2CTDA

Solution structure of two zf-c2h2 domains from human zinc finger protein 512
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
96
structure length
96
Chain Sequence
GSSGSSGRIRKEPPVYAAGSLEEQWYLEIVDKGSVSCPTCQAVGRKTIEGLKKHMENCKQEMFTCHHCGKQLRSLAGMKYHVMANHNSLPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 512
publication title Solution structure of two zf-C2H2 domains from human Zinc finger protein 512
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 13
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2005-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ctdA00
2EN1A 2LVHA 2EN8A 4WSGA 2YU5A 4R2RA 2EPCA 1LLMC 2EM0A 2YU8A 2EN4A 2BB8A 1A1LA 4R2EA 2YTNA 2EN2A 2EOOA 2WBTA 5KL3A 2R1FA 2VRDA 2DLKA 2RPCA 2LCEA 2WBUA 5KL2A 2WCC3 2PRTA 1A1JA 1F2IG 1A1FA 2GLIA 3EPJA 2YTPA 2EOZA 2YTDA 2EM8A 1G2DC 1NCSA 1UN6B 2EPRA 2EPXA 2EPAA 1MEYC 1TN9A 2JP9A 2LO3A 4R2CA 4GZNC 1ZU1A 2EMIA 2EOHA 1YSAC 2EJ4A 2A25A 2ADRA 1JK1A 4IS1C 1Z1BA 2EPPA 1YUJA 2EOFA 2J7JA 2EMYA 2EN3A 2MKDA 2EL6A 2YTFA 1A1KA 1X6HA 1JK2A 2NABA 2EOQA 4X9JA 3UK3C 3EPHA 2CTDA 5KL6A 1X6FA 2DRPA 1X6EA 2EM2A 2DMIA 2ELZA 2EQ3A 2GHFA 2EM5A 2EOIA 3MHHC 4R2PA 2DLQA 4F2JC 2ELYA 2EM6A 4FK5C 1ZAAC 2EMAA 2YTQA 4R2DA 2I13A 2EMCA 2EMWA 3VHTB 2D9HA 2EM4A 2YSPA 1WJPA 2EOMA 1TF3A 1YUIA 1KJKA 1P47A 2YTJA 1DGCA 1X5WA 2EMHA 2EPUA 3EPKA 2LV2A 2EQ1A 2LT7A 1BBOA 5KL7A 2M9AA 4IJDA 2MDGA 2YTEA 2ENCA 2EOYA 1A1GA 2DGCA 2EL5A 2EP3A 1AAYA 2EE8A 2ENAA 2YTOA 2EM7A 2EORA 1A1HA 2HGHA 2EMZA 1X3CA 2CT1A 2EOSA 2EM9A 2YRHA 4R2AA 4M9VC 2EMKA 2EOJA 2EMGA 3M99B 2YTGA 1B69A 2EMXA 2EM3A 2EMBA 1RMDA 1G2FC 2YRMA 2EN7A 2YSOA 2CSHA 5KL5A 2EMLA 1A1IA 1BB8A 2ENHA 2EPZA 2EN6A 4F6NA 2EOEA 1TF6A 2JPAA 2EQ0A 2YTIA 1UBDC 5KL4A 2RSIA 2MKNA 4R2QA 2EOXA 4R2SA 3MHSC 2EMFA 2WBSA 4F6MA 2YRKA 2EL4A 3EPLA 2E72A 1ZR9A
chains in the Genus database with same CATH superfamily
