3C6KA

Crystal structure of human spermine synthase in complex with spermidine and 5-methylthioadenosine
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
363
structure length
335
Chain Sequence
GSRHSTLDFMLETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYEEIDSILNKVEERMKERVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Spermine synthase
publication title Crystal structure of human spermine synthase: implications of substrate binding and catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 335
sequence length 363
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.22: Spermine synthase.
pdb deposition date 2008-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
A PF17950 SpmSyn_N S-adenosylmethionine decarboxylase N -terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 3c6kA02
3.30.160.110 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Siroheme synthase; domain 2 3c6kA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3c6kA03
2BR3A 3C6MA 5E8JA 4P7FA 4PYNA 4MTLA 3TMAA 5BP7A 2P7HA 1RI1A 3LSTA 3GGDA 1AF7A 1WXXA 2ZBRA 3DLCA 3OZTA 4B17A 4RTQA 4RTLA 2AOVA 3GJYA 1HMYA 1NW5A 3PLAE 1I9GA 5GWXA 2VDVE 1UIRA 1X19A 2DPMA 3BGVA 5CUQA 3SX0A 1VIDA 1NW8A 3OE5A 1M0EA 3UJBA 3HCFA 3LPMA 3G2OA 4XCXA 5FUBA 1ZG3A 3NWEA 2H00A 1L3CA 4RVGA 4RVDA 2LD4A 3E23A 3OFKA 4IV8A 4OBWA 1EG2A 4M36A 2Y1WA 1G38A 2ZTHA 4CKEA 1F38A 4QPPA 5D1HA 3KQQA 5EZQA 4PYLA 4R6XA 4RTKA 5E1MA 4KDCA 1JQ3A 1BKYA 3AXSA 2YXEA 3ANXA 1FPQA 1XVAA 1PJZA 3G5TA 4HGZA 5DT2A 5DX0A 3GDHA 3LDUA 2IH5A 4PYOA 3DMFA 2GB4A 2ZLBA 4DMGA 2ZZMA 4YV1A 5CM2Z 1KXZA 2P3LA 4KIGA 2I62A 5BW4A 2PX4A 5LQJA 1SG9A 2AS0A 3LKDA 4ER6A 3HA5A 2Y1XA 3EVEA 4Z2YA 4HG2A 3BGDA 1L1EA 3P9CA 4P7JA 1UFKA 1U2ZA 1YB2A 4V0RA 5DLYA 4P7GA 5GIPE 1OR8A 5DSTA 5E2BA 4GQBA 5F2KA 4PYKA 5LQRA 3KQMA 3R9XB 4GOND 1AV6A 1EAMA 1VP9A 5CVUA 5FA8A 1WS6A 2O57A 1PRYA 3B5IA 3SSOA 5CVDA 3FPHA 4RWZA 2PY6A 2OBFA 1H1DA 1EIZA 3CJQA 4KIFA 4BY9E 1TPYA 2IH4A 4E70A 3CJRA 4HTFB 3KPVA 1KPIA 1ZGJA 3HM2A 4GC9A 4M38A 1G60A 5C1IA 5K0GA 2Z6UA 4R6WA 5HEKA 2A14A 4AX8A 1AQJA 5DM1A 2JH8A 1NE2A 1NW7A 1BHJA 3PFGA 3PS9A 2G8NA 3B3FA 3OU7A 2IFTA 5E1OA 3IEIA 5FHQA 3BZBA 3KU1A 4YUVA 10MHA 3FTEA 4RYLA 2OB1A 3ERCA 1TW2A 2ZIGA 2JHCA 2AOXA 2ZBPA 2ZZKA 2I6GA 2OZVA 3U81A 4POOA 1D2HA 4QTTB 1KP9A 2IP2A 2C7OA 2EJTA 1FP2A 1VPTA 2ZIEA 3THSA 2WK1A 3DXXA 3Q7EA 5H02A 2XVAA 3HVJA 4YV0A 3G7UA 2ZWAA 2FHPA 4YUXA 3A7EA 2OKCA 5K0EA 3NVKI 3ME5A 4UOEA 3EEYA 3EVCA 4CTKA 5K0BA 2I7CA 4WXHA 1Z3CA 2E5WA 4HSGA 1X1BA 4M37A 2P1DA 3O4FA 2NNWB 5D1NA 3OPNA 2IDJA 3P8ZA 3GRZA 5FCDA 4RTJA 2ZZNA 5BW5A 1L3IA 1NKVA 3I64A 3HA7A 3G89A 2HMYB 1P91A 1JR4A 3C3YA 1P1CA 5MHTA 3CVOA 2FRXA 2PV0A 2QRVA 3OU2A 3OFJA 4KDRA 4PYIA 3VC1A 3X0DA 1X1CA 4QDJA 4G56A 5G02A 4FT4A 3HCBA 3MCZA 5E1BA 5T67A 1QAOA 2IIPA 5CVEA 2AVNA 4LWPA 2V74B 4NECA 4DCGA 1SQFA 5K03A 5EG5A 2HTEA 4CWAA 1D2GA 1I1NA 3R6TA 1N7IA 3H2BA 5DRYA 3KQPA 2YR0A 5K09A 2PX5A 3Q87B 2PLWA 1VP3A 3DULA 1KR5A 3NWBA 4FSDA 5DM0A 3UBTA 2Z6AA 3KQYA 1ZQ9A 4R8SA 1O9HA 1VL5A 1G55A 2AN4A 4M7RA 1L3BA 3P71T 4P7KA 2XBMA 3C6KA 1Y8CA 3MAGA 4QPNA 4QVGA 1VQ1A 4E2WA 1SUSA 3KHKA 3KPWA 3T7SA 2PSSA 5ICFA 4PNEA 2B3TA 3A25A 3BKXA 5BXYA 3R0QA 4F84A 2O05A 2OO3A 3OCJA 1NW6A 3E05A 4R8RA 3UA3A 4E33A 3RIEA 1DL5A 5EQJB 5GP1A 4RTSA 7MHTA 4DKJA 4C06A 3A7DA 1X1AA 1VLMA 3UJ8A 3E8SA 5HFJA 4LG1A 1QAMA 1ORHA 5DX8A 1JTFA 4ZTBA 4CKCA 2XVMA 4PGHA 5LQNA 2UYOA 3MGGA 4GOMD 2PXAA 4PONA 5EMLA 4EQZA 5E2AA 5EVJA 3ER8A 2VZ9A 2AVDA 1YUBA 3IYLW 3FZGA 4KRGA 2R3SA 4PYMA 4EK9A 4XUCA 1SKMA 4YUYA 3EVAA 4PCAA 3NW9A 4AZVA 3FUXA 5CIYA 1NV8A 1YFLA 1RJGA 4YMHA 5HIKA 2HWKA 2CL5A 3CC8A 1XXLA 2FPOA 4GEKA 4CTJA 1TW3A 1FBNA 2G71A 5EIWA 3G5LA 4GUAA 2AOUA 1WY7A 3GRRA 4IV0A 3LGAA 2CMHA 2YQZA 4FZVA 4OQDA 5GINE 3KQTA 2H11A 4F86A 5HILA 1QYRA 4BLUA 4FR0A 5DM4A 1WXWA 4FP9A 5FQNA 3ELUA 4O29A 3GCZA 4AZTA 4PYQA 4CXMA 1RI4A 4RTNA 2ZSUA 2AOTB 2ORED 3CKKA 1R00A 3DTNA 3MTIA 4P58A 5DX1A 3HCCA 3LDFA 3TR6A 3AXTA 3DMHA 3I9FA 3KR1A 4ISCA 4E31A 1RI3A 1FP1D 3R24A 3UJ6A 3GRYA 5LR6A 5HIJA 4ER3A 3T0IA 4PIPA 3M6VA 3FYCA 3LL7A 4QTUB 3QOXA 5FA5A 5GM1A 2AR0A 1QZZA 4E2YA 2P7IA 4BP3A 2BR4A 3MB5A 1JQEA 5CVJA 1JG4A 2NXEA 1N7JA 4PCLA 5EEHA 2BM9A 3FPFA 3LCUA 3KKZA 5EHIA 2G70A 3KR0A 2IGTA 2GS9A 2FCAA 5DTQA 2NP6A 3T7RA 3RW9A 2H1RA 2KW5A 4QQKA 4RV9A 5KQSA 2G1PA 2B9EA 2XYRA 3DUWA 2PT9A 4XUDA 5LQUA 3GU3A 5FADA 5EPEA 3CCFA 4C05A 3HTXA 5DRTA 1XDUA 4LWOA 3UJ7A 1PJTA 4OX9Y 5DTMA 1RI5A 2CKDA 2PVCA 1DUSA 1KYZA 5DSXA 3TPZA 3PB3A 3P97A 5K0LA 5U4XA 2GAFA 2ADMA 3PT9A 4RTRA 1BOOA 5P8WA 2C7PA 4AZSA 2ZVJA 2AZTA 1YFJA 4X61A 2BR5A 3F4KA 1PJQA 1IXKA 1EJ6A 5HIIA 3KQWA 3NMUF 3SSMA 4DA4A 1XJ5A 2O0LA 2PT6A 3AJDA 4AUKA 3HCDA 4U7TB 3EGVA 5KVAA 4U7PB 2YUIA 4RSRA 4C08A 2WA1A 4X41A 3M33A 2NP7A 5K01A 4KVZA 4ER7A 3P9NA 2HNKA 1WZNA 5LQAA 3FUVA 4X63A 3SR4A 3G2PA 4YUZA 5HZMA 3NDIA 3GIWA 1YF3A 3M70A 3MHTA 3FPEA 3FRIA 4QVKA 5CCBA 3A27A 3ORHA 1D2CA 4GOLD 4KWCA 4XUEA 3SXJA 1R18A 1EQAA 2CMGA 2OY0A 2PGXA 2YTZA 3EVFA 3FYDA 3G8BA 5E1DA 4BLWA 4C04A 3LCCA 4DCMA 1O9GA 1VBFA 3THRA 2UYCA 4DF3A 1DCTA 2ONYA 3UFBA 2PKWA 1NV9A 2P40A 