2CTDA

Solution structure of two zf-c2h2 domains from human zinc finger protein 512
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
96
structure length
96
Chain Sequence
GSSGSSGRIRKEPPVYAAGSLEEQWYLEIVDKGSVSCPTCQAVGRKTIEGLKKHMENCKQEMFTCHHCGKQLRSLAGMKYHVMANHNSLPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of two zf-C2H2 domains from human Zinc finger protein 512
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Zinc finger protein 512
total genus 13
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2005-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ctdA00
2YRHA 2EQ0A 2EPRA 2YRKA 1P47A 1A1HA 4R2RA 4IS1C 2EOXA 1X6EA 2YTFA 2I13A 2MKNA 2EMIA 2ENAA 2YU5A 3EPJA 2J7JA 1ZR9A 2EOQA 2VRDA 1UBDC 2EPCA 2ADRA 1X6HA 2EOSA 2LCEA 2EM5A 2EN3A 2ENCA 2M9AA 2YTGA 4R2AA 1F2IG 2EPPA 2EMWA 2EM7A 2EMFA 1AAYA 4X9JA 4R2QA 2EPUA 2DRPA 3EPHA 2EMLA 3M99B 2EM0A 2YTDA 4M9VC 2WBUA 1X5WA 1WJPA 2JP9A 2YTEA 3EPLA 2EN4A 1NCSA 2EJ4A 2EOFA 1ZAAC 3MHHC 4R2CA 2CSHA 4R2SA 1KJKA 2DMIA 2RPCA 2WBTA 1Z1BA 2NABA 2MDGA 2EM4A 2EOJA 5KL7A 2EPXA 2DLKA 4R2DA 4F6NA 1A1LA 1X6FA 2ELYA 2EOOA 2EN7A 2EOEA 2EOIA 1JK1A 2WCC3 1G2FC 2EOZA 5KL5A 2EN1A 2EMKA 1YSAC 2EOMA 3VHTB 2A25A 1ZU1A 2EMCA 2EOYA 2BB8A 2EMBA 2YSPA 2YTOA 1B69A 1G2DC 3MHSC 1RMDA 2EMXA 1DGCA 1A1GA 1LLMC 5KL6A 2EN8A 2E72A 1MEYC 2HGHA 1BB8A 2WBSA 2RSIA 2DGCA 2EMYA 2EM9A 2EL5A 1UN6B 2ELZA 4R2EA 2EMAA 2ENHA 2EL4A 1TF6A 2LT7A 2EPAA 4IJDA 2EP3A 2R1FA 2YTPA 2GLIA 2EQ3A 2YTJA 2EE8A 2LVHA 2EL6A 1X3CA 4F6MA 4FK5C 4R2PA 2GHFA 2EN6A 2YTIA 2EMZA 2EQ1A 1A1JA 2YSOA 2EM3A 3EPKA 1A1IA 1TN9A 1TF3A 2LO3A 5KL2A 2EMHA 2EPZA 4F2JC 1A1KA 2EM6A 2LV2A 5KL4A 2EM2A 5KL3A 2D9HA 3UK3C 2YTQA 2EOHA 2EORA 1YUIA 2CTDA 1YUJA 2MKDA 1BBOA 2JPAA 2EMGA 2YRMA 2PRTA 4GZNC 1A1FA 2YTNA 2CT1A 2EN2A 2DLQA 2EM8A 1JK2A 4WSGA 2YU8A
chains in the Genus database with same CATH superfamily
