2CTDA

Solution structure of two zf-c2h2 domains from human zinc finger protein 512
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
96
structure length
96
Chain Sequence
GSSGSSGRIRKEPPVYAAGSLEEQWYLEIVDKGSVSCPTCQAVGRKTIEGLKKHMENCKQEMFTCHHCGKQLRSLAGMKYHVMANHNSLPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Zinc finger protein 512
publication title Solution structure of two zf-C2H2 domains from human Zinc finger protein 512
rcsb
source organism Homo sapiens
total genus 13
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2005-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ctdA00
4WSGA 1LLMC 2M9AA 2MDGA 1UN6B 2EOFA 4R2DA 1UBDC 2EL5A 2EQ1A 2I13A 2EMLA 2YTPA 2EN2A 2YRMA 4R2QA 2RPCA 4F6MA 2LO3A 2DMIA 2EOSA 2EOZA 2GHFA 1A1FA 4R2PA 2EOQA 2DGCA 2EPPA 5KL4A 4FK5C 2EOOA 2EM6A 4R2EA 2E72A 2EL4A 2ELZA 2ENCA 2YU5A 2EMZA 2EN8A 1WJPA 1X6EA 2DLQA 2YTOA 1B69A 1AAYA 2EOIA 3UK3C 2NABA 2JP9A 1G2FC 2YTDA 2EM7A 1A1JA 1ZR9A 2EOJA 1Z1BA 2EN4A 5KL5A 2RSIA 2ENAA 2EJ4A 2EOXA 2YSOA 2LT7A 2YTQA 3MHSC 2YTGA 2EMIA 2WCC3 2EORA 2EN1A 2EMGA 3M99B 2VRDA 3VHTB 5KL6A 2EE8A 1A1GA 2YTJA 5KL2A 4F6NA 1TN9A 1YUJA 2CTDA 2LV2A 2YSPA 4R2CA 2MKNA 2YTFA 1ZAAC 4X9JA 2EM4A 2EMKA 2PRTA 2EMAA 2CT1A 4F2JC 1G2DC 1MEYC 2JPAA 1A1HA 2GLIA 2EMYA 2EMXA 2EMFA 1X3CA 2EN6A 2LCEA 2BB8A 2R1FA 2YTNA 2EM3A 2EMBA 1YUIA 3EPJA 4GZNC 2MKDA 1X6FA 2EPZA 1X5WA 2EPCA 1RMDA 2EMWA 2EP3A 4R2RA 4R2AA 1JK1A 1TF3A 2EMHA 1X6HA 1NCSA 1ZU1A 3MHHC 2YTIA 1P47A 2EM9A 2WBUA 2EMCA 2YTEA 2HGHA 4IJDA 5KL7A 5KL3A 2J7JA 4R2SA 2EM8A 2EM2A 4IS1C 1A1LA 2EOMA 1BB8A 2YU8A 2ADRA 3EPLA 2YRKA 1KJKA 2EQ3A 2EPUA 1A1KA 2EOHA 2WBSA 4M9VC 2EQ0A 2ENHA 2A25A 2EN3A 1JK2A 2EM5A 2YRHA 3EPKA 2EN7A 2DRPA 3EPHA 1A1IA 2EPAA 2CSHA 2LVHA 1BBOA 2DLKA 2EL6A 1DGCA 2EOEA 2WBTA 2EPRA 2EOYA 2EM0A 1F2IG 1YSAC 1TF6A 2D9HA 2EPXA 2ELYA
chains in the Genus database with same CATH superfamily