1SR9A 5CFFE 4DV5E 3IWCA 1DI2A 2YU5A 4ZYDA 2R76A 3C6MA 2LE2A 2YU8A 2BB8A 5IXMB 1A1LA 1XNRE 2IHR1 1GTKA 2EPNA 2EN2A 1GQEA 1BBGA 1O0WA 2R1FA 3HTXA 4JI3E 3FIGA 5DNYA 2FTXB 2FGGA 2YTPA 4M30A 2V83A 2B7VA 4LFBE 3C6KA 3BIDA 1IQOA 2HHHE 3P1XA 1ZU1A 3J81C 4JV5E 2LJUA 1YUJA 2KOUA 5A2QC 4DUYE 2EN3A 1A1KA 4DV1E 1X6HA 2V85A 5LMNE 1PJQA 4X8WA 2CTDA 4WSPA 2DMIA 5A6AA 1PJTA 2EQ3A 2ODRD 2EOIA 4JI2E 1XMOE 2KONA 2M4IA 4NXNE 2ELYA 1YPNA 4JI6E 2EMAA 5IT9C 2I13A 5IWAE 4X66E 3MSWA 2LMZA 1P47A 1DGCA 2EPUA 3EPKA 2JXPA 4IJDA 2MDGA 3ADIA 2ENCA 5AE3A 4YHHE 3THNA 2EE8A 4TUIA 2EPOA 2RQLA 4JI5E 3VK6A 2JYAA 2CT1A 2EM9A 2LBSB 2Q8UA 2H36X 4KZSA 2YTGA 1B69A 2EMBA 3THOB 2ZM6E 2YWQA 1T4NA 2YRMA 4AQYE 2CSHA 4DUZE 4DR4E 4ZYHA 3ADGA 1IMUA 1QU6A 2EPZA 4GKKE 2ODRC 3OTOE 4LFAE 1HNWE 2HJJA 3BF2A 2MKNA 2UUAE 4R2SA 4ZYGA 2K7IA 3JU0A 2YRKA 3RMPA 2EL4A 2M1SA 4RH8A 1FKAE 1ZR9A 2DMYA 2EN1A 2EWLA 4B3RE 2UXDE 4WXDA 1LLMC 3IWBA 2EM0A 4R2EA 1PDAA 1IBME 4L8NA 4ZYEA 1T4OA 2RPCA 2LCEA 1RQ0A 1IQSA 4BBYA 2YZTA 2UUCE 3K6QA 3ECRA 2JOXA 1WXRA 2G7HA 4LTYA 5A6BD 1NCSA 3HXLA 4NXME 1MEYC 4JI4E 1KYQA 2EJ4A 3DJWA 4LFCE 1EH6A 3AV0A 2L2KB 2EPPA 2JVAA 2VF1A 2M7QA 2V86A 4R8OA 4B3SE 4LU9A 2MKDA 4KWYA 4BS9A 3UK3C 5TSEA 2B7TA 2DIXA 2L3JA 1X6FA 2NA2A 3MHHC 1SFEA 3KZYA 3JAMC 3T1HE 4B3TE 2EMWA 4DV6E 4DR1E 1TF3A 1YUIA 1WHNA 4F9BB 1KJKA 3HPSA 1X5WA 2EMHA 2LTSA 2LV2A 4DV7E 2M9AA 2YTEA 2L33A 1A1GA 3VYXA 2EL5A 4KHPE 5A6JA 4DR5E 1AAYA 1HR0E 2L2MA 3F6GA 2YTOA 4LF4E 2EM7A 2NUGA 2I9IA 2HGHA 1YFHA 4JI1E 2EPLX 3C4TA 4M9VC 2N8XA 3M99B 4DR6E 2HC5A 3J7Yp 2EN7A 1PKPA 5IV8B 1BB8A 1A1IA 2L3CA 1J5EE 3AUZA 2L6MA 2ENHA 2UU9E 2LTRA 2EN6A 4F6NA 2EQ0A 1IBKE 1IBLE 1N3GA 5KL4A 1T4LB 1HNZE 2V88A 4DR2E 4B3ME 4F6MA 1WHQA 2EL6A 3EPLA 2E72A 2NUEA 1J26A 1I94E 2LVHA 2EN8A 4WSGA 2DSYA 4O5GA 4R2RA 4Q28A 4N4RB 1QNTA 1YYWA 3OMLA 2YTNA 3ZOQB 2EOOA 2WBTA 5KL3A 2VRDA 4WX9A 2DLKA 5A6KA 2WBUA 4K0KE 2WCC3 2PRTA 5A69A 1WRJA 4LF6E 1EH7A 1UN6B 2EPRA 2EPXA 1TN9A 2LO3A 4R2CA 2EOHA 1YZ9A 4J8ZA 3KWRA 4F9CB 2UXCE 2ADRA 1JK1A 5ADZA 3BGHA 1Z1BA 2EOFA 2J7JA 4WFTA 4JYAE 4O43A 3JTZA 1JK2A 4GEQB 4X9JA 3EPHA 4LF5E 2EPMX 2LUQA 2DRPA 2ELZA 