4HTFA 1JSXA 2P3OA 3REOA 3UA4A 5GOZA 1V39A 3ELWA 4ATNA 2BH2A 5ERGB 2K4MA 3FUTA 4FT2A 3TRKA 2CWWA 2XYQA 5DXJA 2ZW9A 3EGEA 3SM3A 3BWBA 5K0JA 3GRUA 3OZRA 3GRVA 4RTPA 1X1DA 4OQEA 5LQKA 2YX1A 5LSAA 1JG3A 5EIFA 1R8YA 2PXCA 2PJDA 3JWHA 2QM3A 2UYQA 3MTEA 4OA5A 4DQ0A 2G72A 1NBHA 3BT7A 3BWYA 4MHTA 3BGIA 3SGLA 3TFWA 3TM5A 2PWYA 3FTCA 3KR9A 5EEGA 5EMMA 1JG2A 3LDGA 1NW3A 5EHGA 3A4TA 3DR5A 1JTEA 2ZBQA 3M6UA 2AN3A 5T6BA 2V7EA 2GH1A 3GO4A 3NDJA 4PYJA 1XDSA 3IHTA 5M5BA 1HNNA 1YZHA 5FQOA 3JWIA 5C9ZA 3KQVA 5KQRA 3HVHA 3HCAA 2VP3A 4PIMA 1INLA 5IH3A 3C3PA 2IBTA 3BKWA 4BLVA 2EG5A 4E2XA 3DLIA 4E32A 5CD1A 5FULA 1MJFA 2PBFA 2PX2A 3EVGA 4LECA 3FPGA 3DMGA 1SUIA 1G6Q1 3K6RA 5LQCA 3B3JA 2YXLA 4ER0A 4C4AA 3OZSA 3MCTA 3V8VA 5CCXA 2ONZA 2P41A 3CGGA 4V0QA 3S68A 3NTVA 5K0NA 4EKIA 3ELYA 1XDZA 3LCVB 3LECA 3DP7A 3P2KA 2FYTA 4HRAA 2BZGA 5JR3A 1KPHA 3G88A 1T43A 4BP1A 3DXYA 1XCJA 2PWPA 3OU6A 1AQIA 3HNRA 3ID6C 4EVIA 3LKZA 2VS1A 3KQSA 3PVCA 1M6YA 5KYGA 3FTDA 3AY0A 3MERA 4AZWA 1FJXA 3EVDA 2JHAA 5K8VA 2O06A 5F2NA 2PXXA 3UZUA 3A26A 2IH2A 3TM4A 3VSEA 3EGIA 4E2ZA 3O31A 3ELDA 1UWVA 2Z6QA 2ERCA 5EOVA 2YXDA 3D2LA 2R6ZA 2ZULA 4MIKA 1ORIA 4X60A 5FHRA 4PGGA 1KPGA 3TOSA 3I58A 4QQNA 2OB2A 4RTOA 1XTPA 4C07A 4YMGA 1RJFA 3DXZA 1Q0TA 3V97A 4PWYA 3VC2A 1NT2A 2NXCA 1JG1A 1O54A 4KW7A 4K6MA 2AN5A 3BWMA 3E7PA 4QDKA 4X1OA 2IDKA 3PFHA 5FWAA 1R74A 5EKUA 4H0NA 2JHPA 3GXOA 3BUSA 1RJDA 3IV6A 3TKYA 1G8AA 3B89A 3EPPA 4F85A 2GA9A 1PJSA 5E8RA 2OYRA 2B78A 1I4WA 3JWGA 2P35A 5EMKA 2QRVB 5EZSA 1F3LA 2EX4A 5E9JA 2O07A 2NXJA 2OPBA 1M6EX 5CVVA 1B42A 2C7QA 2JG3A 4FSXA 4HC4A 2OXTA 3K0BA 4CKBA 2NYUA 2ESRA 2PX8A 3KR2A 2GPYA 3HP7A 4L7VA 1MHTA 1RI2A 4HGYA 5C0OE 4MWZA 3UJAA 2WA2A 4DZRA 3BXOA 2N47A 4JXJA 3P2IA 2B2CA 3UJCA 3WSTA 2ZIFA 3B7PA 2QY6A 2AOWA 2VDWA 2P3QA 2YVLA 3T7TA 3PX3A 5K0FA 5E9QA 2I9KA 3JWJA 1ZHFA 5E9WA 2AOTA 3KPYA 4RTMA 3EEOA 3UWPA 5EC8A 2UYHA 1KIAA 4MQ4A 5F2OA 3HCEA 4GC5A 1JQDA 2BM8A 1ZKDA 2JJQA 3HA3A 5HIMA 3SMQA 4RVHA 1ZGAA 3P9KA 4FS8A 3SVZA 3CBGA 3HEMA 3L8DA 8MHTA 3FUUA 5ICCA 1SQGA 3LBFA 4C03A 3NJRA 3QV2A 2HV9A 3HVIA 5GIOE 3PTAA 3G2MA 5EGSA 3C0KA 4DM3A 2IPXA 3HVKA 3DOUA 2NXNA 3QOWA 5K0CA 2C7RA 1WG8A 3EVBA 3LHDA 3TQSA 3FPJA 3KPUA 3EVZA 4YUWA 3LX6A 1EJ0A 4OA8A 4PINA 4A6EA 3B3GA 3GNLA 3P9IA 1BC5A 1KHHA 3M4XA 1RJEA 3RODA 4RVFA 5B1SA 4WVLA 1KYWA 2VDUE 4YV2A 1IM8A 3R3HA 5FWDA 3KQOA 1L9KA 1SVUA 4Y2HA 5DPMA 3FTFA 3G2QA 5EMJA 1QAQA 2JH9A 4GOOD 3TLJA 3TKAA 5DTRA 3O7WA 5EKXA 4EMSA 2ZFUA 3EMDA 1P1BA 1N2XA 2ZWVA 3DH0A 2XYVA 3UJ9A 1YZ3A 3GWZA 1VE3A 2EJUA 2GLUA 4GBED 4HH4A 5FTWA 4Y30A 1KYQA 3ER9A 3BWCA 4RX1A 2FK8A 4ER5A 5JUWA 2ZCJA 5ICEA 3SSNA 1R8XA 3CJTA 2Q41A 3I5UA 5DM2A 3PX2A 3FRHA 2QE6A 2HR1A 2AOUB 4EKGA 3MQ2A 1R6AA 5DWQA 3FUWA 5GM2A 5IKMA 4E30A 3LBYA 3G8AA 2P8JA 3M6XA 1P39A 5DXAA 4A6DA 1Q0SA 4FGZA 2IBSA 1IY9A 5T64A 2QYOA 3I53A 5HOQA 5K05A 5KS2A 3NVMB 2UZ4A 1QANA 3EMBA 3VYWA 4R05A 3OE4A 3M6WA 2FK7A 4GF5A 3P2EA 5ICGA 3AWIA 1JSZA 2B25A 4IWNA 1NBIA 3KPJA 9MHTA 4OBXA 2F8LA 2DULA 2EFJA 4IKPA 1G8SA 1XCLA 3UJDA
chains in the Genus database with same CATH superfamily
1MG5A 2WG1A 2VDJA 4QPJC 3C6MA 3K0CA 1J22A 3DD1A 1GQEA 3LX4A 3QEOA 5DSZA 1WD7A 1V95A 3H9EO 3WLRA 2DPYA 2EMBA 4TRJA 4BQFA 4L8YA 4EO4A 4F1WA 1JTVA 2WSMA 3I8XA 3T3PB 2QM7A 1RXUA 2RHOA 1ZD2P 1JAIA 2EZ9A 1BDMA 2QD3A 3DQQA 3HWWA 3K92A 2ZT5A 3KTAA 3R5TA 1AA6A 4AG6A 1ELOA 2YC4C 4F6LA 3HCFA 3U7RA 2C1EA 3RHZA 4JKOA 4HQLA 3HB0A 4UASA 1R9JA 1R6VA 3I2FA 3MT9A 4HUQB 1SK8A 1EZ4A 1JKJB 1OYWA 1PSDA 2V9CA 5IBQA 4L5YA 2Y1CA 5GQSA 5F7ZA 2FKNA 1MC8A 1EK5A 4B3BA 4QPPA 5EE9A 1NATA 1OH7A 2P9JA 3OQMA 4KQFA 2SKEA 3X2FA 3UOAB 1NQWA 2IHR1 1Z83A 3HXPA 1PJZA 3G5TA 4AF7A 1W59A 4DKXA 1EWKA 2OFOA 3KOUA 2IXEA 1L1RA 4I8IA 3TQOA 4ZFNA 1SQ6A 1WL8A 1E9RA 4W8HA 4XRRA 2XX3A 3IUJA 1FKAE 1Z15A 3E2IA 3CLSD 1IK4A 1XRLA 2NTVA 2OGUA 1VE9A 2RGUA 3BCUA 3RABA 1RWNA 4BRZA 4EEXA 3UC9A 4XKJA 1HEUA 1GAEO 5EIXA 4F4CA 2EW8A 1WHQA 2EYQA 4V0RA 1A82A 2QMEA 3A2NA 2OQIA 5E2BA 5A06A 4LZLA 1Q6ZA 3TK1A 2Q7XA 4RS3A 1GPUA 4R40A 5EHQA 3SR0A 4OI1A 4BRSA 2W42A 2CLFB 2W2XA 4ZT3A 2Y99A 3F6PA 3KKMA 2Z4SA 2A92A 5CVDA 2PT5A 1ODSA 1P1FA 1BCSA 1E4EA 3FPHA 1RKVA 3N59A 4HPJB 4B3RE 4N5IX 4RWZA 5AJUA 3VC7A 4UEQA 4BB0A 1WSWA 2QRNA 1J5XA 2GXAA 5DGTA 1D5CA 4KIFA 4X7BA 4II2A 4LMAA 3C39A 4DLSA 4AMYA 3TZLA 4E70A 1B4DA 1AU9A 1TCAA 4MR7B 5A62A 3HK2A 1ULUA 4RHXA 2A14A 3NKLA 1LK7A 3QEMB 2R85A 3EE6A 2X1HA 2G8NA 3FN4A 4WBSA 1P4AA 1J0AA 4EUSA 2V83A 4JB0A 3ZBUA 2PH3A 5KC9A 2J07A 5HSGA 2IEYA 3U60B 2BSXA 3U4AA 1CZLA 1E6CA 3R5XA 4HDRA 4XYGA 2EPMX 4GBMA 1LRJA 4MO9A 2EJTA 3H8WA 1M54A 3CF4A 4ZMRA 1XCMA 1OU4A 2WIBA 3EVTA 3QKRB 4HLNA 3GDOA 4LZNA 4OHMA 3EBPA 4WY8A 1L5KA 3X1JA 4B3DA 4QFMA 3RC2A 4W4TA 3QVLA 1SXJE 4CV3A 2Z30A 1XDBA 3B20A 2GVNA 1ONBA 4IYRA 4OHBA 1E3LA 1OWPA 2I0FA 1K06A 2I6QA 2RTXA 1P81A 4KV9A 4KQEA 3B1ZA 4PBRA 3S1LA 3ZZ1A 1TAHA 1XZKA 1XZPA 1KEVA 4L74A 2CJXA 3H8SA 4Q4CA 1NJ2A 1JFVA 2WVAA 1PDWA 3QEBZ 2NYAA 4FIDA 1FTNA 4E1BA 3PUYA 5JZSA 1X1CA 4IDHA 3CU5A 1JECA 4URXR 5JFOA 4WSOA 5CHYA 2GCPA 2VKTA 4YQZA 2H4WA 5FL7A 1REQA 2ODBA 3IVRA 4O02B 5CVEA 3GT0A 5FTLA 1JIIA 3ASVA 1J39A 4L2IB 1XEWY 5BSUA 