2I13A 4F6NA 1BBGA 4DV0E 1WHNA 2LUQA 3THOB 1A1FA 4K0KE 2YWQA 2EM2A 4BMJA 1HNWE 4WXCA 5KL4A 4LFCE 2RPCA 2WZOA 4M30A 2EQ3A 2RS6A 2YTNA 3IWDA 1A1IA 2CT1A 4HEIA 2B7VA 1X49A 2EN4A 2YTOA 1HNXE 2A25A 4L8NA 2EN8A 2YRHA 5F3WA 4DR4E 4FK5C 1EH6A 5AE3A 4GZNC 1L4SA 1X6FA 2EM0A 4Q28A 2GHFA 2IHR1 5TSEA 4KZSA 5AE1A 2EWLA 2EMHA 3BGHA 2EORA 4LF7E 2N3HA 2YTDA 4P78A 2K4VA 1N36E 2JOXA 2WBSA 3ADIA 2KHXA 4X66E 1N32E 4X9JA 2LO3A 2ENCA 2YRKA 2HHHE 5KL3A 2YPNA 3C4BA 2L2KB 4R8OA 4DR1E 4LF9E 1HR0E 3JAMC 2MDGA 1AH5A 3VHTB 2UXDE 2B3TB 1MGTA 1BBOA 2UXBE 4DUYE 1GZ6A 3ECRA 3C4TA 5ADZA 2EMKA 2EOMA 2WCC3 1KYQA 3HQ1A 4DUZE 1B69A 4N4RB 2L2MA 3EQ1A 4JI8E 3QG5C 4O24A 4BC7A 3ADLA 1PJTA 1NCSA 2JWOA 1YZ9A 2EM7A 4X8WA 2EOXA 1QU6A 2LBSB 4LF6E 2MKNA 4MLQA 4ZYDA 4TUIA 2YTIA 4F54A 4DV6E 1QNTA 2GLIA 4TUGA 1XNQE 3VYXA 2E72A 2MKDA 5AE2A 2B9DA 4P7DA 2JP9A 2N8XA 1X48A 4B3TE 4O4KA 3VK6A 2L33A 2KONA 1UILA 3P1XA 1N3GA 1YYKA 2YSPA 1A1LA 2LT7A 2EM5A 4JI7E 5A6BA 4X64E 2F4VE 2LJHA 3KZYA 2YTPA 4O5GA 2JVAA 4DR7E 2EMAA 3M99B 1ZAAC 1XNRE 2YZTA 4X62E 1T4OA 1T38A 2EPNA 2RS7A 2LJUA 3DJWA 1G2DC 2YTGA 2FGGA 4LFBE 1ZU1A 3IWBA 4DV7E 2EMIA 2EP3A 2FV4B 2JYAA 2MC5A 4DV3E 1F2IG 1BB8A 1SR9A 4BC9A 2EMWA 2EQ1A 5LMNE 4R2RA 3RMPA 2MDRA 4I8OA 3UK3C 2L2NA 4NXME 4NZVA 5LL6R 1MEYC 3LMLA 1WXRA 4R2DA 2UU9E 2L92A 2EM9A 2L3JA 2UXCE 4LF4E 1RQ0A 4M2ZA 1EH8A 2EMGA 2YTQA 4X65E 2ENAA 1YSAC 1DQ3A 3MHSC 4YHHE 5AC5A 1Z1BA 3J81C 3JTZA 4NHRA 2EM3A 2VQEE 4R2CA 4JI0E 3THNA 5AC4A 4OOGC 2EOIA 2EPUA 2JOBA 4R2AA 3FIGA 1T4NA 1SFEA 4F6MA 2ZM6E 2FTXB 1O0WA 2RTXA 2CPNA 4LFAE 3HPZA 2ELZA 1N33E 5A2QC 4GKJE 1X6HA 2GPIA 4WPYA 4BCAA 4RH8A 4RHBB 1I94E 2NUFA 2EOHA 2WBUA 2I9IA 2V89A 1TN9A 2G7HA 4IJDA 2EN6A 1GTKA 2R1FA 1YUJA 1WJPA 1STUA 2EOJA 5FLXC 1TF6A 2LTRA 2KOUA 2VE7C 2BB8A 2DRPA 2UUAE 4DV1E 1X3CA 4KWYA 1G2FC 4ZYGA 2EE8A 1XMOE 1IQOA 2EM6A 2V8QB 3T1HE 2YSOA 1UN6B 4JI1E 4WSPA 2DIXA 1WHQA 2LE2A 4OX9E 2YRMA 4DV4E 2LUPB 2EN3A 2E5LE 