4M30A 2M9AA 2MDGA 2EL5A 2EMLA 2YTPA 2EN2A 4BS9A 2RPCA 3IWCA 2L3JA 5CFFE 4O24A 4DR2E 1A1FA 2B7VA 4R2PA 2KHXA 4WXDA 4FK5C 4NXNE 3VK6A 2IHR1 3J80C 1EH8A 1UILA 4OOGC 5ADZA 4DR5E 2EWLA 3THOB 2YTOA 1AAYA 4HEIA 4WFTA 2JP9A 5DNYA 4JI7E 3JU0A 5A6BD 1Z1BA 1T38A 2EN4A 3F6GA 2EJ4A 2LT7A 3BBGA 3BIDA 3MHSC 5LMNE 2EORA 2CPNA 4LFBE 3ADJA 2NUGA 2LBSB 1YUJA 2N8XA 2R76A 4BC9A 4BMJA 1PJQA 4X9JA 3T1YE 2EMAA 2LUPB 1GTKA 2JPAA 2GLIA 2EMYA 2FTXB 1WXRA 4WPYA 2R1FA 2Q8UA 1J26A 2EPKX 2JWOA 4DV1E 4DV4E 1X5WA 2EPCA 1L4SA 1DQ3A 1IQSA 4R2RA 1TF3A 1NCSA 2EPNA 1HNZE 3MHHC 1FJGE 2YTEA 3HXLA 2M7QA 4IJDA 3IWDA 3C6MA 1GQEA 3IWBA 2YU8A 3ADIA 1N3GA 2ADRA 4F9CB 2HJJA 2RSMA 4LFCE 2UXDE 2EPUA 2MDRA 2WBSA 1PDAA 1YYOA 4NHRA 1T4NA 1JK2A 4JI5E 4DV5E 4YY3E 2CSHA 5IXMB 2KONA 2DSYA 1T39A 3DJWA 2EM0A 1XMQE 3QG5C 4DUYE 4X62E 2EPXA 1IBME 3KZYA 2EPLX 2I9IA 2L2MA 2L2KB 3HPZA 4R2DA 2G7HA 1WHNA 2JY9A 2JXPA 5AC4A 5BR8E 4R2QA 4AQYE 2FV4B 4Q28A 4JI6E 4LF8E 4ZYHA 1RC7A 4I8OA 2L33A 4O5GA 1HR0E 2EL4A 5A2QC 2YU5A 1GZ6A 3DF6A 2N3HA 1WJPA 3L00A 1B69A 5LMUE 3UK3C 2RS6A 3EQ1A 5AASA 5AC5A 4RHBB 2YTDA 2EM7A 1HNWE 1J5EE 2EOXA 1WRJA 5IV8B 1X48A 4HTGA 2YTQA 2F8BA 4P78A 2JOXA 4BHCA 4K0KE 5FLXC 4JV5E 3VHTB 4KHPE 1A1GA 4M2ZA 4R2CA 2UU9E 2EM4A 5A6KA 4F2JC 3KZZA 4JI1E 1MEYC 4B3TE 2JR1A 2L3CA 2LCEA 4ZYGA 1X49A 2BB8A 2ZM6E 4DV3E 2YTNA 1YUIA 2L8TA 2EPZA 2VE7C 4LF6E 3ECRA 1STUA 5AE3A 2EMWA 2EP3A 4R2AA 3LMLA 4B3ME 2EMHA 1X6HA 3C4TA 2YTIA 1P47A 1X47A 1QNTA 1EH6A 4JI3E 1T4OA 2E1MA 5KL3A 1KYQA 2EOMA 4GKJE 1BBGA 3AUZA 4KWYA 3FIGA 4L8NA 4LFAE 4MLVA 1EH7A 1IBLE 2FGGA 2EQ0A 2ENHA 3LLHA 4NXME 2A25A 3P1XA 3KWRA 2EM5A 2EN7A 1HNXE 3EPHA 1A1IA 4X66E 2LVHA 2DLKA 1DGCA 2ODRD 1F2IG 1YSAC 2UXCE 2D9HA 2DMYA 2NA2A 2L2NA 1UN6B 1UBDC 5LLQA 2EQ1A 3J7AG 2L92A 2I13A 5T6JA 2M4IA 2H36X 3JAMC 2GPIA 4F6MA 3H09A 2EOSA 1YPNA 4L5NC 2GHFA 2EOQA 3ZOQB 5KL4A 2V86A 4X65E 2JOBA 4ZYDA 3BF2A 1XMOE 4B3RE 2E72A 3BGHA 4YHHE 1UHZA 2EMZA 2LTSA 4TUIA 3OTOE 2EPMX 2JVAA 4O4KA 3HQ1A 4OX9E 1ZR9A 2K7IA 5KL5A 1IQOA 2RSIA 2V89A 2MC5A 3RMPA 2YSOA 2VQEE 1N34E 3THNA 2V8QB 2EMIA 2WCC3 2EMGA 2WZOA 2VRDA 1PJSA 1SFEA 5KL2A 1TN9A 4X64E 