3C6KA

Crystal structure of human spermine synthase in complex with spermidine and 5-methylthioadenosine
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
363
structure length
335
Chain Sequence
b'GSRHSTLDFMLETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYEEIDSILNKVEERMKERVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermine synthase
publication title Crystal structure of human spermine synthase: implications of substrate binding and catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 103
structure length 335
sequence length 363
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.22: Spermine synthase.
pdb deposition date 2008-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
A PF17950 SpmSyn_N S-adenosylmethionine decarboxylase N -terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 3c6kA02
3.30.160.110 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Siroheme synthase; domain 2 3c6kA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3c6kA03
5JR3A 3TOSA 3E7PA 3E23A 1RI1A 1JG4A 2PGXA 4GC5A 3RIEA 3HEMA 5CUQA 5FQOA 3NMUF 3BWBA 1EJ6A 1JQEA 1R8YA 1VQ1A 3KKZA 4M7RA 3HCAA 5EC8A 3H2BA 1I1NA 3JWHA 5E9QA 2GLUA 3UJ7A 3T7RA 3L8DA 5K0NA 3MAGA 5HILA 3T7TA 5ICCA 4E2ZA 1M0EA 4R8RA 3UA3A 1D2HA 4OA8A 3LCUA 2A14A 5KS2A 1YFJA 2P3LA 2VDVE 3SGLA 4EQZA 4FS8A 1EAMA 1F3LA 1KR5A 1N7IA 2YQZA 5CVEA 2OXTA 4HGZA 1XJ5A 3O4FA 3KPYA 2R6ZA 2FK7A 3DP7A 4MWZA 4MTLA 1YB2A 3FRHA 3A7DA 4Y30A 3BXOA 1NW3A 5KVAA 2AOXA 4X61A 1XCJA 2IDKA 4QPNA 4HGYA 2DPMA 3OU2A 3EVBA 5K0FA 1G55A 1L3CA 3ME5A 2XYVA 3FTDA 2UYQA 4OBWA 3SM3A 5MHTA 5LQRA 2PX5A 1KHHA 3FUTA 3G89A 1YUBA 2ADMA 1PJZA 2JHCA 3G5TA 4EVIA 1RI4A 3M6XA 2NYUA 4PINA 2PLWA 3DTNA 4YV2A 1QAQA 2BM9A 3M4XA 4P7FA 3G5LA 2OB1A 3G2QA 2OYRA 2XYQA 5K05A 1L9KA 3Q87B 5EKXA 2NNWB 3SSMA 3VC2A 2FK8A 3FPFA 4PIMA 5DLYA 4F84A 3VYWA 2C7RA 3B3GA 4Y2HA 3O7WA 4C03A 2PX8A 3UBTA 1FP1D 3K6RA 5DSXA 4KRGA 3G88A 2Z6QA 2BR3A 3ID6C 3B7PA 2OY0A 1KPIA 1KYWA 1IM8A 4YUYA 3FUWA 3UWPA 2V7EA 4E30A 4C08A 1Q0SA 2F8LA 3FYDA 3LDFA 4RTMA 1IXKA 5FA5A 4U7TB 5EVJA 4CKBA 2ZIFA 5EGSA 3EMBA 2BR5A 2XVMA 3M6WA 3ANXA 1WXXA 1VE3A 3C0KA 2PT9A 5CVUA 3MCTA 1G60A 1R8XA 3FPEA 5T64A 3O31A 4E70A 2FYTA 4GEKA 2JHAA 3PX3A 5E8JA 4HTFA 3EVAA 5FULA 3SMQA 2VDWA 5M5BA 4HC4A 3KQMA 3HCBA 2ZBPA 3G2MA 4R05A 5FCDA 3LDGA 2PVCA 3TPZA 3MTIA 5GIOE 2Y1WA 5E2AA 4GF5A 2N47A 4R6WA 2AOVA 5LSAA 3HP7A 4IWNA 1NW5A 1KPGA 1AF7A 1M6YA 3EVGA 1KXZA 2O05A 1ZQ9A 4RTPA 3GRVA 2PBFA 3IEIA 1JTFA 3PFGA 1I9GA 3DLCA 2QRVA 1L1EA 4QDJA 1EJ0A 4RVFA 3HA7A 3NTVA 1FBNA 2IP2A 1ZGJA 2FCAA 2JHPA 5EG5A 2P7IA 5K0JA 3NVKI 5ICEA 5DWQA 2ORED 2P3QA 3R6TA 3B3JA 3EVEA 2Z6UA 3EVFA 4HTFB 1PJQA 4HH4A 2P7HA 1T43A 5LQKA 4XUEA 3DH0A 5HIJA 5GINE 3DXZA 3G2PA 4QQNA 1EQAA 4XUCA 2PX4A 3EEOA 3OU7A 4X63A 4PYQA 3BGVA 4EKIA 2B25A 5T6BA 3FTEA 1SUSA 3PLAE 4R8SA 3CBGA 3RW9A 1WG8A 4GBED 1EIZA 2P40A 3P8ZA 5FADA 5DRTA 3M70A 1R6AA 5DT2A 1AQIA 3EVDA 3I64A 5E1MA 4PYJA 1O54A 4OBXA 3MTEA 2E5WA 1BKYA 5EEGA 3E05A 4QTUB 5E1DA 1ZKDA 3GIWA 4WXHA 5D1NA 2GA9A 3X0DA 1XDSA 2IDJA 4ATNA 2QRVB 2AR0A 2I62A 5FUBA 3TRKA 5EMMA 3EMDA 2JJQA 3KQQA 4X1OA 1G8SA 5LQCA 4EK9A 3BT7A 5LQAA 3OZSA 4XUDA 5DTRA 1FP2A 2H11A 4AUKA 2O0LA 1NT2A 2AOWA 3JWJA 3LCVB 5U4XA 2NXNA 3GGDA 4RTJA 2FRXA 4C05A 4OQDA 1G6Q1 2AOTB 2IGTA 3AWIA 2P41A 3FUUA 4QQKA 2GB4A 3TR6A 1PJTA 2G71A 4YUWA 3P2KA 4ER6A 2JG3A 3HVKA 2UYCA 1AV6A 1YZHA 4FP9A 1YF3A 2PJDA 3P9NA 5HIKA 2EJTA 1ZG3A 3VSEA 3GRRA 2FPOA 4BP3A 1V39A 2ZIEA 3ELWA 4PYMA 3I58A 3KR0A 4BLWA 1I4WA 5GIPE 1N2XA 3DMFA 4A6DA 5K0EA 4FT2A 2ZWVA 4IKPA 1FPQA 3DXYA 4HSGA 2UYOA 5T67A 1KIAA 2PX2A 2P8JA 2YVLA 3DMHA 5DX0A 4PNEA 2IH4A 4X60A 1SUIA 3NWBA 3LGAA 3PVCA 2QM3A 4RYLA 3LDUA 4DA4A 2XBMA 1SG9A 3B89A 3KQPA 2DULA 1RJEA 4RTNA 5EOVA 2UZ4A 1KP9A 2PWYA 3DOUA 2JH9A 4AZWA 3GRUA 5B1SA 3DR5A 3PX2A 4HRAA 5E1BA 2CKDA 3CJRA 3KPUA 3FPGA 5IH3A 5EZSA 3DLIA 4Z2YA 3ERCA 4E2XA 5E9WA 4EKGA 3P97A 1QANA 2FHPA 2ZW9A 3T7SA 5DM4A 5K0BA 3NJRA 3ELYA 3A7EA 4E32A 2AOUB 3LBYA 4RVHA 2AN5A 2WA2A 5GWXA 3KPJA 5HIIA 2P3OA 2PKWA 3NVMB 5F2NA 2ZCJA 4DM3A 1TPYA 1MJFA 3FPJA 5DSTA 4DZRA 1HMYA 2OKCA 1JTEA 4MQ4A 2EJUA 4DCGA 3ELDA 4DQ0A 3C6MA 3EGEA 2IBTA 3UJAA 4ER5A 1Q0TA 3DMGA 3MGGA 1P39A 3ORHA 4FR0A 3EPPA 4E31A 5C1IA 1RI5A 5ICFA 1JQ3A 4C4AA 1NE2A 5GM2A 2O57A 3KQTA 2ZWAA 2PWPA 3KU1A 2BZGA 5F2KA 5DXJA 1XDZA 1KPHA 2ZBQA 1SQGA 3ELUA 3EVCA 5K0CA 4YUZA 2WK1A 4KW7A 4G56A 3THRA 5HEKA 2JH8A 4B17A 4X41A 4YUVA 10MHA 4QTTB 5EPEA 1R18A 3PTAA 2NXCA 4QVKA 2AZTA 3BWCA 2I9KA 3P9CA 1RJDA 5F2OA 1R00A 3LCCA 1X1CA 3BWYA 5FHQA 2AN3A 3PFHA 2PT6A 4H0NA 3SXJA 4LWOA 1SVUA 5EZQA 1X1AA 3LL7A 2CMGA 1O9GA 5EKUA 4CTKA 3I5UA 4MIKA 4F85A 1DCTA 3JWGA 2UYHA 2NP6A 3HCFA 5K0GA 1ORIA 3P2EA 3OFKA 1G8AA 1UFKA 2ZZKA 3FPHA 4PYKA 4YMHA 3R0QA 3U81A 1XTPA 3OE4A 4PGGA 1XDUA 5GM1A 3ER9A 2YTZA 3GXOA 2YUIA 5K03A 3UJCA 1P1CA 2IH5A 3DXXA 3KQSA 4JXJA 3KR9A 1NW6A 3CCFA 3AXTA 5DTQA 4O29A 4FSDA 2VS1A 4ER7A 3SSOA 5DX1A 5LR6A 4L7VA 3MHTA 1NW8A 1QAOA 3BGIA 5C0OE 3QOWA 3KQOA 2AOTA 3UJ6A 3JWIA 2YR0A 4CXMA 4FT4A 3TM4A 3TM5A 4IV8A 1NKVA 1D2CA 4OA5A 3FUXA 5ERGB 4RV9A 2AVNA 4E33A 