1LLMC 1A1JA 4WXDA 5A69A 3BF2A 4IS1C 5IT9C 2EPOA 2DGCA 1JK1A 2EL6A 2EMXA 1RMDA 1FKAE 1YYWA 2L8TA 2CTDA 2CSHA 2EOFA 4JI4E 2EPMX 1ZR9A 1TF3A 4LF8E 2EPXA 1ZBTA 2EN1A 4L5NC 4DR3E 3ZOQB 4YY3E 2WBTA 2EQ0A 2EOSA 4J8ZA 1YFHA 3KWRA 2V87A 2EN7A 2HJJA 2F8BA 1HNZE 1GQEA 5A6BD 5IXMB 3C6KA 2EPZA 4NXNE 4ZYEA 1X5WA 2V86A 2DMIA 5LMUE 2NUGA 2EMBA 2DLQA 2PRTA 4BS9A 4ZYHA 2JXPA 5KL7A 2DMYA 2ODRD 2EOQA 4GEQB 5KL2A 2HGHA 4AQYE 2N3GA 1RC7A 3KZZA 4WYQB 5CFFE 4F2JC 2K7IA 5A6JA 2DB2A 2E1MA 2M1SA 3OMLA 1PJSA 2YTFA 5AASA 1UHZA 2LCEA 1DGCA 1YYOA 1A1KA 1IBKE 4Q35B 1N34E 2EPRA 2M4IA 3VYYA 1JK2A 2LTSA 2LV2A 4M0VA 3H09A 2JY9A 2EPPA 5KL5A 2RSMA 2MC6A 2DSYA 2ENHA 4R2QA 4DV5E 3J7AG 2EPCA 4JYAE 3IWCA 5A6KA 2NABA 4HTGA 1YUIA 1UBDC 1KJKA 4F9CB 4DR2E 2J7JA 2VQFE 3HTXA 2UUCE 2EMZA 1T39A 2H36X 4MLVA 4F9AB 1PKPA 1J5EE 2EL4A 1YPNA 5IV8B 4WFTA 4R2SA 2EL5A 2NA2A 3OTOE 4GKKE 3ADGA 3HPSA 2EPAA 3F6HA 3EPLA 4B3RE 2LMZA 1IMUA 2YTEA 1XMQE 3J7Yp 4DKKA 4O43A 2LVHA 4M9VC 1ZBQA 2YU8A 2EM8A 5IWAE 1T4LB 3JU0A 1IBME 2EOOA
chains in the Genus database with same CATH topology
2CTDA 2CSHA 2YTPA 1AAYA 2EOFA 1ZR9A 2EMAA 3M99B 1TF3A 1ZAAC 2EPXA 2EN1A 2WBTA 2EQ0A 2YU5A 2EOSA 4R2EA 1G2DC 2YTGA 2EN7A 1ZU1A 2EN4A 2EMIA 2ADRA 2EP3A 2YTOA 1F2IG 2A25A 2RSIA 1BB8A 2EN8A 2YRHA 2EMWA 2EQ1A 4WSGA 4FK5C 4R2RA 4GZNC 2EPZA 1X6FA 2EM0A 3UK3C 1X5WA 1MEYC 2DMIA 2EMYA 2EN2A 2GHFA 2EMBA 2ELYA 2DLQA 2PRTA 2EJ4A 4R2DA 2EMHA 5KL7A 2EORA 2EOQA 2YTDA 2EM9A 1X6EA 5KL2A 2HGHA 2EMGA 5KL6A 2YTQA 1P47A 4F2JC 4R2PA 2ENAA 2WBSA 1YSAC 1A1GA 3EPHA 3MHSC 1Z1BA 2EOEA 2JPAA 1RMDA 4X9JA 2EM3A 2EMFA 2LO3A 2ENCA 2YRKA 4R2CA 1A1HA 5KL3A 2YTFA 2EOIA 2DLKA 2EPUA 2LCEA 1DGCA 1A1KA 4R2AA 2MDGA 2EPRA 3VHTB 2EOYA 1BBOA 4F6MA 2EOZA 2EMKA 1JK2A 2EOMA 2D9HA 2LV2A 2VRDA 2WCC3 2EPPA 3EPKA 2EMCA 2ELZA 5KL5A 1B69A 3EPJA 2ENHA 4R2QA 1X6HA 2EPCA 3MHHC 1NCSA 2EM4A 2EM7A 2NABA 1YUIA 2M9AA 2EOHA 1UBDC 1KJKA 2EMLA 2WBUA 2EOXA 2YTJA 2J7JA 