4DV7E 4F54A 2YSPA 2V83A 2YTFA 2PRTA 2B3TB 3ADLA 2CT1A 4DV6E 4DV2E 1N33E 4O43A 4JI2E 2B9DA 1A1HA 1I94E 2EMXA 4BHBA 5IT9C 2LJHA 2RTXA 1PKPA 3VYXA 5IWAE 2VF1A 2EMBA 1EKZA 4GZNC 1X6FA 4JYAE 1RMDA 1XNQE 2YZTA 1ZU1A 2ODRC 2WBUA 4DR6E 2L6MA 4LF9E 2EMCA 2MC6A 5KL7A 4LTYA 1YYWA 3C6KA 2J7JA 4R8OA 4R2SA 4DR3E 2EM2A 1IBKE 4IS1C 1A1LA 2YT4A 4F9BB 1QU6A 3J7Yp 3EPLA 1T4LB 2M1SA 2YRKA 2HC5A 5F3WA 4R03A 4WX9A 3VYYA 2UUAE 2EQ3A 2E5LE 1A1KA 3JTZA 3K6QA 1WHQA 2B7TA 2V88A 4Q35B 2EN3A 4LF5E 4BCAA 3EPKA 2DRPA 4LF7E 2EPAA 2EL6A 2EPRA 1RQ0A 4WSPA 5LL6R 4DR4E 2ELYA 4WSGA 1LLMC 2EOFA 4DV0E 5A6AA 2YRMA 4DKKA 2LO3A 2DMIA 2EOZA 1FKAE 2EZ6A 2DGCA 2EPPA 2UUBE 4M0VA 2EOOA 2LJUA 3C4BA 3F6HA 2EM6A 4R2EA 4WYQB 4GEQB 2ELZA 2ENCA 1IMUA 2EN8A 1X6EA 2DLQA 2EOIA 2JYAA 2NABA 1MGTA 1G2FC 1A1JA 2EOJA 3AV0A 3T1HE 2UXBE 2ENAA 1DI2A 4B3SE 4DR1E 3MSWA 4KZSA 4NZVA 2YTGA 2EN1A 3M99B 5KL6A 1N36E 2EPOA 2EE8A 2YTJA 3ADGA 4F6NA 2V85A 2LUQA 2CTDA 2LV2A 4DUZE 2MKNA 4N4RB 1ZAAC 2EMKA 1G2DC 3TQMA 2DIXA 4JI4E 2EMFA 1X3CA 2EN6A 2KOUA 4DMIA 2UUCE 4DR7E 2RQLA 4LF4E 4RH8A 2BBGA 2EM3A 1YFHA 3EPJA 2MKDA 5A6BA 2NUEA 2N3GA 5A6JA 1YZ9A 2F4VE 1AH5A 1JK1A 1NEIA 4ZYEA 1ZBTA 2V87A 3HTXA 2EM9A 4F9AB 4WXCA 4TUGA 2HGHA 1YYKA 2LE2A 2LRSA 2EM8A 5TSEA 1BB8A 2NUFA 2LMZA 1ZBQA 4BC7A 1O0WA 2K4VA 2YWQA 4JI0E 4X8WA 1N32E 1KJKA 2EOHA 3OMLA 4P7DA 4M9VC 4GKKE 4JI8E 2LTRA 2HHHE 2DB2A 2YRHA 3J81C 2YPNA 5AE1A 1XNRE 3HPSA 1BBOA 2VQFE 1SR9A 2EOEA 2WBTA 4J8ZA 2EOYA 5A69A 1PJTA 2RS7A 4MLQA 4BBYA 5AE2A 1TF6A 4LU9A
chains in the Genus database with same CATH topology
4WSGA 1LLMC 2M9AA 2MDGA 1UN6B 2EOFA 4R2DA 1UBDC 2EL5A 2EQ1A 2I13A 2EMLA 2YTPA 2EN2A 2YRMA 4R2QA 2RPCA 4F6MA 2LO3A 2DMIA 2EOSA 2EOZA 2GHFA 1A1FA 4R2PA 2EOQA 2DGCA 2EPPA 5KL4A 4FK5C 2EOOA 2EM6A 4R2EA 2E72A 2EL4A 2ELZA 2ENCA 2YU5A 2EMZA 2EN8A 1WJPA 1X6EA 2DLQA 2YTOA 1B69A 1AAYA 2EOIA 3UK3C 2NABA 2JP9A 1G2FC 2YTDA 2EM7A 1A1JA 1ZR9A 2EOJA 1Z1BA 2EN4A 5KL5A 2RSIA 2ENAA 2EJ4A 2EOXA 2YSOA 2LT7A 2YTQA 3MHSC 2YTGA 2EMIA 2WCC3 2EORA 