2MDRA 2EPRA 1A1HA 3F6GA 3MSWA 5CFFE 2YTFA 4B3RE 4GEQB 2I13A 1J26A 1L4SA 1IQOA 2EOQA 2EPCA 2DIXA 2V89A 4BC9A 2EOSA 2YTGA 2EMWA 2EM7A 1AAYA 5LL6R 4R2QA 5LLQA 1T4LB 2YTDA 2EPKX 4L8NA 2YTEA 2RS6A 3C6KA 4DV5E 2EN4A 2RQLA 2B9DA 2DSYA 5A6JA 4R2CA 1RC7A 4DR3E 1J5EE 2DMIA 1Z1BA 1WHNA 4R2DA 2HHHE 2L92A 1FKAE 2EN7A 2EOEA 3AV0A 2WCC3 3C4TA 2EMKA 2HJJA 1HNWE 1ZU1A 1PJQA 1EH7A 2YSPA 1RMDA 2ODRC 4B3ME 1SR9A 1LLMC 1ZBQA 2VQFE 2RTXA 2WBSA 2LUPB 2EMYA 4WXDA 2EL5A 1YYWA 4Q35B 4R2EA 3AUZA 1TF6A 4JI2E 2LT7A 4IJDA 4DMIA 2V83A 3BF2A 1EKZA 2VE7C 4GKKE 2YTJA 3BIDA 4F6MA 3P1XA 2L3JA 1I94E 3HXLA 2V85A 2EN6A 4L5NC 2EQ1A 2LBSB 2JR1A 3THOB 4X65E 1A1IA 2EPMX 2EPZA 5KL3A 3UK3C 2YTQA 1YUIA 2CPNA 3C6MA 1STUA 5A2QC 2UU9E 2JPAA 4GZNC 2EN2A 4R8OA 2DLQA 3QG5C 1KJKA 3VYXA 2YRHA 4ZYGA 2EQ0A 2MC5A 2V88A 4DV2E 1GQEA 4JYAE 2KHXA 4R2RA 4KZSA 2EOXA 1X6EA 3TQMA 3EPJA 2J7JA 2EPNA 2LCEA 4OX9E 2EM5A 2EN3A 2M9AA 1IMUA 4R2AA 2EPPA 1UHZA 4X9JA 3J7Yp 3K6QA 4B3TE 2EMLA 4LF8E 4P78A 2JXPA 2FTXB 2KONA 2LTSA 3DJWA 1IBKE 2L6MA 1NCSA 4JI0E 1ZAAC 4F9AB 1XNQE 4DV1E 4X62E 2NABA 2MDGA 2YPNA 4R03A 5KL7A 4F6NA 2HC5A 1X6FA 2EOOA 4ZYEA 2DB2A 1YYOA 4OOGC 5AC5A 1G2FC 4WYQB 2EZ6A 3HPSA 2EOMA 5BR8E 1WXRA 2EMCA 5LMNE 2BBGA 3ECRA 2EMBA 2YTOA 5AC4A 1T38A 2EMXA 5KL6A 4YHHE 2LTRA 2Q8UA 2E72A 1XNRE 2I9IA 2IHR1 4Q28A 5ADZA 1T4OA 3T1HE 2ENHA 2EL4A 2RSMA 2V8QB 4MLVA 1X48A 5A6KA 1EH8A 3JTZA 2NUGA 2EE8A 4ZYHA 3T1YE 4FK5C 4WSPA 1KYQA 1RQ0A 3KZYA 4R2PA 4DV4E 2YTIA 1IBME 2UXBE 2L2MA 2L33A 4DR4E 4BCAA 2YSOA 5TSEA 4LTYA 4NXME 4NHRA 4X64E 2UXCE 2MC6A 4NXNE 4JV5E 4X66E 2EM6A 2LV2A 4J8ZA 5KL4A 1MGTA 4N4RB 3C4BA 1GZ6A 1YYKA 3HQ1A 1HR0E 1PJSA 1BBOA 2LMZA 2EMGA 2YTNA 2CT1A 2FV4B 3IWDA 2L2NA 2ODRD 4LF6E 1PDAA 1DQ3A 3L00A 2V87A 1XMQE 1X47A 5T6JA 2FGGA 2UUAE 4IS1C 4MLQA 3BGHA 2EMIA 2ENAA 5IXMB 2VRDA 2E1MA 1F2IG 4BHCA 1HNXE 2EPUA 2DRPA 2UUCE 1XMOE 1X5WA 2JP9A 3ZOQB 2F8BA 4DUZE 4DKKA 4BHBA 4HEIA 2JY9A 2LJUA 2NA2A 3MHHC 3OMLA 2CSHA 5A6AA 4YY3E 4LFCE 2EOJA 4F9BB 2G7HA 4M0VA 2R76A 4LFBE 4WPYA 4JI7E 1QNTA 2B7VA 4B3SE 3ADIA 2EN1A 5AE2A 1YZ9A 3VHTB 2A25A 1T4NA 3VK6A 4DV3E 2EOYA 2N8XA 2BB8A 1ZBTA 5LMUE 1B69A 3HTXA 