1TN9A 4IJDA 2MKNA 2EN6A 2R1FA 1YUJA 1WJPA 2EOJA 1TF6A 2EMZA 2BB8A 2YTIA 2DRPA 2I13A 2EL4A 2GLIA 1X3CA 4R2SA 1G2FC 2E72A 2EE8A 2EL5A 2EM6A 2MKDA 1UN6B 2YSOA 3EPLA 2EPAA 4F6NA 2JP9A 2YTEA 1A1FA 2LVHA 4M9VC 2EM2A 2YU8A 2YRMA 2EN3A 5KL4A 1LLMC 2EM8A 1A1JA 2RPCA 2EQ3A 2DGCA 2YSPA 4IS1C 1A1LA 2YTNA 1JK1A 2LT7A 2EL6A 2EMXA 2EM5A 2EOOA 1A1IA 2CT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTD A;  2CSH A;  2YTP A;  1AAY A;  2EOF A;  1ZR9 A;  2EMA A;  3M99 B;  1TF3 A;  1ZAA C;  2EPX A;  2EN1 A;  2WBT A;  2EQ0 A;  2YU5 A;  2EOS A;  4R2E A;  1G2D C;  2YTG A;  2EN7 A;  1ZU1 A;  2EN4 A;  2EMI A;  2ADR A;  2EP3 A;  2YTO A;  1F2I G;  2A25 A;  2RSI A;  1BB8 A;  2EN8 A;  2YRH A;  2EMW A;  2EQ1 A;  4WSG A;  4FK5 C;  4R2R A;  4GZN C;  2EPZ A;  1X6F A;  2EM0 A;  3UK3 C;  1X5W A;  1MEY C;  2DMI A;  2EMY A;  2EN2 A;  2GHF A;  2EMB A;  2ELY A;  2DLQ A;  2PRT A;  2EJ4 A;  4R2D A;  2EMH A;  5KL7 A;  2EOR A;  2EOQ A;  2YTD A;  2EM9 A;  1X6E A;  5KL2 A;  2HGH A;  2EMG A;  5KL6 A;  2YTQ A;  1P47 A;  4F2J C;  4R2P A;  2ENA A;  2WBS A;  1YSA C;  1A1G A;  3EPH A;  3MHS C;  1Z1B A;  2EOE A;  2JPA A;  1RMD A;  4X9J A;  2EM3 A;  2EMF A;  2LO3 A;  2ENC A;  2YRK A;  4R2C A;  1A1H A;  5KL3 A;  2YTF A;  2EOI A;  2DLK A;  2EPU A;  2LCE A;  1DGC A;  1A1K A;  4R2A A;  2MDG A;  2EPR A;  3VHT B;  2EOY A;  1BBO A;  4F6M A;  2EOZ A;  2EMK A;  1JK2 A;  2EOM A;  2D9H A;  2LV2 A;  2VRD A;  2WCC 3;  2EPP A;  3EPK A;  2EMC A;  2ELZ A;  5KL5 A;  1B69 A;  3EPJ A;  2ENH A;  4R2Q A;  1X6H A;  2EPC A;  3MHH C;  1NCS A;  2EM4 A;  2EM7 A;  2NAB A;  1YUI A;  2M9A A;  2EOH A;  1UBD C;  1KJK A;  2EML A;  2WBU A;  2EOX A;  2YTJ A;  2J7J A;  1TN9 A;  4IJD A;  2MKN A;  2EN6 A;  2R1F A;  1YUJ A;  1WJP A;  2EOJ A;  1TF6 A;  2EMZ A;  2BB8 A;  2YTI A;  2DRP A;  2I13 A;  2EL4 A;  2GLI A;  1X3C A;  4R2S A;  1G2F C;  2E72 A;  2EE8 A;  2EL5 A;  2EM6 A;  2MKD A;  1UN6 B;  2YSO A;  3EPL A;  2EPA A;  4F6N A;  2JP9 A;  2YTE A;  1A1F A;  2LVH A;  4M9V C;  2EM2 A;  2YU8 A;  2YRM A;  2EN3 A;  5KL4 A;  1LLM C;  2EM8 A;  1A1J A;  2RPC A;  2EQ3 A;  2DGC A;  2YSP A;  4IS1 C;  1A1L A;  2YTN A;  1JK1 A;  2LT7 A;  2EL6 A;  2EMX A;  2EM5 A;  2EOO A;  1A1I A;  2CT1 A; 