2EN1A 2EMGA 3M99B 2VRDA 3VHTB 5KL6A 2EE8A 1A1GA 2YTJA 5KL2A 4F6NA 1TN9A 1YUJA 2CTDA 2LV2A 2YSPA 4R2CA 2MKNA 2YTFA 1ZAAC 4X9JA 2EM4A 2EMKA 2PRTA 2EMAA 2CT1A 4F2JC 1G2DC 1MEYC 2JPAA 1A1HA 2GLIA 2EMYA 2EMXA 2EMFA 1X3CA 2EN6A 2LCEA 2BB8A 2R1FA 2YTNA 2EM3A 2EMBA 1YUIA 3EPJA 4GZNC 2MKDA 1X6FA 2EPZA 1X5WA 2EPCA 1RMDA 2EMWA 2EP3A 4R2RA 4R2AA 1JK1A 1TF3A 2EMHA 1X6HA 1NCSA 1ZU1A 3MHHC 2YTIA 1P47A 2EM9A 2WBUA 2EMCA 2YTEA 2HGHA 4IJDA 5KL7A 5KL3A 2J7JA 4R2SA 2EM8A 2EM2A 4IS1C 1A1LA 2EOMA 1BB8A 2YU8A 2ADRA 3EPLA 2YRKA 1KJKA 2EQ3A 2EPUA 1A1KA 2EOHA 2WBSA 4M9VC 2EQ0A 2ENHA 2A25A 2EN3A 1JK2A 2EM5A 2YRHA 3EPKA 2EN7A 2DRPA 3EPHA 1A1IA 2EPAA 2CSHA 2LVHA 1BBOA 2DLKA 2EL6A 1DGCA 2EOEA 2WBTA 2EPRA 2EOYA 2EM0A 1F2IG 1YSAC 1TF6A 2D9HA 2EPXA 2ELYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WSG A;  1LLM C;  2M9A A;  2MDG A;  1UN6 B;  2EOF A;  4R2D A;  1UBD C;  2EL5 A;  2EQ1 A;  2I13 A;  2EML A;  2YTP A;  2EN2 A;  2YRM A;  4R2Q A;  2RPC A;  4F6M A;  2LO3 A;  2DMI A;  2EOS A;  2EOZ A;  2GHF A;  1A1F A;  4R2P A;  2EOQ A;  2DGC A;  2EPP A;  5KL4 A;  4FK5 C;  2EOO A;  2EM6 A;  4R2E A;  2E72 A;  2EL4 A;  2ELZ A;  2ENC A;  2YU5 A;  2EMZ A;  2EN8 A;  1WJP A;  1X6E A;  2DLQ A;  2YTO A;  1B69 A;  1AAY A;  2EOI A;  3UK3 C;  2NAB A;  2JP9 A;  1G2F C;  2YTD A;  2EM7 A;  1A1J A;  1ZR9 A;  2EOJ A;  1Z1B A;  2EN4 A;  5KL5 A;  2RSI A;  2ENA A;  2EJ4 A;  2EOX A;  2YSO A;  2LT7 A;  2YTQ A;  3MHS C;  2YTG A;  2EMI A;  2WCC 3;  2EOR A;  2EN1 A;  2EMG A;  3M99 B;  2VRD A;  3VHT B;  5KL6 A;  2EE8 A;  1A1G A;  2YTJ A;  5KL2 A;  4F6N A;  1TN9 A;  1YUJ A;  2CTD A;  2LV2 A;  2YSP A;  4R2C A;  2MKN A;  2YTF A;  1ZAA C;  4X9J A;  2EM4 A;  2EMK A;  2PRT A;  2EMA A;  2CT1 A;  4F2J C;  1G2D C;  1MEY C;  2JPA A;  1A1H A;  2GLI A;  2EMY A;  2EMX A;  2EMF A;  1X3C A;  2EN6 A;  2LCE A;  2BB8 A;  2R1F A;  2YTN A;  2EM3 A;  2EMB A;  1YUI A;  3EPJ A;  4GZN C;  2MKD A;  1X6F A;  2EPZ A;  1X5W A;  2EPC A;  1RMD A;  2EMW A;  2EP3 A;  4R2R A;  4R2A A;  1JK1 