3WSTA 3KR1A 1X1DA 5GOZA 4P58A 3V97A 2HR1A 1TW3A 3V8VA 2Z6AA 4ZTBA 2YX1A 3AJDA 3M6VA 2OB2A 3NDJA 5KQRA 3UJDA 1VP3A 2G70A 4FZVA 4GOOD 4YUXA 3R3HA 1VPTA 5E9JA 1JG3A 2HNKA 4PYLA 3VC1A 4HG2A 3GU3A 1JQDA 4DMGA 4PCAA 4ER3A 1R74A 2C7PA 5HFJA 1PJSA 1BC5A 3PB3A 5EHGA 3UJBA 3MERA 1BHJA 4CWAA 3CJQA 3CJTA 1ZGAA 2ZLBA 5LQUA 2ZFUA 4GOLD 4AZSA 5KYGA 5DRYA 3B3FA 1XXLA 5K8VA 4PYNA 4RVDA 2CMHA 2V74B 4CKCA 1IY9A 3TFWA 3C6KA 4GQBA 3GDHA 3SX0A 1RJGA 2XYRA 3C3YA 3CC8A 3A27A 4WVLA 1Y8CA 3OPNA 4PYOA 5DPMA 4P7GA 3T0IA 2QYOA 5GP1A 2EX4A 1VLMA 4YV1A 4RVGA 1DUSA 3R24A 1ORHA 1Z3CA 2B9EA 3KPVA 4AZTA 3EEYA 3KHKA 3HA5A 3MB5A 2HTEA 3MQ2A 5CCXA 5BP7A 3TKYA 3GNLA 5C9ZA 2AOUA 4GUAA 2AS0A 4RTOA 5G02A 3LPMA 2BR4A 4AX8A 4CKEA 5KQSA 2ONZA 2OO3A 4C06A 1QAMA 3UJ9A 3KQVA 2GH1A 5HIMA 5FWAA 5CCBA 2ZVJA 4RTLA 1KYZA 3P9IA 2Y1XA 5E2BA 3UFBA 1UWVA 2G1PA 4KWCA 4M38A 4BLUA 4CTJA 5EQJB 1VBFA 5E1OA 1WY7A 2Q41A 1X19A 3OZRA 1M6EX 3G8AA 1YZ3A 2ZULA 4OQEA 3S68A 3SSNA 5K01A 4LG1A 1SQFA 5CVVA 3KQYA 1QYRA 3UA4A 3SVZA 4RTQA 3OU6A 3E8SA 5DTMA 3AY0A 5H02A 2OZVA 2C7QA 2VDUE 2I7CA 3TLJA 4PGHA 3FUVA 4FGZA 3GWZA 4PIPA 4BY9E 2NXEA 3FZGA 1U2ZA 3GRZA 3NDIA 4KDCA 3M33A 5CM2Z 3BWMA 3G7UA 5EMLA 3THSA 2ZZMA 2XVAA 3UZUA 2IH2A 1JG1A 4DCMA 4F86A 5EHIA 3A25A 2IBSA 1B42A 3GJYA 2PSSA 3I53A 3UJ8A 3HCDA 1NBIA 4QVGA 2ESRA 2AVDA 4RWZA 2HWKA 1OR8A 1EG2A 5IKMA 2QY6A 1P1BA 1G38A 4MHTA 2WA1A 3QOXA 2ONYA 5EMJA 3SR4A 4PCLA 4V0RA 1QZZA 3LHDA 2EG5A 3HCEA 4XCXA 1NV8A 4AZVA 2CWWA 3KR2A 3TKAA 4M36A 3FTCA 2PXCA 1VL5A 3CVOA 1JG2A 2BH2A 4E2WA 1UIRA 1D2GA 1NV9A 1X1BA 3PS9A 1MHTA 3AXSA 4IV0A 3B5IA 1JSXA 1WZNA 4DF3A 1RI3A 2PXAA 1PRYA 3OFJA 4QPPA 5CVJA 4RTRA 4EMSA 3LKDA 5BW5A 5LQNA 1SKMA 8MHTA 1L3IA 3NW9A 2R3SA 4C04A 2YXLA 3CKKA 4P7KA 3LSTA 2EFJA 3MCZA 3RODA 1TW2A 2YXDA 3BZBA 5DM2A 4GOND 4PYIA 1VIDA 4KIFA 4RX1A 2I6GA 3KQWA 4OX9Y 1RJFA 2OPBA 3LX6A 3GCZA 2GAFA 3IYLW 2ZZNA 5FA8A 1N7JA 2HV9A 1NW7A 4LECA 4POOA 3FTFA 1JSZA 2QE6A 3FYCA 3HVIA 3QV2A 3BKWA 1JR4A 3C3PA 7MHTA 2VZ9A 2BM8A 5ICGA 5CIYA 2NP7A 3P71T 1INLA 1HNNA 1P91A 3P2IA 3DUWA 2B78A 4KIGA 3TMAA 5E8RA 2ERCA 3OE5A 4P7JA 4C07A 2LD4A 2P35A 4BP1A 2HMYB 3EGVA 5DM0A 2KW5A 2ZBRA 1AQJA 3D2LA 3FRIA 4PWYA 5CD1A 4GOMD 3I9FA 2B2CA 5DM1A 5DX8A 1ZHFA 1O9HA 4FSXA 1RI2A 3HNRA 3IV6A 2G8NA 3M6UA 5HZMA 1FJXA 5FQNA 5P8WA 3A4TA 2VP3A 2YXEA 2ZSUA 5FHRA 4E2YA 1L3BA 2IPXA 4YV0A 1BOOA 2PY6A 2O07A 2P1DA 2B3TA 2GS9A 3KPWA 3LBFA 3EGIA 3BUSA 4RSRA 4NECA 5FTWA 2H00A 4R6XA 1WS6A 5D1HA 2CL5A 4GC9A 4ER0A 1H1DA 4PONA 3DULA 3GO4A 2GPYA 3GRYA 2AN4A 1XCLA 2OBFA 5FWDA 2G72A 4RTKA 4DKJA 1NBHA 4K6MA 5EIWA 4U7PB 5BW4A 3F4KA 5EEHA 3HM2A 5JUWA 2C7OA 2O06A 4KDRA 3NWEA 2ZIGA 4A6EA 3BGDA 3PT9A 5DXAA 1KYQA 3HCCA 5CVDA 3HVJA 4KVZA 3TQSA 2K4MA 3EVZA 3HA3A 4QDKA 9MHTA 4YMGA 3OZTA 3P9KA 4LWPA 5LQJA 4UOEA 3REOA 4ISCA 3CGGA 5K0LA 4BLVA 2PXXA 3LKZA 1DL5A 2IIPA 3G2OA 2ZTHA 3BKXA 3HVHA 3K0BA 5EIFA 2H1RA 3IHTA 3ER8A 3OCJA 4RTSA 2PV0A 1XVAA 1WXWA 1YFLA 2NXJA 5HOQA 4M37A 5K09A 3Q7EA 3HTXA 5BXYA 3G8BA 1F38A 5EMKA 1VP9A 3LECA 3R9XB 3A26A 4V0QA 2IFTA
chains in the Genus database with same CATH superfamily
4GBGA 4OGLA 3DJWA 1F6BA 1JG4A 1MD9A 1RI1A 2RJ3A 2XYHA 1DBVO 5MFZA 3NMUF 1W36B 1Q3TA 1XJQA 4JYAB 1E1MA 1NAHA 3O2JA 2JAXA 3V4VB 1XDBA 2NU7A 2HCTA 3KHSA 1EP2B 3UGKA 5AW5A 3ZJ5A 1KQNA 4DNXA 3CLSC 3DCIA 2IYZA 1UPUA 1UP7A 3L8DA 2B37A 4GPD1 4JFAA 4N7BA 1HL3A 1KI3A 3MELA 4NEQA 5AJXA 2QTNA 4ZQIA 4QXOA 3SBEA 2E21A 1Z5NA 3EIWA 1VZ3A 2LIVA 4MWBA 4XQ0A 2R25B 3KXPA 3RFTA 5KYTA 2A5GA 4BAGA 1T4BA 5AJVB 1UP4A 5KYUA 4U5XA 3LQQA 1DKOA 2F3SA 1A5ZA 3RSOA 1U5BB 3R6LA 4LSZA 4B4UA 4J4BA 2IPNA 4W5OA 1KMHA 4UVEA 3OJXA 3VSDA 1MJHA 4F2PA 3I3OA 3F4LA 2VBGA 2HUPA 1Z6ZA 3KJNA 3K9CA 1CRQA 4QBGB 4BYGA 2Y05A 3L7DA 2II6A 3PBKA 3AGPA 1O95D 3I5AA 1CDZA 3ME5A 4IBOA 3GLHE 3L6EA 4G07A 3E53A 3LT2A 1D4FA 3EUWA 4Q4DA 3HJFA 4AQYE 2CSHA 2FCRA 4W8HA 3LOUA 5A3SA 1DFIA 1NJ6A 4CT4B 4LY0A 4UBOA 2W2MA 2XDAA 2VLBA 1W6UA 4O2RA 4B43A 1AZSC 1B4DA 3KYIB 3OICA 4E5MA 4YV2A 1QAQA 1PJAA 1E92A 1R0LA 1XFAA 2IHUA 4MV1A 1NLZA 4AJJA 5BV1A 2Z09A 3LI2A 4QHSA 4UM9D 2HHAA 3Q87B 4LZWA 2JLVA 4GZMA 4BBYA 2WTBA 1D1PA 3GMTA 1CP2A 3CN9A 2ZRLA 5T4EA 4F84A 1AD2A 1YJ8A 2DUWA 5FLEX 1GTL1 2WYOA 4BB5A 4C03A 1HFEL 5BR4A 3TIFA 2ZYSA 4GKJB 1JI3A 2QD3A 4B3BA 3EGWA 2JF0A 3VHQA 3ZQKA 5KEIA 2ZQZA 2R1VA 3HY3A 4W6ZA 1TT7A 2BR3A 1RXVA 1CWUA 1QIIA 1D4ZA 2BGIA 3CF4G 3MSWA 4C2AA 2J46A 4DPLA 5AC5A 5B4UA 3FUWA 2CLFB 1FXWA 2VYCA 1J22A 1XD9A 3KS9A 2O0MA 3VOBA 1EK1A 3HGTA 5CG2A 3CLTC 3CWCA 3L84A 1FY2A 2BYTA 3HJRA 4N9QA 3D6AA 3NC0C 5CVUA 3ZX5A 3DVAA 2ZE8A 3ND8A 3I42A 4IIJA 2H48A 5EE3A 3HXTA 3HXOA 1XTSA 2RGUA 3TZKA 5D7NA 4BC9A 5F4ZA 5KYVA 1OA1A 2W2LD 2OQIA 4CG2A 5KYXA 3GBPA 1LNQA 2EFCB 2PGNA 5KWIA 3ZE7A 2XNJA 4ETWA 4C7MA 2AG0A 2P5YA 3MJRA 2ZG6A 5KWSA 2D3WA 1SXJE 1AKEA 4R6WA 3NDBB 3QH4A 4ZAXA 4G2NA 3F49S 2WT9A 4IIEA 4TUIA 4DR6B 2YNMA 2EP7A 3EVGA 1NNEA 5CW2A 1A1HA 2SKDA 2GK7A 2X9QA 2BMDA 3LXXA 3N3AC 1L5OA 2JGKA 3NYIA 3NP9A 2QRVA 2IYWA 3K9GA 3QFTA 1P80A 3A2NA 4MB2A 1ECPA 2O0HA 1XAIA 3U31A 4AVYA 5IWAB 2WB2A 3AZOA 2D5CA 3NHWA 4PQEA 2FCAA 2BKVA 1PW7A 1VFNA 2P7IA 2OPHA 1J0EA 2P3QA 4EOGA 2YWXA 