1TN9A

The solution structure of tn916 integrase n-terminal domain/dna complex
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDAISLREKIAELQKDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Integrase/dna
molecule keywords DNA (5'-D(*GP*AP*GP*TP*AP*GP*TP*AP*AP*AP*TP*TP*C)-3')
publication title NMR structure of the Tn916 integrase-DNA complex.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 7
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1999-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tn9A00
2EN8A 2MKDA 2YTIA 2YTJA 1KJKA 1A1IA 4M9VC 1B69A 5KL7A 2WBUA 3EPJA 4F6NA 1DGCA 2EM0A 2ENHA 4R2CA 5KL4A 2YTFA 5KL3A 2RSIA 2CT1A 2E72A 2EMZA 1UBDC 2EMXA 2EOXA 2EMYA 4R2PA 2EN4A 2EPAA 2EN6A 2RPCA 2HGHA 2EN7A 1Z1BA 2JPAA 2EE8A 2DGCA 2ENCA 4IJDA 2EMBA 2EQ3A 2EM6A 1BBOA 2EMAA 1X6EA 2EMKA 1YUIA 2YRHA 2EMFA 3MHHC 2EP3A 3EPLA 2LT7A 2YTPA 2EORA 1LLMC 3M99B 4R2RA 2BB8A 2DMIA 2MKNA 1A1KA 1UN6B 1WJPA 2YTDA 2YTGA 4R2EA 4IS1C 1TF6A 2JP9A 2YU8A 1JK1A 2EPXA 1NCSA 1X6FA 2LCEA 1TN9A 4R2SA 2EMWA 2EPRA 2YSOA 2EM5A 1BB8A 2YTNA 2YTEA 2EN3A 2DRPA 2YRKA 1YUJA 2PRTA 1TF3A 2A25A 4FK5C 3EPHA 2CSHA 2EM8A 2I13A 2YSPA 1A1GA 2EMGA 5KL2A 4GZNC 1A1JA 2EOJA 4R2QA 1X5WA 2DLKA 2R1FA 1RMDA 1MEYC 2EOEA 2EOFA 2EM4A 2EL4A 1X6HA 2EM2A 2EOYA 1JK2A 1A1FA 2EPUA 2CTDA 5KL6A 3VHTB 2M9AA 2EOMA 1AAYA 2EM3A 4X9JA 1ZU1A 2EN1A 2YU5A 2D9HA 2EJ4A 2LO3A 2EOHA 2EQ1A 2ELZA 2LVHA 2GHFA 3EPKA 2MDGA 4R2AA 2EPPA 2DLQA 2EPZA 1ZR9A 2EMCA 2WBSA 4F2JC 2EOIA 1P47A 2EMHA 2GLIA 2ENAA 2YTOA 1G2DC 2VRDA 2EL6A 2EPCA 3UK3C 1YSAC 2YTQA 1A1HA 2EN2A 2WBTA 2EM7A 4R2DA 2LV2A 1G2FC 2NABA 4F6MA 1X3CA 2YRMA 2EOZA 4WSGA 2EMIA 2WCC3 2ADRA 1ZAAC 3MHSC 2EL5A 2EQ0A 2J7JA 1F2IG 2ELYA 2EM9A 5KL5A 2EOOA 2EOQA 1A1LA 2EMLA 2EOSA
chains in the Genus database with same CATH superfamily