2JOXA 2M4IA 1X49A 4KHPE 1A1GA 5A6BA 5A6BD 2HGHA 1MEYC 1BB8A 1WRJA 2RSIA 2DGCA 4DR1E 2EM9A 4BMJA 1O0WA 3OTOE 2YT4A 2EMAA 3EQ1A 2VF1A 2EPAA 4RHBB 2EPOA 1PKPA 2R1FA 5AASA 2YTPA 3KZZA 3KWRA 2JWOA 2EQ3A 2LVHA 1UILA 2EL6A 2VQEE 5A69A 3BBGA 4GKJE 2JVAA 4WXCA 2LUQA 4LF5E 1A1JA 2EWLA 4F9CB 1NEIA 4KWYA 1TN9A 3J80C 2EMHA 4F2JC 3ADLA 1IBLE 2GPIA 4JI1E 2LRSA 1N3GA 2EOHA 2EORA 1FJGE 2CTDA 4NZVA 3ADJA 2WZOA 2F4VE 2YRMA 2V86A 2YWQA 1BBGA 2EM8A 1JK2A 4X8WA 4WSGA 4M2ZA 2YRKA 1P47A 2JYAA 4F54A 2H36X 2N3HA 4DR2E 1EH6A 2JOBA 2MKNA 1PJTA 2YU5A 2YZTA 1ZR9A 2M7QA 1UBDC 4DV6E 2ADRA 4JI4E 1X6HA 3LLHA 4WX9A 2ENCA 4JI3E 4LF7E 3THNA 4BBYA 2L3CA 2EMFA 3VYYA 2DMYA 1YFHA 3EPHA 2NUFA 4TUGA 1HNZE 3M99B 2EM0A 5DNYA 4M9VC 4JI8E 4ZYDA 2WBUA 5FLXC 1WJPA 2M1SA 5IWAE 1QU6A 4JI5E 5AE3A 3JU0A 3EPLA 4DUYE 3HPZA 2EJ4A 2EOFA 2L8TA 2LJHA 1DI2A 4R2SA 2RPCA 2WBTA 4JI6E 4M30A 5F3WA 2EM4A 2EPXA 3J7AG 2DLKA 4HTGA 1A1LA 4O5GA 4DV0E 2ELYA 4WFTA 2N3GA 2EOIA 1JK1A 2NUEA 2EOZA 5KL5A 1YSAC 1AH5A 1N32E 1N33E 3IWCA 2B3TB 4K0KE 3J81C 4I8OA 1G2DC 1SFEA 3MHSC 1DGCA 2E5LE 4P7DA 4RH8A 4TUIA 1YPNA 2EN8A 1WHQA 4O43A 3LMLA 1UN6B 4LFAE 2ELZA 4LU9A 3H09A 2KOUA 1T39A 3JAMC 3F6HA 2UXDE 2EP3A 4DV7E 2GLIA 4DR5E 1IQSA 1N36E 1X3CA 2EPLX 4BS9A 2RS7A 4BC7A 4LF9E 2GHFA 3ADGA 2K7IA 2EMZA 3IWBA 2ZM6E 4DR6E 5IT9C 4O4KA 2EM3A 3DF6A 3EPKA 2UUBE 4LF4E 4AQYE 2LO3A 3FIGA 5KL2A 2K4VA 1TF3A 1A1KA 1GTKA 2EM2A 4O24A 4DR7E 2D9HA 5IV8B 3RMPA 1YUJA 2MKDA 2PRTA 1A1FA 2L2KB 1N34E 2B7TA 2LE2A 2YU8A 5AE1A
chains in the Genus database with same CATH topology
2YRHA 2EQ0A 2EPRA 2YRKA 1P47A 1A1HA 4R2RA 4IS1C 2EOXA 1X6EA 2YTFA 2I13A 2MKNA 2EMIA 2ENAA 2YU5A 3EPJA 2J7JA 1ZR9A 2EOQA 2VRDA 1UBDC 2EPCA 2ADRA 1X6HA 2EOSA 2LCEA 2EM5A 2EN3A 2ENCA 2M9AA 2YTGA 4R2AA 1F2IG 2EPPA 2EMWA 2EM7A 2EMFA 1AAYA 4X9JA 4R2QA 2EPUA 2DRPA 3EPHA 2EMLA 3M99B 2EM0A 2YTDA 4M9VC 2WBUA 1X5WA 1WJPA 2JP9A 2YTEA 3EPLA 2EN4A 1NCSA 2EJ4A 2EOFA 1ZAAC 3MHHC 4R2CA 2CSHA 4R2SA 1KJKA 2DMIA 2RPCA 2WBTA 1Z1BA 2NABA 2MDGA 2EM4A 2EOJA 