4AD8A 1ZR4A 1AK1A 3KUUA 3ZNQA 3AM1A 2P2GA 1NRXA 1S2DA 1V47A 3OTWA 3K2EA 4NR0A 3CRQA 4PSVA 1RPJA 2EKBA 3IR5A 4G5YA 3B38A 3GNQA 4NMWA 4ZEOA 3CB4A 4H31A 3MHSC 3VA7A 3OX2A 3WK6A 1F1BA 5COAA 4ZT5A 5JNUA 1WVGA 2X6TA 2WHEA 3EA4A 3AK4A 1XFDA 1G4AE 4QNNA 1TGYA 1Z8HA 2NX2A 2ODRC 2LV2A 4LZAA 3BIOA 4NBKA 1L7BA 4Z0NA 4XGQA 1XEXB 1DS6A 1QKIA 5D1NA 3HB4X 3HP4A 4P0QB 4JP1A 3OQIA 2H17A 3STTA 3OQOA 1AKMA 3I62A 3EJWA 3IEXA 2X8AA 1QOZA 2J30A 2NZ2A 2ATIA 1VSVA 3BCHA 3RT1A 3KZYA 2PKQO 2PZMA 4HXYA 4PHCA 4C29A 4PLTA 4K0KB 1P1HA 1GZVA 4ZDIA 3WGTA 3VDNB 1R7RA 2HQOA 3DBVO 4Q1CA 3Q88A 2CF6A 5ALUA 4BX3A 1W6RA 3C97A 4IS3A 4LPSA 1HR0B 4ZOLB 5C8YB 3EGCA 4I4TB 3IR7A 3NIDB 1PJTA 3ECRA 1U65A 1VE9A 3EISA 2Q5IA 2C8LA 4IVNA 4OGGA 5DI3A 2QZSA 3WC4A 4Z7JA 3GI1A 1QHHA 3BOSA 3P9NA 1QIMA 3ROKA 1EDBA 4PYMA 1YFKA 3I58A 3P9SA 3OQPA 2L92A 1G5IA 3UO8B 2F1RA 5F9FA 2CLCX 2J6HA 3G5AA 5AI9A 5K0EA 1YO6A 4P35A 5DMHA 1IE3A 3RBAA 1PVDA 2H57A 1PL6A 2BBTA 5A0FA 3KL4A 1MORA 1T0UA 2EWLA 3PVCA 3LDUA 1RIFA 4JJZA 1SG9A 4XYBA 3WO1A 4FGSA 4UCXA 1IIRA 1BGWA 4U9UA 1Q22A 4CV3A 2UZ4A 3J80A 2HSZA 3D6FA 1O95A 3IURA 3T52A 5I7SA 1QYCA 4CCSA 3AM4A 4PZPA 2PQ6A 2XUFA 3C98A 3IE0A 2EN3A 5E1BA 4B09A 5IH3A 1Z68A 2IU6A 3S5UA 3CT6A 2GM3A 2B5OA 1X3SA 4JT2A 4S35A 3OFSA 2OHJA 2REQB 3LHSA 4TYYA 5DM4A 4UBKA 2AR9A 3JZFA 4GMFA 1WB4A 1Z3IX 1RQ2A 4P0PB 3AVVA 1YR3A 2WA2A 1W8DA 1G0NA 3OKPA 2OC9A 1J2TA 2QAIA 3T12A 1PG2A 3FPJA 2YMLA 3WR5A 4C0WA 3E18A 4QBIA 1PQYA 3Q3JB 2ACWA 2DWPA 3E9EA 4V0ME 2AE2A 1JPUA 3ORHA 3S7ZA 4YRGA 1TAGA 3AIMA 1GSAA 5AQ1A 4TQGA 1P1RA 2HHJA 1W4BA 4HGRA 3CZ4A 2B8NA 3DO6A 5ENZA 1H94A 2PPVA 4G5OA 2V8BA 4MMYB 5JAPA 1LH0A 2HL6A 4DADA 4YUZA 1PR3A 1DINA 1RQNA 3MSCA 3DL2A 4HDSB 3RSCA 3THRA 2PUWA 2NU9B 1TCVA 3FIJA 3RGGA 3D8NA 5EPEA 1WUTA 3ZLJA 4FC7A 1N2BA 1SCDA 3ETDA 2ZIUB 4CLOB 2WJJA 3BWCA 2W2LA 3RC2A 5F2OA 4JL8A 3KM0A 4GE0A 5JSZA 4E5KA 1JIKA 1BS1A 1QFXA 2Z83A 2EPPA 4IHJA 5FHQA 4MXDA 5TB5A 1C3XA 5TMPA 3WRWA 2RKWA 1X1AA 3DG9A 1HLFA 4YI5A 1YS9A 4M98A 2BGTA 2X8WA 3A1EA 3NBMA 4KX3A 3MOIA 5JV5A 3OUUA 2D06A 3K0KA 2HK7A 4HV4A 4CZ2A 1XCMA 4JLWA 1KBOA 1B1CA 4UBJA 2I7TA 4RY9A 5TGTA 3OE4A 1ISGA 4I19A 4TMTA 4Y6LA 5FP0A 3S0JA 1HI9A 3KTDA 4BVHA 1P1CA 2QLTA 2R62A 2Y0PA 1W85B 5INTA 3FYSA 4B82A 4W5NA 2ZIZA 2FFQA 5I9MA 4IH9A 3ZWBA 2PMBA 5DU2A 4ZAVA 5LJLA 4Q9IA 2P2LA 3IPYA 4YAKA 1Y6JA 3PA6A 3ZFQA 3FOWA 5K3BA 3SBOA 3KEQA 2P2ZA 3SWWA 2UYHA 2XQIA 2GLXA 2TRSB 3KDPA 4UU8A 2XPCA 3QE3A 2GR9A 4LJRA 5L51A 1PNOA 3NPMA 3TOZA 1C3VA 1UUFA 4FYKA 1Z88A 3TDKA 4AYXA 2P2YA 2YJ3A 3C5VA 3V2IA 2CT1A 3PD7A 1J56A 4MCIA 3ITNA 1SBIA 3LVFO 4DM7A 1TA0A 3VX4A 3OQHA 1GV0A 1RXCA 3H5VA 4TTTS 2HR1A 4ZTBA 2Z6AA 1DKUA 1RPZA 3K94A 3UJDA 4L8WB 4FZVA 2HT6A 3W2GA 2PZGA 2J3EA 3EXHC 4HMOA 2ZWOA 4K0RA 4XE5A 3HWSA 4AZ0B 3Q12A 1K06A 4HQRA 3GPCA 4MWSA 1FYWA 4EZIA 4GKKE 1QSGA 3E7DA 4QGSA 3CJTA 3TECE 3CPSA 4FHGA 2VH5R 5JXIA 3PSAA 3AR3A 3OA0A 3PWTA 3FIGA 1Q7BA 5K8VA 4GPAA 1X38A 2UVPB 1QVZA 2VP0A 4TUYA 5IDVA 2GVDC 4L02A 1XZLA 2BHNA 3SEAA 1ZOOA 5DYGA 4CM4B 4F3CA 2NQ8A 1F2VA 1B7GO 1AGRA 4PYOA 4R51A 1AQ6A 4JV5B 2AG8A 1KXJA 1H1TA 4OA8A 4Q01A 1JQJC 4KACA 3F47A 4WI1A 4XZ3A 3WB2A 4C04A 2R8RA 4Z9BA 4C0KA 3RJMA 2EN1A 1U3FA 1YJCA 4ZGWA 4ZYZA 2YYSA 5ELXA 1TX4B 4FYVA 4RLFA 1YVEI 3QX8A 1GN8A 4K6HA 3WRXC 1C3OB 5BMVA 5KIAA 4C2UA 4I1SA 2ZAIA 3ECCA 4YECA 3VZQA 4Z49A 4KMSA 3R5HA 3DE3X 3GJ0A 4I5FA 3VI3B 5C81A 3FW1A 4HP8A 1IJEA 2J3KA 3C5CA 4FMCB 4BUJA 4E13A 1YZYA 1J0BA 1G6OA 2COEA 3F3MA 1G5FA 4M38A 4TVBA 2BTQA 3RYIA 4IJKA 3ORQA 5AK3A 1CEQA 2VYVD 3HRHA 4KLCA 1OFTA 5ITVA 4AYWA 3OQ6A 5F7XA 5DNYB 4TSKA 1RBQA 3C41J 2E82A 4MK4A 2EEPA 2VHUA 4B46A 2IP4A 3KD3A 4LVCA 4WSGA 5E4YA 4G0NA 5CM2Z 1PNRA 1XQWA 5ADZA 2QN3A 1A5SB 2BVNA 3HJBA 4FHCA 5AM2A 2H3HA 2C42A 1SA0B 3IVAA 4LHYA 5KYGA 3HEAA 1OWOA 2RCYA 1N3YA 3QF4B 4I99A 4YB8A 5D7BA 1CJKC 5J9FA 4DLNA 5DLQC 3VH3A 1AJEA 4D3DA 3K9FC 2HWKA 1DMRA 2H4JA 4M4SA 2XGMA 2YJNA 4OY3A 4BMYA 4JSTA 2ANBA 1RAFA 2NUAB 3RBXA 2A0FA 4EEZA 2MOKA 3NZEA 2WKWA 2X40A 1KAOA 3GEMA 3H4TA 3KWRA 4HWPA 4ECEA 5JAIA 4KO8A 3I39X 3KZOA 5I8PA 1BE1A 4JNKA 4XM2A 3I9NA 3PC6A 3JR3A 3V2GA 1T3HA 4MLZA 1KY2A 4YIHA 2JY9A 1FFYA 4H17A 4X0EA 1WZNA 3DOIA 2PXAA 2GO1A 4FFNA 5JCJD 2CB0A 4M3NA 1A4UA 3SR0A 4CG0A 4ENTA 4WKOA 1DCFA 4GZLA 1BJTA 1VJ1A 3C7TA 1QVRA 5BO5A 1HE3A 3VJLA 4XWOA 2VQ6A 1WZ2A 3VMFA 5LDHA 2V8QB 2YXDA 2NN3C 5AJTA 3SJUA 4IJWA 3PR1A 4ZVVA 2HMAA 3TCKA 3X1MA 4AMGA 1HX7A 2CLMB 3CZAA 4I1OA 4OX9Y 4JC8A 1YZKA 2GAFA 4O6VA 1GQOA 1QTRA 4M0UA 5HGJA 1YB6A 3ZOKA 4UM5A 1FK8A 4OJMX 2YOGA 3H75A 3OWXA 4JQYA 3WK8A 4X66B 3JQ9A 3LOQA 4MH0R 1F4VA 3CVXA 2QPTA 1KEZA 1QIDA 4KR3A 2VQEE 1AUXA 1HBJA 3C3PA 3LCJA 3MMSA 4LBVA 3P2IA 5K45A 5FUQA 5AVVA 4R2DA 4IWYA 3T15A 4KLAA 2IRWA 4I14A 1VIYA 5D5HA 3ZK8A 3ZFOA 3SIRA 4TV9B 4FBGA 5C5EA 1H4TA 1ZK2A 4M53A 2ODAA 4MX8A 2KONA 1O97D 1I0IA 3NV9A 4GOMD 2QHXA 3I9FA 1JVNA 4K46A 4UDOA 3VDRA 4E5VA 1SNYA 4MAMA 3TLZA 2ODBA 4B7XA 3PZBA 2REBA 3SE7A 1FX1A 4FWBA 4AO7A 4YBZA 1OPRA 1PFWA 3K9BA 4JB0A 2J9ZB 1U7TA 3PCXA 3EIOA 2V5AA 2O7NA 3EIUA 3MJTA 4R98A 3PUZA 5CA1A 3UYKA 1TUEA 3A1TA 1K2VN 3FDXA 4JL6A 4KRYA 1Y89A 2HA7A 3DULA 1N2CB 4K2HA 2GPYA 