1N36E 2GHFA 2F4VE 2VQEE 4HTGA 2DLQA 2V8QB 5BR8E 1NEIA 4FK5C 4P7DA 1ZAAC 4HEIA 2EMCA 5AE1A 1XMQE 4DV0E 2YSPA 4DKKA 1WJPA 4LF9E 1L4SA 1N32E 2UXBE 3BBGA 4R03A 5FLXC 4DR7E 1BBOA 1ZBTA 4BHBA 4JI8E 2WZOA 1N34E 4NZVA 1T39A 5AE2A 2DGCA 2EOYA 3HPZA 3LMLA 1HNXE 1X47A 3ADJA 4DV2E 4WPYA 1RC7A 1MGTA 4TUGA 4OX9E 1X49A 3T1YE 2YRHA 2EMKA 2EOJA 2EMXA 2EM3A 2L2NA 1DQ3A 1G2FC 2B9DA 2JWOA 2YT4A 2YSOA 5KL5A 4O4KA 2EMLA 4P78A 5A6BA 5AC4A 4OOGC 3L00A 2N3HA 2EOEA 1TF6A 2RS7A 1UBDC 1XNQE 3VYYA 3QG5C 2RSIA 3F6HA 3ADLA 4JI7E 2LJHA 1STUA 3MHSC 1PJSA 4X65E 2E5LE 3KZZA 2B3TB 2DB2A 1EKZA 4X62E 2MC6A 2EPCA 2EN4A 1YYKA 4F9AB 2MC5A 4Q35B 4M0VA 4L5NC 4BCAA 4GKJE 4DR3E 1FJGE 3DF6A 4O24A 3IWDA 5KL2A 1A1JA 4NHRA 1F2IG 1A1FA 2GLIA 3EPJA 2UUBE 2EOZA 2YTDA 2EM8A 3LLHA 1G2DC 2EPAA 1UILA 2JP9A 4GZNC 4YY3E 2EMIA 2MDRA 1YSAC 4BC7A 1N33E 2A25A 2RTXA 3C4BA 2F8BA 2GPIA 5AC5A 4IS1C 4WXCA 2LRSA 1GZ6A 1EH8A 2EMYA 4M2ZA 2YTFA 2N3GA 2NABA 2EOQA 2EPKX 2RS6A 2YPNA 5KL6A 4BC9A 5LL6R 1X6EA 2EM2A 4I8OA 1AH5A 1UHZA 2EM5A 4BMJA 2E1MA 4R2PA 3TQMA 4F2JC 4DV3E 2JOBA 2EM6A 4LF7E 2YTQA 4R2DA 2KHXA 3VHTB 2D9HA 4JI0E 2EM4A 2EZ6A 2EOMA 1YYOA 4BHCA 4DMIA 2YTJA 2EQ1A 2LT7A 5KL7A 4MLQA 5LLQA 5F3WA 3J7AG 3H09A 2VQFE 2BBGA 2EP3A 3J80C 1T38A 4LF8E 4F54A 2ENAA 2V87A 2JR1A 2EORA 2K4VA 5LMUE 2LUPB 1A1HA 3EQ1A 2EMZA 1X3CA 2EOSA 2L92A 4R2AA 5AASA 4MLVA 2EMGA 1X48A 2NUFA 1RMDA 5T6JA 2CPNA 2V89A 2VE7C 2RSMA 2FV4B 4DV4E 2JPAA 3HQ1A 1ZBQA 2YTIA 4WYQB 4X64E 2JY9A 4RHBB 4R2QA 2EOXA 2L8TA 2EMFA 2WBSA
chains in the Genus database with same CATH topology
2EN1A 2LVHA 2EN8A 4WSGA 2YU5A 4R2RA 2EPCA 1LLMC 2EM0A 2YU8A 2EN4A 2BB8A 1A1LA 4R2EA 2YTNA 2EN2A 2EOOA 2WBTA 5KL3A 2R1FA 2VRDA 2DLKA 2RPCA 2LCEA 2WBUA 5KL2A 2WCC3 2PRTA 1A1JA 1F2IG 1A1FA 2GLIA 3EPJA 2YTPA 2EOZA 2YTDA 2EM8A 1G2DC 1NCSA 1UN6B 2EPRA 2EPXA 2EPAA 1MEYC 1TN9A 2JP9A 2LO3A 4R2CA 4GZNC 1ZU1A 2EMIA 2EOHA 1YSAC 2EJ4A 2A25A 2ADRA 1JK1A 4IS1C 1Z1BA 2EPPA 1YUJA 2EOFA 2J7JA 2EMYA 2EN3A 2MKDA 2EL6A 2YTFA 1A1KA 1X6HA 1JK2A 2NABA 