2CTDA

Solution structure of two zf-c2h2 domains from human zinc finger protein 512
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
96
structure length
96
Chain Sequence
GSSGSSGRIRKEPPVYAAGSLEEQWYLEIVDKGSVSCPTCQAVGRKTIEGLKKHMENCKQEMFTCHHCGKQLRSLAGMKYHVMANHNSLPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of two zf-C2H2 domains from human Zinc finger protein 512
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Zinc finger protein 512
total genus 13
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2005-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ctdA00
3M99B 1YUIA 2EORA 5KL5A 2EN6A 2EM5A 2EM3A 2EMYA 2EOJA 1P47A 2EPZA 2EOMA 2DMIA 2EOEA 1TF6A 1RMDA 2WCC3 2YTNA 2YTIA 2EPXA 1A1IA 2EOQA 2EOOA 1A1FA 4X9JA 2WBTA 2EN8A 2EOXA 1AAYA 2EPAA 3VHTB 1X6FA 5KL4A 2JP9A 4WSGA 2ENAA 2ELZA 2EOYA 4R2CA 2EE8A 1UBDC 2EMGA 2R1FA 2DLKA 2YRMA 2EMKA 2LT7A 1A1GA 2EPCA 2ADRA 2EOHA 2YU5A 1X6EA 5KL6A 1A1KA 2NABA 2YRKA 2EMCA 2EN7A 4R2SA 3UK3C 2MDGA 3MHHC 2EM4A 2EPPA 2YSOA 2CTDA 2GLIA 2ELYA 4F6NA 2EN1A 2WBSA 1X5WA 2EN4A 2ENHA 2EN3A 2EP3A 2EMBA 2CSHA 3EPLA 2HGHA 1TF3A 4R2EA 2EMXA 1LLMC 2EJ4A 2EMHA 5KL7A 2CT1A 2YTDA 4GZNC 1DGCA 2J7JA 1YSAC 2LO3A 1ZR9A 1A1HA 4R2AA 2E72A 2PRTA 2EL6A 2EPRA 2EM9A 4F6MA 2YTFA 2A25A 2YTGA 2YTQA 4R2PA 1G2FC 2EMFA 1YUJA 2DRPA 4IJDA 1BB8A 2YSPA 2EOSA 2EQ1A 2VRDA 2EM0A 2RPCA 3EPJA 2EM2A 2EQ0A 2EPUA 4F2JC 1TN9A 2LCEA 2EOIA 2ENCA 1JK2A 2I13A 2EMLA 1MEYC 1F2IG 1ZU1A 2YTJA 2EL5A 4R2QA 2BB8A 2DGCA 1A1JA 1JK1A 1X3CA 2EOZA 1X6HA 2EM7A 2EMAA 2YTPA 3EPKA 2EMZA 2WBUA 2EQ3A 3MHSC 2YTOA 2MKDA 2MKNA 2D9HA 2EL4A 2M9AA 2EM6A 5KL3A 1WJPA 1G2DC 4R2RA 1UN6B 2EOFA 2EM8A 2LV2A 4FK5C 2EMIA 1BBOA 5KL2A 2YTEA 2RSIA 2YU8A 1B69A 2LVHA 1NCSA 2EN2A 1KJKA 2EMWA 1A1LA 4R2DA 2DLQA 3EPHA 2JPAA 4IS1C 4M9VC 2YRHA 2GHFA 1ZAAC 1Z1BA
chains in the Genus database with same CATH superfamily