2ODRC 2VQFE 2R76A 2NUGA 1DGCA 2EM0A 2ENHA 3H09A 2E5LE 1XMQE 1ZBQA 1L4SA 2RSIA 2CT1A 4F54A 2NUEA 3OTOE 1UBDC 1QNTA 2DIXA 2L6MA 4BHBA 3F6HA 2NA2A 3ADJA 4X62E 2EN4A 4WXCA 2RPCA 2EN7A 2MC5A 3EQ1A 2JPAA 2EE8A 1EH6A 2EQ3A 3THOB 2EM6A 1EH8A 2L3CA 2L92A 1BBOA 2EMAA 3KZZA 5T6JA 3F6GA 1N34E 1WHNA 2KHXA 3MHHC 4LFCE 3FIGA 4LF9E 3JAMC 4WXDA 2LBSB 1A1KA 4B3TE 1MGTA 2JOXA 4J8ZA 2VF1A 2UXDE 2EPXA 4WSPA 2B3TB 2LCEA 1TN9A 3IWBA 2M1SA 2L8TA 2YTNA 1GQEA 2YTEA 2DRPA 1XNQE 4BBYA 3HTXA 1X48A 2N8XA 2HJJA 4O43A 2YZTA 1DQ3A 1SFEA 2LTRA 4R2QA 3KZYA 1RMDA 2EOEA 5A6BD 3BBGA 3VHTB 2M9AA 2EOMA 4R03A 2EM3A 3ADIA 3KWRA 4X9JA 2B7TA 2LO3A 3RMPA 1X49A 2UUCE 5IXMB 3EPKA 1PJQA 4P7DA 3K6QA 2EPOA 1PDAA 2WBSA 2YTOA 1G2DC 1IQSA 2NUFA 2EPCA 2K7IA 4ZYGA 1A1HA 2EN2A 4DR1E 2EM7A 5AASA 2NABA 1FJGE 2ADRA 1IMUA 3MHSC 2L2MA 4Q35B 3T1YE 2EM9A 4M2ZA 5KL5A 2KONA 2EMLA 1IBKE 2HHHE 4WPYA 4R8OA 2DMYA 4DV6E 2YTJA 1KJKA 3ADLA 1B69A 1YYOA 5A2QC 5IT9C 1HNWE 4JI8E 2L2KB 3ZOQB 5KL4A 4M30A 5BR8E 2EWLA 1YYKA 4JI6E 1UILA 2EMXA 2EOXA 2EPAA 2HGHA 2MDRA 2FV4B 3QG5C 1Z1BA 1XMOE 4BMJA 3T1HE 4ZYEA 2EMBA 4JI1E 2IHR1 4DKKA 1N36E 4LFAE 5A6BA 4F9BB 2Q8UA 4AQYE 2BBGA 1LLMC 2MKNA 3BIDA 4R2RA 2DMIA 4LTYA 4B3ME 1WJPA 3J80C 2LJUA 2JVAA 1T4NA 4IS1C 4GKJE 3DJWA 3MSWA 4DV2E 2JP9A 4JV5E 1IBME 1X6FA 2FGGA 1IBLE 1UHZA 2HC5A 1TF3A 2A25A 2CSHA 2L33A 4X64E 2RQLA 2LRSA 1DI2A 4GKKE 1QU6A 2JR1A 1X5WA 4LF5E 1N32E 2YWQA 1GTKA 4DR4E 3OMLA 1RQ0A 2EOYA 1X6HA 3C6KA 1JK2A 4HTGA 1GZ6A 1AAYA 2YT4A 2EN1A 2RS7A 2E1MA 2D9HA 2ELZA 2GHFA 2MDGA 3BGHA 4R2AA 2DLQA 4F2JC 2EOIA 2EMHA 2GLIA 2L3JA 4BHCA 2JOBA 4JYAE 2VRDA 4KWYA 4X65E 4MLVA 4JI7E 2YTQA 2RSMA 2GPIA 1ZBTA 4GEQB 4DR2E 3AV0A 2LE2A 1N3GA 4F6MA 1T4LB 4TUIA 5LLQA 3L00A 2EL5A 2J7JA 1F2IG 4F9CB 4JI3E 1J5EE 1YPNA 2EN8A 2MKDA 4YHHE 2YTIA 4KHPE 4M9VC 4NHRA 5KL7A 3AUZA 5AE1A 1WRJA 4R2CA 4B3RE 4KZSA 2B7VA 5KL3A 2E72A 5AC4A 4WYQB 1IQOA 1I94E 4L5NC 1X47A 4F9AB 2EMYA 2G7HA 3J7AG 4R2PA 2DSYA 2VE7C 2UUBE 4DUZE 2VQEE 4LF7E 2EMKA 2H36X 1YUIA 2JWOA 3J81C 2L2NA 2EP3A 3EPLA 4OX9E 2LT7A 2YTPA 2EORA 2JYAA 2N3GA 3M99B 4M0VA 1XNRE 1UN6B 5LMNE 4NXME 2YTGA 4DV7E 3ECRA 4R2EA 1TF6A 4BS9A 3THNA 2JY9A 1JK1A 5TSEA 5IV8B 4LF4E 1YYWA 2EMWA 