5KL7A 2EPXA 2DLKA 4R2DA 4F6NA 1A1LA 1X6FA 2ELYA 2EOOA 2EN7A 2EOEA 2EOIA 1JK1A 2WCC3 1G2FC 2EOZA 5KL5A 2EN1A 2EMKA 1YSAC 2EOMA 3VHTB 2A25A 1ZU1A 2EMCA 2EOYA 2BB8A 2EMBA 2YSPA 2YTOA 1B69A 1G2DC 3MHSC 1RMDA 2EMXA 1DGCA 1A1GA 1LLMC 5KL6A 2EN8A 2E72A 1MEYC 2HGHA 1BB8A 2WBSA 2RSIA 2DGCA 2EMYA 2EM9A 2EL5A 1UN6B 2ELZA 4R2EA 2EMAA 2ENHA 2EL4A 1TF6A 2LT7A 2EPAA 4IJDA 2EP3A 2R1FA 2YTPA 2GLIA 2EQ3A 2YTJA 2EE8A 2LVHA 2EL6A 1X3CA 4F6MA 4FK5C 4R2PA 2GHFA 2EN6A 2YTIA 2EMZA 2EQ1A 1A1JA 2YSOA 2EM3A 3EPKA 1A1IA 1TN9A 1TF3A 2LO3A 5KL2A 2EMHA 2EPZA 4F2JC 1A1KA 2EM6A 2LV2A 5KL4A 2EM2A 5KL3A 2D9HA 3UK3C 2YTQA 2EOHA 2EORA 1YUIA 2CTDA 1YUJA 2MKDA 1BBOA 2JPAA 2EMGA 2YRMA 2PRTA 4GZNC 1A1FA 2YTNA 2CT1A 2EN2A 2DLQA 2EM8A 1JK2A 4WSGA 2YU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YRH A;  2EQ0 A;  2EPR A;  2YRK A;  1P47 A;  1A1H A;  4R2R A;  4IS1 C;  2EOX A;  1X6E A;  2YTF A;  2I13 A;  2MKN A;  2EMI A;  2ENA A;  2YU5 A;  3EPJ A;  2J7J A;  1ZR9 A;  2EOQ A;  2VRD A;  1UBD C;  2EPC A;  2ADR A;  1X6H A;  2EOS A;  2LCE A;  2EM5 A;  2EN3 A;  2ENC A;  2M9A A;  2YTG A;  4R2A A;  1F2I G;  2EPP A;  2EMW A;  2EM7 A;  2EMF A;  1AAY A;  4X9J A;  4R2Q A;  2EPU A;  2DRP A;  3EPH A;  2EML A;  3M99 B;  2EM0 A;  2YTD A;  4M9V C;  2WBU A;  1X5W A;  1WJP A;  2JP9 A;  2YTE A;  3EPL A;  2EN4 A;  1NCS A;  2EJ4 A;  2EOF A;  1ZAA C;  3MHH C;  4R2C A;  2CSH A;  4R2S A;  1KJK A;  2DMI A;  2RPC A;  2WBT A;  1Z1B A;  2NAB A;  2MDG A;  2EM4 A;  2EOJ A;  5KL7 A;  2EPX A;  2DLK A;  4R2D A;  4F6N A;  1A1L A;  1X6F A;  2ELY A;  2EOO A;  2EN7 A;  2EOE A;  2EOI A;  1JK1 A;  2WCC 3;  1G2F C;  2EOZ A;  5KL5 A;  2EN1 A;  2EMK A;  1YSA C;  2EOM A;  3VHT B;  2A25 A;  1ZU1 A;  2EMC A;  2EOY A;  2BB8 A;  2EMB A;  2YSP A;  2YTO A;  1B69 A;  1G2D C;  3MHS C;  1RMD A;  2EMX A;  1DGC A;  1A1G A;  1LLM C;  5KL6 A;  2EN8 A;  2E72 A;  1MEY C;  2HGH A;  1BB8 A;  2WBS A;  2RSI A;  2DGC A;  2EMY A;  2EM9 A;  2EL5 A;  1UN6 B;  2ELZ A;  4R2E A;  2EMA A;  2ENH A;  2EL4 