3AUZA 4I8OA 2EN6A 2V85A 2ZM6E 2EMYA 1P47A 2FV4B 5A6BA 1GZ6A 2EOMA 4DMIA 4DV0E 3THOB 1TF6A 2WZOA 1J26A 4F9BB 2LJUA 1GTKA 2EPLX 3HPSA 2UUBE 2EPAA 4N4RB 1X6FA 2L3JA 4R2CA 5LL6R 2V88A 4B3SE 2EMGA 2R1FA 2YRMA 2EMKA 3IWDA 2EOHA 2YU5A 1X6EA 1XNQE 2NABA 2YRKA 2EN7A 1IBKE 3MHHC 2E1MA 1EKZA 3TQMA 4F6NA 1SFEA 1X5WA 2EN4A 2N3GA 2ENHA 4KZSA 3EPLA 3AV0A 4BBYA 1LLMC 2EJ4A 4JV5E 2CT1A 4WXDA 4BC7A 4JI7E 1HNZE 1YSAC 1A1HA 4R2AA 2EPKX 3KZZA 2EL6A 2F4VE 2EM9A 1N3GA 2VQEE 2G7HA 2H36X 2YTGA 2YTQA 1GQEA 4B3RE 1BB8A 2YSPA 2VQFE 3HQ1A 4GEQB 2EM2A 4JI4E 5AE3A 4F2JC 1TN9A 4LF7E 4DR7E 2LCEA 1JK2A 4NXNE 2HC5A 2L33A 3ZOQB 4BCAA 1F2IG 3VK6A 4JI3E 2EL5A 3JU0A 1A1JA 1JK1A 2FGGA 1IBLE 2EMZA 2WBUA 3MHSC 2YTOA 4M2ZA 4DR4E 3ADJA 2JYAA 1X49A 2YT4A 1UN6B 1G2DC 5DNYA 4YY3E 1N36E 4NZVA 2ODRC 5A2QC 2LVHA 2UUCE 5AC5A 2N3HA 4DUZE 2VE7C 5IXMB 4DV6E 2EZ6A 4IS1C 2M4IA 2MDRA 2EORA 3RMPA 1RC7A 2EPOA 4GKJE 4P7DA 4WFTA 2EPZA 2DMIA 4DV5E 4X64E 2NUEA 2JWOA 3OMLA 3IWCA 4LFCE 2YTNA 1A1IA 2JOXA 2DB2A 4BC9A 1XNRE 2BBGA 4X9JA 1YZ9A 4NXME 4RHBB 2ENAA 2V8QB 4B3ME 4Q35B 1N32E 2HHHE 4BMJA 2ADRA 5KL6A 1A1KA 3T1HE 1IQOA 3K6QA 5A6AA 1ZBQA 4JI5E 1YFHA 3BGHA 4R2SA 2L3CA 4BHBA 5CFFE 2EN3A 3ADIA 1WXRA 2EMXA 1T39A 4DR6E 3C6MA 5KL7A 3J80C 2FTXB 1DGCA 4NHRA 2J7JA 1ZR9A 4TUGA 1PJTA 5AE2A 4LF5E 2EPRA 4ZYDA 2A25A 2L92A 4X65E 1G2FC 2JVAA 3F6HA 4IJDA 1FJGE 5ADZA 4ZYEA 2VRDA 4DKKA 2EQ0A 2EPUA 2N8XA 3MSWA 1QNTA 2LUQA 3QG5C 4BS9A 2UUAE 2UXBE 3J81C 3H09A 1T4LB 4R8OA 5AE1A 4DV3E 1T4NA 2DGCA 1RQ0A 3THNA 2RTXA 2EQ3A 2MKNA 4LF8E 4JYAE 2M9AA 4WX9A 2M1SA 1YYKA 5AC4A 2EOFA 1UILA 2LV2A 2EMIA 2YWQA 3HTXA 1EH8A 3J7AG 2YTEA 2EN2A 2KONA 1HR0E 1KJKA 4P78A 2DLQA 3EPHA 3ADLA 2YRHA 1X48A 1QU6A 1XMOE 2B7TA 5A69A 4DR2E 3IWBA 1Z1BA 3ADGA 3M99B 1T4OA 5A6BD 1WHNA 3BBGA 2EM3A 2EOJA 3JTZA 1J5EE 4LF9E 2RS6A 2B3TB 1T38A 2V86A 1IMUA 1RMDA 5IT9C 1I94E 2WCC3 5TSEA 5A6JA 4WYQB 2EPXA 2EOQA 1A1FA 4X62E 4O5GA 1YPNA 4X8WA 3J7Yp 2EN8A 4WXCA 4DV7E 1AAYA 2EWLA 5KL4A 1N34E 4J8ZA 4WSGA 1UHZA 1YYWA 4OOGC 2EOYA 3HPZA 2EE8A 4ZYHA 1UBDC 2JOBA 2RS7A 1PKPA 1AH5A 2EPCA 4BHCA 1IQSA 3VYYA 1A1GA 4JI2E 4Q28A 2M7QA 2MDGA 2NUFA 2Q8UA 2YSOA 