2EOQA 4X9JA 3UK3C 3EPHA 2CTDA 5KL6A 1X6FA 2DRPA 1X6EA 2EM2A 2DMIA 2ELZA 2EQ3A 2GHFA 2EM5A 2EOIA 3MHHC 4R2PA 2DLQA 4F2JC 2ELYA 2EM6A 4FK5C 1ZAAC 2EMAA 2YTQA 4R2DA 2I13A 2EMCA 2EMWA 3VHTB 2D9HA 2EM4A 2YSPA 1WJPA 2EOMA 1TF3A 1YUIA 1KJKA 1P47A 2YTJA 1DGCA 1X5WA 2EMHA 2EPUA 3EPKA 2LV2A 2EQ1A 2LT7A 1BBOA 5KL7A 2M9AA 4IJDA 2MDGA 2YTEA 2ENCA 2EOYA 1A1GA 2DGCA 2EL5A 2EP3A 1AAYA 2EE8A 2ENAA 2YTOA 2EM7A 2EORA 1A1HA 2HGHA 2EMZA 1X3CA 2CT1A 2EOSA 2EM9A 2YRHA 4R2AA 4M9VC 2EMKA 2EOJA 2EMGA 3M99B 2YTGA 1B69A 2EMXA 2EM3A 2EMBA 1RMDA 1G2FC 2YRMA 2EN7A 2YSOA 2CSHA 5KL5A 2EMLA 1A1IA 1BB8A 2ENHA 2EPZA 2EN6A 4F6NA 2EOEA 1TF6A 2JPAA 2EQ0A 2YTIA 1UBDC 5KL4A 2RSIA 2MKNA 4R2QA 2EOXA 4R2SA 3MHSC 2EMFA 2WBSA 4F6MA 2YRKA 2EL4A 3EPLA 2E72A 1ZR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN1 A;  2LVH A;  2EN8 A;  4WSG A;  2YU5 A;  4R2R A;  2EPC A;  1LLM C;  2EM0 A;  2YU8 A;  2EN4 A;  2BB8 A;  1A1L A;  4R2E A;  2YTN A;  2EN2 A;  2EOO A;  2WBT A;  5KL3 A;  2R1F A;  2VRD A;  2DLK A;  2RPC A;  2LCE A;  2WBU A;  5KL2 A;  2WCC 3;  2PRT A;  1A1J A;  1F2I G;  1A1F A;  2GLI A;  3EPJ A;  2YTP A;  2EOZ A;  2YTD A;  2EM8 A;  1G2D C;  1NCS A;  1UN6 B;  2EPR A;  2EPX A;  2EPA A;  1MEY C;  1TN9 A;  2JP9 A;  2LO3 A;  4R2C A;  4GZN C;  1ZU1 A;  2EMI A;  2EOH A;  1YSA C;  2EJ4 A;  2A25 A;  2ADR A;  1JK1 A;  4IS1 C;  1Z1B A;  2EPP A;  1YUJ A;  2EOF A;  2J7J A;  2EMY A;  2EN3 A;  2MKD A;  2EL6 A;  2YTF A;  1A1K A;  1X6H A;  1JK2 A;  2NAB A;  2EOQ A;  4X9J A;  3UK3 C;  3EPH A;  2CTD A;  5KL6 A;  1X6F A;  2DRP A;  1X6E A;  2EM2 A;  2DMI A;  2ELZ A;  2EQ3 A;  2GHF A;  2EM5 A;  2EOI A;  3MHH C;  4R2P A;  2DLQ A;  4F2J C;  2ELY A;  2EM6 A;  4FK5 C;  1ZAA C;  2EMA A;  2YTQ A;  4R2D A;  2I13 A;  2EMC A;  2EMW A;  3VHT B;  2D9H A;  2EM4 A;  2YSP A;  1WJP A;  2EOM A;  1TF3 A;  1YUI A;  1KJK A;  1P47 A;  2YTJ A;  1DGC A;  1X5W A;  2EMH A;  2EPU A;  3EPK A;  2LV2 A;  2EQ1 A;  2LT7 A;  1BBO A;  5KL7 A;  2M9A A;  4IJD A;  2MDG A;  2YTE A;  2ENC A;  