3IWCA 1W5AA 3GVIA 4DCGA 5C46F 3EW9A 2J3JA 3CSDA 1RHUA 3E82A 2XE8A 3EGDB 4EHFA 2V65A 3DCYA 2H59A 2RD2A 2VYNA 16PKA 3ANTA 3DULA 4Z9BA 3NS7A 5AESA 3G02A 3V8MA 5LBTA 1XMQE 1ZQ9A 5LZ5A 1OIXA 1ONPA 2TECE 3L41A 1WMAA 1A1JA 2NSJA 3LUAA 4LGYA 2RMKA 2X3FA 3LBIA 5EXXA 4BFWA 3NGMA 1VOTA 4DVGA 3SJBA 1USGA 3KPWA 1DBWA 1EE1A 1YK0A 2XB6A 2HDWA 3GLRA 1HQYE 4G84A 3WK8A 2GLXA 4V1CB 4NBKA 5C52B 1Q21A 1LBHA 3C5CA 4IY1A 4BX8A 2VK1A 4G07A 3KJXA 3RUDA 2W9XA 1DHTA 3AI3A 3OHPA 3PZRA 4D46A 4QOSA 3WWPA 1EP9A 2X58A 3D1LA 1V0JA 4N7MA 4UAGA 3WO0A 3OIUA 2EL6A 5HP4A 4OHRA 3HPRA 4I5EA 1BVUA 5SYNA 4ZTBA 1QUFA 2C2YA 3ICOA 4MI9A 4O43A 2FR8C 1ACJA 3HU5A 5EWJB 4PLZA 5DNYB 2QU8A 4NXMB 3WGOA 2V0NA 1U9IA 6NULA 1YUBA 4IL5A 4HZUB 2O5VA 1FJHA 4ZVSA 4CM4A 4Q39A 4BXOA 3JARB 2WKSA 3CEAA 2Q3HA 4U6SA 1OYVA 4DV0B 4QZVA 2HT1A 1DKRA 2ZS8A 4EB8A 5JNWA 2QR5A 3LE8A 4Z0NA 2K7IA 3GQBA 4M1TA 3GEMA 1NM5C 1RJGA 4YMHA 5ITZB 2XIQA 5ADZA 1T2EA 3JQFA 5F7OA 4YUAA 4LVCA 2RK4A 2PR2A 5K45A 4TOIA 5CH8A 3ZJUA 1N32B 3EPHA 1XVUA 5G4KB 3NC4A 4CCWA 4K87A 2PGJA 1MGOA 4DTIA 4WIAA 1M7GA 2H11A 4F86A 2FEMA 2XXBA 1JB9A 3T5BA 2WUWE 2ZSEA 2JLYA 2EP5A 1B8UA 3ZU3A 4AJNA 3LBHA 5EJ4A 3DTNA 3CKKA 2ZS7A 3EISA 4P53A 3TR6A 5BWOA 3IAM6 4LXGA 3J7Yp 2D3TA 4OO3A 2DQYA 3PCTA 1M2FA 3F97A 1C3VA 3DF7A 1N0HA 5F3DA 1E2GA 2OUKA 1SVLA 1U2DC 4NOJA 1AKVA 4Q4LA 1PZHA 4LFAE 2IUFA 4W7IA 2EM6A 1OAAA 1YC5A 2VUIB 5H82A 1JQEA 3C8DA 2WIAA 2L2KB 1DAKA 4LFCB 2CV1A 4DCNA 3RS8A 1KU0A 2OGWA 4YCNA 1QYXA 4J43A 1VBMA 4IG4A 4V2IA 3T7RA 1QF6A 3PC4A 1KQOA 5A69A 3MJEA 1H5UA 2ZUSA 4OMFG 4WDRA 1KFEB 2O8FB 1T0JB 4G4IA 5FADA 3MS4A 4TTAA 3H7AA 3F5DA 2O20A 1YL5A 2O2GA 4LIPD 1BB8A 4HUQA 1JKJA 3Q85A 3LM8A 3NT2A 3T0FA 1NX9A 3AB7A 3ANLA 3DVLA 3E6AA 5DCWA 3BIOA 4RF5A 1LI5A 4HS9A 1VG9B 5HQJA 2PN1A 3F74A 1K3FA 3PB3A 4HUTA 5A7HA 5EERA 2DQSA 1DEXA 1R64A 3WI7A 3AJ9A 3UK2A 4O0MA 3CH5A 5EJGA 4CT5A 3W90A 2JAUA 1XU4A 2QZZA 5B6JA 3CPEA 2W90A 3ESQA 4QSHA 1ZKMA 3IFSA 2C5AA 2YMLA 4WK4B 3AIOA 3WHLA 3BX1A 5DNCA 1ULTA 1J7JA 1EHYA 5CB6A 4YCSA 1ZXBA 1T1RA 4L5CA 2WIDA 2XD4A 2J67A 1T8TA 1RHRA 3AZOA 3FZQA 4NL4H 4U7PB 4D9IA 4R1NA 1ND6A 1XNQE 4BS9A 2VQ6A 3TTUA 2R1ZA 3CX4A 2J33A 3P9NA 4Q6BA 4BCDA 4ZHSA 3WL3A 5KU7A 3MHTA 5A4AA 5D3MB 1CJCA 3FRIA 2O8CB 1OBOA 1E60A 5J9FA 4J1TC 1KZ7B 3RU7A 6ADHA 1CFJA 4GXQA 4KMRA 3UXYA 1V3VA 5GVRA 1D6NA 2WLSA 1R18A 3RGGA 3TRFA 4FHZA 3VSAA 1L8AA 3OIWA 3OEYA 1IDN1 2I6TA 5F5XA 1DKLA 1GTL1 1GU1A 1C7IA 1U3DA 2H2IA 3LGSA 4LYDA 3QX9A 2WD7B 1QOPB 1T0UA 4MLPA 4MR7A 2GCGA 4DLNA 2QSYA 3CR7A 3INRA 3HCNA 3QEMA 3ZWAA 3E53A 3CUTA 3ELWA 4GMKA 4GQAA 5BUSA 3I4LA 2VJAA 3H13A 3LW8A 4EB3A 1T3SA 4IQ0A 5DIZA 4F4UA 1I7PA 4G1UC 4M3NA 1X1DA 2GPWA 4J6FA 3DP9A 3DCJA 1XEWX 3O90A 1ZL2A 2F9MA 1RQXA 2IY8A 3LRTA 1ZBTA 1QIFA 1QQ6A 1IM5A 4PSDA 3TTVA 3TN7A 2EJVA 2CLLB 2Q0SA 3MS2A 2YY6A 3LP5A 3RC9A 3VR5A 3A4NA 3QKRA 4ABYA 3OURA 3S2FA 1ZIOA 1CRPA 4KX5A 1ZIXA 7ADHA 1NW3A 4WK2B 3A4TA 1VSBA 4XVQA 1GUAA 2REOA 2XTNA 4YMWA 1PVOA 3OJCA 4HDOB 4OP3A 5LLDA 2HSZA 3T52A 4A0QA 3R3WA 2VHQA 2CSUA 3ZK9A 4JNCA 4TKUA 3F7OA 1ZL0A 1KMNA 5T7BA 4Q4HB 2BF4A 1BA3A 3TQIA 5T8KC 4YT8A 2EOOA 2PX2A 3L7AA 1SUWA 1OASA 1X0VA 3LVQE 2R4TA 3IB6A 3QVWA 5IS2A 2DQKA 2HT6A 2D1RA 2W83A 2YXNA 4DJAA 1KFJB 3ZZMA 4U8HA 3SDZA 1YS4A 2R1TB 2R8XA 5FX2A 3GVPA 2V03A 4N5HX 1L4SA 3LECA 4TTJA 3P2KA 4QPZA 4DLRA 1JP7A 3OHSX 4EA8A 4J8ZA 2AR9A 3E0XA 2HUNA 3L77A 4L2IA 1NFRA 5T6MA 2CV0A 1T43A 2HCJB 5TQVA 3BORA 3EGDA 1XCJA 1RYMA 3LCJA 3ED5A 3AQIA 4KVGA 3C8HA 1AQIA 1A1KA 4Y2QA 3LKZA 3QHPA 1GGHA 5FEUA 2Z8YA 1QVVA 1JIQA 2DJ5A 3JTEA 4MHSA 1UJNA 4QREA 3OMXA 4YX9A 1NNSA 5NLLA 1QLWA 2IHBA 1COWD 1M66A 1IZ0A 3FFXA 1WAMA 2CLHB 3CE9A 3LUGA 3KD3A 3PFBA 4MGKR 4AP5A 4PF1A 2J5BA 3ROTA 4V1CA 3WE7A 1H6BA 2XMDA 4DR3B 3W2GA 1UMBB 3ZWYA 5TV2A 3J7TA 1BH2A 2DFKB 2X6QA 3SBXA 4QQNA 4FFDA 3VAAA 1MFZA 3KWMA 2P6PA 4G1VA 4ZZ2A 5BRAA 5KDOA 4HOYA 2NUAB 2DOKA 3ELBA 4F5YA 1W5TA 3A14A 3K6SB 1UOPA 3E27A 2ZAOA 4BX9A 1DRVA 4DXHA 3BWDD 5DNYA 2OHIA 4H7PA 4QNNA 4KI0A 2HLDA 4BX3A 4BMJA 3BGSA 4HZUA 3OZIA 1TK3A 1XYGA 4LDJA 1KNQA 3JARA 5JSKA 1F4PA 3R40A 3RS5A 2VYVA 1QGDA 4HGPA 2LDBA 4BVBA 4Z4GA 1VI6A 2ZDHA 1M83A 2OCIA 5E9JA 1OLSB 1Y1KE 5ITZA 2C7QA 2JG3A 2EFCB 2H1IA 5DGIA 3ABIA 4WUTA 4N12A 4CEHB 3NEYA 1CP3A 1YBVA 5G4KA 2A4KA 1XA4A 3N3AC 4ND7A 2N8XA 3ZLVA 5CX4A 4AURA 1KEEB 4JVMA 3IE2A 1OGJA 1XCOA 3VNUA 3A9TA 3G17A 3UMVA 4AO6A 1E1DA 2O6LA 2PKCA 4E6PA 3M81A 3K5PA 4LQDA 3EARA 4LDAA 5K0FA 3ZLUA 2HYIC 1A1HA 3I52A 3NZEA 4B8YA 1MORA 3M8KA 5HMMA 2QN1A 1L7XA 1T9CA 3HABA 4IH9A 4BVGA 1J0CA 3WSTA 3NIBA 1JVBA 3W79A 1TNDA 2WSYB 2ZE5A 1DLJA 4XQGA 4DV4B 4LYYA 2OA0A 1VZ2A 4E5NA 4CMBA 4DKKA 2PCLA 4DQXA 5K8UA 1VE5A 3L6OO 3DOUA 4MA4A 3AZPA 3LAWA 5AI9A 4YDQA 5K0CA 5KBYA 1J2JA 3FCXA 2P68A 1L6IA 3MTQA 4S05A 2OR3A 4YMIA 2JH3A 1E2IA 3EIUA 3EVZA 1Z3IX 3QE4A 3H3JA 3SSAA 1FXWA 1DX4A 5AVUA 3C48A 2Q4BA 3L82B 2EOFA 1GD1O 1ZQ1A 3B5EA 1YI1A 2XB9A 1PJAA 3EDQA 2DHCA 2O8FA 3QEKA 3VHQA 1TM1E 5J59A 1SOAA 1SVUA 3BA1A 2ZIAA 3TKAA 3ZE1B 3C6YA 3LQ4A 4ZCRA 1VKHA 3CZ5A 2XYVA 3FWHA 5B2EA 2A9KA 3HB5X 2BT4A 4ROSA 3D7NA 2YC2C 4FCTA 2EN8A 4I46A 4L08A 4RX1A 1F8YA 3S2SA 1DTWB 4W9NA 4CT0A 