2EPRA 2YSOA 4ZYDA 4TUGA 3ADGA 5CFFE 3VYYA 2YRKA 3TQMA 3LMLA 5AE3A 1YUJA 1T38A 4B3SE 4DR6E 4O24A 4FK5C 3EPHA 2DB2A 2EPLX 1A1GA 4YY3E 3IWCA 5KL2A 5ADZA 5A6AA 3VK6A 5A6KA 1HNXE 2R1FA 3C6MA 2UXCE 3J7Yp 2EOFA 3P1XA 4NZVA 2EL4A 2V83A 1A1FA 2EPUA 2CTDA 2LMZA 4DV1E 2ODRD 4BC7A 2EJ4A 2EOHA 2EQ1A 4WX9A 2V8QB 2LVHA 3HPSA 4RH8A 4DV3E 1AH5A 2EPZA 1ZR9A 4JI5E 1WHQA 4X8WA 2EMCA 2UXBE 1J26A 1P47A 3JU0A 4BCAA 3HPZA 5A69A 2V85A 1YFHA 3VYXA 3HXLA 5AC5A 1STUA 2V88A 4R2DA 2LV2A 1NEIA 4LF6E 4LU9A 1X3CA 2YRMA 3BF2A 4WSGA 4JI0E 2WCC3 1BBGA 2ZM6E 1EH7A 2EQ0A 4HEIA 2ELYA 2KOUA 4WFTA 4NXNE 1A1LA 3HQ1A 1PJSA 1FKAE 4K0KE 1N33E 4DR3E 4ZYHA 1A1IA 4O4KA 1HNZE 1T39A 2WBUA 4Q28A 3EPJA 4F6NA 2CPNA 2I9IA 2EPNA 2YTFA 3C4TA 2LUPB 2EMZA 2UU9E 4O5GA 2EPMX 2WZOA 4OOGC 2EN6A 4DV0E 4DV5E 2DGCA 2ENCA 4IJDA 4RHBB 1PJTA 1X6EA 5IWAE 4DV4E 4JI4E 2YRHA 2EMFA 4DR7E 2LJHA 2BB8A 2YTDA 5LL6R 2M4IA 5LMUE 5FLXC 2YU8A 5AE2A 1NCSA 2EPKX 3LLHA 4R2SA 4I8OA 4N4RB 4L8NA 2EM5A 1BB8A 1YZ9A 2EN3A 2MC6A 2PRTA 2LUQA 2UUAE 2EM8A 2JXPA 2I13A 2YSPA 2FTXB 2B9DA 2EMGA 4GZNC 1A1JA 2EOJA 4JI2E 2DLKA 2EOSA 1MEYC 2EM4A 4LF8E 2RTXA 2EM2A 2YPNA 5KL6A 4X66E 3DF6A 4DUYE 5DNYA 1ZU1A 1EKZA 2N3HA 2YU5A 1KYQA 4MLQA 2EPPA 2F8BA 1O0WA 4P78A 2M7QA 2ENAA 2V86A 1T4OA 4DR5E 2EL6A 3UK3C 2F4VE 1RC7A 2RS6A 2V87A 2K4VA 1YSAC 5A6JA 2WBTA 1G2FC 2V89A 3IWDA 1PKPA 1SR9A 2EZ6A 2EOZA 4LFBE 5F3WA 2EMIA 3C4BA 1ZAAC 3JTZA 4BC9A 2EOOA 4DMIA 2EOQA 1WXRA 1HR0E 2LTSA
chains in the Genus database with same CATH topology
2EN8A 2MKDA 2YTIA 2YTJA 1KJKA 1A1IA 4M9VC 1B69A 5KL7A 2WBUA 3EPJA 4F6NA 1DGCA 2EM0A 2ENHA 4R2CA 5KL4A 2YTFA 5KL3A 2RSIA 2CT1A 2E72A 2EMZA 1UBDC 2EMXA 2EOXA 2EMYA 4R2PA 2EN4A 2EPAA 2EN6A 2RPCA 2HGHA 2EN7A 1Z1BA 2JPAA 2EE8A 2DGCA 2ENCA 4IJDA 2EMBA 2EQ3A 2EM6A 1BBOA 2EMAA 1X6EA 2EMKA 1YUIA 2YRHA 2EMFA 3MHHC 2EP3A 3EPLA 2LT7A 2YTPA 2EORA 1LLMC 3M99B 4R2RA 2BB8A 2DMIA 2MKNA 1A1KA 1UN6B 1WJPA 2YTDA 2YTGA 4R2EA 4IS1C 1TF6A 2JP9A 2YU8A 1JK1A 2EPXA 1NCSA 1X6FA 2LCEA 1TN9A 4R2SA 