#chains in the Genus database with same CATH topology
 4B3M E;  1AAY A;  2ODR C;  2BBG A;  4DV2 E;  3BID A;  4JI2 E;  4LU9 A;  2YU5 A;  1X47 A;  4R2E A;  2V85 A;  3ADJ A;  2M7Q A;  2RQL A;  2ADR A;  4F9B B;  2RSI A;  3K6Q A;  4B3S E;  4WSG A;  5T6J A;  1PJQ A;  1J26 A;  4DMI A;  4R03 A;  4JI6 E;  4BHC A;  4DR6 E;  2Q8U A;  1WRJ A;  3T1Y E;  2EZ6 A;  2EMY A;  2EN2 A;  2ELY A;  2L3C A;  2L6M A;  2EJ4 A;  1DI2 A;  2VF1 A;  4JI3 E;  1X6E A;  2HC5 A;  5DNY A;  4JV5 E;  5KL6 A;  1P47 A;  2LRS A;  3HXL A;  4R2P A;  3F6G A;  3L00 A;  1A1G A;  3TQM A;  3EPH A;  2EPK X;  2EOE A;  2JPA A;  4KHP E;  2YT4 A;  5LLQ A;  3BBG A;  1A1H A;  2EMF A;  2V83 A;  2DLK A;  4BHB A;  2JR1 A;  1EH7 A;  4LTY A;  1IQS A;  3J80 C;  2EOY A;  2B7T A;  3DF6 A;  2EOZ A;  4DR5 E;  2UUB E;  1FJG E;  2V88 A;  2D9H A;  2VRD A;  3C6M A;  3EPK A;  2EMC A;  3LLH A;  2R76 A;  4LF5 E;  4BBY A;  3EPJ A;  1PDA A;  3MHH C;  4WX9 A;  2EPL X;  4JI5 E;  2EM4 A;  5BR8 E;  2M9A A;  1IBL E;  1NEI A;  2EML A;  3AV0 A;  5A6A A;  2YTJ A;  1EKZ A;  3AUZ A;  3MSW A;  2NUE A;  2I13 A;  4F6N A;  1BBG A;  4DV0 E;  1WHN A;  2LUQ A;  3THO B;  1A1F A;  4K0K E;  2YWQ A;  2EM2 A;  4BMJ A;  1HNW E;  4WXC A;  5KL4 A;  4LFC E;  2RPC A;  2WZO A;  4M30 A;  2EQ3 A;  2RS6 A;  2YTN A;  3IWD A;  1A1I A;  2CT1 A;  4HEI A;  2B7V A;  1X49 A;  2EN4 A;  2YTO A;  1HNX E;  2A25 A;  4L8N A;  2EN8 A;  2YRH A;  5F3W A;  4DR4 E;  4FK5 C;  1EH6 A;  5AE3 A;  4GZN C;  1L4S A;  1X6F A;  2EM0 A;  4Q28 A;  2GHF A;  2IHR 1;  5TSE A;  4KZS A;  5AE1 A;  2EWL A;  2EMH A;  3BGH A;  2EOR A;  4LF7 E;  2N3H A;  2YTD A;  4P78 A;  2K4V A;  1N36 