1R8XA 3L8GA 3OJEA 3WIBA 2JF0A 3DBLB 1Z18A 3IR6A 1PS8A 1Z4MA 2X0JA 2Q5LA 1TQ8A 4IGKA 4JJ6A 3ZIAD 3QG5A 5C81A 1PBTA 2WPDA 4I9UA 5D2CA 3RVBA 4DR7E 1I32A 3IAAA 4ZI5A 2VXBA 1I1QB 5HQ3B 4XJSA 2ZTMA 3O3CA 3GRPA 3WGTA 4G8JA 3RYCB 3ETGA 3IBYA 4UDNA 3ADJA 1MG0A 5EZ5A 2L33A 2HKIA 4MUMA 1R10A 5HOQA 3THWB 1EH8A 1RKUA 1CUYA 1BGVA 2G67A 4BKPA 5BSWA 4WH0A 2I1QA 4XZ3A 1G3RA 1Q7EA 2GM3A 1LQTA 4G8BA 1L7VC 1CHDA 1J0BA 3FGOA 3LS2A 1NBIA 1EDOA 5D3MA 3KEGA 4L9RA 4CG0A 4D6XA 5IZCA 4BGDA 3NMUF 5DU2A 1EA5A 4KLRA 1Y9DA 1RBQA 4I9HA 1ZMRA 4JBGA 2NO0A 5B1HA 2FMIA 2ZB7A 3KV1A 3LPLA 3WJAA 1Z8FA 1OREA 3P9ZA 3SC4A 1WXXA 1SELA 3DLCA 4MYRA 2WD7A 3Q7SA 1N6OA 3LV8A 4JUCA 1V3QE 4ZVNA 2TSYB 3KEFA 2ZUWA 1UIRA 1QHEA 4B44A 3M89A 3N2LA 2B7BA 2VZLA 2F90A 5TEWA 1RIFA 2XOKD 3HZZA 3UT5B 4CIBA 2H00A 2QQEA 1L3CA 2XUIA 2Y4NA 3X1DA 4UXIA 1GKUB 1W4CA 3QBVA 5A2QA 4CV0A 1J5EB 4KNVA 1GQRA 1VKOA 1Y7IA 2Y1WA 2ZQYA 3GJZA 3IPYA 4LXIA 5LVAA 1E59A 3WP1B 3L0DA 2NZWA 3OZWA 1FNSA 2H6EA 4IDPA 1OVGA 1XU9A 4XJTA 2WHPB 3GCGA 3ZWXA 4DB2A 3B6MA 1DQYA 2QL5A 2Z5FA 3TRIA 3AUKA 3HN7A 4L4UA 5KVVA 5DX0A 3TR0A 4KE6A 2LBSB 5KOYA 1XX6A 1BE1A 3DMFA 1CLEA 4YV1A 1KH1A 2VT7A 4DV3E 5CM2Z 5BN1A 2VXCA 2PX4A 4WLFA 4NZVA 1GRRA 1FP4B 3QOFA 4BFXA 3F6YA 4Q4HA 2W2LD 3STVA 4F3RA 3K2IA 3GK3A 1NWCA 4YCLA 4OQ4A 2HADA 1RCFA 2VHXA 1RBYA 4U8GA 1F4VA 1K9SA 2O7VA 1WJPA 2C5LA 3F96A 2R1TA 3PGVA 5BSRA 5AW9A 2NUTB 1Z28A 3CRNA 5H4HA 4HYQA 5K8LA 1KI4A 2QRZA 1G5HA 3BJMA 5D6NA 4C0QC 4QLOA 2OBNA 1CRWG 2H57A 2P2YA 3Q3HA 3CNHA 4ND3A 1ZC3A 1YDHA 2EQAA 4K9MA 5C1IA 3ZE8A 4URVR 3A1CA 3Q3VA 2FAXA 1J56A 1PFVA 2ZVPX 3ZCRA 4LTMA 1E92A 1T9GS 4HNVA 2IVZA 3AF0A 4KQ1A 4WLEA 3GC6A 1AUOA 3LC2O 5C8YF 5LMNB 4YUVA 2DT5A 2FX3A 4GM1A 5HS4A 3U6KA 5C51B 4POOA 1A1LA 2I6GA 2OZVA 4OQMA 1M0WA 4BN0A 3ZQKA 1VLLA 4GR9A 4M1SA 2EARA 3LI2A 3AEKB 4IO0A 2J3QA 1UMBA 2VWPA 4L16A 3GHYA 4LZPA 1CUEA 3THSA 3WB2A 5JATA 2WK1A 1PLLA 4G8DA 5B36A 1J5PA 1J7KA 1QS0B 1U0OC 2W71A 3O93A 3DZKA 3OO0A 4M9QA 1TXGA 3N2YA 3NEPX 5K0EA 2OKCA 4DQDA 2YIMA 4P2GA 5CNKA 1K88A 3WZ2A 2D7DA 1J8FA 1T15A 1Z2CA 2ECFA 2QW1A 2WMNB 1QCYA 4MI1A 4YJFB 1Z3CA 4D3ZA 3PEWA 2YL2A 5AI4A 4GAEA 5L9AA 4DIOA 1FL9A 4US2R 4HSGA 2O2HA 4HWGA 3O4FA 3VKHA 2PCJA 3JQAD 2VPWA 3K09A 4ESOA 5LYJB 2XMCA 3DXFA 5AVXA 3G6WA 4KFRA 4D8XA 5KJ6A 1T2NA 4O4IF 2ZCUA 3IUQA 4TRMA 3QUBA 1N2SA 3FW1A 4CF5A 1NURA 3OFJA 1JJIA 4Q28A 1RPJA 2EOAA 1OLSA 2ODQA 3GCXA 3S2IA 3SQDA 4MLVA 1DC6A 4DV7B 4KC0A 3ZX4A 4LF6E 1CUBA 3KT6A 4UU0A 5AXAA 5IN5A 3AF6A 4OQFA 2PMEA 2XRYA 1MIHA 5A6BA 3OF5A 4UEJA 4B45A 3MUOA 4OU5A 4YA6A 2HTEA 1ZHOA 4J7AA 1KEEA 5EN4A 4YQEA 3U4QB 2NSLA 4DA6A 2EMKA 1P80A 4YLEA 2VPTA 2AJDA 4P0TA 3AP1A 3MCWA 2VCEA 4MO2A 4FZ3A 5BV8A 3GJ3A 2QRMA 4DV6B 5KYWA 2AHOA 3PQFA 3MCUA 1UJ4A 1RMTA 1WEKA 2XA2A 5I7UA 1CY8A 2CLCX 4MV4A 1W94A 3T4PA 5FO1A 1A2OA 3NKFA 2ZM5A 2CDCA 5LQDA 1KQPA 2IYQA 2OV2A 3BKXA 1Q7CA 4N3AA 1U8XX 3UPDA 1SZJG 3QLUC 2AC7A 3L4KA 3WBKA 1B0UA 3ITDA 4JLBA 4Y2XA 3FDJA 4QTYA 4NMWA 4W1PA 3AI1A 1WB4A 2QDXA 1MEJA 1W75A 3EZLA 4FDUA 5FYQA 3T5GA 3ZLTA 1PX0A 4ND1A 2IZOA 1JTFA 1LFAA 4EI9A 1GL9B 5JYEA 2EN6A 1BNCA 4LE2A 3RFCA 3RTGA 3TPFA 4F93B 2H7YA 4LJKA 1UBOS 2PXAA 3MT8A 3UPTA 5ALPA 4F04A 2X2FA 4MP8A 3U31A 3R77A 1YYOA 1YUNA 2AVDA 3W2FA 2QS9A 4LC0A 3EMKA 1SVNA 5C3MA 1GGJA 6YASA 2PUDA 3OG9A 1FTQA 4CG1A 5HRCA 4JX9A 1EFVB 4OGLA 2A9VA 4R03A 4OF4A 4C0KA 5IKXA 1DTWA 4E0BA 4MRPA 2WLTA 4E4RA 5HJ7A 5JG7A 4C5AA 3Q2IA 4QQRA 3AG6A 4KTVE 2ZATA 4X93A 4ARUA 4DLYA 3O4IA 4F9TA 5B57C 5GJBA 1CLUA 2HBQA 5HQ3A 4N49A 3UXHA 3IBSA 5J43A 3ELUA 3LW7A 4BJ1A 3RYCA 1G3QA 2RGRA 2FWNA 1ZJ6A 2REQB 1YSCA 3THWA 4NNPA 1FS5A 2RDMA 1HYEA 4E31A 4O2AF 2BYTA 3DE5X 2ISSD 2RK3A 2XDWA 3UJ6A 4LDZA 1JR3E 1VFNA 1HLDA 3LO8A 3ZOKA 1RQRA 5FPQA 4EGQA 1CUFA 3CSSA 1O94A 1KE1A 2VJOA 2XHEA 3UMRA 3M4JA 2W37A 2AR0A 2PL5A 1QF9A 3GR6A 3NV7A 3CBQA 1TEXA 5E4YA 2RSIA 5TQJA 3STYA 4C7KA 2ODTX 3WQHA 2JLBA 5GZ6A 2ZYAA 2G70A 3GUYA 3KR0A 1HPLA 1IATA 3SBDA 3LP8A 5J5CA 2G1PA 3MMZA 2Q3FA 1IQSA 1JLHA 1JB1A 4CM7A 1OTYA 2B9EA 3QA9A 5J40A 5JSYA 4X0EA 3A3OA 3I30X 3PDCA 2RAVA 3TS1A 3UT5A 2WAOA 3LQ1A 4V0OA 5CDHA 4LRTB 4TWJA 2PFKA 5DT9A 2CKDA 3IKJA 1Y4AE 2QT1A 1I2MA 1IUKA 2R4QA 1XD2A 2SICE 3DMTA 5LP1A 3L8FA 4NBRA 2B94A 1QVRA 4US0R 4XIGS 2VI5A 2YWDA 1SPXA 5KO2A 2WHPA 1LC3A 2BMVA 3OZGA 5EHXA 1JPJA 4ZYHA 1PW7A 1KSJA 1V6CA 3O8OB 1MQAA 3PL5A 4LDQA 4GECA 3HFGA 5J23A 1I4LD 1VMDA 5K4AA 3BHJA 2F8BA 1GLVA 3H3FA 3KQWA 1T1SA 4X20B 2X8WA 3QPBA 1UPTA 5IJXA 1BDIA 1Q92A 1QGAA 1X7HA 2X76A 3EEQA 1T9BA 4LXHA 3QU7A 5EJFA 4DCTA 2J5XA 4YT4A 4JLJA 1R3DA 2Q50A 5IJ0B 1Y3IA 2GN1A 4Y1GA 2E1MA 2VJBA 3F6HA 2KBEA 1R0ZA 2W6CX 4U2BA 3KDAA 1F12A 3WAKA 1ND5A 2GEKA 4F38A 1LVUA 2FRDA 2GESA 3MJRA 1XKQA 4IHJF 5ALTA 4QVKA 2X77A 2NT4A 3TQCA 2RGNC 1M6WA 3VPBA 4CKWB 4EZBA 2D8MA 4DDUA 2HNAA 1BS1A 2NUTA 2O4UX 3EVFA 5DCYA 4YRNA 4FEEA 1SM4A 1F8GA 5HUHA 3ND8A 4DF3A 4EVQA 5CYFA 2XGGA 4X6LA 4ZGBA 1QRDA 4KYUA 1L4HA 3QTTA 2YVUA 4RKFA 3OUZA 2VF1A 2VF5X 1YV9A 3RC8A 3DZBA 5JCJD 1IB6A 4LNUA 5C1PA 2IEIA 3EGEA 4M6WB 3SLKA 4B4KA 3QWIA 2CUZA 4JI8B 1BFDA 4QAQA 3W7BA 4GT1A 2PT7A 2C83A 1ECLA 1OHHD 3QU4A 5A6VA 4IJ5A 1GQFA 1NVTA 4PPFA 