2EMWA 2EPRA 2YSOA 2EM5A 1BB8A 2YTNA 2YTEA 2EN3A 2DRPA 2YRKA 1YUJA 2PRTA 1TF3A 2A25A 4FK5C 3EPHA 2CSHA 2EM8A 2I13A 2YSPA 1A1GA 2EMGA 5KL2A 4GZNC 1A1JA 2EOJA 4R2QA 1X5WA 2DLKA 2R1FA 1RMDA 1MEYC 2EOEA 2EOFA 2EM4A 2EL4A 1X6HA 2EM2A 2EOYA 1JK2A 1A1FA 2EPUA 2CTDA 5KL6A 3VHTB 2M9AA 2EOMA 1AAYA 2EM3A 4X9JA 1ZU1A 2EN1A 2YU5A 2D9HA 2EJ4A 2LO3A 2EOHA 2EQ1A 2ELZA 2LVHA 2GHFA 3EPKA 2MDGA 4R2AA 2EPPA 2DLQA 2EPZA 1ZR9A 2EMCA 2WBSA 4F2JC 2EOIA 1P47A 2EMHA 2GLIA 2ENAA 2YTOA 1G2DC 2VRDA 2EL6A 2EPCA 3UK3C 1YSAC 2YTQA 1A1HA 2EN2A 2WBTA 2EM7A 4R2DA 2LV2A 1G2FC 2NABA 4F6MA 1X3CA 2YRMA 2EOZA 4WSGA 2EMIA 2WCC3 2ADRA 1ZAAC 3MHSC 2EL5A 2EQ0A 2J7JA 1F2IG 2ELYA 2EM9A 5KL5A 2EOOA 2EOQA 1A1LA 2EMLA 2EOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN8 A;  2MKD A;  2YTI A;  2YTJ A;  1KJK A;  1A1I A;  4M9V C;  1B69 A;  5KL7 A;  2WBU A;  3EPJ A;  4F6N A;  1DGC A;  2EM0 A;  2ENH A;  4R2C A;  5KL4 A;  2YTF A;  5KL3 A;  2RSI A;  2CT1 A;  2E72 A;  2EMZ A;  1UBD C;  2EMX A;  2EOX A;  2EMY A;  4R2P A;  2EN4 A;  2EPA A;  2EN6 A;  2RPC A;  2HGH A;  2EN7 A;  1Z1B A;  2JPA A;  2EE8 A;  2DGC A;  2ENC A;  4IJD A;  2EMB A;  2EQ3 A;  2EM6 A;  1BBO A;  2EMA A;  1X6E A;  2EMK A;  1YUI A;  2YRH A;  2EMF A;  3MHH C;  2EP3 A;  3EPL A;  2LT7 A;  2YTP A;  2EOR A;  1LLM C;  3M99 B;  4R2R A;  2BB8 A;  2DMI A;  2MKN A;  1A1K A;  1UN6 B;  1WJP A;  2YTD A;  2YTG A;  4R2E A;  4IS1 C;  1TF6 A;  2JP9 A;  2YU8 A;  1JK1 A;  2EPX A;  1NCS A;  1X6F A;  2LCE A;  1TN9 A;  4R2S A;  2EMW A;  2EPR A;  2YSO A;  2EM5 A;  1BB8 A;  2YTN A;  2YTE A;  2EN3 A;  2DRP A;  2YRK A;  1YUJ A;  2PRT A;  1TF3 A;  2A25 A;  4FK5 C;  3EPH A;  2CSH A;  2EM8 A;  2I13 A;  2YSP A;  1A1G A;  2EMG A;  5KL2 A;  4GZN C;  1A1J A;  2EOJ A;  4R2Q A;  1X5W A;  2DLK A;  2R1F A;  1RMD A;  1MEY C;  2EOE A;  2EOF A;  2EM4 A;  2EL4 A;  1X6H A;  2EM2 A;  2EOY A;  1JK2 A;  1A1F A;  2EPU A;  2CTD A;  5KL6 A;  3VHT B;  2M9A A;  2EOM A;  1AAY A;  2EM3 A;  4X9J A;  1ZU1 A;  2EN1 A;  2YU5 A;  