2GZDA 5EE0A 4Y98A 1AURA 1K7FB 2C9DA 3EC1A 1CZRA 1SIUA 3GUHA 4HDKA 1SOAA 1E9EA 4LF6E 3OY7A 4K6MA 2E0IA 3RM3A 3RT7A 5BSWA 4UATA 1TVKA 5JY6A 1ML4A 4KDRA 2PH7A 1OWNA 2W58A 4E07A 1JBQA 1FBTA 3G0IA 3ORFA 2O54A 1P2UA 3HUNA 1YZNA 2P2CA 3HVJA 1FFBA 1LXCA 4Q3EA 1X80B 4INAA 4X62B 4YMGA 5MF6A 3OZTA 5KL7A 4E6PA 4Q18A 4JS0A 2HSWA 1MEOA 4OI4A 4D8VA 1NQXA 2BEKA 1F20A 4OB6A 4BP8A 3GLIE 2OCGA 3LKZA 2B5WA 2AWOA 4US0R 1ZESA 2A9RA 3Q10A 4UNNA 4FDUA 1UN6B 5DEIA 1CP3A 5EIFA 5L45A 1XJCA 5BN3B 4KFUA 3MSXA 5HQTA 3V8MA 2NXJA 1BXGA 5LMUE 5B2EA 2WP0A 1NX6A 3HTXA 2R6AA 4KOAA 2VDRB 5I9TA 3R7DA 1CUHA 4TLAA 2E4WA 4PAGA 3UC5A 2VRCD 1PDWA 3E7PA 2W8ZA 4F4DA 4EY8A 4ZZIA 4QOHA 4ARIA 4DDVA 4J2TA 5CT8A 3SC4A 3W7AA 1R8YA 1EM8A 2QTBA 2VZ8A 2BCGY 2NUPB 1A7JA 2NWQA 2RGYA 4KBFA 3U4DA 4J0JA 3GBSA 4JLBA 4FZJA 2VYVA 1T1IA 4KIUA 5KJ6A 2EPMX 4HNHA 3ZWDA 2EPOA 1KH1A 3QU4A 3QUCA 4A2QA 4ZV4A 3EAFA 2CLOB 1E32A 1X9IA 2Q7XA 5HILA 1CD5A 3ZV4A 3ZQ4A 3DC7A 4DY6A 4YRBA 4MGIR 3ZH2A 1YL5A 4M2LA 3C70A 5DCLA 4FS8A 2GNOA 4D3XA 3OA2A 3PHLA 3FPLA 1CRLA 2HI0A 2OCYC 5KMGA 1BMTA 2TMGA 4NKRA 1MAWA 2WHRA 3T5CA 1DXOA 3RPEA 3MD9A 1UZLA 4COKA 5FWYA 4UCQA 2XXAB 2PSHA 4YCLA 1FUIA 1P0IA 5EJ8A 4JQSA 5DCUA 3HKEB 2ETVA 3DZIA 2FPMA 2Z2JA 3AJAA 4AMUA 1EFVB 3CR3C 3HYNA 4IQFA 1SUBA 5EJMA 5H82A 2EBUA 2NU7B 4IG4A 4P3NA 3QEOA 1DGCA 4DR2B 3ADIA 4HWSA 4B6FA 1JKJA 1B3RA 2OBNA 3G82C 4EVIA 1K7YA 2BFOA 2OBMA 5C7OO 2OILA 2OZEA 2VUHB 3DQQA 1UR5A 1P6UA 1WHSB 3DFKA 1QRDA 1E69A 2BM9A 4JBNA 4F21A 4ZI7F 4RMNA 3ISTA 4OM7A 3WQSB 3KZZA 5JCJA 1Y4UA 2YMMA 3GGGA 4EHDA 4EI9A 5KYUB 2NNWB 2Q2NA 1YRAA 1FIUA 1OGIA 2OAQ1 4NAVA 4LJ6A 4R31A 4IOJA 4LJ7A 1KMHB 2YV4A 5LZ8A 3OZXA 1KH2A 1OAKA 2VHYA 1L5HB 1VL8A 1ZD2P 5H9VA 3RC7A 4DC1A 5EZ6B 3PPIA 2RC5A 2ZSJA 3F46A 4JJ6A 4Z9YA 1KGDA 4I1YA 1CNEA 2ZPUA 4EY7A 1U0TA 2OXIA 1G291 3UWPA 1F12A 1VI2A 3B1KA 3JSXA 1UBKS 2N3GA 2GXQA 5CK5A 1EGMB 2IKQA 4PG6A 2PKRA 3EAQA 4GSYA 5BQFA 4NZVA 3O4GA 2XCUA 3OE7D 1I2ZA 1P75A 5DHTA 5BW8A 1PJRA 2IYYA 2BM1A 4INZA 3BQMB 1W1UA 1USVA 1LLMC 4HKTA 4KI0A 2ST1A 3UKDA 1N2SA 1QG0A 1YFZA 3HZHA 4QDZA 4QYMA 1BW9A 4RD2A 1M8FA 3BREA 5GIOE 1GR1A 2WILA 3U4QA 1JX6A 2P3SA 2CDRA 4HZIA 4B71A 3KLMX 1X42A 5JXWA 3QKRB 3GZNB 3SYKA 3WJ7A 5G1OA 4UVGA 3IDFA 2Q3JA 3BMCA 4N0DA 3RSGA 1ODCA 2W6ZA 1WM1A 3TQRA 4QRDA 2FLVA 5T3YA 5C35A 1PG0A 3TKLA 1IHPA 5IUJC 1OBOA 4S0XA 5BYKA 3A11A 5TC4A 4R8OA 1E0JA 2RH4A 4C08A 3U5ZB 3OPXA 4N7RA 2RHRA 4ILEA 2RI0A 2CHEA 1HE1C 1MPXA 2BBSA 4OYLA 3L6DA 5DNVA 1ZUWA 4MYUA 1FBNA 2IP2A 4AP5A 3HFRA 1C7FA 2FZWA 3IVCA 4HFRA 5AHWA 2HJGA 1FP7A 5I5GA 4AK9A 4BB9A 3T9DA 1WPRA 1YJBA 2J33A 2RGDA 3ZHZA 1EQUA 3VFDA 4IIJB 2PDAA 3I04A 1FTQA 1H2EA 3E5MA 1FE8A 1VLLA 3L0SA 1RC8A 4CLHA 1KSFX 4YS6A 3ABIA 3UBMA 1KI6A 4GKAA 5HTOA 1QRAA 2OM6A 3PXUA 4J8ZA 3EEOA 2YWJA 1BXRB 4EKIA 1JDSA 1P29A 2VFAA 3JPWA 5KUTA 1ZH8A 1AC5A 1Q1GA 2ZSEA 4GBED 1CZNA 1YR2A 4RXMA 2JAPA 1M8KA 5E6SA 4V1CB 3TSZA 1RPAA 2O2JA 5L95A 2BUCA 1E1DA 1E7RA 3F8SA 1ICEA 1N8KA 4HWGA 5IMBA 3LHFA 4ZDKA 3DR3A 4DB4A 2I76A 1RNLA 4WXHA 2Q0HA 3U6BA 4U6SA 4KVGA 2EPZA 2QRVB 2VUIB 2ZT6A 1Q17A 2XAAA 3WKBA 1V41E 4YMVA 4N0QA 2EARA 4KPGA 2VRCA 2E87A 2PMDA 3COSA 3H8VA 5J4KA 3LHIA 3WBJA 1P0CA 3R2JA 1I1OA 4WIAA 1YTUA 1KO8A 2AZXA 4UE6A 3JPYA 4L4RA 5DYIA 4MVJD 6NULA 2KOUA 5HOEA 1DLIA 3B60A 2D2EA 1N2EA 1NY5A 3CUTA 5THXA 1JR3E 5HS6A 6GPBA 3AU9A 4AG6A 3IAM6 4BP3A 1ISJA 3C3EA 3G2LA 3VH2A 2OO7A 1UEIA 3IDOA 1EB8A 4F1JA 1K9VF 3DMFA 3H17A 2X1HA 1PT9A 5TT0A 2I3BA 1WZCA 3ND9A 3QKIA 3DMHA 3QNUA 4OM8A 3UOWA 4JBHA 4O4IB 4Y2PA 3E70C 5IHPA 3BULA 4FQ5A 2W6QA 5G4KA 1WDMA 1PGQA 5ICMA 4WK6A 4X71A 3IA2A 1UWLA 3S2EA 3ZOQB 1P18A 3PGA1 1KJ8A 1JIVA 2IE8A 4UUOA 4AJKA 4AKHA 3EB9A 1U8UA 2J41A 4O0MA 5AVXA 2QAGA 4CF7A 3A2MA 3RKSA 4B3TB 4JB8A 4F2GA 2YWDA 4RSHA 2GJ4A 4JYBA 2PGAA 2OZKA 1U0EA 2Z8ZA 4Z2YA 1VXOA 2G25A 5AI4A 4YCAA 3ZDAA 1GFWA 2PIDA 4U6NA 5G1PA 3SG0A 1VG9B 3NJRA 3HMKA 2EMXA 3QWIA 4I8IA 4W1QA 2J9FA 4B3HA 5A4KA 2PVSA 3II6X 6YASA 4NRDA 4UDNA 2CDCA 1GTJ1 3ITDA 5F2NA 2UAGA 5L3RA 2F43B 3OZFA 1OROA 1NLMA 3JQGB 3IQFA 4LQDA 4LZZA 1P0PA 2QUIA 5FV7A 3HDGA 3EMVA 1ULHA 4JAVC 4ZAZA 3LUAA 4DCUA 3ED1A 2YYZA 4IRXA 1T35A 4L4UA 1G41A 2IUEA 1L5ZA 2Q99A 4IUBS 4ZYHA 1LRLA 1SQ5A 1U0FA 2FP3A 2FWBA 5FNVA 2PKQP 2DC1A 3C8UA 5JY1A 1JNYA 3EPPA 1A7AA 3W5UA 4GPBA 1RM4A 3H42B 2O3SA 1NE2A 3DT8A 1T5TA 1Z6YA 1LJLA 4JLOA 4DV6E 2G28A 3TWOA 3ZTTA 3T4UA 1OX4A 1KPHA 4PS1A 3TLCA 1T36A 4D81A 4RVNA 4KW7A 1DKMA 3OE7A 4TWRA 3BZUA 3DZHA 3GEHA 3UHOA 1WW3A 1NUHA 621PA 3AI7A 2IHKA 4XFDA 2L69A 3PYLA 4DCPA 1B74A 2AFHB 1FYDA 4XWKA 3TQHA 5JJ5A 1YZVA 3IQZA 1VJTA 1NKTA 2ICAA 1K7SN 2XEDA 5J40A 1PZNA 1K08A 4Q3BA 1SU6A 1THGA 1PQWA 5DP1A 3EQ1A 1YCDA 4JBXA 4OIFA 3T5MA 4DJFC 1CNMA 1WQ1R 3N8IA 5EZQA 2Z8YA 4ADSG 2B34A 2WIKA 2D4HA 2WV9A 1I36A 1TZMA 2B1QA 1XF1A 3AEKA 3AHJA 1JMKC 1Q19A 1C81A 2A57A 3AY6A 4XYEA 5SZHB 1LEHA 1TJ3A 2YYAA 2CWDA 1XZQA 4EDHA 3H0KA 2HA2A 2DIXA 4B6RA 3R5FA 2YTJA 3LA8A 3QVGA 1K6JA 4RSGA 1LTHR 1SKYB 2IH5A 4S1WA 5FBRB 3H3FA 1NW6A 3NTLA 1U0RA 1BB8A 4A15A 3PUWA 2BSQA 4CEJB 3TTSA 2BMWA 3B51X 1XZMA 3QY9A 4Y1EA 4Y6QA 5LA6B 4D45A 2VS1A 4DW8A 3INGA 5C1OA 1GVHA 1RXUA 3FR7A 4EO4A 