3KWRA 2GLIA 4F9AB 4KWYA 2I9IA 2EN1A 4DR1E 4HEIA 2RQLA 2EP3A 2YPNA 1KYQA 2HGHA 1TF3A 3F6GA 2YTDA 2K7IA 2E72A 2PRTA 2HJJA 1FKAE 1DI2A 4LF6E 4F6MA 4L5NC 4O43A 1BBGA 2L8TA 2EPNA 4R2PA 4K0KE 3P1XA 5AASA 1PJQA 1EH7A 3T1YE 3BF2A 2EQ1A 2RPCA 3EPJA 2V89A 4ZYGA 2EOIA 2ENCA 4LU9A 2I13A 1WHQA 3C4TA 5FLXC 1MEYC 4F54A 1NEIA 2MC6A 2BB8A 2E5LE 2B7VA 3JAMC 4LTYA 1X3CA 1X6HA 2EM7A 2LTSA 5A6KA 2B9DA 2UU9E 2L6MA 2EL4A 2V83A 2EM6A 4X66E 5KL3A 2LMZA 4FK5C 4O4KA 1HNXE 2DIXA 5KL2A 1B69A 2RSIA 2KOUA 2YU8A 1X47A 4L8NA 5IV8B 2L2NA 1N33E 4TUIA 1A1LA 3EQ1A 2JPAA 4M9VC 1PDAA 2GHFA 1ZAAC 5IWAE 2LTRA 1YUIA 5KL5A 3OTOE 2EM5A 1DQ3A 4DR5E 2EOEA 2L2KB 2YTIA 1IBME 4OX9E 2EOOA 5F3WA 4MLVA 4JI1E 1STUA 4M0VA 2WBTA 2EOXA 2UXCE 2NA2A 3VHTB 4LFBE 3BIDA 5BR8E 2JP9A 3KZYA 2V87A 2ELZA 2JR1A 1XMQE 4JI6E 4R03A 2DLKA 3HXLA 3DJWA 4WSPA 2LT7A 3VYXA 4GKKE 1PJSA 2EMCA 2R76A 3UK3C 4JI0E 2VF1A 2EM4A 2LUPB 2EPPA 2CTDA 4JI8E 4DV4E 2ELYA 2WBSA 2LRSA 4O24A 1HNWE 2CPNA 2EMBA 2CSHA 4F9CB 2JY9A 4R2EA 2EMHA 1EH6A 2ODRD 4GZNC 2RSMA 5T6JA 2LO3A 1YYOA 2DMYA 3LMLA 2LE2A 4KHPE 1O0WA 3ECRA 2YTFA 1MGTA 2IHR1 2EMFA 1YUJA 2DRPA 2DSYA 2EOSA 4WPYA 2EM0A 2GPIA 4YHHE 2EMLA 2LJHA 5LMUE 4DR3E 1ZBTA 2LBSB 1ZU1A 2YTJA 4B3TE 3DF6A 3FIGA 4R2QA 2MC5A 2EOZA 1L4SA 2JXPA 3L00A 4M30A 2EMAA 2YTPA 3EPKA 4DV2E 2F8BA 3LLHA 3C6KA 2L2MA 2MKDA 4HTGA 2D9HA 2NUGA 4RH8A 4LF4E 1WJPA 5LMNE 4R2RA 2KHXA 2EM8A 4LFAE 1BBOA 2K4VA 4AQYE 1NCSA 3C4BA 4MLQA 4DUYE 2UXDE 2EMWA 2YZTA 5LLQA 2EPMX 4R2DA 4DV1E 1WRJA 1SR9A
chains in the Genus database with same CATH topology
3M99B 1YUIA 2EORA 5KL5A 2EN6A 2EM5A 2EM3A 2EMYA 2EOJA 1P47A 2EPZA 2EOMA 2DMIA 2EOEA 1TF6A 1RMDA 2WCC3 2YTNA 2YTIA 2EPXA 1A1IA 2EOQA 2EOOA 1A1FA 4X9JA 2WBTA 2EN8A 2EOXA 1AAYA 2EPAA 3VHTB 1X6FA 5KL4A 2JP9A 4WSGA 2ENAA 2ELZA 2EOYA 4R2CA 2EE8A 1UBDC 2EMGA 2R1FA 2DLKA 2YRMA 2EMKA 2LT7A 1A1GA 2EPCA 2ADRA 2EOHA 2YU5A 1X6EA 5KL6A 1A1KA 2NABA 2YRKA 2EMCA 2EN7A 4R2SA 3UK3C 2MDGA 3MHHC 2EM4A 2EPPA 2YSOA 2CTDA 2GLIA 2ELYA 4F6NA 2EN1A 2WBSA 1X5WA 