A;  1TF6 A;  2LT7 A;  2EPA A;  4IJD A;  2EP3 A;  2R1F A;  2YTP A;  2GLI A;  2EQ3 A;  2YTJ A;  2EE8 A;  2LVH A;  2EL6 A;  1X3C A;  4F6M A;  4FK5 C;  4R2P A;  2GHF A;  2EN6 A;  2YTI A;  2EMZ A;  2EQ1 A;  1A1J A;  2YSO A;  2EM3 A;  3EPK A;  1A1I A;  1TN9 A;  1TF3 A;  2LO3 A;  5KL2 A;  2EMH A;  2EPZ A;  4F2J C;  1A1K A;  2EM6 A;  2LV2 A;  5KL4 A;  2EM2 A;  5KL3 A;  2D9H A;  3UK3 C;  2YTQ A;  2EOH A;  2EOR A;  1YUI A;  2CTD A;  1YUJ A;  2MKD A;  1BBO A;  2JPA A;  2EMG A;  2YRM A;  2PRT A;  4GZN C;  1A1F A;  2YTN A;  2CT1 A;  2EN2 A;  2DLQ A;  2EM8 A;  1JK2 A;  4WSG A;  2YU8 A; 
#chains in the Genus database with same CATH topology
 2MDR A;  2EPR A;  1A1H A;  3F6G A;  3MSW A;  5CFF E;  2YTF A;  4B3R E;  4GEQ B;  2I13 A;  1J26 A;  1L4S A;  1IQO A;  2EOQ A;  2EPC A;  2DIX A;  2V89 A;  4BC9 A;  2EOS A;  2YTG A;  2EMW A;  2EM7 A;  1AAY A;  5LL6 R;  4R2Q A;  5LLQ A;  1T4L B;  2YTD A;  2EPK X;  4L8N A;  2YTE A;  2RS6 A;  3C6K A;  4DV5 E;  2EN4 A;  2RQL A;  2B9D A;  2DSY A;  5A6J A;  4R2C A;  1RC7 A;  4DR3 E;  1J5E E;  2DMI A;  1Z1B A;  1WHN A;  4R2D A;  2HHH E;  2L92 A;  1FKA E;  2EN7 A;  2EOE A;  3AV0 A;  2WCC 3;  3C4T A;  2EMK A;  2HJJ A;  1HNW E;  1ZU1 A;  1PJQ A;  1EH7 A;  2YSP A;  1RMD A;  2ODR C;  4B3M E;  1SR9 A;  1LLM C;  1ZBQ A;  2VQF E;  2RTX A;  2WBS A;  2LUP B;  2EMY A;  4WXD A;  2EL5 A;  1YYW A;  4Q35 B;  4R2E A;  3AUZ A;  1TF6 A;  4JI2 E;  2LT7 A;  4IJD A;  4DMI A;  2V83 A;  3BF2 A;  1EKZ A;  2VE7 C;  4GKK E;  2YTJ A;  3BID A;  4F6M A;  3P1X A;  2L3J A;  1I94 E;  3HXL A;  2V85 A;  2EN6 A;  4L5N C;  2EQ1 A;  2LBS B;  2JR1 A;  3THO B;  4X65 E;  1A1I A;  2EPM X;  2EPZ A;  5KL3 A;  3UK3 C;  2YTQ A;  1YUI A;  2CPN A;  3C6M A;  1STU A;  5A2Q C;  2UU9 E;  2JPA A;  4GZN C;  2EN2 A;  4R8O A;  2DLQ A;  3QG5 C;  1KJK A;  3VYX A;  2YRH A;  4ZYG A;  2EQ0 A;  2MC5 A;  2V88 A;  4DV2 E;  1GQE A;  4JYA E;  2KHX A;  4R2R A;  4KZS A;  2EOX A;  1X6E A;  3TQM A;  3EPJ A;  2J7J A;  2EPN A;  2LCE A;  4OX9 E;  