1VPVA 2MSNA 5ITZB 3GLFB 1DJLA 4M87A 4B6GA 1R5JA 4QGAA 5CFQA 5JSZB 4OP3A 1CR4A 1S01A 1A2BA 1FP4A 4YGXB 2D9HA 1RVDA 1JI0A 2EPCA 1I7LA 3R7LA 1EEHA 1V1JA 3KETA 1Q1EA 3G0BA 1QORA 3G9TA 3ZDZB 1MIOB 1UWKA 2Y77A 4ZOQI 5A04A 4NJEA 1NVBA 1JJBA 2J3DA 2OB2A 1XWWA 2XUOA 4R2MA 2QEQA 1TADA 3S8MA 5FAKA 4MGZR 3R3HA 1YACA 3FWHA 2WAMA 5JXGA 3IL2A 2OTCA 2Q3HA 4R0VA 3ANMA 2ECPA 2FZVA 4HG2A 1TM4E 2GCOA 5IJ0A 2AHRA 4DSZA 1J5XA 3TTXA 2JI6A 1KNQA 5LU9A 3WLOA 5HF8A 1ZGAA 3MJEA 4BFLA 1N77A 3F4BA 4WOPA 2B8WA 3GHHA 2CNNA 3CONA 5JPIA 3ETLA 4KXWA 4TZKA 4GH5A 2QUHA 2YQ4A 4MVJA 3STWA 2EWWA 3COPA 1KGSA 4NL4H 1E7YA 1Y8CA 3D6HA 4HQ6A 1W0CA 2E49A 3HDVA 3R0VA 2W11A 4MI3A 4BMVA 5K6AA 3Q2KA 4YONB 2ODWA 4AZTA 3VBEA 1DIGA 4EHHA 1BU8A 1KZ1A 3U4CA 3ZR4B 3P7MA 4P3KA 1Q1NA 1T1EA 5JAZA 1TF2A 1U1GA 4HLCA 4AF8A 2OO3A 1VLVA 3TSAA 1AGPA 1NDQA 3OKAA 1DUVG 3WYDA 1M7BA 1NQAO 2WMYA 2PYDA 2XB8A 3PD0A 4RHYA 2IDZA 4C3UA 4Q1DA 9GPBA 1J2UA 2ETXA 2YRHA 1ZVMA 3D4IA 2O8DA 1U7HA 3CQ9A 3DP9A 4CQLA 2YRKA 2W9XA 2Q41A 4L76A 1V35A 5KSWB 1KRXA 1ZK1A 1M7GA 1XKTA 2E4XA 3KQYA 2B4YA 4QUKA 2BLNA 1KETA 2AXQA 3PQ3A 5E2IA 1OLUB 1SUEA 2PN1A 4RJIA 3ZXUB 2CPNA 4YRJA 2ZJ7A 3GLUA 3OLWA 3G7UA 4IIBA 3FFBA 4D8UA 2ZSBA 1PL0A 1PG5A 1QHYA 4YMTA 5AVWA 2O8FB 3ESDA 4B7AA 2CV1A 1I3NA 1Z0UA 2PLNA 3ZGVA 4LX0A 2ZU0C 3KZXA 3UG6A 5IFLA 4FOOA 5ES3A 1UC8A 3VHXA 3B5JA 1M6HA 5BMVB 2BBGA 1UJNA 3HVUA 5BSMA 4RY0A 4FDTA 1EQ2A 1Z5ZA 4NV3A 1Y1RA 3HV0A 4OFZA 2AUNA 1QS0B 2VF8A 3U56A 4L1KA 2DPGA 3NT4A 4RDHA 3RYIB 8ABPA 1CZUA 3NHRA 1QZZA 3EMKA 3AF6A 2ID7A 2WD9A 1S8FA 4ZT3A 5I9SA 5KDOA 3N7TA 4IQGA 2J0QA 3U4GA 3FTCA 4MUJA 4IVQA 2P9CA 5GJBA 2BZ0A 2H59A 2KS6A 3O1IC 1EFDN 1UJ2A 1HWYA 4NQZA 1ZR2A 2JL1A 1EVYA 3DBHB 3OG9A 4AJLA 3V46A 4DS3A 3HABA 4DV3B 4YP9A 4ZYXA 2Y92A 3D3WA 4ZU3A 5JNTA 2QJFA 1SKMA 2YOHA 4MUHA 3CKKA 3CUUA 5JDIA 3CSDA 3UAGA 1FXSA 1U4NA 3K0EA 4U00A 4ARZA 5THKA 1AN0A 1LI7A 1O6BA 4Q48A 4EGAA 1E0DA 3QVXA 4ZI2A 1Q57A 4YUAA 4CEIA 1XLVA 2NUGA 1D6SA 3NO4A 3K8ZA 4KYIB 1JHQA 3H2KA 1ZVKA 2I66A 1PZHA 1QP0A 1DO2A 2IS4A 4PLYA 4UVHA 2JEOA 3N9IA 2WU8A 3ZY6A 2NSHA 3KB8A 1AVTA 1BX1A 3P71T 3L07A 4Q6BA 5HRUA 4IXDA 4JIGA 3PJEA 4P7JA 5L4LA 4AU1A 2EWMA 3KNZA 3UAVA 5T6JA 3OTOB 1S1MA 3OZ7A 1W73A 4KO2S 3N70A 1V25A 1CLUA 1TK3A 3VSAA 3GF4A 1SPBS 2F1JA 4MUKA 2V6FA 3K2IA 1E18A 5DX8A 3KZKA 4ZU1X 1E98A 2GCGA 4TS9A 3W8NA 1NATA 2V3WA 2R47A 2VJDA 3NI2A 1T4NA 1UMCA 2B94A 3DYIA 3KUKA 3MTAA 1LK7A 5KYWA 2JJ2D 4OUDA 2E1RA 3LZCA 3FE2A 3UUFA 2GCNA 5JS6A 3OI7A 4M8KA 2QQGA 2I4MA 3EFHA 1F2IG 3M8KA 4D9JA 4E7PA 3WS7A 1E77A 3HKCA 2EMFA 3CVJA 5GGXA 3VR6D 3KZCA 4XD7D 1NI4A 3PE3A 4WKPA 3ET5A 1XRJA 1XCLA 4KXQA 3X2SA 2JFXA 1PFUA 2R9VA 2NZ8A 3LIPA 1DDGA 4GDMA 4XEUA 3F4KA 1YRLA 5CGZA 4PM4A 1KQFA 1WXHA 3BGDA 3PT9A 4PCUA 1HT0A 1E4EA 4KL8S 1GN9A 5AWFC 3SLGA 4G0PA 4YJHA 9MHTA 5IVPA 4CM3A 4DV0E 4PR3A 1CFJA 1HOXA 1L5RA 2BFDA 3AX6A 4E12A 1E3TA 8AT1A 4OIMA 4JLJA 3HKBA 3MGCA 4C7KA 3OM0A 2FWAA 1KF0A 4MKZA 1RS0A 1RWKA 5CA1B 2PD3A 3MW8A 5HE8A 4M9QA 1HUQA 2DLNA 2QN6A 1IBSA 2I8AA 1VMDA 2IXDA 3ABOB 1TCCA 1G20E 1I0LA 3PITA 3TPCA 3ZHRA 4CBVA 2FMUA 4OHXA 1CUCA 3ECAA 1S3GA 3RJ9A 4BNLA 2FMFA 2DXIA 1U1IA 3RU2A 3T94A 2CHVA 2GPAA 1GKKA 2IUFA 2X8LA 4BKRA 3HK2A 2WJAA 5A6SA 4QXQA 3KLOA 3EWNA 4F4FA 4CL8A 1DIHA 4PG8A 4ESEA 5AOCA 2X0FA 5DI9A 5L4NA 1Q6ZA 2A1UA 2VSXA 1JHVA 2OGSA 5E9QA 5CBPA 1W48A 3T7RA 5I7EA 1XZIA 3HWWA 4BS9A 1GWNA 3KUXA 1X0XA 3NPAA 4HH3C 4IJ5A 5LBUA 4ZYGA 1KNXA 3K09C 2DG2A 3HB9A 3F9CA 4V0KA 3OLZA 1A8SA 1WZEA 2VDVE 3B1XA 2P9QA 3B6MA 5D2CA 1HLGA 5B6PA 1V5WA 4TL9A 1SOUA 3I83A 1F51E 2FX2A 3B6KA 3PQ2A 3JQFA 1CR6A 1NYRA 4BHTA 3AVOA 2WBSA 1BXGB 3TDMA 3C3MA 3HVRA 1M2WA 2W2KA 2NUFA 2RTXA 3PPWA 4JNCA 5HM8A 1FQWA 2QQEA 4FKBA 3CV3A 1A9QA 2HWYA 4D9KA 1FU4A 5JROA 3OECA 1SOWA 2AEJA 1COWD 2FMTA 3TR5A 1CJVC 2QRHA 1RPNA 4B8ZA 2PEZA 3E3LA 3OQVA 2H9IA 3NXKA 2CL7X 1DRKA 2EIHA 1YUBA 1NOKA 1J8QA 4H7FA 2QRLA 3R4VA 4NFSA 3IEVA 4B3MB 1ZRMA 2YZ2A 3W3AH 1H2ZA 1RRFA 1M2GA 3JAWB 3LT4A 1YB5A 4R9RA 3C6ZA 2FQ1A 2VJMB 3GFFA 4Q82A 3HXLA 1L7NA 2AG5A 4N9WA 4DY4A 3W2TA 1C5KA 1JILA 2A7QA 3L5KA 3S1LA 1T38A 1EP9A 2ORWA 4I3FA 2XUZA 4KXUA 1F06A 3VJKA 1WNFA 4NXNE 1U2GA 3FHJA 3RNOA 3WG9A 3FWKA 1ZUNA 5F3WA 2PX8A 1YQDA 1GCIA 3VVMA 2QW0X 3OF5A 5EP3A 3ADCA 3HUTA 3ID6C 3LA6A 3OZWA 4YR7A 4CDGA 2RQLA 3K0SA 4UMEA 2PSDA 3QKSA 2H3EA 3LDFA 3Q1LA 5CB8A 4L4SA 1M2OB 5T67A 1P1JA 3ENVA 2WY2D 3KSRA 1KDYA 1U9JA 1CK4A 2Q5FA 1Z2CA 1T1JA 1MC5A 2VPPA 3DQPA 4H7HA 2X2OA 1JKJB 4LHVA 4DJ5X 4QEZA 5FULA 5FFNA 2Z08A 4R9NA 5DLEA 4BQPA 1M33A 1USIA 1HNXE 2RSMA 2A9KA 4KUGA 1GTG1 1S4QA 3LDGA 3FBTA 5CR9A 2C0PA 5EE5B 3RS7A 4KOEC 4QSMA 4GF5A 4LSWA 1RP1A 1V16A 5A2GA 1VHJA 3RB8A 3C4BA 4TMFA 2H18A 3G0GA 2GSWA 4I9UA 3FLBA 3GDOA 4TRNA 4EF4A 2JJ2A 3V1UA 2I3DA 1KPGA 2W4QA 2WF7A 4WJZA 1OTHA 4RPKA 5DDIP 3T3DA 1ULUA 4WLUA 2EW8A 8ATCA 2J9GA 3FX2A 5EP2A 2JLSA 1BKSB 3PFGA 3QU5A 1TA4A 5EWMA 4LWQA 4XD7A 3VR6A 4C0BA 3PNBA 1NYQA 2QNBA 1RTKA 4LRUA 5EIBD 3LFHA 3W2EA 4LF7E 1EDZA 4BRWA 2A6PA 4N4AA 1X1QA 5HRCA 4WUTA 4C4YA 2H1WA 4PNHA 1NUPA 4BN0A 2BEWB 4C7JA 2Z6UA 4RPCA 2CVFA 2WTMA 2ACEA 3DWGA 3O4VA 2Y9PB 3QE2A 3CW2A 1Y5IA 2E3JA 3E5HA 3OESA 