2EN4A 2ENHA 2EN3A 2EP3A 2EMBA 2CSHA 3EPLA 2HGHA 1TF3A 4R2EA 2EMXA 1LLMC 2EJ4A 2EMHA 5KL7A 2CT1A 2YTDA 4GZNC 1DGCA 2J7JA 1YSAC 2LO3A 1ZR9A 1A1HA 4R2AA 2E72A 2PRTA 2EL6A 2EPRA 2EM9A 4F6MA 2YTFA 2A25A 2YTGA 2YTQA 4R2PA 1G2FC 2EMFA 1YUJA 2DRPA 4IJDA 1BB8A 2YSPA 2EOSA 2EQ1A 2VRDA 2EM0A 2RPCA 3EPJA 2EM2A 2EQ0A 2EPUA 4F2JC 1TN9A 2LCEA 2EOIA 2ENCA 1JK2A 2I13A 2EMLA 1MEYC 1F2IG 1ZU1A 2YTJA 2EL5A 4R2QA 2BB8A 2DGCA 1A1JA 1JK1A 1X3CA 2EOZA 1X6HA 2EM7A 2EMAA 2YTPA 3EPKA 2EMZA 2WBUA 2EQ3A 3MHSC 2YTOA 2MKDA 2MKNA 2D9HA 2EL4A 2M9AA 2EM6A 5KL3A 1WJPA 1G2DC 4R2RA 1UN6B 2EOFA 2EM8A 2LV2A 4FK5C 2EMIA 1BBOA 5KL2A 2YTEA 2RSIA 2YU8A 1B69A 2LVHA 1NCSA 2EN2A 1KJKA 2EMWA 1A1LA 4R2DA 2DLQA 3EPHA 2JPAA 4IS1C 4M9VC 2YRHA 2GHFA 1ZAAC 1Z1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M99 B;  1YUI A;  2EOR A;  5KL5 A;  2EN6 A;  2EM5 A;  2EM3 A;  2EMY A;  2EOJ A;  1P47 A;  2EPZ A;  2EOM A;  2DMI A;  2EOE A;  1TF6 A;  1RMD A;  2WCC 3;  2YTN A;  2YTI A;  2EPX A;  1A1I A;  2EOQ A;  2EOO A;  1A1F A;  4X9J A;  2WBT A;  2EN8 A;  2EOX A;  1AAY A;  2EPA A;  3VHT B;  1X6F A;  5KL4 A;  2JP9 A;  4WSG A;  2ENA A;  2ELZ A;  2EOY A;  4R2C A;  2EE8 A;  1UBD C;  2EMG A;  2R1F A;  2DLK A;  2YRM A;  2EMK A;  2LT7 A;  1A1G A;  2EPC A;  2ADR A;  2EOH A;  2YU5 A;  1X6E A;  5KL6 A;  1A1K A;  2NAB A;  2YRK A;  2EMC A;  2EN7 A;  4R2S A;  3UK3 C;  2MDG A;  3MHH C;  2EM4 A;  2EPP A;  2YSO A;  2CTD A;  2GLI A;  2ELY A;  4F6N A;  2EN1 A;  2WBS A;  1X5W A;  2EN4 A;  2ENH A;  2EN3 A;  2EP3 A;  2EMB A;  2CSH A;  3EPL A;  2HGH A;  1TF3 A;  4R2E A;  2EMX A;  1LLM C;  2EJ4 A;  2EMH A;  5KL7 A;  2CT1 A;  2YTD A;  4GZN C;  1DGC A;  2J7J A;  1YSA C;  2LO3 A;  1ZR9 A;  1A1H A;  4R2A A;  2E72 A;  2PRT A;  2EL6 A;  2EPR A;  2EM9 A;  4F6M A;  2YTF A;  2A25 A;  2YTG A;  2YTQ A;  4R2P A;  1G2F C;  2EMF A;  1YUJ A;  2DRP A;  4IJD A;  1BB8 A;  2YSP A;  2EOS A;  2EQ1 A;  2VRD A;  2EM0 A;  2RPC A;  3EPJ A;  2EM2 A;  2EQ0 A;  2EPU A;  4F2J C;  1TN9 A;  2LCE A;  2EOI