2EOY A;  1A1G A;  2DGC A;  2EL5 A;  2EP3 A;  1AAY A;  2EE8 A;  2ENA A;  2YTO A;  2EM7 A;  2EOR A;  1A1H A;  2HGH A;  2EMZ A;  1X3C A;  2CT1 A;  2EOS A;  2EM9 A;  2YRH A;  4R2A A;  4M9V C;  2EMK A;  2EOJ A;  2EMG A;  3M99 B;  2YTG A;  1B69 A;  2EMX A;  2EM3 A;  2EMB A;  1RMD A;  1G2F C;  2YRM A;  2EN7 A;  2YSO A;  2CSH A;  5KL5 A;  2EML A;  1A1I A;  1BB8 A;  2ENH A;  2EPZ A;  2EN6 A;  4F6N A;  2EOE A;  1TF6 A;  2JPA A;  2EQ0 A;  2YTI A;  1UBD C;  5KL4 A;  2RSI A;  2MKN A;  4R2Q A;  2EOX A;  4R2S A;  3MHS C;  2EMF A;  2WBS A;  4F6M A;  2YRK A;  2EL4 A;  3EPL A;  2E72 A;  1ZR9 A; 
#chains in the Genus database with same CATH topology
 1SR9 A;  5CFF E;  4DV5 E;  3IWC A;  1DI2 A;  2YU5 A;  4ZYD A;  2R76 A;  3C6M A;  2LE2 A;  2YU8 A;  2BB8 A;  5IXM B;  1A1L A;  1XNR E;  2IHR 1;  1GTK A;  2EPN A;  2EN2 A;  1GQE A;  1BBG A;  1O0W A;  2R1F A;  3HTX A;  4JI3 E;  3FIG A;  5DNY A;  2FTX B;  2FGG A;  2YTP A;  4M30 A;  2V83 A;  2B7V A;  4LFB E;  3C6K A;  3BID A;  1IQO A;  2HHH E;  3P1X A;  1ZU1 A;  3J81 C;  4JV5 E;  2LJU A;  1YUJ A;  2KOU A;  5A2Q C;  4DUY E;  2EN3 A;  1A1K A;  4DV1 E;  1X6H A;  2V85 A;  5LMN E;  1PJQ A;  4X8W A;  2CTD A;  4WSP A;  2DMI A;  5A6A A;  1PJT A;  2EQ3 A;  2ODR D;  2EOI A;  4JI2 E;  1XMO E;  2KON A;  2M4I A;  4NXN E;  2ELY A;  1YPN A;  4JI6 E;  2EMA A;  5IT9 C;  2I13 A;  5IWA E;  4X66 E;  3MSW A;  2LMZ A;  1P47 A;  1DGC A;  2EPU A;  3EPK A;  2JXP A;  4IJD A;  2MDG A;  3ADI A;  2ENC A;  5AE3 A;  4YHH E;  3THN A;  2EE8 A;  4TUI A;  2EPO A;  2RQL A;  4JI5 E;  3VK6 A;  2JYA A;  2CT1 A;  2EM9 A;  2LBS B;  2Q8U A;  2H36 X;  4KZS A;  2YTG A;  1B69 A;  2EMB A;  3THO B;  2ZM6 E;  2YWQ A;  1T4N A;  2YRM A;  4AQY E;  2CSH A;  4DUZ E;  4DR4 E;  4ZYH A;  3ADG A;  1IMU A;  1QU6 A;  2EPZ A;  4GKK E;  2ODR C;  3OTO E;  4LFA E;  1HNW E;  2HJJ A;  3BF2 A;  2MKN A;  2UUA E;  4R2S A;  4ZYG A;  2K7I A;  3JU0 A;  2YRK A;  3RMP A;  2EL4 A;  2M1S A;  4RH8 A;  1FKA E;  1ZR9 A;  2DMY A;  2EN1 A;  2EWL A;  