A;  1TF3 A;  2EMH A;  1X6H A;  1NCS A;  1ZU1 A;  3MHH C;  2YTI A;  1P47 A;  2EM9 A;  2WBU A;  2EMC A;  2YTE A;  2HGH A;  4IJD A;  5KL7 A;  5KL3 A;  2J7J A;  4R2S A;  2EM8 A;  2EM2 A;  4IS1 C;  1A1L A;  2EOM A;  1BB8 A;  2YU8 A;  2ADR A;  3EPL A;  2YRK A;  1KJK A;  2EQ3 A;  2EPU A;  1A1K A;  2EOH A;  2WBS A;  4M9V C;  2EQ0 A;  2ENH A;  2A25 A;  2EN3 A;  1JK2 A;  2EM5 A;  2YRH A;  3EPK A;  2EN7 A;  2DRP A;  3EPH A;  1A1I A;  2EPA A;  2CSH A;  2LVH A;  1BBO A;  2DLK A;  2EL6 A;  1DGC A;  2EOE A;  2WBT A;  2EPR A;  2EOY A;  2EM0 A;  1F2I G;  1YSA C;  1TF6 A;  2D9H A;  2EPX A;  2ELY A; 
#chains in the Genus database with same CATH topology
 4M30 A;  2M9A A;  2MDG A;  2EL5 A;  2EML A;  2YTP A;  2EN2 A;  4BS9 A;  2RPC A;  3IWC A;  2L3J A;  5CFF E;  4O24 A;  4DR2 E;  1A1F A;  2B7V A;  4R2P A;  2KHX A;  4WXD A;  4FK5 C;  4NXN E;  3VK6 A;  2IHR 1;  3J80 C;  1EH8 A;  1UIL A;  4OOG C;  5ADZ A;  4DR5 E;  2EWL A;  3THO B;  2YTO A;  1AAY A;  4HEI A;  4WFT A;  2JP9 A;  5DNY A;  4JI7 E;  3JU0 A;  5A6B D;  1Z1B A;  1T38 A;  2EN4 A;  3F6G A;  2EJ4 A;  2LT7 A;  3BBG A;  3BID A;  3MHS C;  5LMN E;  2EOR A;  2CPN A;  4LFB E;  3ADJ A;  2NUG A;  2LBS B;  1YUJ A;  2N8X A;  2R76 A;  4BC9 A;  4BMJ A;  1PJQ A;  4X9J A;  3T1Y E;  2EMA A;  2LUP B;  1GTK A;  2JPA A;  2GLI A;  2EMY A;  2FTX B;  1WXR A;  4WPY A;  2R1F A;  2Q8U A;  1J26 A;  2EPK X;  2JWO A;  4DV1 E;  4DV4 E;  1X5W A;  2EPC A;  1L4S A;  1DQ3 A;  1IQS A;  4R2R A;  1TF3 A;  1NCS A;  2EPN A;  1HNZ E;  3MHH C;  1FJG E;  2YTE A;  3HXL A;  2M7Q A;  4IJD A;  3IWD A;  3C6M A;  1GQE A;  3IWB A;  2YU8 A;  3ADI A;  1N3G A;  2ADR A;  4F9C B;  2HJJ A;  2RSM A;  4LFC E;  2UXD E;  2EPU A;  2MDR A;  2WBS A;  1PDA A;  1YYO A;  4NHR A;  1T4N A;  1JK2 A;  4JI5 E;  4DV5 E;  4YY3 E;  2CSH A;  5IXM B;  2KON A;  2DSY A;  1T39 A;  3DJW A;  2EM0 A;  1XMQ E;  3QG5 C;  4DUY E;  4X62 E;  2EPX A;  1IBM E;  3KZY A;  2EPL X;  2I9I A;  2L2M A;  2L2K B;  3HPZ A;  4R2D A;  2G7H A;  1WHN A;  2JY9 