A;  2ENC A;  1JK2 A;  2I13 A;  2EML A;  1MEY C;  1F2I G;  1ZU1 A;  2YTJ A;  2EL5 A;  4R2Q A;  2BB8 A;  2DGC A;  1A1J A;  1JK1 A;  1X3C A;  2EOZ A;  1X6H A;  2EM7 A;  2EMA A;  2YTP A;  3EPK A;  2EMZ A;  2WBU A;  2EQ3 A;  3MHS C;  2YTO A;  2MKD A;  2MKN A;  2D9H A;  2EL4 A;  2M9A A;  2EM6 A;  5KL3 A;  1WJP A;  1G2D C;  4R2R A;  1UN6 B;  2EOF A;  2EM8 A;  2LV2 A;  4FK5 C;  2EMI A;  1BBO A;  5KL2 A;  2YTE A;  2RSI A;  2YU8 A;  1B69 A;  2LVH A;  1NCS A;  2EN2 A;  1KJK A;  2EMW A;  1A1L A;  4R2D A;  2DLQ A;  3EPH A;  2JPA A;  4IS1 C;  4M9V C;  2YRH A;  2GHF A;  1ZAA C;  1Z1B A; 
#chains in the Genus database with same CATH topology
 3AUZ A;  4I8O A;  2EN6 A;  2V85 A;  2ZM6 E;  2EMY A;  1P47 A;  2FV4 B;  5A6B A;  1GZ6 A;  2EOM A;  4DMI A;  4DV0 E;  3THO B;  1TF6 A;  2WZO A;  1J26 A;  4F9B B;  2LJU A;  1GTK A;  2EPL X;  3HPS A;  2UUB E;  2EPA A;  4N4R B;  1X6F A;  2L3J A;  4R2C A;  5LL6 R;  2V88 A;  4B3S E;  2EMG A;  2R1F A;  2YRM A;  2EMK A;  3IWD A;  2EOH A;  2YU5 A;  1X6E A;  1XNQ E;  2NAB A;  2YRK A;  2EN7 A;  1IBK E;  3MHH C;  2E1M A;  1EKZ A;  3TQM A;  4F6N A;  1SFE A;  1X5W A;  2EN4 A;  2N3G A;  2ENH A;  4KZS A;  3EPL A;  3AV0 A;  4BBY A;  1LLM C;  2EJ4 A;  4JV5 E;  2CT1 A;  4WXD A;  4BC7 A;  4JI7 E;  1HNZ E;  1YSA C;  1A1H A;  4R2A A;  2EPK X;  3KZZ A;  2EL6 A;  2F4V E;  2EM9 A;  1N3G A;  2VQE E;  2G7H A;  2H36 X;  2YTG A;  2YTQ A;  1GQE A;  4B3R E;  1BB8 A;  2YSP A;  2VQF E;  3HQ1 A;  4GEQ B;  2EM2 A;  4JI4 E;  5AE3 A;  4F2J C;  1TN9 A;  4LF7 E;  4DR7 E;  2LCE A;  1JK2 A;  4NXN E;  2HC5 A;  2L33 A;  3ZOQ B;  4BCA A;  1F2I G;  3VK6 A;  4JI3 E;  2EL5 A;  3JU0 A;  1A1J A;  1JK1 A;  2FGG A;  1IBL E;  2EMZ A;  2WBU A;  3MHS C;  2YTO A;  4M2Z A;  4DR4 E;  3ADJ A;  2JYA A;  1X49 A;  2YT4 A;  1UN6 B;  1G2D C;  5DNY A;  4YY3 E;  1N36 E;  4NZV A;  2ODR C;  5A2Q C;  2LVH A;  2UUC E;  5AC5 A;  2N3H A;  4DUZ E;  2VE7 C;  5IXM B;  4DV6 E;  2EZ6 A;  4IS1 C;  2M4I A;  2MDR A;  2EOR A;  3RMP A;  1RC7 A;  