4B3R E;  2UXD E;  4WXD A;  1LLM C;  3IWB A;  2EM0 A;  4R2E A;  1PDA A;  1IBM E;  4L8N A;  4ZYE A;  1T4O A;  2RPC A;  2LCE A;  1RQ0 A;  1IQS A;  4BBY A;  2YZT A;  2UUC E;  3K6Q A;  3ECR A;  2JOX A;  1WXR A;  2G7H A;  4LTY A;  5A6B D;  1NCS A;  3HXL A;  4NXM E;  1MEY C;  4JI4 E;  1KYQ A;  2EJ4 A;  3DJW A;  4LFC E;  1EH6 A;  3AV0 A;  2L2K B;  2EPP A;  2JVA A;  2VF1 A;  2M7Q A;  2V86 A;  4R8O A;  4B3S E;  4LU9 A;  2MKD A;  4KWY A;  4BS9 A;  3UK3 C;  5TSE A;  2B7T A;  2DIX A;  2L3J A;  1X6F A;  2NA2 A;  3MHH C;  1SFE A;  3KZY A;  3JAM C;  3T1H E;  4B3T E;  2EMW A;  4DV6 E;  4DR1 E;  1TF3 A;  1YUI A;  1WHN A;  4F9B B;  1KJK A;  3HPS A;  1X5W A;  2EMH A;  2LTS A;  2LV2 A;  4DV7 E;  2M9A A;  2YTE A;  2L33 A;  1A1G A;  3VYX A;  2EL5 A;  4KHP E;  5A6J A;  4DR5 E;  1AAY A;  1HR0 E;  2L2M A;  3F6G A;  2YTO A;  4LF4 E;  2EM7 A;  2NUG A;  2I9I A;  2HGH A;  1YFH A;  4JI1 E;  2EPL X;  3C4T A;  4M9V C;  2N8X A;  3M99 B;  4DR6 E;  2HC5 A;  3J7Y p;  2EN7 A;  1PKP A;  5IV8 B;  1BB8 A;  1A1I A;  2L3C A;  1J5E E;  3AUZ A;  2L6M A;  2ENH A;  2UU9 E;  2LTR A;  2EN6 A;  4F6N A;  2EQ0 A;  1IBK E;  1IBL E;  1N3G A;  5KL4 A;  1T4L B;  1HNZ E;  2V88 A;  4DR2 E;  4B3M E;  4F6M A;  1WHQ A;  2EL6 A;  3EPL A;  2E72 A;  2NUE A;  1J26 A;  1I94 E;  2LVH A;  2EN8 A;  4WSG A;  2DSY A;  4O5G A;  4R2R A;  4Q28 A;  4N4R B;  1QNT A;  1YYW A;  3OML A;  2YTN A;  3ZOQ B;  2EOO A;  2WBT A;  5KL3 A;  2VRD A;  4WX9 A;  2DLK A;  5A6K A;  2WBU A;  4K0K E;  2WCC 3;  2PRT A;  5A69 A;  1WRJ A;  4LF6 E;  1EH7 A;  1UN6 B;  2EPR A;  2EPX A;  1TN9 A;  2LO3 A;  4R2C A;  2EOH A;  1YZ9 A;  4J8Z A;  3KWR A;  4F9C B;  2UXC E;  2ADR A;  1JK1 A;  5ADZ A;  3BGH A;  1Z1B A;  2EOF A;  2J7J A;  4WFT A;  4JYA E;  4O43 A;  3JTZ A;  1JK2 A;  4GEQ B;  4X9J A;  3EPH A;  4LF5 E;  2EPM X;  2LUQ A;  2DRP A;  2ELZ A;  1N36 E;  2GHF A;  2F4V E;  2VQE E;  4HTG A;  2DLQ A;  2V8Q B;  5BR8 E;  1NEI A;  4FK5 C;  4P7D A;  1ZAA C;  4HEI A;  2EMC A;  5AE1 A;  1XMQ E;  4DV0 E;  