2D9H A;  2EJ4 A;  2LO3 A;  2EOH A;  2EQ1 A;  2ELZ A;  2LVH A;  2GHF A;  3EPK A;  2MDG A;  4R2A A;  2EPP A;  2DLQ A;  2EPZ A;  1ZR9 A;  2EMC A;  2WBS A;  4F2J C;  2EOI A;  1P47 A;  2EMH A;  2GLI A;  2ENA A;  2YTO A;  1G2D C;  2VRD A;  2EL6 A;  2EPC A;  3UK3 C;  1YSA C;  2YTQ A;  1A1H A;  2EN2 A;  2WBT A;  2EM7 A;  4R2D A;  2LV2 A;  1G2F C;  2NAB A;  4F6M A;  1X3C A;  2YRM A;  2EOZ A;  4WSG A;  2EMI A;  2WCC 3;  2ADR A;  1ZAA C;  3MHS C;  2EL5 A;  2EQ0 A;  2J7J A;  1F2I G;  2ELY A;  2EM9 A;  5KL5 A;  2EOO A;  2EOQ A;  1A1L A;  2EML A;  2EOS A; 
#chains in the Genus database with same CATH topology
 2ODR C;  2VQF E;  2R76 A;  2NUG A;  1DGC A;  2EM0 A;  2ENH A;  3H09 A;  2E5L E;  1XMQ E;  1ZBQ A;  1L4S A;  2RSI A;  2CT1 A;  4F54 A;  2NUE A;  3OTO E;  1UBD C;  1QNT A;  2DIX A;  2L6M A;  4BHB A;  3F6H A;  2NA2 A;  3ADJ A;  4X62 E;  2EN4 A;  4WXC A;  2RPC A;  2EN7 A;  2MC5 A;  3EQ1 A;  2JPA A;  2EE8 A;  1EH6 A;  2EQ3 A;  3THO B;  2EM6 A;  1EH8 A;  2L3C A;  2L92 A;  1BBO A;  2EMA A;  3KZZ A;  5T6J A;  3F6G A;  1N34 E;  1WHN A;  2KHX A;  3MHH C;  4LFC E;  3FIG A;  4LF9 E;  3JAM C;  4WXD A;  2LBS B;  1A1K A;  4B3T E;  1MGT A;  2JOX A;  4J8Z A;  2VF1 A;  2UXD E;  2EPX A;  4WSP A;  2B3T B;  2LCE A;  1TN9 A;  3IWB A;  2M1S A;  2L8T A;  2YTN A;  1GQE A;  2YTE A;  2DRP A;  1XNQ E;  4BBY A;  3HTX A;  1X48 A;  2N8X A;  2HJJ A;  4O43 A;  2YZT A;  1DQ3 A;  1SFE A;  2LTR A;  4R2Q A;  3KZY A;  1RMD A;  2EOE A;  5A6B D;  3BBG A;  3VHT B;  2M9A A;  2EOM A;  4R03 A;  2EM3 A;  3ADI A;  3KWR A;  4X9J A;  2B7T A;  2LO3 A;  3RMP A;  1X49 A;  2UUC E;  5IXM B;  3EPK A;  1PJQ A;  4P7D A;  3K6Q A;  2EPO A;  1PDA A;  2WBS A;  2YTO A;  1G2D C;  1IQS A;  2NUF A;  2EPC A;  2K7I A;  4ZYG A;  1A1H A;  2EN2 A;  4DR1 E;  2EM7 A;  5AAS A;  2NAB A;  1FJG E;  2ADR A;  1IMU A;  3MHS C;  2L2M A;  4Q35 B;  3T1Y E;  2EM9 A;  4M2Z A;  5KL5 A;  2KON A;  2EML A;  1IBK E;  2HHH E;  4WPY A;  4R8O A;  2DMY A;  4DV6 E;  2YTJ A;  1KJK