A;  2JXP A;  5AC4 A;  5BR8 E;  4R2Q A;  4AQY E;  2FV4 B;  4Q28 A;  4JI6 E;  4LF8 E;  4ZYH A;  1RC7 A;  4I8O A;  2L33 A;  4O5G A;  1HR0 E;  2EL4 A;  5A2Q C;  2YU5 A;  1GZ6 A;  3DF6 A;  2N3H A;  1WJP A;  3L00 A;  1B69 A;  5LMU E;  3UK3 C;  2RS6 A;  3EQ1 A;  5AAS A;  5AC5 A;  4RHB B;  2YTD A;  2EM7 A;  1HNW E;  1J5E E;  2EOX A;  1WRJ A;  5IV8 B;  1X48 A;  4HTG A;  2YTQ A;  2F8B A;  4P78 A;  2JOX A;  4BHC A;  4K0K E;  5FLX C;  4JV5 E;  3VHT B;  4KHP E;  1A1G A;  4M2Z A;  4R2C A;  2UU9 E;  2EM4 A;  5A6K A;  4F2J C;  3KZZ A;  4JI1 E;  1MEY C;  4B3T E;  2JR1 A;  2L3C A;  2LCE A;  4ZYG A;  1X49 A;  2BB8 A;  2ZM6 E;  4DV3 E;  2YTN A;  1YUI A;  2L8T A;  2EPZ A;  2VE7 C;  4LF6 E;  3ECR A;  1STU A;  5AE3 A;  2EMW A;  2EP3 A;  4R2A A;  3LML A;  4B3M E;  2EMH A;  1X6H A;  3C4T A;  2YTI A;  1P47 A;  1X47 A;  1QNT A;  1EH6 A;  4JI3 E;  1T4O A;  2E1M A;  5KL3 A;  1KYQ A;  2EOM A;  4GKJ E;  1BBG A;  3AUZ A;  4KWY A;  3FIG A;  4L8N A;  4LFA E;  4MLV A;  1EH7 A;  1IBL E;  2FGG A;  2EQ0 A;  2ENH A;  3LLH A;  4NXM E;  2A25 A;  3P1X A;  3KWR A;  2EM5 A;  2EN7 A;  1HNX E;  3EPH A;  1A1I A;  4X66 E;  2LVH A;  2DLK A;  1DGC A;  2ODR D;  1F2I G;  1YSA C;  2UXC E;  2D9H A;  2DMY A;  2NA2 A;  2L2N A;  1UN6 B;  1UBD C;  5LLQ A;  2EQ1 A;  3J7A G;  2L92 A;  2I13 A;  5T6J A;  2M4I A;  2H36 X;  3JAM C;  2GPI A;  4F6M A;  3H09 A;  2EOS A;  1YPN A;  4L5N C;  2GHF A;  2EOQ A;  3ZOQ B;  5KL4 A;  2V86 A;  4X65 E;  2JOB A;  4ZYD A;  3BF2 A;  1XMO E;  4B3R E;  2E72 A;  3BGH A;  4YHH E;  1UHZ A;  2EMZ A;  2LTS A;  4TUI A;  3OTO E;  2EPM X;  2JVA A;  4O4K A;  3HQ1 A;  4OX9 E;  1ZR9 A;  2K7I A;  5KL5 A;  1IQO A;  2RSI A;  2V89 A;  2MC5 A;  3RMP A;  2YSO A;  2VQE E;  1N34 E;  3THN A;  2V8Q B;  2EMI A;  2WCC 3;  2EMG A;  2WZO A;  2VRD A;  1PJS A;  1SFE A;  5KL2 A;  1TN9 A;  4X64 E;  4DV7 E;  4F54 A;  2YSP A;  2V83 A;  2YTF A;  2PRT A;  2B3T B;  3ADL A;  2CT1 A;  4DV6 E;  4DV2 E;  1N33 E;  4O43 A;  4JI2 E;  2B9D A;  1A1H A;  1I94 E;  2EMX