2EPO A;  4GKJ E;  4P7D A;  4WFT A;  2EPZ A;  2DMI A;  4DV5 E;  4X64 E;  2NUE A;  2JWO A;  3OML A;  3IWC A;  4LFC E;  2YTN A;  1A1I A;  2JOX A;  2DB2 A;  4BC9 A;  1XNR E;  2BBG A;  4X9J A;  1YZ9 A;  4NXM E;  4RHB B;  2ENA A;  2V8Q B;  4B3M E;  4Q35 B;  1N32 E;  2HHH E;  4BMJ A;  2ADR A;  5KL6 A;  1A1K A;  3T1H E;  1IQO A;  3K6Q A;  5A6A A;  1ZBQ A;  4JI5 E;  1YFH A;  3BGH A;  4R2S A;  2L3C A;  4BHB A;  5CFF E;  2EN3 A;  3ADI A;  1WXR A;  2EMX A;  1T39 A;  4DR6 E;  3C6M A;  5KL7 A;  3J80 C;  2FTX B;  1DGC A;  4NHR A;  2J7J A;  1ZR9 A;  4TUG A;  1PJT A;  5AE2 A;  4LF5 E;  2EPR A;  4ZYD A;  2A25 A;  2L92 A;  4X65 E;  1G2F C;  2JVA A;  3F6H A;  4IJD A;  1FJG E;  5ADZ A;  4ZYE A;  2VRD A;  4DKK A;  2EQ0 A;  2EPU A;  2N8X A;  3MSW A;  1QNT A;  2LUQ A;  3QG5 C;  4BS9 A;  2UUA E;  2UXB E;  3J81 C;  3H09 A;  1T4L B;  4R8O A;  5AE1 A;  4DV3 E;  1T4N A;  2DGC A;  1RQ0 A;  3THN A;  2RTX A;  2EQ3 A;  2MKN A;  4LF8 E;  4JYA E;  2M9A A;  4WX9 A;  2M1S A;  1YYK A;  5AC4 A;  2EOF A;  1UIL A;  2LV2 A;  2EMI A;  2YWQ A;  3HTX A;  1EH8 A;  3J7A G;  2YTE A;  2EN2 A;  2KON A;  1HR0 E;  1KJK A;  4P78 A;  2DLQ A;  3EPH A;  3ADL A;  2YRH A;  1X48 A;  1QU6 A;  1XMO E;  2B7T A;  5A69 A;  4DR2 E;  3IWB A;  1Z1B A;  3ADG A;  3M99 B;  1T4O A;  5A6B D;  1WHN A;  3BBG A;  2EM3 A;  2EOJ A;  3JTZ A;  1J5E E;  4LF9 E;  2RS6 A;  2B3T B;  1T38 A;  2V86 A;  1IMU A;  1RMD A;  5IT9 C;  1I94 E;  2WCC 3;  5TSE A;  5A6J A;  4WYQ B;  2EPX A;  2EOQ A;  1A1F A;  4X62 E;  4O5G A;  1YPN A;  4X8W A;  3J7Y p;  2EN8 A;  4WXC A;  4DV7 E;  1AAY A;  2EWL A;  5KL4 A;  1N34 E;  4J8Z A;  4WSG A;  1UHZ A;  1YYW A;  4OOG C;  2EOY A;  3HPZ A;  2EE8 A;  4ZYH A;  1UBD C;  2JOB A;  2RS7 A;  1PKP A;  1AH5 A;  2EPC A;  4BHC A;  1IQS A;  3VYY A;  1A1G A;  4JI2 E;  4Q28 A;  2M7Q A;  2MDG A;  2NUF A;  2Q8U A;  2YSO A;  3KWR A;  2GLI A;  4F9A B;  4KWY A;  2I9I A;  2EN1 A;  4DR1 E;  4HEI A;  2RQL A;  2EP3 A;  2YPN A;  1KYQ A;  2HGH A;  1TF3 A;  3F6G A;  2YTD A;  