A;  3ADL A;  1B69 A;  1YYO A;  5A2Q C;  5IT9 C;  1HNW E;  4JI8 E;  2L2K B;  3ZOQ B;  5KL4 A;  4M30 A;  5BR8 E;  2EWL A;  1YYK A;  4JI6 E;  1UIL A;  2EMX A;  2EOX A;  2EPA A;  2HGH A;  2MDR A;  2FV4 B;  3QG5 C;  1Z1B A;  1XMO E;  4BMJ A;  3T1H E;  4ZYE A;  2EMB A;  4JI1 E;  2IHR 1;  4DKK A;  1N36 E;  4LFA E;  5A6B A;  4F9B B;  2Q8U A;  4AQY E;  2BBG A;  1LLM C;  2MKN A;  3BID A;  4R2R A;  2DMI A;  4LTY A;  4B3M E;  1WJP A;  3J80 C;  2LJU A;  2JVA A;  1T4N A;  4IS1 C;  4GKJ E;  3DJW A;  3MSW A;  4DV2 E;  2JP9 A;  4JV5 E;  1IBM E;  1X6F A;  2FGG A;  1IBL E;  1UHZ A;  2HC5 A;  1TF3 A;  2A25 A;  2CSH A;  2L33 A;  4X64 E;  2RQL A;  2LRS A;  1DI2 A;  4GKK E;  1QU6 A;  2JR1 A;  1X5W A;  4LF5 E;  1N32 E;  2YWQ A;  1GTK A;  4DR4 E;  3OML A;  1RQ0 A;  2EOY A;  1X6H A;  3C6K A;  1JK2 A;  4HTG A;  1GZ6 A;  1AAY A;  2YT4 A;  2EN1 A;  2RS7 A;  2E1M A;  2D9H A;  2ELZ A;  2GHF A;  2MDG A;  3BGH A;  4R2A A;  2DLQ A;  4F2J C;  2EOI A;  2EMH A;  2GLI A;  2L3J A;  4BHC A;  2JOB A;  4JYA E;  2VRD A;  4KWY A;  4X65 E;  4MLV A;  4JI7 E;  2YTQ A;  2RSM A;  2GPI A;  1ZBT A;  4GEQ B;  4DR2 E;  3AV0 A;  2LE2 A;  1N3G A;  4F6M A;  1T4L B;  4TUI A;  5LLQ A;  3L00 A;  2EL5 A;  2J7J A;  1F2I G;  4F9C B;  4JI3 E;  1J5E E;  1YPN A;  2EN8 A;  2MKD A;  4YHH E;  2YTI A;  4KHP E;  4M9V C;  4NHR A;  5KL7 A;  3AUZ A;  5AE1 A;  1WRJ A;  4R2C A;  4B3R E;  4KZS A;  2B7V A;  5KL3 A;  2E72 A;  5AC4 A;  4WYQ B;  1IQO A;  1I94 E;  4L5N C;  1X47 A;  4F9A B;  2EMY A;  2G7H A;  3J7A G;  4R2P A;  2DSY A;  2VE7 C;  2UUB E;  4DUZ E;  2VQE E;  4LF7 E;  2EMK A;  2H36 X;  1YUI A;  2JWO A;  3J81 C;  2L2N A;  2EP3 A;  3EPL A;  4OX9 E;  2LT7 A;  2YTP A;  2EOR A;  2JYA A;  2N3G A;  3M99 B;  4M0V A;  1XNR E;  1UN6 B;  5LMN E;  4NXM E;  2YTG A;  4DV7 E;  3ECR A;  4R2E A;  1TF6 A;  4BS9 A;  3THN A;  2JY9 A;  1JK1 A;  5TSE A;  5IV8 B;  4LF4 E;  1YYW A;  2EMW A;  2EPR A;  2YSO A;  4ZYD A;  4TUG A;  3ADG A;  5CFF E;  3VYY A;  2YRK A;  3TQM A;  3LML