4HH4A 4TX1A 1TKBA 4TWIA 4XUEA 5GINE 1I4EB 4I6EA 3VRHA 1U9CA 4HWTA 4XQGA 4QQNA 1XTBA 1H65A 2ZRMA 2A5LA 3AJ8A 4YJ3F 3S2FA 4X63A 4DTIA 5A5FA 5LOVA 3UK1A 2B25A 4NLLA 2Q7OE 3FCOA 1Y1PA 3X1JA 1ZLYA 4EJ0A 5JZMA 3AZQA 4H15A 4L72A 3BMCB 4ZCLA 3T5GA 3GRCA 2J31A 3EVDA 1QONA 4OBXA 3SE0A 1MRSA 1TVEA 3I8XA 4BIIA 2KBEA 2Z1NA 1MEEA 1ZN7A 2C4KA 1X87A 3GIWA 1OASA 3AFIA 1RWPA 3GY0A 2REXB 3K5HA 4BJ5A 2L18A 4DZRA 1EWYA 3UUEA 2A33A 5AKIA 1TTPB 4FM9A 3IUQA 1T5OA 1W30A 3DFIA 4PLFA 1MU0A 3KQQA 4F06A 1S8AA 2JD2A 3G9UA 1KH3A 1LGYA 1NJ5A 4C0LA 3TJMA 3BT7A 3GVHA 4YXFA 1KS2A 3OZSA 1J09A 5A6JA 5DOZA 2I2BA 3UB2A 4DV2B 1Z6AA 2PWBA 3JSAA 3UQYS 3I01M 5U1PA 4H7PA 1A9SA 1QCYA 1QJ4A 3BHJA 3F6PA 1FDIA 4O43A 2EMLA 1AQYA 1NN3A 1FC0A 3NGLA 2YZGA 1CQIA 1NQOA 3K9HA 1BE8A 3PQCA 1X15A 5DW0A 1RTTA 4LUCA 1X6EA 2V54A 4B4KA 1UK7A 3HVKA 2QMZA 3EXG2 5FL7D 4BO7A 4FCTA 4MR8A 1QLHA 1K8YB 3QXSA 4URUR 4B6QA 1YZGA 2C8VA 2G9QA 2I2FA 1VHDA 3RYFB 4CMGA 2EOZA 4KX5A 5LLSA 4Z51A 3TTYA 1X2BA 2UZ1B 4FT2A 4ZT6A 3WWEA 5A7FA 1AQNA 4C30A 4ZYUA 1LPAB 1LPNA 2YVLA 2EL4A 5EIEA 4QDTA 1WULS 1FVFA 1JQBA 4G1UC 2DQKA 1EVQA 3NC1C 1WDWB 4MQFB 2IX3A 2RDMA 2ELZA 5AQEA 1HMPA 2HIGA 4AJ2A 4JX8A 1E3JA 3VPSA 4U9IS 4BQNA 4ZO7A 1YVUA 4WESA 3ZWPA 1W5AA 3DOUA 1COWA 3F6YA 4C7XA 1SUWA 1E1LA 1Z6GA 3SEZA 4OLBA 4WCFB 3DR5A 4EYKA 5KWVA 2KB0A 4JP8A 5CLQA 4EPTA 3KT8A 1AKTA 3P96A 4KXFB 1ADBA 1VYTA 2YH2A 4ZA2A 6PFKA 1ZI8A 2F1OA 1YDHA 2FZ4A 1MV8A 2IYSA 1YAJA 2HLDD 3HSSA 3L41A 1Z0AA 1Z73A 1ES9A 1ZDMA 3GXBA 4ED9A 3PRJA 4QGBA 3OJOA 5HIIA 5HUJA 4JR1A 2P6RA 1ULTA 3NVMB 1XQYA 1Q84A 1TPYA 1MJFA 3F7TA 3FIUA 3DSRA 1YPNA 1EFPA 2D62A 3LLMA 1KVUA 2P5UA 4X3OA 1OWLA 2OKCA 3ZD9A 4BNFA 4GMDA 2EWVA 4X20B 2O2EA 5GONA 3W9UA 3IJ5A 1IBME 2XUIA 4KAXA 5BR7A 4XRRA 3EGEA 3PCRB 2PWZA 3MGGA 1P39A 4PGAA 4DSTA 1AV6A 3EGXA 2ZSIA 5BYBA 4B6EA 4W5RA 3EOZA 4OGWA 2G1UA 3OWHA 3QFRA 3RK1A 1PT8A 3I9KA 4M2ZA 1Y9JA 4LY6A 1GPWB 3ED5A 1GLNA 5T5QA 4JR0A 2QB5A 2RHCA 2WK1A 4DUGD 1EVJA 2JH8A 2Q6TA 5LWQA 10MHA 1RXIA 2R8YA 4KXNA 4HYEA 2C31A 1AHHA 1QGZA 1Z4KA 2ZYRA 3E4DA 4YP6A 3UHJA 3ZY3A 2OKGA 4HD8A 1O9BA 3BG5A 1ZXLA 2AZTA 2AYYA 4GLJA 4LGMA 2UXDB 2J9FB 1WSAA 2FPSA 3AG6A 3EK2A 4MGEA 5FJJA 2EOMA 4N41A 4EDFA 1GG8A 1ZM2A 2V7XA 3UK2A 1L4NA 1W5EA 4M6WB 3QV1A 5K4AA 3FSEA 2NVBA 3V8PA 3OJLA 1DCTA 4AY2A 3L7IA 1E2GA 4I5DA 3JWGA 4MIKA 1A9XA 1VYUA 2BRUA 2VUUA 4M8SA 4WY2A 5BUQA 5FNVB 1UFKA 1JLSA 3DPSA 1J07A 1RKXA 3RCBA 4LDAA 2KBFA 1XTPA 3AY3A 3K5PA 4PGGA 5A9SA 4MCJA 5JJBA 3HXQA 2PFGA 3AVPA 4X8OA 4EP1A 2C1XA 1XTKA 3H2JA 4NNJA 1UK6A 5FPQA 4XYGA 4C4XA 1I01A 1T36B 1JDBB 4LJKA 3IWBA 3SLKA 4CQMD 1II8A 4ZC8A 1ABBA 1ZAAC 3TLXA 1A69A 1L1RA 3I2YX 1QAOA 2Q6OA 1X48A 3AB8A 1EUQA 1FFCA 4MO2A 5JS1A 1XVIA 2J0VA 1I4OA 2JFNA 3CRNA 4B35A 2HMWA 2FN7A 3A6DA 1QK5A 3SU8A 4OXXA 4RGVA 1G21E 1PDVA 3L6RA 2EM9A 3AEKB 4D4JA 2OAP1 5K51A 2YX1A 2D2VA 2HHHE 3TD6A 4O3MA 5CHYA 2IXBA 1DNPA 5TMDA 2V7VA 1G7SA 1F2TA 4FYWA 3TGWA 3ZJUA 4N6NA 3WXBA 3DEYX 2UUAE 1GQSA 1OXBB 1YYOA 2B21A 3I6YA 4GX5A 4YAEA 2WJHA 4ND2A 5TV2A 3TI9A 3A4LA 3V2HA 1ZPDA 1WETA 1BWPA 4NBWA 2WF6A 1MTOA 1GSOA 4H60A 1MMFB 1NUTA 4AKEA 4KVAA 4AZSA 1QZXA 1V9SA 4LJYA 4O1MA 4O3FA 5IN5A 3RUIA 1Z4IA 2FEPA 2VHWA 5KNBD 1GHTA 1Y48E 3VKHA 4JI0E 1IQRA 1N9ZA 3BGWA 2MR6A 3IJRA 1OT5A 2ZIWB 2AJBA 3H97A 1IPEA 3JYQA 5J2UB 4EA9A 3V3TA 2B3TB 1LQUA 4JLMA 2R8EA 5CH3A 1DUSA 1OYYA 1QO7A 2JK1A 2H4ZA 3O1LA 1FS6A 2FW6A 5FL7A 5BSHA 5AC4A 3TGPA 2PH5A 5I4CA 4JI2B 5LBTA 3MMXA 2AOUA 1O58A 2QPLA 4MJ3A 1GLGA 1KJ9A 4NJEB 4CCYA 2W00A 4L8YA 2H1LA 1KIFA 5CVCA 3C5EA 5SZJA 5AJYA 3WVNA 1PGOA 4ZCPA 1G5RA 3JQDA 1A4XA 1CJCA 5LYJF 3PKIA 2WJ6A 4KE7A 5E3JA 3WLMA 4LGCA 4HAUA 5IJ0B 1WRBA 4GLBA 1NT4A 4XXHA 3KE8A 5E2BA 3E2PA 4BAZA 3AETB 4U2KA 4YRDA 3L77A 3UCFA 3VISA 1FSFA 3G8AA 1YZ3A 3MUOA 3KTOA 2CSUA 3PNOA 1KYYA 2F1HA 1SQFA 1G8YA 1ZITA 2WSIA 4QLAA 4HPWA 1MT0A 3RK4A 3G7SA 1Y6RA 1RU3A 2NZJA 4PTYA 1EGVB 5DN9A 3VDXA 3UB3A 1MB0A 1N5KA 3H4MA 1NIPA 4MRRA 4EENA 1WLYA 1Z0DA 3D7MA 3WLKX 3K53A 3UHFA 3J7Yp 3NETA 2IVZA 2ZJAA 3FJOA 4JVLA 4W99A 1M9NA 3ZGYA 4AG5A 2HLDA 1EK2A 1KAEA 3G0DA 4N5HX 5AUOB 1OFVA 2XIJA 3JQPA 1KZYC 5EP4A 4X7BA 5ALFA 2IHVA 4BXOA 2HMSA 2OXFA 4RM3A 4RWZA 2PG3A 5J2TF 3RF7A 3T9FA 4IGKA 1AUVA 3ENZA 4HI0E 4ASUD 3WNCA 1GU1A 2O14A 1SPXA 3ETJA 3H04A 2QUJA 4IDCA 3G2KA 4PSAA 2C97A 3I4FA 3I30X 4CQLB 2O8DB 1EVLA 4WNAB 3RV3A 3MWDB 3QM1A 1N36E 3DE2X 1DZ3A 1TUGA 3TKAA 4ZTZB 3PE6A 4M36A 1UXJA 4LXQA 1JKXA 4MDFA 3UMVA 2PGDA 2BH2A 4GX1A 1UIRA 1XMQE 3NTXA 2A8YA 4LZJA 4EJSB 2OXEA 4FX5A 2QR3A 3AXSA 5IZCA 4Y2RA 1XZCA 4ND7A 4DUGA 2JATA 1V4BA 4DSAA 4PC1A 1SB8A 2GXUA 3JTZA 2OG2A 2OORC 4B33A 2KYRA 2WTAA 2XWJI 4IZOA 3TOXA 4J07A 4RJKA 2YQ5A 4CIYA 5LQNA 4GE3A 3D43A 1OTYA 1R0ZA 4LTNA 3K70C 2Y2VA 4ZYVA 4TTJA 1KDRA 1GLVA 3QPBA 3REQA 3KFXA 2XRFA 4JQZA 3WWYA 1U0GA 4CV1A 1V7CA 3CEJA 2I91A 4NXMB 1VCOA 3IUJA 1KP3A 3H3XA 3ZY5A 4LECA 4OQYA 2A86A 2AG1A 3FNIA 5T41A 1JSZA 2X5NA 3RKRA 3RUPA 2IZOA 1ZZEA 2BFFB 4S3MA 1COZA 5CGQB 4KJXA 5CIYA 2RHDA 4MYHA 3TQCA 4G01B 1X7DA 3DUWA 5JWOA 5LFAA 4DWJA 3DCYA 1YHYA 2ZTMA 3TBKA 3VR1A 1CUDA 1M6VB 1P6QA 3SXUA 4FB4A 5BNZA 1FS5A 2Y93A 3E03A 2QV0A 3UMMA 3ZDDA 3JXEA 