A;  4BHB A;  5IT9 C;  2LJH A;  2RTX A;  1PKP A;  3VYX A;  5IWA E;  2VF1 A;  2EMB A;  1EKZ A;  4GZN C;  1X6F A;  4JYA E;  1RMD A;  1XNQ E;  2YZT A;  1ZU1 A;  2ODR C;  2WBU A;  4DR6 E;  2L6M A;  4LF9 E;  2EMC A;  2MC6 A;  5KL7 A;  4LTY A;  1YYW A;  3C6K A;  2J7J A;  4R8O A;  4R2S A;  4DR3 E;  2EM2 A;  1IBK E;  4IS1 C;  1A1L A;  2YT4 A;  4F9B B;  1QU6 A;  3J7Y p;  3EPL A;  1T4L B;  2M1S A;  2YRK A;  2HC5 A;  5F3W A;  4R03 A;  4WX9 A;  3VYY A;  2UUA E;  2EQ3 A;  2E5L E;  1A1K A;  3JTZ A;  3K6Q A;  1WHQ A;  2B7T A;  2V88 A;  4Q35 B;  2EN3 A;  4LF5 E;  4BCA A;  3EPK A;  2DRP A;  4LF7 E;  2EPA A;  2EL6 A;  2EPR A;  1RQ0 A;  4WSP A;  5LL6 R;  4DR4 E;  2ELY A;  4WSG A;  1LLM C;  2EOF A;  4DV0 E;  5A6A A;  2YRM A;  4DKK A;  2LO3 A;  2DMI A;  2EOZ A;  1FKA E;  2EZ6 A;  2DGC A;  2EPP A;  2UUB E;  4M0V A;  2EOO A;  2LJU A;  3C4B A;  3F6H A;  2EM6 A;  4R2E A;  4WYQ B;  4GEQ B;  2ELZ A;  2ENC A;  1IMU A;  2EN8 A;  1X6E A;  2DLQ A;  2EOI A;  2JYA A;  2NAB A;  1MGT A;  1G2F C;  1A1J A;  2EOJ A;  3AV0 A;  3T1H E;  2UXB E;  2ENA A;  1DI2 A;  4B3S E;  4DR1 E;  3MSW A;  4KZS A;  4NZV A;  2YTG A;  2EN1 A;  3M99 B;  5KL6 A;  1N36 E;  2EPO A;  2EE8 A;  2YTJ A;  3ADG A;  4F6N A;  2V85 A;  2LUQ A;  2CTD A;  2LV2 A;  4DUZ E;  2MKN A;  4N4R B;  1ZAA C;  2EMK A;  1G2D C;  3TQM A;  2DIX A;  4JI4 E;  2EMF A;  1X3C A;  2EN6 A;  2KOU A;  4DMI A;  2UUC E;  4DR7 E;  2RQL A;  4LF4 E;  4RH8 A;  2BBG A;  2EM3 A;  1YFH A;  3EPJ A;  2MKD A;  5A6B A;  2NUE A;  2N3G A;  5A6J A;  1YZ9 A;  2F4V E;  1AH5 A;  1JK1 A;  1NEI A;  4ZYE A;  1ZBT A;  2V87 A;  3HTX A;  2EM9 A;  4F9A B;  4WXC A;  4TUG A;  2HGH A;  1YYK A;  2LE2 A;  2LRS A;  2EM8 A;  5TSE A;  1BB8 A;  2NUF A;  2LMZ A;  1ZBQ A;  4BC7 A;  1O0W A;  2K4V A;  2YWQ A;  4JI0 E;  4X8W A;  1N32 E;  1KJK A;  2EOH A;  3OML A;  4P7D A;  4M9V C;  4GKK E;  4JI8 E;  2LTR A;  2HHH E;  2DB2 A;  2YRH A;  3J81 C;  2YPN A;  5AE1 A;  1XNR E;  3HPS A;  1BBO A;  2VQF E;  1SR9 A;  2EOE A;  2WBT A;  4J8Z A;  2EOY A;  5A69 A;  1PJT A;  2RS7 A;  4MLQ A;  4BBY A;  5AE2 A;  1TF6 A;  4LU9 A; 