2EM5 A;  2EN3 A;  2M9A A;  1IMU A;  4R2A A;  2EPP A;  1UHZ A;  4X9J A;  3J7Y p;  3K6Q A;  4B3T E;  2EML A;  4LF8 E;  4P78 A;  2JXP A;  2FTX B;  2KON A;  2LTS A;  3DJW A;  1IBK E;  2L6M A;  1NCS A;  4JI0 E;  1ZAA C;  4F9A B;  1XNQ E;  4DV1 E;  4X62 E;  2NAB A;  2MDG A;  2YPN A;  4R03 A;  5KL7 A;  4F6N A;  2HC5 A;  1X6F A;  2EOO A;  4ZYE A;  2DB2 A;  1YYO A;  4OOG C;  5AC5 A;  1G2F C;  4WYQ B;  2EZ6 A;  3HPS A;  2EOM A;  5BR8 E;  1WXR A;  2EMC A;  5LMN E;  2BBG A;  3ECR A;  2EMB A;  2YTO A;  5AC4 A;  1T38 A;  2EMX A;  5KL6 A;  4YHH E;  2LTR A;  2Q8U A;  2E72 A;  1XNR E;  2I9I A;  2IHR 1;  4Q28 A;  5ADZ A;  1T4O A;  3T1H E;  2ENH A;  2EL4 A;  2RSM A;  2V8Q B;  4MLV A;  1X48 A;  5A6K A;  1EH8 A;  3JTZ A;  2NUG A;  2EE8 A;  4ZYH A;  3T1Y E;  4FK5 C;  4WSP A;  1KYQ A;  1RQ0 A;  3KZY A;  4R2P A;  4DV4 E;  2YTI A;  1IBM E;  2UXB E;  2L2M A;  2L33 A;  4DR4 E;  4BCA A;  2YSO A;  5TSE A;  4LTY A;  4NXM E;  4NHR A;  4X64 E;  2UXC E;  2MC6 A;  4NXN E;  4JV5 E;  4X66 E;  2EM6 A;  2LV2 A;  4J8Z A;  5KL4 A;  1MGT A;  4N4R B;  3C4B A;  1GZ6 A;  1YYK A;  3HQ1 A;  1HR0 E;  1PJS A;  1BBO A;  2LMZ A;  2EMG A;  2YTN A;  2CT1 A;  2FV4 B;  3IWD A;  2L2N A;  2ODR D;  4LF6 E;  1PDA A;  1DQ3 A;  3L00 A;  2V87 A;  1XMQ E;  1X47 A;  5T6J A;  2FGG A;  2UUA E;  4IS1 C;  4MLQ A;  3BGH A;  2EMI A;  2ENA A;  5IXM B;  2VRD A;  2E1M A;  1F2I G;  4BHC A;  1HNX E;  2EPU A;  2DRP A;  2UUC E;  1XMO E;  1X5W A;  2JP9 A;  3ZOQ B;  2F8B A;  4DUZ E;  4DKK A;  4BHB A;  4HEI A;  2JY9 A;  2LJU A;  2NA2 A;  3MHH C;  3OML A;  2CSH A;  5A6A A;  4YY3 E;  4LFC E;  2EOJ A;  4F9B B;  2G7H A;  4M0V A;  2R76 A;  4LFB E;  4WPY A;  4JI7 E;  1QNT A;  2B7V A;  4B3S E;  3ADI A;  2EN1 A;  5AE2 A;  1YZ9 A;  3VHT B;  2A25 A;  1T4N A;  3VK6 A;  4DV3 E;  2EOY A;  2N8X A;  2BB8 A;  1ZBT A;  5LMU E;  1B69 A;  3HTX A;  2JOX A;  2M4I A;  1X49 A;  4KHP E;  1A1G A;  5A6B A;  5A6B D;  2HGH A;  1MEY C;  1BB8 A;  1WRJ A;  2RSI A;  2DGC A;  4DR1 E;  2EM9 A;  4BMJ A;  