3FKJA 2V0GA 4PE5B 4CQMA 2CL6X 5JNLA 2VDJA 2B92A 2BL4A 3H5TA 3M3HA 4DR4E 3A1NA 3NVAA 4HGOA 5DM1A 1MH1A 1FNNA 2G8NA 2GZHA 3ADPA 2WFLB 2BGUA 1IJFA 4HS4A 3TSYA 2BPOA 3FSRA 1WBBA 1UXIA 3A4TA 2VP3A 3JRXA 5BSTA 2O19A 3LIIA 1L3BA 4B6OA 1EDOA 3C45A 3SIWA 1C0EA 2E55A 2P1DA 3K96A 5FEMA 2HCBA 4LXIA 4CEIB 4HHEA 4NECA 4C6SA 4EHLA 2I4RA 4IHQA 3CISA 3RUHA 1JXQA 3ZW7A 3PGJA 3OP4A 5JADA 4YIKA 2M1SA 2B8TA 1KDPA 2YWFA 5KKAA 1JPJA 3WQBA 4BNUA 4DCSA 3QEAZ 2OD7A 5COBA 7ADHA 4RO0A 1M6NA 5DTJA 2NLOA 1SULA 3KAJA 4MUBA 1K8QA 1UEXC 4B3IA 2CL0X 3LKVA 2W42A 5BV2P 4HDMB 4JBIA 2K6GA 4WEQA 3GNSA 3C24A 5DXAA 1NVFA 3Q7SA 1V9CA 5TSDA 4JUDX 1LSJA 2BEVA 2IYUA 1BEUB 4OHFA 4BNTA 3D6UA 2ZB7A 1IZYA 3DEHA 4HEA1 4MB0A 1CQZA 1EWKA 4KWIA 5KNBA 4JI3E 2WAOA 4ZEXA 3D2AA 4UOEA 2VNJA 3REOA 2J87A 5E6RB 1SO8A 4E46A 3MLAA 5CB0A 1R88A 4OUDB 1FJHA 1PUXA 1A77A 1U28C 3B1WA 3GLHB 2VQFB 5JQGA 2FN8A 3IO5A 4U2EA 1QYXA 1W5TA 1QDEA 2ZRIA 4MB6A 2BBWA 1GGFA 1MW9X 1M1NA 3HVHA 3FPAA 3TQQA 3HKCB 4AQYB 2IS1A 3TYXA 2PV0A 1P0MA 4YCCA 3HLTA 4LEIA 2IW3A 3M9LA 1MOSA 3RSFA 2J3JA 1E63A 1HZZC 4G4SO 4RDCA 3KXKA 5BMOA 1FTYA 3OJ0A 1KIMA 5ADWA 2RH8A 2PCJA 3K0FB 2CV2A 2GUWA 3U44A 2FB9A 4F56A 3JD0A 2WKPA 2FOXA 1E4EB 1TYDE 4KO1S 5AIAA 3H65A 3OQNA 3FDFA 3IUEA 3DV2A 1G8PA 4RLSA 5K0NA 5ALTA 1HQCA 1HQYE 1SUFA 1CUAA 3GAMA 3VZDA 1CCWA 4YPOA 1EK0A 2BFDB 5ALVA 4DDKA 5A69A 1BS9A 1TM2A 3HKBB 5D3KA 3IVRA 1V9LA 1YFJA 2DQ4A 2IA5A 4WZAA 4KIWA 3WGKA 1J90A 1SQSA 1TEHA 1ZJ4A 4R1LA 1XJ5A 4I36A 4K9OA 3MTGA 2FK7A 2P0AA 4O4JF 3SM9A 2FGKA 1JEEA 1YL6A 3H5NA 5HF5A 4GT1A 1K6EA 5E0KB 3ZE8A 2PUGA 3Q7PA 4A73A 1I5EA 5FO0A 1JFLA 5TQ0B 4ASUA 4EMTA 5FD8A 2DR2A 1YC2A 4E3WA 2UYGA 5JAUA 4JVOA 1ODJA 3RHFA 3BAFA 1V7PC 3G8DA 4DBVO 1NVDA 1SXJB 4U7HA 4WFIA 5JSKA 4FNAA 2QTVA 4RJTA 3FYHA 4MDEA 3KEMA 3LDAA 4AG3A 2F7SA 2XMDA 4JJ4A 1Z0JA 2IP1A 1D4AA 3I4CA 4QM6A 1GNLA 2XGSA 2Y66A 3EBOA 2ZRKA 3L0BA 2W48A 4H77A 1WBDA 1EFAA 1WUIS 1YNSA 2YIVX 1PJ2A 3PGMA 4Y6RA 4DDUA 2YYYA 2AX3A 2KHXA 3L04A 1DEOA 2C4MA 3CLTD 1GQYA 1U6KA 4TKLA 2QRMA 4U02A 3FPFA 4PIMA 1XLTC 2DLQA 2PX3A 3GVCA 1JZSA 3B3GA 4AY3A 4BATA 5FFFA 2Q45A 4PLZA 2VSFA 4D8TA 1JFSA 2QDXA 3HNPA 1IXZA 1JQLB 3A4IA 3ESRA 3ZIAD 4ZZ1A 4ZAGA 3VVBA 4RETA 1ODTC 3MXOA 5A06A 2QE7D 2XZTA 1U0OC 3OKFA 4G24A 4IKPA 5HZHA 3UCXA 4RDIA 5EGSA 4BKPA 2FUNB 2AEFA 3HYTA 4NONA 4BMXA 3LUCA 3ASZA 5F1PA 4ESOA 5HSGA 1U63A 3MCTA 3SN6A 1PT5A 2JKYA 3OOJA 3PE4A 2AQ8A 1GD1O 1SVKA 1WIWA 2OHVA 2VDWA 3DKVA 3IOEA 5CB4F 3KAQA 1EIWA 4QODA 4B3CA 3G2MA 3VPXA 4DWWA 3T61A 4FMDB 4YJKA 1PVVA 1E1QD 1TJYA 2HCFA 4K7JA 1EZ1A 3PPYA 2QUZA 1N2JA 4MRMA 3UY4A 4R8VA 4FNOA 1D7OA 2IHJA 3CTPA 4LBWA 4R3WA 2BMEA 1QUEA 2UUOA 4IWNA 1GNRA 3GLTA 1KK1A 1SEPA 2AXPA 3X44A 2JA1A 4Q4JA 2O7RA 4ZDJA 1KFKB 1I7PA 1RXSA 4KE8A 3L4BC 4FMBB 4J1NA 1XZEA 6ABPA 1ZP6A 2C5GA 1KY4A 1Z4LA 3CKLA 1V1MB 2AJCA 3KBBA 4IRUB 3VOAA 2SKEA 4JI7B 4E88A 1ZM3A 4ZOBA 3T34A 1Z0SA 2G67A 3K16A 4RZ2A 4A2PA 5B4VA 4HOYA 5DWQA 2FE1A 2AH5A 4KKXB 3LAWA 4S05A 3EVEA 3LCMA 2HX1A 2NO6A 4R2XA 4ROTA 4UHFA 3PLNA 4FDVA 1PU2A 2O2IA 3NP7A 4IEEA 4XIJA 3TLBA 4E2FA 4A1FA 5ALLA 5IU6A 3TZEA 4JLUA 1YS1X 4C4RA 2RGEA 3GGCA 4W7SA 2PBZA 3M9WA 1H0HA 1KDVA 5DN6D 1QU3A 3H2YA 4HEA6 1DQSA 3N58A 3FZNA 2G4VA 3FKSD 2XA1A 5ALZA 4R2HA 3T9EA 2DH5A 3ILSA 4LYFA 5HF6A 3S5JA 3X2EA 5ITWA 2QNRA 2RIRA 1PWEA 1R4NB 1GKIA 2EQ1A 1PS9A 3WAKA 3F3SA 2PD6A 4ZV7A 1G18A 3BGSA 3R3XA 4QU8A 4RD6A 2R2AA 5E1DA 4ZVPA 4AN4A 5IC4A 3L5OA 4FVTA 4IJVA 5L3VA 2IDJA 2V6MA 1U8XX 2M1XA 4U1RA 1DEKA 5EWMB 4NV1A 4Q7MB 4ZYYA 3W5DA 2CZGA 2DFPA 3LPLA 5L7WA 2P62A 2ZB8A 4JT9A 3SCZA 1LNSA 1IHOA 2OV4A 3FLEA 4QREA 1WUKS 1FP2A 2KQUA 4TXJA 4MYCA 1YULA 1EMDA 5F9HA 4NS4A 2R84A 2XMPA 3M89A 3LVQE 1WJPA 2QLJA 4HGPA 4KXVA 2XXJA 2P41A 3ZV6A 2V1UA 3NHJA 3GN2A 1QF6A 2BELA 5JNRA 1YFHA 2XCOA 4YUWA 3G0HA 1RBZA 3B82A 3OD1A 1OYVA 5P21A 1M2JA 2QVCA 2G9NA 1KU6A 3LS2A 5HIKA 4D25A 2FN4A 1P2FA 1MQ9A 1AKQA 2XTZA 1TQ6A 2XTMA 3A9SA 4QFMA 4W7HA 2PTGA 3NJ4A 1MFPA 1W96A 5SICE 5ER9A 4KR9A 5KOHB 5CDYA 3CIFA 4ZVRA 4NU8X 1CT9A 2EL9A 1E3WA 2I6XA 4E3ZA 1PO7A 1CY1A 1PZGA 1HE2A 1KOJA 3SZOA 2VPQA 1A88A 4U3JA 3WIUA 5BSEA 1ZD4A 4KFSA 1PL8A 3RJTA 4D9GA 4O24A 2XBMA 4BQSA 3BK7A 3K4HA 3B89A 3WYCA 5DBGA 1E2MA 5JW6A 1Y3AA 4N8EA 4FEAA 3BMOA 1Y5LA 2H9AA 1D1TA 3JAMA 3LH5A 1N1GA 5I9BA 3LSYA 2E18A 1I51A 4OSPA 2IVFA 3IERA 4XIFA 2FV8A 2WYVA 1U8FO 3R75A 5JS8A 3DXFA 2CKDA 3ET4A 2W70A 5MN4A 1O03A 3KP1A 1FNCA 3JS5A 4RH1A 1PR2A 4FX2A 4OATA 1Y7PA 3TDNA 2YFYA 5KOJB 1KJNA 2CLEB 2I2DA 1GCAA 4UEJA 4MR8B 3CGWA 3ZKWA 3WB0A 3Q6MA 4J9VA 4E32A 4B83A 1B0AA 1EINA 3V7UA 5KREA 5BPHA 3QXXA 2W4IA 4NNPA 1A4RA 1CF9A 1ODFA 5E6UB 2BKUA 4GEQB 3IBCA 1N6RA 1T2AA 1Z5GA 3EFOA 4DQVA 2BUAA 2JGLA 3UPTA 1MX1A 3Q72A 2QRUA 3DLAA 3L0CA 1CW2B 3WTBA 8GPBA 4FGLA 3ZIAA 3T1OA 3L0DA 5KVCA 1TEXA 3S1AA 4UVDA 4UCFA 2ONKA 1T9KA 1GUYA 2ZWPA 3HP1A 3L93A 1P8JA 2QE7A 4Y1GA 4MV9A 5AKJA 2DGDA 1S5PA 3IRUA 2ZWAA 4H4DA 4DRXA 4MVJM 3B3AA 3EVNA 2ZBQA 4R1QA 1OYWA 1OZHA 2BE9A 1GSHA 4RPGA 5AKKA 5EJIA 3NX4A 5JT1A 4GRIA 3Q7QA 2VXBA 4BFZA 5FT9A 1Y9AA 3F6BX 3LUBA 4G0VA 4MICA 1QQTA 4BMDA 4QSHA 1YGPA 1DX4A 5HG0A 4E5YA 2DFLA 3A9RA 1V5IA 5A4MS 2X3UA 