#chains in the Genus database with same CATH homology
 4WSG A;  1LLM C;  2M9A A;  2MDG A;  1UN6 B;  2EOF A;  4R2D A;  1UBD C;  2EL5 A;  2EQ1 A;  2I13 A;  2EML A;  2YTP A;  2EN2 A;  2YRM A;  4R2Q A;  2RPC A;  4F6M A;  2LO3 A;  2DMI A;  2EOS A;  2EOZ A;  2GHF A;  1A1F A;  4R2P A;  2EOQ A;  2DGC A;  2EPP A;  5KL4 A;  4FK5 C;  2EOO A;  2EM6 A;  4R2E A;  2E72 A;  2EL4 A;  2ELZ A;  2ENC A;  2YU5 A;  2EMZ A;  2EN8 A;  1WJP A;  1X6E A;  2DLQ A;  2YTO A;  1B69 A;  1AAY A;  2EOI A;  3UK3 C;  2NAB A;  2JP9 A;  1G2F C;  2YTD A;  2EM7 A;  1A1J A;  1ZR9 A;  2EOJ A;  1Z1B A;  2EN4 A;  5KL5 A;  2RSI A;  2ENA A;  2EJ4 A;  2EOX A;  2YSO A;  2LT7 A;  2YTQ A;  3MHS C;  2YTG A;  2EMI A;  2WCC 3;  2EOR A;  2EN1 A;  2EMG A;  3M99 B;  2VRD A;  3VHT B;  5KL6 A;  2EE8 A;  1A1G A;  2YTJ A;  5KL2 A;  4F6N A;  1TN9 A;  1YUJ A;  2CTD A;  2LV2 A;  2YSP A;  4R2C A;  2MKN A;  2YTF A;  1ZAA C;  4X9J A;  2EM4 A;  2EMK A;  2PRT A;  2EMA A;  2CT1 A;  4F2J C;  1G2D C;  1MEY C;  2JPA A;  1A1H A;  2GLI A;  2EMY A;  2EMX A;  2EMF A;  1X3C A;  2EN6 A;  2LCE A;  2BB8 A;  2R1F A;  2YTN A;  2EM3 A;  2EMB A;  1YUI A;  3EPJ A;  4GZN C;  2MKD A;  1X6F A;  2EPZ A;  1X5W A;  2EPC A;  1RMD A;  2EMW A;  2EP3 A;  4R2R A;  4R2A A;  1JK1 A;  1TF3 A;  2EMH A;  1X6H A;  1NCS A;  1ZU1 A;  3MHH C;  2YTI A;  1P47 A;  2EM9 A;  2WBU A;  2EMC A;  2YTE A;  2HGH A;  4IJD A;  5KL7 A;  5KL3 A;  2J7J A;  4R2S A;  2EM8 A;  2EM2 A;  4IS1 C;  1A1L A;  2EOM A;  1BB8 A;  2YU8 A;  2ADR A;  3EPL A;  2YRK A;  1KJK A;  2EQ3 A;  2EPU A;  1A1K A;  2EOH A;  2WBS A;  4M9V C;  2EQ0 A;  2ENH A;  2A25 A;  2EN3 A;  1JK2 A;  2EM5 A;  2YRH A;  3EPK A;  2EN7 A;  2DRP A;  3EPH A;  1A1I A;  2EPA A;  2CSH A;  2LVH A;  1BBO A;  2DLK A;  2EL6 A;  1DGC A;  2EOE A;  2WBT A;  2EPR A;  2EOY A;  2EM0 A;  1F2I G;  1YSA C;  1TF6 A;  2D9H A;  2EPX A;  2ELY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...