E;  2JOX A;  2WBS A;  3ADI A;  2KHX A;  4X66 E;  1N32 E;  4X9J A;  2LO3 A;  2ENC A;  2YRK A;  2HHH E;  5KL3 A;  2YPN A;  3C4B A;  2L2K B;  4R8O A;  4DR1 E;  4LF9 E;  1HR0 E;  3JAM C;  2MDG A;  1AH5 A;  3VHT B;  2UXD E;  2B3T B;  1MGT A;  1BBO A;  2UXB E;  4DUY E;  1GZ6 A;  3ECR A;  3C4T A;  5ADZ A;  2EMK A;  2EOM A;  2WCC 3;  1KYQ A;  3HQ1 A;  4DUZ E;  1B69 A;  4N4R B;  2L2M A;  3EQ1 A;  4JI8 E;  3QG5 C;  4O24 A;  4BC7 A;  3ADL A;  1PJT A;  1NCS A;  2JWO A;  1YZ9 A;  2EM7 A;  4X8W A;  2EOX A;  1QU6 A;  2LBS B;  4LF6 E;  2MKN A;  4MLQ A;  4ZYD A;  4TUI A;  2YTI A;  4F54 A;  4DV6 E;  1QNT A;  2GLI A;  4TUG A;  1XNQ E;  3VYX A;  2E72 A;  2MKD A;  5AE2 A;  2B9D A;  4P7D A;  2JP9 A;  2N8X A;  1X48 A;  4B3T E;  4O4K A;  3VK6 A;  2L33 A;  2KON A;  1UIL A;  3P1X A;  1N3G A;  1YYK A;  2YSP A;  1A1L A;  2LT7 A;  2EM5 A;  4JI7 E;  5A6B A;  4X64 E;  2F4V E;  2LJH A;  3KZY A;  2YTP A;  4O5G A;  2JVA A;  4DR7 E;  2EMA A;  3M99 B;  1ZAA C;  1XNR E;  2YZT A;  4X62 E;  1T4O A;  1T38 A;  2EPN A;  2RS7 A;  2LJU A;  3DJW A;  1G2D C;  2YTG A;  2FGG A;  4LFB E;  1ZU1 A;  3IWB A;  4DV7 E;  2EMI A;  2EP3 A;  2FV4 B;  2JYA A;  2MC5 A;  4DV3 E;  1F2I G;  1BB8 A;  1SR9 A;  4BC9 A;  2EMW A;  2EQ1 A;  5LMN E;  4R2R A;  3RMP A;  2MDR A;  4I8O A;  3UK3 C;  2L2N A;  4NXM E;  4NZV A;  5LL6 R;  1MEY C;  3LML A;  1WXR A;  4R2D A;  2UU9 E;  2L92 A;  2EM9 A;  2L3J A;  2UXC E;  4LF4 E;  1RQ0 A;  4M2Z A;  1EH8 A;  2EMG A;  2YTQ A;  4X65 E;  2ENA A;  1YSA C;  1DQ3 A;  3MHS C;  4YHH E;  5AC5 A;  1Z1B A;  3J81 C;  3JTZ A;  4NHR A;  2EM3 A;  2VQE E;  4R2C A;  4JI0 E;  3THN A;  5AC4 A;  4OOG C;  2EOI A;  2EPU A;  2JOB A;  4R2A A;  3FIG A;  1T4N A;  1SFE A;  4F6M A;  2ZM6 E;  2FTX B;  1O0W A;  2RTX A;  2CPN A;  4LFA E;  3HPZ A;  2ELZ A;  1N33 E;  5A2Q C;  4GKJ E;  1X6H A;  2GPI A;  4WPY A;  4BCA A;  4RH8 A;  4RHB B;  1I94 E;  2NUF A;  2EOH A;  2WBU A;  2I9I A;  