2K7I A;  2E72 A;  2PRT A;  2HJJ A;  1FKA E;  1DI2 A;  4LF6 E;  4F6M A;  4L5N C;  4O43 A;  1BBG A;  2L8T A;  2EPN A;  4R2P A;  4K0K E;  3P1X A;  5AAS A;  1PJQ A;  1EH7 A;  3T1Y E;  3BF2 A;  2EQ1 A;  2RPC A;  3EPJ A;  2V89 A;  4ZYG A;  2EOI A;  2ENC A;  4LU9 A;  2I13 A;  1WHQ A;  3C4T A;  5FLX C;  1MEY C;  4F54 A;  1NEI A;  2MC6 A;  2BB8 A;  2E5L E;  2B7V A;  3JAM C;  4LTY A;  1X3C A;  1X6H A;  2EM7 A;  2LTS A;  5A6K A;  2B9D A;  2UU9 E;  2L6M A;  2EL4 A;  2V83 A;  2EM6 A;  4X66 E;  5KL3 A;  2LMZ A;  4FK5 C;  4O4K A;  1HNX E;  2DIX A;  5KL2 A;  1B69 A;  2RSI A;  2KOU A;  2YU8 A;  1X47 A;  4L8N A;  5IV8 B;  2L2N A;  1N33 E;  4TUI A;  1A1L A;  3EQ1 A;  2JPA A;  4M9V C;  1PDA A;  2GHF A;  1ZAA C;  5IWA E;  2LTR A;  1YUI A;  5KL5 A;  3OTO E;  2EM5 A;  1DQ3 A;  4DR5 E;  2EOE A;  2L2K B;  2YTI A;  1IBM E;  4OX9 E;  2EOO A;  5F3W A;  4MLV A;  4JI1 E;  1STU A;  4M0V A;  2WBT A;  2EOX A;  2UXC E;  2NA2 A;  3VHT B;  4LFB E;  3BID A;  5BR8 E;  2JP9 A;  3KZY A;  2V87 A;  2ELZ A;  2JR1 A;  1XMQ E;  4JI6 E;  4R03 A;  2DLK A;  3HXL A;  3DJW A;  4WSP A;  2LT7 A;  3VYX A;  4GKK E;  1PJS A;  2EMC A;  2R76 A;  3UK3 C;  4JI0 E;  2VF1 A;  2EM4 A;  2LUP B;  2EPP A;  2CTD A;  4JI8 E;  4DV4 E;  2ELY A;  2WBS A;  2LRS A;  4O24 A;  1HNW E;  2CPN A;  2EMB A;  2CSH A;  4F9C B;  2JY9 A;  4R2E A;  2EMH A;  1EH6 A;  2ODR D;  4GZN C;  2RSM A;  5T6J A;  2LO3 A;  1YYO A;  2DMY A;  3LML A;  2LE2 A;  4KHP E;  1O0W A;  3ECR A;  2YTF A;  1MGT A;  2IHR 1;  2EMF A;  1YUJ A;  2DRP A;  2DSY A;  2EOS A;  4WPY A;  2EM0 A;  2GPI A;  4YHH E;  2EML A;  2LJH A;  5LMU E;  4DR3 E;  1ZBT A;  2LBS B;  1ZU1 A;  2YTJ A;  4B3T E;  3DF6 A;  3FIG A;  4R2Q A;  2MC5 A;  2EOZ A;  1L4S A;  2JXP A;  3L00 A;  4M30 A;  2EMA A;  2YTP A;  3EPK A;  4DV2 E;  2F8B A;  3LLH A;  3C6K A;  2L2M A;  2MKD A;  4HTG A;  2D9H A;  2NUG A;  4RH8 A;  4LF4 E;  1WJP A;  5LMN E;  4R2R A;  2KHX A;  2EM8 A;  4LFA E;  1BBO A;  2K4V A;  4AQY E;  1NCS A;  3C4B A;  4MLQ A;  4DUY E;  2UXD E;  2EMW A;  2YZT A;  5LLQ A;  2EPM X;  4R2D A;  4DV1 E;  1WRJ A;  1SR9 A; 