1O0W A;  3OTO E;  2YT4 A;  2EMA A;  3EQ1 A;  2VF1 A;  2EPA A;  4RHB B;  2EPO A;  1PKP A;  2R1F A;  5AAS A;  2YTP A;  3KZZ A;  3KWR A;  2JWO A;  2EQ3 A;  2LVH A;  1UIL A;  2EL6 A;  2VQE E;  5A69 A;  3BBG A;  4GKJ E;  2JVA A;  4WXC A;  2LUQ A;  4LF5 E;  1A1J A;  2EWL A;  4F9C B;  1NEI A;  4KWY A;  1TN9 A;  3J80 C;  2EMH A;  4F2J C;  3ADL A;  1IBL E;  2GPI A;  4JI1 E;  2LRS A;  1N3G A;  2EOH A;  2EOR A;  1FJG E;  2CTD A;  4NZV A;  3ADJ A;  2WZO A;  2F4V E;  2YRM A;  2V86 A;  2YWQ A;  1BBG A;  2EM8 A;  1JK2 A;  4X8W A;  4WSG A;  4M2Z A;  2YRK A;  1P47 A;  2JYA A;  4F54 A;  2H36 X;  2N3H A;  4DR2 E;  1EH6 A;  2JOB A;  2MKN A;  1PJT A;  2YU5 A;  2YZT A;  1ZR9 A;  2M7Q A;  1UBD C;  4DV6 E;  2ADR A;  4JI4 E;  1X6H A;  3LLH A;  4WX9 A;  2ENC A;  4JI3 E;  4LF7 E;  3THN A;  4BBY A;  2L3C A;  2EMF A;  3VYY A;  2DMY A;  1YFH A;  3EPH A;  2NUF A;  4TUG A;  1HNZ E;  3M99 B;  2EM0 A;  5DNY A;  4M9V C;  4JI8 E;  4ZYD A;  2WBU A;  5FLX C;  1WJP A;  2M1S A;  5IWA E;  1QU6 A;  4JI5 E;  5AE3 A;  3JU0 A;  3EPL A;  4DUY E;  3HPZ A;  2EJ4 A;  2EOF A;  2L8T A;  2LJH A;  1DI2 A;  4R2S A;  2RPC A;  2WBT A;  4JI6 E;  4M30 A;  5F3W A;  2EM4 A;  2EPX A;  3J7A G;  2DLK A;  4HTG A;  1A1L A;  4O5G A;  4DV0 E;  2ELY A;  4WFT A;  2N3G A;  2EOI A;  1JK1 A;  2NUE A;  2EOZ A;  5KL5 A;  1YSA C;  1AH5 A;  1N32 E;  1N33 E;  3IWC A;  2B3T B;  4K0K E;  3J81 C;  4I8O A;  1G2D C;  1SFE A;  3MHS C;  1DGC A;  2E5L E;  4P7D A;  4RH8 A;  4TUI A;  1YPN A;  2EN8 A;  1WHQ A;  4O43 A;  3LML A;  1UN6 B;  4LFA E;  2ELZ A;  4LU9 A;  3H09 A;  2KOU A;  1T39 A;  3JAM C;  3F6H A;  2UXD E;  2EP3 A;  4DV7 E;  2GLI A;  4DR5 E;  1IQS A;  1N36 E;  1X3C A;  2EPL X;  4BS9 A;  2RS7 A;  4BC7 A;  4LF9 E;  2GHF A;  3ADG A;  2K7I A;  2EMZ A;  3IWB A;  2ZM6 E;  4DR6 E;  5IT9 C;  4O4K A;  2EM3 A;  3DF6 A;  3EPK A;  2UUB E;  4LF4 E;  4AQY E;  2LO3 A;  3FIG A;  5KL2 A;  2K4V A;  1TF3 A;  1A1K A;  1GTK A;  2EM2 A;  4O24 A;  4DR7 E;  2D9H A;  5IV8 B;  3RMP A;  1YUJ A;  2MKD A;  2PRT A;  1A1F A;  2L2K B;  1N34 E;  2B7T A;  2LE2 A;  2YU8 A;  5AE1 A; 