3EUEA 1F1JA 3GEDA 5IYZA 3JWHA 4JUIA 3MMXA 4CJXA 3IO3A 1Y1QA 1QS0A 3CUEF 1N6HA 3BULA 1P2FA 1OZGA 3DL2A 2LV2A 2G7HA 1OT5A 2ZBQA 5AVZA 4JB8A 1KA9H 2I6XA 2O3TA 3D6MA 4JVLA 4UUOA 3GVCA 4YJFA 4ZAVA 5A4DA 3KQVA 1L8LA 4PIMA 2X6TA 4WXPA 4Q1CA 1HOTA 1YAJA 4XPZA 1ULZA 3HFSA 4PZEA 3HY6A 3K6JA 5LYJA 2XNKA 3LA8A 3LYAA 4NCXA 1E7YA 2HHCA 4E32A 5FWYB 4DIDA 3RYTC 3X1ZA 1D4OA 2H8KA 2GM5A 1RPZA 2HA3A 4FC6A 1KH2A 3KZNA 1ZUHA 4Z53A 1HNWB 3OZSA 1I94E 3ISJA 1PWZA 2CYAA 2DECA 1F48A 1FQWA 2Y77A 5JAUA 2KHXA 1JN0A 4U00A 5T6JA 1NN5A 1OLOA 2C9BA 2YIVX 4NBSA 5HF6A 3CMCO 1ZNQO 5KZMB 1E1QD 1YFKA 4QJBA 1QO9A 1BHQ1 1ULHA 3P2YA 3PNPA 4FGWA 4HBZA 4B6RA 4XCVA 5IVKA 2OV8A 2FZKA 4OYHA 2DC1A 2DXIA 2JFVA 3U4QA 2RI1A 2R8PA 1JHMA 4RMIA 4COOA 1BYUA 2PVSA 2OCGA 3F7MA 5D5HA 1B6TA 1KDTA 4PGMA 3G0OA 3PXCX 5CM9C 4D9MA 4D9JA 3QVGB 1I1OA 5J2UB 3T1YB 1II8B 1ZCAA 3GZTB 3NWPA 4X6UA 3KDSE 5EFOA 3SFVA 3D3NA 1YRQA 1ZEMA 1N6KA 5G1NA 5AW5A 3OO1A 3KYIB 4Z51A 5IDXA 2ZTVA 4HB0A 1WZCA 1L7NA 2FN7A 3R6WA 4POAA 3D2LA 5EOVA 4KZSA 2V7XA 5C31A 3AFIA 3B78A 2XCIA 4GPEA 4TKMA 2CUTA 4PQEA 3W8NA 1DG1G 1FEZA 4X62E 4Z6KA 1YKGA 1L4EA 1D2MA 1EFPB 1TLFA 1YQ9A 3GX1A 3WNCA 3EXEB 5I4BA 4FM9A 2ANCA 4BMZA 3ICCA 2AN5A 4X1OA 5KHLB 3U16A 4A16A 5KWSA 4BV2A 1NVFA 3AINA 5JCPA 1EVLA 1NMXA 1UQTA 2GK3A 4J07A 1HE8B 1IEVA 1LUAA 3CKMA 3K1ZA 3RE1A 4XB1A 1FSSA 1QDEA 5FPKA 1G8AA 1Q1AA 3PDUA 1G64A 2JJYA 4P4UA 5BQ3A 5E8RA 1SC9A 4D3XA 2CEAA 5HIAA 4A8HA 1TQ6A 4HY3A 3RVJA 1EUYA 1TU0A 2KE5A 1TVMA 3C3EA 1B6SA 2TMDA 3N8DA 4JBHA 4KWYA 1KZ9A 3BXEA 4FOTA 4FSXA 4ONEA 1WETA 4OL9A 1T2FA 1MEYC 2HLPA 1SG6A 3BWEA 2GBIA 1R2QA 1AVTA 3KBBA 4JLNA 4HGYA 4XIIA 4PG5A 5T4EA 3WK5A 1EXDA 2E4AA 1PS0A 2GCOB 5HNKA 1I33A 3LFTA 5K99A 4LXUA 4AKIA 1EUZA 4WZ6A 2B2CA 4YO8A 1P8JA 2WU8A 2ZIFA 3Q0TA 2M6SA 2P69A 2YVLA 2YIJA 3M1LA 3PX3A 2VQSA 3IALA 2REQA 3IRVA 3UICA 5TIIA 1GAXA 5CIQA 3BE4A 1XRRA 1K92A 1KS9A 4WACA 3EHEA 5KVCA 1WF6A 4GC5A 2ZYIA 1KBOA 2QRUA 2WOOA 2GF9A 3IA2A 5FUYA 2IV3A 4R16A 4DYDA 2ISQA 4X6YA 4AKTA 3CRVA 3OOHA 1QKIA 4OHWA 1E99A 2PA3A 1EEHA 1Z8NA 4JT8A 4B3IA 2J3KA 3EZXA 2B8WA 5CLQA 1WKCA 3CLUD 1KZHA 4YUWA 3T1HB 1H1LB 2JPDA 4FNGA 1KAEA 4CFYA 1U3VA 3QTLA 1PFGA 3TG8A 1C3OB 1NMQA 3IWBA 1Z13A 1JU3A 1XFDA 2JFBA 3GJ6A 3TAHA 1XYVA 1KYIA 2XQGA 3VR3A 4QG3A 1NTRA 5BQ5A 1IVSA 4N6GA 1GV1A 1RVDA 3R3HA 2O23A 2QVXX 2JD0A 3CUSA 1BMTA 1GKKA 4N6OA 1G2PA 4Q4AB 1K66A 1R6DA 3OPYI 3H3XA 4JVSB 1O87A 1JHYA 2GGSA 2NAPA 4QGAA 4CQMD 5CFPA 4EW6A 1K2VN 3PNQA 4WYQB 1EP1B 2FPSA 3FI9A 4BZQA 2JD1A 3DFIA 3T6KA 1SBHA 4YFVA 4P80A 2PJUA 3CJTA 1PNVA 3FVQA 3I3SR 5E3JA 4WBNF 2ZYHA 2A1UB 4ZDIA 5ITVA 1AURA 4MARA 3O8OA 1OW3B 1CEQA 4GVPA 3GGSA 3WK7A 1T0PA 1WBJB 3ONNA 1M2HA 5M3BA 4EKGA 1VI2A 2L69A 5IP5A 1T5IA 2IU6A 5GM2A 3AL0C 1SJ9A 2H16A 4CQNA 4X20A 2DPLA 4EHBA 1YONA 3ZH2A 3ODPA 4UPDA 1GADO 1Y6FA 1Q0SA 1OXUA 1QFSA 3J7AG 5FR2A 4DV6E 3EGCA 3I53A 1OT3A 5IJ0A 1A9TA 1SXJC 4QJ5A 4RVCA 2RHWA 5K6TA 3UAWA 4FX5A 3NM6B 1U7OA 3P2EA 2GCEA 1G8FA 2J85A 2YV4A 2WIKA 3OI7A 2G3YA 3DVQX 4TMTA 4BO0A 4R1UA 5JXHA 4KWIA 1JJVA 4KQ6A 1YR2A 2F3SA 5HS6A 4DQLA 4CKWA 1BKDR 1E0SA 2JXPA 5A3QA 5E3HA 2I1WA 4EG8A 2XV1A 1Z4PX 4N4AA 5F4ZA 2PKQO 4DPLA 4PGAA 4U1RA 3O2JA 2YCBA 2YOHA 3HDTA 3MWDB 5EUQB 1MIOA 4IW3B 4DILA 4KUEA 2R1VA 5DGCA 5AM4A 4KBFA 4IQ4A 3L1VA 2FFHA 2HA2A 3FNRA 3VA7A 2WD9A 2ZM6B 1Y5MA 3QV1A 1ULSA 1U3CA 4RETA 2NMVA 5CFZA 2EQ3A 4OHPA 5TGZA 4CGYA 5AIBA 1ZG3A 1FZTA 2X3YA 1O97C 1ZK3A 5DBFA 5E0OA 4HT3B 3UV3A 1EVEA 2ODEA 1EWTA 2JATA 3C16C 1ZCJA 2YMQA 3CW9A 3BRSA 3GEEA 3QFSA 3JWEA 3W8DA 4AP9A 1BJRE 5ED0A 2FR8A 2EN1A 2ZR9A 4BVFA 1UADA 1CZKA 1ZZGA 2F1JA 1V8PA 1WUKS 1PL6A 4AYTA 3D7RA 3FKJA 4KDCA 1BKYA 1KMQA 1ZAKA 3AXSA 5E1MA 2LP4Y 4N54A 4A23A 1HTBA 3CYFA 3DA8A 3GFGA 4HGZA 1KBQA 4L3OA 5DT2A 4DUZB 1OFGA 3LWZA 4PO8A 3ZR4B 3C8ZA 3EZ9A 2ZZMA 3U4MA 1G2DC 4CDMA 2WMOB 1YACA 3HKCA 1C9MA 1NM5A 2EFGA 2PTGA 2IZ0A 1E2UA 3RTAA 4R68A 4A8JC 5CBKA 1BN6A 5IT9C 3A58B 4ND5A 4Z2YA 5FWYA 1WOMA 4F3CA 4ENPA 4CDNA 2DUNA 1KYTA 1UFKA 2ID9A 2P4QA 1HUQA 4U2DA 4BNJA 1M6NA 1ULAA 4LBZA 4IZHA 4X9XA 5AO9A 4GOND 4XWOA 1ZYUA 1C81A 4LOHA 1FMCA 4BMXA 1NF2A 1H3EA 1TZBA 1QUEA 3B5IA 2QMHA 3D4OA 1YBFA 3OIVA 1ZM9A 2OC9A 3MUNA 2JLCA 4F5ZA 4C9BA 3QPDA 3RUFA 3UB2A 1N36B 1U5CA 1ZP6A 3H4TA 4WKNA 4EA7A 5FOTA 1ZGJA 2NZJA 4IR7A 4CMCA 2VJPA 1U2DA 4R6WA 3Q9LA 2NZVG 4NYMQ 4TVBA 4E09A 3HXOA 1BMFA 3TXYA 2I9IA 5KDLA 1II8A 4ZHQF 5C80A 2FMUA 4UBMA 4BEVA 1BH6A 8LDHA 3TRDA 1ZBDA 1OB2A 1EFLA 1PG0A 3VBEA 1AE1A 1D2HA 4P2BA 3LBAA 1MENA 4QTTB 3SQWA 3E3LA 3S55A 4LA4A 1LW6E 5TPZD 5IEBA 4AO7A 1CW2B 3E4DA 5DEOA 1EFPA 1COZA 5FKJA 1IXRC 2QT0A 3TL2A 1DPGA 4UOEA 1E9EA 1Y37A 2QX9A 1CRLA 1MB2A 2WVGA 3EXEA 4J4HA 4PTLA 2FP3A 2UUBE 4TTPA 4DJEC 5LZ9A 3EAFA 4MRSA 1OLXB 3PLNA 3X1XA 2EVWX 4PXSA 1ZJWA 3HNPA 1U9CA 3O0TA 2VATA 4A26A 1LDBA 2X1LA 1P31A 3MFYA 3P0JA 2WVHA 3R09A 4REQA 5ALNA 2IIQA 2UZ1A 4NV1A 4R2IA 1NKVA 2TMGA 3DOFA 5F98A 2ST1A 3HP4A 4R1SA 5M29A 4KQHA 2DWQA 4MKIA 2QAJA 3ZE7A 1LH0A 1Z0JA 4WE3A 1YC2A 3ZQ6A 2G1AA 4XYLA 2IVFA 5FV7A 4LNAA 3K16A 4AN1A 4LHEA 4JEMA 2GPNA 4KL8S 4FCVA 3ZEIA 1TIPA 2R66A 3LHSA 3RC1A 2E49A 4S24A 1FF9A 221PA 2V74B 5D6OA 5I9TA 1JI3A 