4CM9D 1BU5A 2JEZA 4Q5IA 3P0IA 1E1QA 3TNJA 4C21A 5JZBA 4ANFA 2M7QA 3LQ1A 1S3IA 4GKKB 3TW6A 2PGJA 5C1DA 1UPXA 4ZVKA 5ICSA 3IUYA 3U17A 2QT9A 1E3DA 4LI0A 1ZU5A 2GKOA 3OFKA 4CMIA 2AX4A 3QSYA 3KXLA 3QP9A 1G3MA 3R0QA 1JYEA 3IEUA 1M2FA 2WIDA 4IDFA 2Z2XA 4MS1A 4IOKA 4AP6A 1EWVA 2AEEA 4I8XA 1H4QA 2G0TA 3GXOA 1R4ZA 3TRJA 1CUWA 4TN1A 1E6UA 4R81A 2J5QA 2PH3A 1XDDA 1M2HA 1P0QA 1U3DA 2HFKA 2WTXA 1RKVA 3DE4X 3NBYC 5DTQA 4DNFA 2V58A 1NVGA 3BFVA 3KT6A 3O82A 2WKSA 1CJSA 4PO8A 5JASA 3B9PA 4I55F 3LE8A 4XB1A 5IJAA 1LBEA 1NW8A 1QE5A 2ZB3A 1GCUA 2CVZA 1Q14A 5C7IO 4OK3A 4B6PA 1I4LD 4PO1A 2NXWA 1AUOA 2HF7A 2EOXA 5DN6A 4D9MA 4EARA 1QRSA 1PBNA 3FKSA 3N2ZB 1J2RA 1T3TA 4ZVTA 1CR0A 2Q07A 4OKSA 3AZPA 3I05A 3RIMA 4L0CA 4BB6A 3IPCA 3M6VA 4XFKA 2EM4A 3T7KA 3AVXA 2P2NA 4P5PA 2ZBUA 4R1NA 3AI2A 3CMCO 4X5OA 3EHDA 4GOOD 2OUIA 1IRXA 1SXPA 2GZMA 5A9SB 1Z13A 4F7WA 4KQXA 3FDIA 1JG6A 3HDYA 2QGNA 3N0WA 1YHZA 3URKA 3TCXB 2YNMC 1P6XA 2MC5A 4QG3A 5AKZA 3OCYA 3PDHA 1G1MA 3HUFA 4XDGA 5TJHA 4F6NA 1II8B 3P94A 1NA5A 1DO8A 3PWKA 5GVSA 3SQWA 2EGHA 1DHRA 1QHFA 4ZODA 2I65A 3WWOA 1EUCA 1F2UB 3GDHA 3OCWA 5AM0A 1DG9A 1TO6A 5BQPA 5BN1A 3BXHA 3C3YA 3CC8A 2VT3A 3QI2A 1XLWA 4HMQA 5DPMA 3T38A 3UC9A 2NMVA 1KDTA 1ZRNA 4Q1VA 2Z2KA 3G85A 1BQ3A 1EXMA 1CERA 2E7ZA 1OOEA 4JEHA 5L3SB 4DABA 2HTEA 2JFYA 1FMTA 1Q77A 2QLMA 5ILQA 3CF0A 3EIQA 1YQXA 2O9JA 2G6TA 2XWQA 2K87A 2VDOB 3W5AA 1MDFA 1RPTA 3A0UA 3ST7A 1GARA 4C0XA 2EZ8A 4C06A 2D74A 1YQUA 2X1VA 1QNLA 5KVQA 2HQ1A 4DCOA 2OCPA 3QWBA 1QYDA 4O4HF 4IMRA 2FEKA 2B61A 4ZRDA 5HVNA 3DUFA 1TMKA 4CCAA 4M1ZA 3SHTA 3FWYA 1GCOA 1DQPA 1CVRA 1UJBA 3P9IA 3GQVA 2YL2A 1T2FA 2ELYA 1NW4A 2LVHA 2VDLB 3L7AA 1M6EX 4D99A 1RHRA 2NVOA 3RU3A 1DTSA 2OLEA 1KHTA 2OGTA 2R7MA 3ZD8A 1JSLA 3ZQJA 5A3QA 1ZOLA 2GZ3A 1X7YB 4OMCA 1IZ0A 2X0DA 3FUVA 2IZ6A 4GICA 2J08A 1LUAA 2R86A 2WWVD 4HPXB 5ELMA 1PVOA 5EMLA 5K8JB 2G17A 3AUZA 4BQQA 4DIBA 2IH2A 5FPPA 2GEVA 5EWLA 4DCMA 3DM5A 3L79A 1Z5OA 3T4XA 2VQEB 5ED4A 1L7QA 2NV0A 1JU4A 1K9SA 1MRZA 2EN7A 1ZUIA 3BF2A 1MEYC 2NVUA 4HNVA 1OR8A 3IKTA 3WYFA 3AERB 2MU1A 4WLOA 4D3FA 3C1AA 1P1BA 2Y71A 2OHOA 1CUBA 4L27A 3ITKA 3ADGA 3SFTA 5IDWA 3BK2A 2FPIB 2L0XA 3DT6A 4FK8A 2GTPA 2FUKA 4BV8A 4C5CA 4EO7A 2EFYA 5JU6A 4XCXA 1Y8QA 2EFGA 3ZZUA 4I50F 4CL2A 4GDFA 4WDQA 2CUZA 3K1AB 1L5MA 2Y0EA 3I1FA 2JJ1D 2IUUA 3JU3A 4BE9A 3J7AG 3IHWA 1NWHA 4IOMA 2EZ4A 4FYPA 3WDKA 2G07A 1RI3A 1NVTA 1VJ0A 1FVXA 4JYAE 2FU5C 3O93A 4QOJA 5J4HA 3LKDA 5LZ7A 1QHXA 1UK8A 3UV7A 5AHRA 1O95C 2IYXA 5EIXA 2EPNA 4HDRA 2QN9A 1DBSA 2YXLA 4H16A 4LF6B 4CM9A 3TJZA 3KJEA 4KQ6A 4M0FA 4OHOA 3W5VA 2O6LA 4ZIRA 1OBVA 1J5EB 1RJFA 2V8OA 2OPBA 2RS6A 4PLWA 4U7GA 2JFHA 3HU1A 4M0KA 1E20A 3EC2A 4JI1B 5CNJA 4DLAA 1H5NA 5JD4A 3T5BA 4DNQA 1BH6A 3DAYA 4NJMB 3GRFA 3GLIB 2FZLA 3B2EA 1GG2A 3I9LA 3IXQA 4LMPA 3GAZA 1CC1S 2CY0A 5JOQA 3WKDA 2R7KA 4QG7A 3UXEA 2P35A 5BV0A 4OL0A 5DM0A 2FWIA 2B83A 4QO8A 1ITZA 2C94A 3IP7A 5I9NA 2UUCE 1HDOA 3CW8X 1E8NA 4PPQA 2MMCA 1JLLB 3A1UA 4RGQA 4DARA 4YRFA 4EJ6A 3IV6A 4KNVA 3IQIX 5K20A 1T0HB 3EY9A 3RGWS 1UDAA 2ZIVB 4I8DA 3G9QA 4WXPA 1FFWA 2HAEA 1O08A 3ZWCA 4YRMA 1W4CA 3D8BA 3TEFA 3KPWA 1W4LA 3REQB 3EF0A 1BVHA 2C8JA 3VU9A 3NV7A 1LQ2A 1KJQA 2OQVA 1YBVA 4F91B 4J4HA 1P9RA 2ZU6A 4G1BA 5DBHX 3HXMA 2A1TR 4OMFG 3WIOA 1MKYA 1B00A 1DC6A 2AIRA 3H83A 1FQOA 3OX3A 1A5BB 4D46A 3ABZA 1B15A 5HCUA 1KDOA 1DX6A 1HDCA 5BWOA 3BFJA 1ZL2A 3QXJA 2GF9A 3A04A 5DO9A 1PFKA 1ZCJA 1M8GA 3T5TA 3K0CA 3D7RA 3F1KA 2VQDA 3WX0A 2HXGA 4NS1A 2EL6A 5ELLA 1S8NA 4BQOA 2FHSA 4PHGA 4NBNA 1M0SA 2P1ZA 1RW4A 2GXSA 1IDN1 5I9IA 1FTGA 2ZK7A 3PF8A 2QU8A 2VXCA 3OLCX 3WBKA 2UU9B 3VNVA 1W4AA 3KUCA 3ZHQA 1EK6A 1C4WA 1I2BA 1MAAA 1PLKA 2GHRA 3V4SA 3W1VA 1LVUA 3RH0A 3WQHA 4YEDA 4EZBA 3VPDA 4DLVA 4MQ6A 2WYUA 2GOYA 1JK1A 3OCUA 4O5OA 1G3QA 3WGMA 2JOXA 1SD2A 2J7KA 4MPRA 3AW9A 1GKUB 5TGZA 2Q6VA 5FI3A 1RMTA 4JI8E 1CZLA 1PLLA 1SUDA 2PGXA 4Q00A 1O7JA 4H1HA 4OEHA 2FPWA 4XPZA 3W6UA 2D13A 1K6XA 3LXMA 3EEFA 4URYR 3UANA 4HH0A 2EKLA 4Q19A 3C5HA 421PA 1KEEB 1RWNA 3LUHA 1U0BB 3LYLA 4IRMA 3DLHA 3NBAA 1PKXA 4FU0A 1E1RD 4G09A 3IWCA 4M1YA 3KZVA 1FLNA 1U2RA 3SD7A 4C4OA 1B43A 1B16A 4D8XA 3SLRA 3EIFA 2C88A 2J3LA 3CN7A 4MEBA 4WW0A 5EVCA 5JQGB 1Q7RA 3DNMA 2IEIA 1F3LA 1VKNA 2FJPA 3RIXA 3RUFA 3Q40A 2ZR7A 5SYAA 2WR8A 1QCCA 4WOBA 5G0WA 2WZOA 2BC9A 4UUQA 3LXRA 4JJGA 4HDNA 1T25A 3A7DA 4EHFA 1KVSA 1S89A 1D2EA 1KZ6A 4JKIA 5H68A 821PA 5EUBA 4AROA 1FFXA 1ECCA 1OKKD 1P4RA 2CZQA 2GBIA 2PQ2A 2XDWA 3D6NB 3DHEA 3GLQA 3GYGA 3MIZA 3P0FA 4MRAA 3V33A 5J43A 5LJIA 1FZTA 4M7OA 3ZVLA 2HOQA 3SZRA 1MGTA 1KWKA 3CUSA 3BIXA 4GO1A 2HIAA 2WABA 1PJZA 2ZJBA 4UBNA 3H0EA 2JJ1A 2XUQA 1RC0A 1ZBDA 3DDZX 3FF4A 2GPSA 4RZXA 4V24A 3L7NA 3STXA 4EVSA 4EY5A 5JAQA 3VVLA 1QXSA 3SS9X 2XI4A 2N1MA 2XYQA 1XNGA 2EQAA 1T4CA 4RHTA 2F9MA 1BVRA 4JA0A 4MVJI 4O2BB 1WLSA 3EDMA 4WZAB 3O73A 5DYWA 4GP6A 5EKXA 1P3JA 5TMBA 3PGKA 2QLNA 1TVCA 1F8YA 3PXEA 1P5JA 2BTOA 3GN1A 1Z74A 1FYEA 1PFGA 2PANA 4G4SP 5EIOA 5LC1A 4L74A 3SOPA 3UT5A 2IEDA 5ED0A 1O1YA 4DR5E 1TJ4A 1SHZA 3FETA 1IQPA 1D0VA 3G88A 2CDAA 3L1IA 3O8OA 4JBWA 3G8CA 5JLAA 3RBZA 5IWCA 2PD4A 4JH0A 4BZQA 2VP2A 1KYWA 2V3CC 1QMGA 1RWMA 4X3PA 2EZ6A 2PR7A