#chains in the Genus database with same CATH homology
 2YRH A;  2EQ0 A;  2EPR A;  2YRK A;  1P47 A;  1A1H A;  4R2R A;  4IS1 C;  2EOX A;  1X6E A;  2YTF A;  2I13 A;  2MKN A;  2EMI A;  2ENA A;  2YU5 A;  3EPJ A;  2J7J A;  1ZR9 A;  2EOQ A;  2VRD A;  1UBD C;  2EPC A;  2ADR A;  1X6H A;  2EOS A;  2LCE A;  2EM5 A;  2EN3 A;  2ENC A;  2M9A A;  2YTG A;  4R2A A;  1F2I G;  2EPP A;  2EMW A;  2EM7 A;  2EMF A;  1AAY A;  4X9J A;  4R2Q A;  2EPU A;  2DRP A;  3EPH A;  2EML A;  3M99 B;  2EM0 A;  2YTD A;  4M9V C;  2WBU A;  1X5W A;  1WJP A;  2JP9 A;  2YTE A;  3EPL A;  2EN4 A;  1NCS A;  2EJ4 A;  2EOF A;  1ZAA C;  3MHH C;  4R2C A;  2CSH A;  4R2S A;  1KJK A;  2DMI A;  2RPC A;  2WBT A;  1Z1B A;  2NAB A;  2MDG A;  2EM4 A;  2EOJ A;  5KL7 A;  2EPX A;  2DLK A;  4R2D A;  4F6N A;  1A1L A;  1X6F A;  2ELY A;  2EOO A;  2EN7 A;  2EOE A;  2EOI A;  1JK1 A;  2WCC 3;  1G2F C;  2EOZ A;  5KL5 A;  2EN1 A;  2EMK A;  1YSA C;  2EOM A;  3VHT B;  2A25 A;  1ZU1 A;  2EMC A;  2EOY A;  2BB8 A;  2EMB A;  2YSP A;  2YTO A;  1B69 A;  1G2D C;  3MHS C;  1RMD A;  2EMX A;  1DGC A;  1A1G A;  1LLM C;  5KL6 A;  2EN8 A;  2E72 A;  1MEY C;  2HGH A;  1BB8 A;  2WBS A;  2RSI A;  2DGC A;  2EMY A;  2EM9 A;  2EL5 A;  1UN6 B;  2ELZ A;  4R2E A;  2EMA A;  2ENH A;  2EL4 A;  1TF6 A;  2LT7 A;  2EPA A;  4IJD A;  2EP3 A;  2R1F A;  2YTP A;  2GLI A;  2EQ3 A;  2YTJ A;  2EE8 A;  2LVH A;  2EL6 A;  1X3C A;  4F6M A;  4FK5 C;  4R2P A;  2GHF A;  2EN6 A;  2YTI A;  2EMZ A;  2EQ1 A;  1A1J A;  2YSO A;  2EM3 A;  3EPK A;  1A1I A;  1TN9 A;  1TF3 A;  2LO3 A;  5KL2 A;  2EMH A;  2EPZ A;  4F2J C;  1A1K A;  2EM6 A;  2LV2 A;  5KL4 A;  2EM2 A;  5KL3 A;  2D9H A;  3UK3 C;  2YTQ A;  2EOH A;  2EOR A;  1YUI A;  2CTD A;  1YUJ A;  2MKD A;  1BBO A;  2JPA A;  2EMG A;  2YRM A;  2PRT A;  4GZN C;  1A1F A;  2YTN A;  2CT1 A;  2EN2 A;  2DLQ A;  2EM8 A;  1JK2 A;  4WSG A;  2YU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...