#chains in the Genus database with same CATH homology
 3M99 B;  1YUI A;  2EOR A;  5KL5 A;  2EN6 A;  2EM5 A;  2EM3 A;  2EMY A;  2EOJ A;  1P47 A;  2EPZ A;  2EOM A;  2DMI A;  2EOE A;  1TF6 A;  1RMD A;  2WCC 3;  2YTN A;  2YTI A;  2EPX A;  1A1I A;  2EOQ A;  2EOO A;  1A1F A;  4X9J A;  2WBT A;  2EN8 A;  2EOX A;  1AAY A;  2EPA A;  3VHT B;  1X6F A;  5KL4 A;  2JP9 A;  4WSG A;  2ENA A;  2ELZ A;  2EOY A;  4R2C A;  2EE8 A;  1UBD C;  2EMG A;  2R1F A;  2DLK A;  2YRM A;  2EMK A;  2LT7 A;  1A1G A;  2EPC A;  2ADR A;  2EOH A;  2YU5 A;  1X6E A;  5KL6 A;  1A1K A;  2NAB A;  2YRK A;  2EMC A;  2EN7 A;  4R2S A;  3UK3 C;  2MDG A;  3MHH C;  2EM4 A;  2EPP A;  2YSO A;  2CTD A;  2GLI A;  2ELY A;  4F6N A;  2EN1 A;  2WBS A;  1X5W A;  2EN4 A;  2ENH A;  2EN3 A;  2EP3 A;  2EMB A;  2CSH A;  3EPL A;  2HGH A;  1TF3 A;  4R2E A;  2EMX A;  1LLM C;  2EJ4 A;  2EMH A;  5KL7 A;  2CT1 A;  2YTD A;  4GZN C;  1DGC A;  2J7J A;  1YSA C;  2LO3 A;  1ZR9 A;  1A1H A;  4R2A A;  2E72 A;  2PRT A;  2EL6 A;  2EPR A;  2EM9 A;  4F6M A;  2YTF A;  2A25 A;  2YTG A;  2YTQ A;  4R2P A;  1G2F C;  2EMF A;  1YUJ A;  2DRP A;  4IJD A;  1BB8 A;  2YSP A;  2EOS A;  2EQ1 A;  2VRD A;  2EM0 A;  2RPC A;  3EPJ A;  2EM2 A;  2EQ0 A;  2EPU A;  4F2J C;  1TN9 A;  2LCE A;  2EOI A;  2ENC A;  1JK2 A;  2I13 A;  2EML A;  1MEY C;  1F2I G;  1ZU1 A;  2YTJ A;  2EL5 A;  4R2Q A;  2BB8 A;  2DGC A;  1A1J A;  1JK1 A;  1X3C A;  2EOZ A;  1X6H A;  2EM7 A;  2EMA A;  2YTP A;  3EPK A;  2EMZ A;  2WBU A;  2EQ3 A;  3MHS C;  2YTO A;  2MKD A;  2MKN A;  2D9H A;  2EL4 A;  2M9A A;  2EM6 A;  5KL3 A;  1WJP A;  1G2D C;  4R2R A;  1UN6 B;  2EOF A;  2EM8 A;  2LV2 A;  4FK5 C;  2EMI A;  1BBO A;  5KL2 A;  2YTE A;  2RSI A;  2YU8 A;  1B69 A;  2LVH A;  1NCS A;  2EN2 A;  1KJK A;  2EMW A;  1A1L A;  4R2D A;  2DLQ A;  3EPH A;  2JPA A;  4IS1 C;  4M9V C;  2YRH A;  2GHF A;  1ZAA C;  1Z1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...