2V89 A;  1TN9 A;  2G7H A;  4IJD A;  2EN6 A;  1GTK A;  2R1F A;  1YUJ A;  1WJP A;  1STU A;  2EOJ A;  5FLX C;  1TF6 A;  2LTR A;  2KOU A;  2VE7 C;  2BB8 A;  2DRP A;  2UUA E;  4DV1 E;  1X3C A;  4KWY A;  1G2F C;  4ZYG A;  2EE8 A;  1XMO E;  1IQO A;  2EM6 A;  2V8Q B;  3T1H E;  2YSO A;  1UN6 B;  4JI1 E;  4WSP A;  2DIX A;  1WHQ A;  2LE2 A;  4OX9 E;  2YRM A;  4DV4 E;  2LUP B;  2EN3 A;  2E5L E;  1LLM C;  1A1J A;  4WXD A;  5A69 A;  3BF2 A;  4IS1 C;  5IT9 C;  2EPO A;  2DGC A;  1JK1 A;  2EL6 A;  2EMX A;  1RMD A;  1FKA E;  1YYW A;  2L8T A;  2CTD A;  2CSH A;  2EOF A;  4JI4 E;  2EPM X;  1ZR9 A;  1TF3 A;  4LF8 E;  2EPX A;  1ZBT A;  2EN1 A;  4L5N C;  4DR3 E;  3ZOQ B;  4YY3 E;  2WBT A;  2EQ0 A;  2EOS A;  4J8Z A;  1YFH A;  3KWR A;  2V87 A;  2EN7 A;  2HJJ A;  2F8B A;  1HNZ E;  1GQE A;  5A6B D;  5IXM B;  3C6K A;  2EPZ A;  4NXN E;  4ZYE A;  1X5W A;  2V86 A;  2DMI A;  5LMU E;  2NUG A;  2EMB A;  2DLQ A;  2PRT A;  4BS9 A;  4ZYH A;  2JXP A;  5KL7 A;  2DMY A;  2ODR D;  2EOQ A;  4GEQ B;  5KL2 A;  2HGH A;  4AQY E;  2N3G A;  1RC7 A;  3KZZ A;  4WYQ B;  5CFF E;  4F2J C;  2K7I A;  5A6J A;  2DB2 A;  2E1M A;  2M1S A;  3OML A;  1PJS A;  2YTF A;  5AAS A;  1UHZ A;  2LCE A;  1DGC A;  1YYO A;  1A1K A;  1IBK E;  4Q35 B;  1N34 E;  2EPR A;  2M4I A;  3VYY A;  1JK2 A;  2LTS A;  2LV2 A;  4M0V A;  3H09 A;  2JY9 A;  2EPP A;  5KL5 A;  2RSM A;  2MC6 A;  2DSY A;  2ENH A;  4R2Q A;  4DV5 E;  3J7A G;  2EPC A;  4JYA E;  3IWC A;  5A6K A;  2NAB A;  4HTG A;  1YUI A;  1UBD C;  1KJK A;  4F9C B;  4DR2 E;  2J7J A;  2VQF E;  3HTX A;  2UUC E;  2EMZ A;  1T39 A;  2H36 X;  4MLV A;  4F9A B;  1PKP A;  1J5E E;  2EL4 A;  1YPN A;  5IV8 B;  4WFT A;  4R2S A;  2EL5 A;  2NA2 A;  3OTO E;  4GKK E;  3ADG A;  3HPS A;  2EPA A;  3F6H A;  3EPL A;  4B3R E;  2LMZ A;  1IMU A;  2YTE A;  1XMQ E;  3J7Y p;  4DKK A;  4O43 A;  2LVH A;  4M9V C;  1ZBQ A;  2YU8 A;  2EM8 A;  5IWA E;  1T4L B;  3JU0 A;  1IBM E;  2EOO A; 