1WHNA 3JXEA 1IWOA 1G8KA 1KGDA 2GCOA 1N9KA 4QT4A 5KYKA 3VNVA 1T24A 3GFPA 3N7AA 1P72A 2FR1A 3U40A 2Q1WA 4J1TA 1SKUA 2NV2B 3GV0A 3OFNA 4DLTA 2EN7A 5AKJA 2PUEA 3L7JA 4PQYA 1AUVA 2H2WA 4LRUA 4XR4A 3GNSA 1U02A 2RI6A 1QGED 4E14A 2CNKA 1C3JA 2Q28A 1WHSB 3QPAA 4YDSA 4KKVA 1FLVA 1HYHA 3AK4A 3IHKA 3Q1LA 4X90A 5CRIA 4QXQA 1ADJA 4RH1A 2PSSA 2IS1A 1FRVA 2RCNA 1PKXA 3R0QA 3H99A 4O2BF 4F5EA 4LDRA 4W7HA 1EQ2A 3CCCA 1JWBB 3D8SA 3D8TA 5DTEA 5JCZA 4YP7A 1PJLA 3GJ4A 4BMPB 1YJAA 4HFMA 4B7XA 3EEFA 2JDIA 4JASB 5TSDA 2XZOA 2EJBA 3O8QB 5JAQA 1R5OA 2VJDA 1H1LA 3WYDA 5FI0B 5JO0A 3AJ8A 2O5CA 2FN4A 1F0KA 1P5ZB 2QL7A 3ZE2B 4IXNA 3MGGA 2GZAA 4EUNA 3AONB 5IAJA 2CXOA 3AU9A 4FYXA 1E9FA 4EQZA 3N75A 4QO8A 5JXWA 3A6HA 5D01A 1QG4A 4EBFA 2AZDA 3AEXA 4HAYA 3FF4A 4KOAA 4QJIA 3DQZA 5ALSA 4Q4AA 2MCFA 4K0KE 5I7AA 2VWHA 3KKLA 4U7GA 3IP6A 5IFLA 4YUYA 1XZCA 1NYRA 3P5BA 1XT6A 4LS3A 5HZHA 4GP6A 1CV2A 4O2RA 1T3GA 3ZZUA 3I04M 5KVQA 4DN6A 4XWWA 2VDRB 4G0YA 4GEKA 1ORDA 1TW3A 2FHSA 2A1UA 3CKLA 2RJOA 5T8KA 4GUAA 1A77A 1QHYA 3FNGA 5LXTF 1KK3A 4GWKA 5JS6A 1T2AA 4RZ2A 1KO8A 4H4DA 1GLGA 5B37A 3T7AA 2EEZA 3ROMA 1VLQA 1ENOA 2VDWB 1OZFA 2OXFA 1U8TA 3FMIA 4QICA 5CXUA 3KYDB 2WFAA 1E6UA 3ZDXB 2B4RO 2FPWA 3NRJA 1MCZA 3MTIA 5AW1A 2BKXA 3PUHA 3HV2A 2EPRA 3HCPA 1ML4A 3H5AA 2FUKA 2GEJA 4GSLA 4MRMB 1RI3A 4Q48A 3AY6A 3ACBA 4HDMB 1HEIA 1YZNA 4EHDA 4ER3A 3DFMA 4W5HA 4KQXA 2VBFA 4PIPA 1FVHA 3IV7A 4G4SO 1OGIA 3H42B 1C0PA 1NLUA 2BR4A 2P7IA 1UWKA 3CF2A 3H6KA 4JQOA 2W2NA 6REQB 2OKGA 3DO8A 2K4VA 2HXGA 2QL9A 2VHTA 1HGXA 1P60A 2A1TR 1GCOA 1M33A 3MWDA 3U48A 3F7NA 5KJ1A 3HPZA 2GM9A 3ZDQA 2JCXA 2OZKA 3KUKA 3PPWA 3OA0A 4HVAA 4PW0A 3VR2D 5JNVA 2XYRA 2WJJA 1MVNA 1M1UA 2F9LA 4PZCA 1E9BA 1P1JA 4INPA 2FV4B 3GP5A 2FW7A 1NI5A 4K9SA 4BNTA 4X66E 1BW9B 3EK2A 3O94A 4Y6RA 5KC8A 1J0EA 2YVQA 4DV5E 5EAIA 4B85A 5KWJA 1FDIA 1CJBA 3KELA 1GSHA 2FJ0A 2HJVA 4TYNA 1UPCA 3GAFA 3GLFE 1SVKA 3TBHA 2IEGA 3AU8A 1RD4A 5KPDA 2R62A 2QMUA 1G5RA 1SC4A 1AB5A 2J9GA 3ZTYA 3SXUA 3R20A 3NYIA 1J09A 3M3PA 2YWHA 3CNOA 2UVPB 2O6HA 1JK2A 1IPHA 1RPNA 2EP8A 2JASA 2V98A 3B1KA 3KHSA 3PEFA 4M0EA 5FORA 5HPYB 2YYZA 3H5NA 2DFLA 3MRSA 1NVWQ 4ZODA 3L0SA 4AD8A 3ZYZA 1JYFA 2HA0A 3DEAA 1E79A 1M1YE 3LUJA 3ED1A 2Q0QA 1XXHE 4NOMA 1THZA 4RSRA 3D2BA 3T3GA 3M33A 3M6IA 3TEMA 2QUBA 3RFUA 1A0OA 3THNA 4JI2B 2CFSA 4WNAB 4X63A 3SEQA 3WLSA 4OYLA 1DE0A 4P78A 1L5MA 4U2FA 1PU2A 2VXYA 2E55A 1HT2E 1T6YA 2H7XA 4R51A 1HYQA 4KIUA 4MW1A 4XVCA 4Z3DA 2L2QA 1DFGA 4GOLD 1NOJA 4GIBA 4YP5A 1SFRA 4TT3A 4WXYB 5IYZB 3WMRA 3JYNA 3U2QA 2IS2A 4KVFA 5KVSA 1UKZA 1KEUA 1K89A 4JD5A 1VBFA 2GYUA 4B4OA 2RHHA 3K0EA 2OV3A 3EIFA 3U37A 3P20A 3WWZA 3H1EA 1XRMA 4F4DA 3WL8A 3EB9A 4XFDA 4FW8A 4NYMR 4MI3A 4B09A 1UKAA 3URMA 5KEIA 2YTNA 3BE8A 4Q3DA 5I3ZA 5JAMA 2D2FA 2QENA 3PD7A 4AUNA 3F4BA 1GUFA 1SQSA 3JQDA 4JCOA 3N86A 1PJ4A 3LUFA 4KR9A 4F4FA 3A32A 1ZESA 2BGUA 3HY4A 1FTWA 3QY9A 2OMKA 4FVTA 3DE3X 2Y0PA 3I09A 4MVJG 3SX4A 1G4UR 1UJBA 1VZ3A 5F73A 4MGEA 2AN1A 1WXEA 2IY9A 3MWLA 4M0LA 3TFWA 3TM5A 2VRBA 1EFHA 2W4QA 3KR9A 4DDKA 1I2CA 4QDUA 2V7TA 1MVOA 3DV9A 3GFTA 3PCXA 3FSEA 1WVMA 1XZNA 4TWBA 5SY6A 4A0HA 1LB1B 2ZS9A 5CB4B 3NRCA 4DUYE 3SEZA 2WSSA 4JDPA 1OLXA 2BEUB 3AFMA 1NQTA 4Y2GA 2W6ZA 1M6VA 2XR1A 2Q1XA 3TTSA 3GFFA 1RRCA 1YQTA 2EEPA 1YTUA 2LCIA 4OJTA 1ZEJA 1X49A 4WUVA 3RFTA 3PUJA 3EVGA 2NVBA 3G2JA 3V5NA 2JJ2D 3FZNA 2D1YA 2ZYUX 2HY7A 5AM0A 1UK8A 3RARA 1N0IA 1UFRA 1E2DA 1Y4SA 5KMGB 2YWQA 1GFZA 2FUEA 2VF4X 2BKAA 4UM5A 4DG5A 4JI6E 4ZYYA 1HFKA 3CLRC 1NBME 1XLVA 1PD0A 3N74A 4DQVA 4LF7E 3EOZA 4P9NA 3LNCA 4ANFA 1QG6A 3OJ0A 1SHZA 1I8TA 2V6JA 2HREA 2Q2WA 3VR5H 2RC6A 3OMLA 5HCNA 4PZ0A 3DBRB 5IXSA 4WSGA 4GX5A 4PXYA 2XUFA 4YT5A 4C30A 1EFAA 1GPWB 1TMYA 3JVVA 3MERA 5C53B 2JHAA 3CMMA 2ZB4A 2F3PA 1WHSA 1LPNA 1RMQA 5H16A 4MNTA 2VFAA 1F51E 3KSAC 4DSUA 4C21A 4CHTA 2XTZA 3QEAZ 3LT1A 4ZT5A 4J3NA 1P44A 3KCNA 4QUGA 3T15A 3BRCA 3GFQA 3MILA 2I29A 3SZLA 2ZBUA 3AOGA 3GW8A 3VPSA 4XDZA 3K70C 3D31A 4AN0A 3O8QA 1F5NA 4AXBA 1KAMA 4YRFA 2XBUA 1TYAE 1ZK0A 2WUDA 2XHZA 1E2HA 3VVMA 4NFSA 5HJEA 1OV4A 3F6GA 2R00C 1CY0A 2FXIA 2QY9A 4CTOA 2O0MA 3PDIB 2X14A 1NG1A 2PRKA 4HDKB 2HSWA 1C8LA 1JAXA 2PFSA 4FCCA 3SC2B 1CUWA 1KO4A 4XYEA 2PNFA 3LFUA 4HFRA 5BSTA 1PJSA 1QMGA 2P4SA 2GBPA 1I4WA 1DQPA 3RT9A 3K1YA 4AYWA 2Y76A 4NZNA 5KNBH 3N6XA 3KU4A 4B3JA 1Q0ZA 4UD2A 5C35A 4BV3A 2FX5A 2YCLA 2C4TA 1K1EA 5JROA 4IV5A 1K86A 2DWPA 2O14A 2QJOA 2VDKB 3AHJA 3UJAA 5COBA 4V3CA 5CDUA 3R9KA 4NONA 2DHRA 1YB5A 1Z33A 1F0NA 4EW1A 2VDWA 2PH7A 3HXTA 3NHUA 3W4KA 2IYXA 1OBVA 1Q16A 3KYDA 5EFZA 2DY0A 1FRNA 1HZJA 4ZJPA 4RTMA 4UPVA 3VYSB 5AI5A 3CLHA 3EWNA 4MRMA 5E2IA 1DQ3A 3NFYA 2BM8A 4EFNA 1LDGA 4HDMA 2M1ZA 1N5LA 3P9KA 3HEMA 1JEOA 1C3LA 3HWX1 3RKRA 3HVIA 2XMSA 1IULA 4PV7A 2X5NA 4GKBA 4F8YA 5GADl 4R1LA 1GSOA 3AUFA 4ALJA 5BWBA 3W77A 2O5EA 4B48A 4C6TB 2CLEB 5BSHA 1E32A 3F9IA 1SEVA 1ZU1A 1C80A 5JD5A 2V87A 5K3SA 2AMYA 1U4SA 3R5HA 3FBTA 4PSAA 4X64E 1GFWA 4H18A 1LK0A 2DRPA 3U0VA 1SPBS 1DBPA 2IHJA 3HBJA 3NB0A 5A04A 3RS4A 5FWDA 4C29A 1XNJA 2VSXA 3KQOA 1XTBA 3FFTA 2QA5A 4BNZA 1BW9A 2DH5A 4TS9A 4YH1A 1WA5A 3WWCA 3KUXA 1U8FO 1K63A 3HB4X 4OHFA 4RM2A 3GWZA 1FX1A 