A;  5AE3 A;  1YUJ A;  1T38 A;  4B3S E;  4DR6 E;  4O24 A;  4FK5 C;  3EPH A;  2DB2 A;  2EPL X;  1A1G A;  4YY3 E;  3IWC A;  5KL2 A;  5ADZ A;  5A6A A;  3VK6 A;  5A6K A;  1HNX E;  2R1F A;  3C6M A;  2UXC E;  3J7Y p;  2EOF A;  3P1X A;  4NZV A;  2EL4 A;  2V83 A;  1A1F A;  2EPU A;  2CTD A;  2LMZ A;  4DV1 E;  2ODR D;  4BC7 A;  2EJ4 A;  2EOH A;  2EQ1 A;  4WX9 A;  2V8Q B;  2LVH A;  3HPS A;  4RH8 A;  4DV3 E;  1AH5 A;  2EPZ A;  1ZR9 A;  4JI5 E;  1WHQ A;  4X8W A;  2EMC A;  2UXB E;  1J26 A;  1P47 A;  3JU0 A;  4BCA A;  3HPZ A;  5A69 A;  2V85 A;  1YFH A;  3VYX A;  3HXL A;  5AC5 A;  1STU A;  2V88 A;  4R2D A;  2LV2 A;  1NEI A;  4LF6 E;  4LU9 A;  1X3C A;  2YRM A;  3BF2 A;  4WSG A;  4JI0 E;  2WCC 3;  1BBG A;  2ZM6 E;  1EH7 A;  2EQ0 A;  4HEI A;  2ELY A;  2KOU A;  4WFT A;  4NXN E;  1A1L A;  3HQ1 A;  1PJS A;  1FKA E;  4K0K E;  1N33 E;  4DR3 E;  4ZYH A;  1A1I A;  4O4K A;  1HNZ E;  1T39 A;  2WBU A;  4Q28 A;  3EPJ A;  4F6N A;  2CPN A;  2I9I A;  2EPN A;  2YTF A;  3C4T A;  2LUP B;  2EMZ A;  2UU9 E;  4O5G A;  2EPM X;  2WZO A;  4OOG C;  2EN6 A;  4DV0 E;  4DV5 E;  2DGC A;  2ENC A;  4IJD A;  4RHB B;  1PJT A;  1X6E A;  5IWA E;  4DV4 E;  4JI4 E;  2YRH A;  2EMF A;  4DR7 E;  2LJH A;  2BB8 A;  2YTD A;  5LL6 R;  2M4I A;  5LMU E;  5FLX C;  2YU8 A;  5AE2 A;  1NCS A;  2EPK X;  3LLH A;  4R2S A;  4I8O A;  4N4R B;  4L8N A;  2EM5 A;  1BB8 A;  1YZ9 A;  2EN3 A;  2MC6 A;  2PRT A;  2LUQ A;  2UUA E;  2EM8 A;  2JXP A;  2I13 A;  2YSP A;  2FTX B;  2B9D A;  2EMG A;  4GZN C;  1A1J A;  2EOJ A;  4JI2 E;  2DLK A;  2EOS A;  1MEY C;  2EM4 A;  4LF8 E;  2RTX A;  2EM2 A;  2YPN A;  5KL6 A;  4X66 E;  3DF6 A;  4DUY E;  5DNY A;  1ZU1 A;  1EKZ A;  2N3H A;  2YU5 A;  1KYQ A;  4MLQ A;  2EPP A;  2F8B A;  1O0W A;  4P78 A;  2M7Q A;  2ENA A;  2V86 A;  1T4O A;  4DR5 E;  2EL6 A;  3UK3 C;  2F4V E;  1RC7 A;  2RS6 A;  2V87 A;  2K4V A;  1YSA C;  5A6J A;  2WBT A;  1G2F C;  2V89 A;  3IWD A;  1PKP A;  1SR9 A;  2EZ6 A;  2EOZ A;  4LFB E;  5F3W A;  2EMI A;  3C4B A;  1ZAA C;  3JTZ A;  4BC9 A;  2EOO A;  4DMI A;  2EOQ A;  1WXR A;  1HR0 E;  2LTS A; 