#chains in the Genus database with same CATH homology
 2CTD A;  2CSH A;  2YTP A;  1AAY A;  2EOF A;  1ZR9 A;  2EMA A;  3M99 B;  1TF3 A;  1ZAA C;  2EPX A;  2EN1 A;  2WBT A;  2EQ0 A;  2YU5 A;  2EOS A;  4R2E A;  1G2D C;  2YTG A;  2EN7 A;  1ZU1 A;  2EN4 A;  2EMI A;  2ADR A;  2EP3 A;  2YTO A;  1F2I G;  2A25 A;  2RSI A;  1BB8 A;  2EN8 A;  2YRH A;  2EMW A;  2EQ1 A;  4WSG A;  4FK5 C;  4R2R A;  4GZN C;  2EPZ A;  1X6F A;  2EM0 A;  3UK3 C;  1X5W A;  1MEY C;  2DMI A;  2EMY A;  2EN2 A;  2GHF A;  2EMB A;  2ELY A;  2DLQ A;  2PRT A;  2EJ4 A;  4R2D A;  2EMH A;  5KL7 A;  2EOR A;  2EOQ A;  2YTD A;  2EM9 A;  1X6E A;  5KL2 A;  2HGH A;  2EMG A;  5KL6 A;  2YTQ A;  1P47 A;  4F2J C;  4R2P A;  2ENA A;  2WBS A;  1YSA C;  1A1G A;  3EPH A;  3MHS C;  1Z1B A;  2EOE A;  2JPA A;  1RMD A;  4X9J A;  2EM3 A;  2EMF A;  2LO3 A;  2ENC A;  2YRK A;  4R2C A;  1A1H A;  5KL3 A;  2YTF A;  2EOI A;  2DLK A;  2EPU A;  2LCE A;  1DGC A;  1A1K A;  4R2A A;  2MDG A;  2EPR A;  3VHT B;  2EOY A;  1BBO A;  4F6M A;  2EOZ A;  2EMK A;  1JK2 A;  2EOM A;  2D9H A;  2LV2 A;  2VRD A;  2WCC 3;  2EPP A;  3EPK A;  2EMC A;  2ELZ A;  5KL5 A;  1B69 A;  3EPJ A;  2ENH A;  4R2Q A;  1X6H A;  2EPC A;  3MHH C;  1NCS A;  2EM4 A;  2EM7 A;  2NAB A;  1YUI A;  2M9A A;  2EOH A;  1UBD C;  1KJK A;  2EML A;  2WBU A;  2EOX A;  2YTJ A;  2J7J A;  1TN9 A;  4IJD A;  2MKN A;  2EN6 A;  2R1F A;  1YUJ A;  1WJP A;  2EOJ A;  1TF6 A;  2EMZ A;  2BB8 A;  2YTI A;  2DRP A;  2I13 A;  2EL4 A;  2GLI A;  1X3C A;  4R2S A;  1G2F C;  2E72 A;  2EE8 A;  2EL5 A;  2EM6 A;  2MKD A;  1UN6 B;  2YSO A;  3EPL A;  2EPA A;  4F6N A;  2JP9 A;  2YTE A;  1A1F A;  2LVH A;  4M9V C;  2EM2 A;  2YU8 A;  2YRM A;  2EN3 A;  5KL4 A;  1LLM C;  2EM8 A;  1A1J A;  2RPC A;  2EQ3 A;  2DGC A;  2YSP A;  4IS1 C;  1A1L A;  2YTN A;  1JK1 A;  2LT7 A;  2EL6 A;  2EMX A;  2EM5 A;  2EOO A;  1A1I A;  2CT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...