1G9TA 2GLUA 4HH4A 3V4LA 3FNHA 1HY3A 2Q5JA 1UOOA 2WJHA 1J8DA 1JQ5A 1Q1BA 3IBCA 4CG2A 4JT2A 4EEZA 2YZKA 5JNUA 4FYHA 4UEWA 4IRMA 2UVPA 1X0XA 3DT6A 4S1VA 4XEHA 1EP3B 1NJ8A 1YIAA 2C0QA 2YJ5A 3HLTA 1MX9A 5F1YA 3N0XA 4NESA 2KHZA 1E6EA 5A6AA 4JYZA 1HDEA 4DR1E 3GBSA 2E89A 5KS2A 4R9VA 3A6ZA 4L22A 3BBGA 2YMPA 4WNAA 2OYCA 2P79A 2VO1A 4QDZA 3BXZA 4ARIA 3HYLA 4AM8A 2EFJA 5CURA 4OAPA 3WISA 3AW9A 2LCFA 2HJGA 3DKPA 4ALKA 4D0SA 2YWGA 1MC1A 1RIIA 4JI5E 1PYGA 1UDCA 1QJ4A 2HF7A 3PQ4A 3QGMA 5IK2A 2PNJA 3S5JA 3WLEA 4KGXA 1UC5B 3QIVA 3IBFA 3GGDA 2HFJA 1D8TA 3UHAA 5ELLA 3ZV4A 1YR7A 1H4QA 4Q3LA 3HR8A 2PKRA 1H69A 1YKFA 3TI7A 3KQNA 1T3HA 3EY9A 2VHEA 3GJYA 1AKUA 1D2NA 2O8EB 5FLXC 2IXFA 1THGA 3QLUA 1SKQA 2EM8A 1GITA 5F4BA 3INYA 4NEGA 1G20B 3CUYA 4UUPA 4C7JA 4N39A 1ADGA 4F2JC 2O8VA 3TE6A 3YASA 4JI1B 3IBTA 1KK0A 3J80C 2C07A 4NZZA 4IV8A 1GQQA 2P77A 1GFIA 4JLWA 4R4JA 1I4EB 3E5RA 3QF4B 1MEEA 3QJ5A 1U6KA 3ADLA 3EYAA 5JY1A 2FFQA 1ZR4A 5K20A 4M8LA 5IDVA 1TMKA 3V46A 3MGBA 5ALYA 3WWOA 2H4XA 2NO9A 2PKYX 1VGQA 1C3EA 5CB4A 4YV7A 3IE0A 3D3EA 2FPMA 2ZSHA 3M6FA 2CHVA 2BEUA 2PX6A 1TAGA 2FCRA 3O6VA 1T6NA 3TR5A 2JAXA 3PXAA 1PE0A 3RVLA 1T5DX 4Y0NA 3C7CB 1Z0UA 4AG5A 3O3NB 4E11A 4NJEB 3ADGA 4X3PA 5JWOA 2FEAA 4JOSA 2QTVA 4PXAA 2I2AA 2OG2A 2Y9PB 3KLNA 3HUEA 4PX3A 2ZYWX 3X1WA 2EOQA 4BNYA 1NNEA 1E4YA 3G0CA 3QLVA 1H94A 2IEBA 3C97A 4ZU6X 2VWGA 4JXKA 4BFSA 4RNCA 2H9YA 2O2IA 2QD2A 2W2TA 3PQ8A 3WSWA 2C82A 1VGRA 2D74A 1KSGA 4I81A 1WMFA 1QX3A 3H0EA 4UVEA 5EIHA 3KSRA 1DXQA 4BC7A 3H19A 1Y63A 1KPIA 2WJIA 1UPUA 2REXB 3HM2A 5T3YA 1AXGA 2E5FA 5K0GA 3DBRA 2NN3C 2Y1OA 4WZAE 3DKIA 1L7DA 2Z58A 2D00A 3E48A 4QRHA 4XEUA 1SR9A 5I7HA 1JQBA 2B0JA 1RDFA 2ZBDA 4G5GA 1MZVA 4I6GA 2F43B 2D2VA 2VYND 3FCSB 5JSZA 1E8NA 1TW2A 2EBUA 1H8HA 3IIMA 3IP9A 1W25A 3V2IA 3L92A 3I61A 5IXJA 1CFZA 1Z1BA 3OJOA 4EO9A 1ODLA 5IBRA 2HC9A 2GPBA 2ZIEA 2C4MA 4L02A 2G82A 2L42A 3PXBA 4UJ5A 4ZYZA 1NTOA 3C2QA 1TEVA 1K7YA 1HH4A 1TO1E 2Y6UA 1ZFNA 4JT9A 3CFYA 1H2EA 1KK2A 1KEPA 2YFQA 2PZGA 3SDSA 2YBEA 3WNBA 2JW5A 4JVNA 4BHTA 4QEDA 4EF5A 1EA7A 1JVNA 1YZTA 1Q1NA 3HADA 3PDIA 2IY7A 4JWTA 4PZ9A 1NF8A 4RK5A 3RD5A 3SQNA 4HVCA 1ZH6A 3C8UA 1JG6A 4F71A 2APJA 2AH5A 2ZZNA 4ZREA 3SC2A 5DYNA 3BZUA 2Z3WA 2OFPA 1DJQA 4DSNA 5C7LO 2HF2A 1NNLA 5BSEA 1IQRA 3M5WA 1TA0A 2O2SA 1X1QA 3IOCA 3B70A 2FW1A 4N7BA 3OPXA 3ZY5A 1D8AA 4OL0A 5DB4A 1Z4LA 3WIVA 4DA7A 3KL4A 1QAOA 1L1QA 1SXJB 4GI7A 4YONB 1MA3A 2PX0A 1SRRA 3DLBA 3OY7A 4NBVA 3ZW9A 3W2HA 3PX7A 3DCIA 2AYYA 1I1NA 1R12A 1J1UA 2FY8A 2WJGA 1N7IA 3B85A 3H2BA 3I05A 3R9IA 2HJSA 5IARA 1ADBA 3OBBA 1Y1LA 4BX0A 4YPVA 4UHCA 2RGNA 3LX8A 1AKEA 4D74A 4GR4A 1ZNYA 1HK7A 4FBMA 4BQEA 4R8SA 1VL5A 4EHJA 1H3FA 1PL8A 3PR3A 2GYYA 1A8UA 3ZHTA 4C0AC 1B1CA 3GRCA 4IMJB 3HCWA 2D59A 1VDMA 2PANA 1Z5VA 3ECAA 4QX6A 3ST7A 4BQIA 1R0CA 4ZOLA 3JYHA 1G7TA 1PNTA 2QG9A 1R5BA 4KI7A 4HXFB 3QFCA 3ABZA 2OO3A 2D1FA 3BTUA 1KQ3A 1U9JA 3EQZA 1W9MA 1PWHA 2JB9A 3G1TA 4H4EA 4CCYA 3G5AA 1ZAYA 3KYCA 4TXLA 2ZUBA 5HXAA 2P6RA 3AJAA 1GUDA 1GWNA 2AV6A 5EQTA 2H08A 4C6TA 2O3SA 4ZDKA 2VC2B 2VK8A 3OLYA 1PJ8A 4IICA 3BICA 2BKLA 4XTCS 1QAMA 4QHYA 3PEVA 4JUDX 4AJJA 3AVXA 2E3JA 1DIOB 1FTGA 2CB9A 4AU1A 1DIBA 1RWVA 4H3KB 4PPNA 5CT8A 3G8CA 3WK4A 4EFKA 4GOMD 3EZGA 2UUAE 3AGPA 2AT1A 3PRYA 3RQSA 2HRCA 4MLZA 3ER8A 3TEJA 4BKOA 4PS0A 3OQNA 2XB2A 1UM9A 1PKEA 3NFRA 1Z16A 1M72A 3VR6H 3K6KA 4ZZ0A 1KAHA 3KEQA 3QXXA 1ETUA 1H93A 2XMRA 2RC5A 1CYDA 4ZTUB 1XZDA 4BKRA 4A8JB 1O0WA 4CTNA 1JIKA 3E9EA 5BR7A 3T41A 2DTEA 3I01M 3OOSA 2FPOA 2P11A 4L15A 5CXXA 4E5MA 3QW4B 3LH5A 5L40A 4IP0A 4OQDA 2CLDX 3ESRA 3I32A 3MD9A 3IKVA 4O4HB 3S8EA 2V54A 2GPIA 4IMIB 1JIUA 4IIXA 2YIDA 5A5DA 3WO1A 5FQNA 3R0XA 4IMRA 1OZ0A 1PT7A 3OCVA 1JDZA 3TZQA 3L7DA 4JLKA 2Q7OE 2ZSDA 1RI4A 1M1XB 3PYXA 4X8HA 4FU0A 3M2TA 2B2NA 3W9SA 1GEGA 2OOSA 3OKFA 3WDKA 1JT9A 3T94A 3HO8A 4XVHA 1SZPA 2ZYVX 2JLWA 5K3DA 1B26A 1QIGA 1ADFA 4TYYA 2WZCA 1X9IA 2J45A 3BRWA 3C4VA 3RB8A 4HVLA 1N2CE 1YH3A 3UO8B 2R751 2JY9A 3BJIC 2RHBA 3MPOA 1D03A 3VH3A 3IJEB 2WKWA 4B9AA 4R1OA 2CDRA 3W6PA 3LY7A 3WK6A 2I9KA 5HKOA 4KRFA 4PBSA 1KH3A 2WKRA 1TM7E 2W6IA 1ZM3A 4EKEA 1ZXXA 5H9WA 1CNFA 3TZHA 1MX1A 2OILA 2O8EA 2KW5A 1Q1EA 2QSZA 3KBOA 1OX4B 1Q3TA 2CXQA 4J2HA 5EKTA 5FLEX 1G20A 1HYBA 3Q2OA 1FFHA 3R5FA 1PX2A 2XWBF 3GLHB 1DFIA 4K6HA 4ZARA 4X1KB 3NBKA 4MW9A 4C4XA 1Y3BE 5E7JA 3FHCB 4OX9Y 3BMNB 1O6FA 4GPAA 1F9AA 1V16B 4E15A 1KMCA 3CZ9A 4BNFA 4B7UA 5JLJA 3FVVA 3QF4A 3FNFA 2E18A 1QORA 1ZZEA 3CY6A 3GLIB 1YHZA 2QTZA 3C3CA 1BOOA 1UDBA 2JCGA 5F12A 4AZSA 2AZTA 3DL0A 2E82A 2FZWA 5GY7A 5BT9A 1Y7TA 2LW7A 4RYDA 1G4AE 5D5QA 4ZT7A 1T3ZA 5IMBA 3VR5D 2XIJA 1XA3A 1EKZA 3V7YA 4WI1A 1VRCA 5HF5A 3SSMA 3GH1A 2WU3A 4JYMA 4ARZB 3I2GA 5CNIA 5F1OA 2RGGA 2DU8A 5B58T 4II7A 4C08A 4HDSB 4G6ZA 1RVV1 2ZSJA 3A05A 3G13A 5FXMA 3V4OA 4C22A 2J1LA 4QIHA 3GLGE 1R0WA 3ZHZA 3VVCA 2P2LA 5JALA 3GIWA 2A4MA 2QN6A 4TKVA 4Z9XA 1NJ6A 1YIDA 1QH8B 2BRUC 4DA8A 4YHHB 1G2IA 3I6IA 2DJIA 1CJTC 4PHFA 4GLJA 3CNLA 3EG5A 4OQNA 4PFQA 4X1YB 2G7MC 3NASA 3X43A 1WKVA 4XDHA 4C04A 4XIJA 1A5AB 4F9BB 1NJFA 2PUJA 3THRA 2UYCA 2A0UA 2J9FB 1ZOLA 1I6MA 1L6RA 4QOGA 1TL7C 3I0ZA 1FLDA 2ETXA 4H6VA 3V8EA 