2YSP A;  4DKK A;  1WJP A;  4LF9 E;  1L4S A;  1N32 E;  2UXB E;  3BBG A;  4R03 A;  5FLX C;  4DR7 E;  1BBO A;  1ZBT A;  4BHB A;  4JI8 E;  2WZO A;  1N34 E;  4NZV A;  1T39 A;  5AE2 A;  2DGC A;  2EOY A;  3HPZ A;  3LML A;  1HNX E;  1X47 A;  3ADJ A;  4DV2 E;  4WPY A;  1RC7 A;  1MGT A;  4TUG A;  4OX9 E;  1X49 A;  3T1Y E;  2YRH A;  2EMK A;  2EOJ A;  2EMX A;  2EM3 A;  2L2N A;  1DQ3 A;  1G2F C;  2B9D A;  2JWO A;  2YT4 A;  2YSO A;  5KL5 A;  4O4K A;  2EML A;  4P78 A;  5A6B A;  5AC4 A;  4OOG C;  3L00 A;  2N3H A;  2EOE A;  1TF6 A;  2RS7 A;  1UBD C;  1XNQ E;  3VYY A;  3QG5 C;  2RSI A;  3F6H A;  3ADL A;  4JI7 E;  2LJH A;  1STU A;  3MHS C;  1PJS A;  4X65 E;  2E5L E;  3KZZ A;  2B3T B;  2DB2 A;  1EKZ A;  4X62 E;  2MC6 A;  2EPC A;  2EN4 A;  1YYK A;  4F9A B;  2MC5 A;  4Q35 B;  4M0V A;  4L5N C;  4BCA A;  4GKJ E;  4DR3 E;  1FJG E;  3DF6 A;  4O24 A;  3IWD A;  5KL2 A;  1A1J A;  4NHR A;  1F2I G;  1A1F A;  2GLI A;  3EPJ A;  2UUB E;  2EOZ A;  2YTD A;  2EM8 A;  3LLH A;  1G2D C;  2EPA A;  1UIL A;  2JP9 A;  4GZN C;  4YY3 E;  2EMI A;  2MDR A;  1YSA C;  4BC7 A;  1N33 E;  2A25 A;  2RTX A;  3C4B A;  2F8B A;  2GPI A;  5AC5 A;  4IS1 C;  4WXC A;  2LRS A;  1GZ6 A;  1EH8 A;  2EMY A;  4M2Z A;  2YTF A;  2N3G A;  2NAB A;  2EOQ A;  2EPK X;  2RS6 A;  2YPN A;  5KL6 A;  4BC9 A;  5LL6 R;  1X6E A;  2EM2 A;  4I8O A;  1AH5 A;  1UHZ A;  2EM5 A;  4BMJ A;  2E1M A;  4R2P A;  3TQM A;  4F2J C;  4DV3 E;  2JOB A;  2EM6 A;  4LF7 E;  2YTQ A;  4R2D A;  2KHX A;  3VHT B;  2D9H A;  4JI0 E;  2EM4 A;  2EZ6 A;  2EOM A;  1YYO A;  4BHC A;  4DMI A;  2YTJ A;  2EQ1 A;  2LT7 A;  5KL7 A;  4MLQ A;  5LLQ A;  5F3W A;  3J7A G;  3H09 A;  2VQF E;  2BBG A;  2EP3 A;  3J80 C;  1T38 A;  4LF8 E;  4F54 A;  2ENA A;  2V87 A;  2JR1 A;  2EOR A;  2K4V A;  5LMU E;  2LUP B;  1A1H A;  3EQ1 A;  2EMZ A;  1X3C A;  2EOS A;  2L92 A;  4R2A A;  5AAS A;  4MLV A;  2EMG A;  1X48 A;  2NUF A;  1RMD A;  5T6J A;  2CPN A;  2V89 A;  2VE7 C;  2RSM A;  2FV4 B;  4DV4 E;  2JPA A;  3HQ1 A;  1ZBQ A;  2YTI A;  4WYQ B;  4X64 E;  2JY9 A;  4RHB B;  4R2Q A;  2EOX A;  2L8T A;  2EMF A;  2WBS A; 