#chains in the Genus database with same CATH homology
 2EN8 A;  2MKD A;  2YTI A;  2YTJ A;  1KJK A;  1A1I A;  4M9V C;  1B69 A;  5KL7 A;  2WBU A;  3EPJ A;  4F6N A;  1DGC A;  2EM0 A;  2ENH A;  4R2C A;  5KL4 A;  2YTF A;  5KL3 A;  2RSI A;  2CT1 A;  2E72 A;  2EMZ A;  1UBD C;  2EMX A;  2EOX A;  2EMY A;  4R2P A;  2EN4 A;  2EPA A;  2EN6 A;  2RPC A;  2HGH A;  2EN7 A;  1Z1B A;  2JPA A;  2EE8 A;  2DGC A;  2ENC A;  4IJD A;  2EMB A;  2EQ3 A;  2EM6 A;  1BBO A;  2EMA A;  1X6E A;  2EMK A;  1YUI A;  2YRH A;  2EMF A;  3MHH C;  2EP3 A;  3EPL A;  2LT7 A;  2YTP A;  2EOR A;  1LLM C;  3M99 B;  4R2R A;  2BB8 A;  2DMI A;  2MKN A;  1A1K A;  1UN6 B;  1WJP A;  2YTD A;  2YTG A;  4R2E A;  4IS1 C;  1TF6 A;  2JP9 A;  2YU8 A;  1JK1 A;  2EPX A;  1NCS A;  1X6F A;  2LCE A;  1TN9 A;  4R2S A;  2EMW A;  2EPR A;  2YSO A;  2EM5 A;  1BB8 A;  2YTN A;  2YTE A;  2EN3 A;  2DRP A;  2YRK A;  1YUJ A;  2PRT A;  1TF3 A;  2A25 A;  4FK5 C;  3EPH A;  2CSH A;  2EM8 A;  2I13 A;  2YSP A;  1A1G A;  2EMG A;  5KL2 A;  4GZN C;  1A1J A;  2EOJ A;  4R2Q A;  1X5W A;  2DLK A;  2R1F A;  1RMD A;  1MEY C;  2EOE A;  2EOF A;  2EM4 A;  2EL4 A;  1X6H A;  2EM2 A;  2EOY A;  1JK2 A;  1A1F A;  2EPU A;  2CTD A;  5KL6 A;  3VHT B;  2M9A A;  2EOM A;  1AAY A;  2EM3 A;  4X9J A;  1ZU1 A;  2EN1 A;  2YU5 A;  2D9H A;  2EJ4 A;  2LO3 A;  2EOH A;  2EQ1 A;  2ELZ A;  2LVH A;  2GHF A;  3EPK A;  2MDG A;  4R2A A;  2EPP A;  2DLQ A;  2EPZ A;  1ZR9 A;  2EMC A;  2WBS A;  4F2J C;  2EOI A;  1P47 A;  2EMH A;  2GLI A;  2ENA A;  2YTO A;  1G2D C;  2VRD A;  2EL6 A;  2EPC A;  3UK3 C;  1YSA C;  2YTQ A;  1A1H A;  2EN2 A;  2WBT A;  2EM7 A;  4R2D A;  2LV2 A;  1G2F C;  2NAB A;  4F6M A;  1X3C A;  2YRM A;  2EOZ A;  4WSG A;  2EMI A;  2WCC 3;  2ADR A;  1ZAA C;  3MHS C;  2EL5 A;  2EQ0 A;  2J7J A;  1F2I G;  2ELY A;  2EM9 A;  5KL5 A;  2EOO A;  2EOQ A;  1A1L A;  2EML A;  2EOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...