4FD3A 1WPRA 4HLCA 1AZTA 1OE0A 4OMUA 1NJSA 2UUCB 5BNWA 5AUOB 3LT2A 4OHUA 2RQLA 3T7CA 3L3BA 4JP8A 3FOEC 2LT7A 2PGIA 2F43A 3BHNA 3OFVA 3VZCA 2BMDA 2VP6A 2J0VA 3FGPA 3GRVA 4Q9LA 5L3RA 4K26A 3DC2A 4ALMA 3L8EA 5A0FA 3CLKA 2YX1A 1MAAA 4N5DA 5G4LA 4F4JA 2C9CA 2HQRA 1SXIA 5KNBD 1XMXA 1Q12A 3MLBA 5ITWA 2HHHE 2HRQA 2CK3D 3MTEA 4DQ0A 3GELA 4EHAA 3WL6A 4I5IA 5CG2A 3IMCA 4Q9KA 3WYAA 1AK9A 3KZXA 4B6OA 3UMGA 1PZEA 2XMQA 3DAPA 1JU9A 4N6NA 1KO5A 4WEOA 3EZFA 3RAGA 1DC4A 3QJYA 1YT5A 1HNNA 1QC5B 2I33A 2OFXA 3ROFA 2WWFA 1RQ7A 3AFHA 2P78A 3HCAA 3HB9A 3FDZB 2JLUA 3Q1KA 2AF4C 3O83A 4DR6B 2H51A 3TVYA 1I6LA 1LDYA 1KSHA 4B84A 1WIWA 4LY9A 1T9GR 4Z7JA 4AIIA 5JS7A 3GT7A 3NOOA 5GGXA 4DMFA 5K6AA 5M04A 3SIPA 5CEFA 2E4ZA 3GPLA 5DI9A 3KAJA 2FSFA 3B6EA 1QFZA 2VSFA 4O5GA 3CR3C 2VYVD 2ZSFA 1SXJA 1XMOE 1V9CA 2WBUA 3AIKA 4MW2A 2HSJA 2HJJA 5A4MS 3CSUA 4YTEA 5EUBA 5KSWB 4MQ5A 1K7FB 1MN6A 3QVSA 2D0PB 1THMA 1QHGA 1GTMA 1WPGA 1LPAB 4X24A 1EE9A 4U39A 1NVXQ 3VZDA 1TFUA 3SKXA 2FN9A 3BH0A 3L06A 5A05A 5KREA 4G0OA 4URHA 4DWJA 1AO0A 1E3QA 2B9VA 3FPCA 4BVJA 2IH2A 2WD8A 4WEQA 2A78A 2FWPA 4YQYA 3CVJA 8ADHA 3DLHA 1XWWA 3B3AA 2EZ8A 3T7DA 3WWEA 1Y82A 2A9PA 2ANBA 1TVKB 3MK31 2JJ8A 3CEHA 1JMVA 2GPJA 4DJ5X 3OZCA 1ZOOA 4D79A 3HVUA 3KP1A 3AKZA 2C99A 1TECE 4WOKA 4C05A 4KPUB 1H2HA 3E7PA 4BC1A 3S40A 1W46A 4RKRA 4BJHB 2D0OB 3DYIA 3O1LA 4TM7A 2HWUA 2BGMA 4X94A 5G41A 2F1KA 3LG2A 4DMMA 3HM9A 2VQFB 2QTLA 4U5QA 1A4IA 3VFDA 4RZHA 1OH8A 4AJLA 5AW0A 4F1JA 5I4IA 2HF8A 1D2RA 5EINA 1V4NA 4GDMA 1Z6QA 3COWA 3BREA 3KEMA 3F5QA 2O2CA 4A8JA 1ZXLA 4LGMA 4WGGA 3RU9A 4HNAB 2H54A 4MX8A 2YJNA 5IT9A 3Q2KA 3KR2A 4B5KA 4C43A 4D9EA 1NUQA 1I4TD 3EXAA 4A5OA 4G0WA 1XNHA 4O4HA 2WBTA 3ZV6A 1HFWA 2KOUA 2ECKA 1V7ZA 4G5HA 2YHAA 4TYQA 4JXJA 4IFBA 3ZKWB 2O2ZA 2Y0DA 3QPCA 3UJCA 5KNCH 4KHPE 4KQ9A 5MF6A 2OAQ1 4LI0A 1FYFA 2Y2UA 2R65A 4BNMA 2XMBA 4I5GA 4AY6A 1SUPA 4JC5A 3TX6A 4JYAE 2HIAA 3F49S 3HYSA 4HMPA 5C34B 4MYHA 1Y1SA 5HIMA 1KK1A 1M9NA 1V1JA 2QD5A 2XT6A 3FOAA 3FUUA 5IKOA 2R6DA 4C03A 1GQSA 2RH5A 2NUFA 1P47A 2C2HA 2QLBA 3BMQA 3DE0X 2GASA 3RQIA 1K75A 3C0KA 3LF1A 3TUZC 1IBCA 4LRQA 3P45A 3ZXYA 1IBLE 2G25A 4D97A 1TO6A 3LHDA 1AKMA 4YCMA 3ZDDA 4YK7A 3T1NA 1XN1A 4K6KA 1SVOA 4QG7A 4NU5A 4S1WA 1P2UA 2KJQA 3ZFNA 4AS3A 2L92A 2CBGA 1OX4A 2DYKA 4TLAA 2H5IA 5ECGC 1BAPA 4JI4B 3JR7A 3KD2A 3GLHA 4RZ3A 1AHHA 4XOIA 4X1KA 5PNTA 2I4NA 3BIJA 4X9JA 1XLTC 2RJ3A 4IQFA 4ND6A 5EE1A 3SICE 2HU5A 2QW8A 3CNNA 1QAQA 2I5PO 1W48A 3CX6A 5EMJA 2YTOA 13PKA 1TO2E 1W0CA 3BMNA 4DZZA 1V16A 4LMRA 5EPUA 4E12A 3U3XA 1UKEA 4G8CA 1H9CA 2OUIA 4U9HS 2YSPA 4PZZA 1K6MA 4BQQA 3L0ZA 2ZAMA 3HACA 2EQ0A 2YS6A 3GLIA 3SSNA 1JLMA 2DG2A 1HYGA 2Q41A 1S1CA 2GEBA 2NT3A 3A1TA 3GLUA 4Z7QB 1TOAA 3IIKA 2AOUB 2I34A 2CPNA 1AK2A 1I0IA 3A6KA 3RPEA 2ON6A 5HE9A 4NCNA 4E30A 4BNDB 1HI9A 1VLVA 4LK3A 1JDPA 5JJKA 3GB9A 2OFWA 1A97A 4ARZA 2IX3A 1XQWA 4B3ME 2QDKA 3RF6A 3RAPR 4YCJA 5G40A 1QF7A 4HDSA 4XQ9A 3JD3A 1UKBA 3ADKA 2ZU0C 3PNMA 4Q9DA 3WBBA 3PHIA 5ECYA 4RQAA 5HMLA 2AEMA 4GF5A 1Z7WA 3L7OA 2H0RA 4FK8A 4NNOA 2B25A 2BFMA 3FCEA 4C0XA 2BVNA 2SBTA 5I9IA 1QH8A 2B7TA 1XCLA 5AW3A 2H65A 4PE5B 2XCSB 2A9RA 1N6RA 1TZMA 1H4TA 1YR3A 3FSJX 2FLKA 1NVVQ 2EM0A 1OJ7A 3R5KA 4O5AA 1AS2A 4ZPJA 3SZOA 3VUFA 5CH3A 3VZQA 5KQPA 4YRSA 2J9FA 2WHXA 4ZDWA 3V1LA 1ZICA 1FBTA 2IJGX 1UC8A 4X8MA 4PNZA 2G0NA 3GJ0A 4GP9A 5DBIA 5IDYA 3CNQS 5GOTA 5D85A 2F3TA 1NW8A 2OFFA 2P4HX 4CL3A 3LPMA 3FROA 1FRFS 4KPEC 3THYB 2WE7A 1TKRA 3K70B 5KTNA 3UKJA 3HO1A 1XPOA 2B30A 4GGPA 3O4GA 1DBRA 1Y5NA 3BERA 2EOIA 2PBZA 1G42A 2Z2JA 2R8RA 3S44A 1OI7A 2IU3A 2O59A 3F6CA 2ZTHA 1NQUA 3TB4A 2YTEA 4MDHA 1IQUA 4FJ0A 3WMEA 1EWYA 4C3OB 1EXVA 4ZDJA 4PCVA 1JQ3A 1QZ3A 3QNWA 2FA9A 1ISGA 1OXKB 4AC9A 4ZV9A 4XLZA 8ABPA 4UCWA 3SIRA 2C98A 4L5BA 1QC5A 2PSJA 2POQX 3PXUA 1O2DA 2Q4TA 2EBFX 2I62A 1CZUA 4KIGA 4ID3A 2D2XA 1CERA 2FTKE 3FDZA 4E4TA 3L0IB 5LQJA 2O1XA 1IHOA 4HG2A 1UJ2A 4G26A 1KFBB 4PO1A 3M2PA 5TF0A 1P5JA 2FSVC 3BB3A 1ZVQA 3LIIA 3TOVA 1D1QA 2HQSA 2BHSA 4PYKA 2VJYA 3PCRB 5D3KA 1UJCA 3TOZA 1A1VA 1I7NA 1SHUX 2KLHA 4NTZA 5F52A 4B8WA 1ECGA 2HMAA 2X0RA 2DPGA 1E9SA 1BJTA 2G40A 3AM5A 3V3KA 2O8BB 4QYIB 4P3XA 1N5OX 4P3KA 5I3CA 1YFZA 3QUAA 5CFRA 3GGCA 4RACA 3JTZA 3H83A 2DH6A 4IYJA 1JYEA 4LYEA 1DADA 3EXFB 1KI2A 4DLXA 2ZE7A 1FNMA 3EFBA 3O4RA 1Z6AA 4FIZA 4FLEA 3ZKAA 2A9JA 2CLKB 4RD0A 4RH8A 2JFQA 1LLUA 4G0VA 1Q84A 1GA6A 1N2OA 3PFGA 2AFHE 5MN6A 2EYUA 1YXMA 4JBYA 3VR6D 2CZQA 4ZEOA 1T36B 4WERA 5I9SA 3ERCA 3E22A 2B1QA 4EPRA 3MXTA 1AKRA 2C9ZA 3V7UA 1UXOA 3NCHA 5D84A 1NEIA 3QVXA 5DCLA 4RF4A 3WLNA 3ANSA 2VEOA 1NQ5A 3PR2B 3DR3A 3W5JA 4CM9A 1RAAA 4H3SA 3TNYA 1K3TA 3HZRA 2F67A 1FS6A 5LZ7A 4XM0A 3W5BA 5DULA 4G2TA 4URWR 5G0SA 4NS1A 1CDEA 1QB8A 1I3LA 1Y3AA 2W2KB 4YPOA 1X8XA 5A1JA 1AGRA 2AEEA 3U39A 3OPNA 5JRJA 3IXLA 4K9LA 5G2OA 3ETDA 1ICIA 4Q19A 1F0YA 1YDGA 3O95A 2G4VA 5L3SB 1WLSA 4MVJF 1KIMA 2XA9A 1T5OA 1EDEA 4I50F 2HC5A 4UMVA 1P9RA 3AKDA 4C2BA 4HNAA 2G63A 1ZGGA 2AXQA 3WHPA 4NR0A 5FUXA 3TZEA 5KNDA 1GKYA 5IWAB 4KR3A 4NBTA 3KNZA 1NZDA 5J47A 1IZ7A 1WSDA 5A5EA 2HGSA 3PFKA 2E0IA 1IL0A 3IXMA 3ZKWA 2YR0A 4NZYA 5EGNA 3ZBQA 1ZA2A 4EI7A 1G1MA 3MJFA 3UBTA 4RPKA