#chains in the Genus database with same CATH homology
 2EN1 A;  2LVH A;  2EN8 A;  4WSG A;  2YU5 A;  4R2R A;  2EPC A;  1LLM C;  2EM0 A;  2YU8 A;  2EN4 A;  2BB8 A;  1A1L A;  4R2E A;  2YTN A;  2EN2 A;  2EOO A;  2WBT A;  5KL3 A;  2R1F A;  2VRD A;  2DLK A;  2RPC A;  2LCE A;  2WBU A;  5KL2 A;  2WCC 3;  2PRT A;  1A1J A;  1F2I G;  1A1F A;  2GLI A;  3EPJ A;  2YTP A;  2EOZ A;  2YTD A;  2EM8 A;  1G2D C;  1NCS A;  1UN6 B;  2EPR A;  2EPX A;  2EPA A;  1MEY C;  1TN9 A;  2JP9 A;  2LO3 A;  4R2C A;  4GZN C;  1ZU1 A;  2EMI A;  2EOH A;  1YSA C;  2EJ4 A;  2A25 A;  2ADR A;  1JK1 A;  4IS1 C;  1Z1B A;  2EPP A;  1YUJ A;  2EOF A;  2J7J A;  2EMY A;  2EN3 A;  2MKD A;  2EL6 A;  2YTF A;  1A1K A;  1X6H A;  1JK2 A;  2NAB A;  2EOQ A;  4X9J A;  3UK3 C;  3EPH A;  2CTD A;  5KL6 A;  1X6F A;  2DRP A;  1X6E A;  2EM2 A;  2DMI A;  2ELZ A;  2EQ3 A;  2GHF A;  2EM5 A;  2EOI A;  3MHH C;  4R2P A;  2DLQ A;  4F2J C;  2ELY A;  2EM6 A;  4FK5 C;  1ZAA C;  2EMA A;  2YTQ A;  4R2D A;  2I13 A;  2EMC A;  2EMW A;  3VHT B;  2D9H A;  2EM4 A;  2YSP A;  1WJP A;  2EOM A;  1TF3 A;  1YUI A;  1KJK A;  1P47 A;  2YTJ A;  1DGC A;  1X5W A;  2EMH A;  2EPU A;  3EPK A;  2LV2 A;  2EQ1 A;  2LT7 A;  1BBO A;  5KL7 A;  2M9A A;  4IJD A;  2MDG A;  2YTE A;  2ENC A;  2EOY A;  1A1G A;  2DGC A;  2EL5 A;  2EP3 A;  1AAY A;  2EE8 A;  2ENA A;  2YTO A;  2EM7 A;  2EOR A;  1A1H A;  2HGH A;  2EMZ A;  1X3C A;  2CT1 A;  2EOS A;  2EM9 A;  2YRH A;  4R2A A;  4M9V C;  2EMK A;  2EOJ A;  2EMG A;  3M99 B;  2YTG A;  1B69 A;  2EMX A;  2EM3 A;  2EMB A;  1RMD A;  1G2F C;  2YRM A;  2EN7 A;  2YSO A;  2CSH A;  5KL5 A;  2EML A;  1A1I A;  1BB8 A;  2ENH A;  2EPZ A;  2EN6 A;  4F6N A;  2EOE A;  1TF6 A;  2JPA A;  2EQ0 A;  2YTI A;  1UBD C;  5KL4 A;  2RSI A;  2MKN A;  4R2Q A;  2EOX A;  4R2S A;  3MHS C;  2EMF A;  2WBS A;  4F6M A;  2YRK A;  2EL4 A;  3EPL A;  2E72 A;  1ZR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...