3C6KA

Crystal structure of human spermine synthase in complex with spermidine and 5-methylthioadenosine
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
363
structure length
335
Chain Sequence
GSRHSTLDFMLETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYEEIDSILNKVEERMKERVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human spermine synthase: implications of substrate binding and catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Spermine synthase
total genus 103
structure length 335
sequence length 363
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.22: Spermine synthase.
pdb deposition date 2008-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
A PF17950 SpmSyn_N S-adenosylmethionine decarboxylase N -terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 3c6kA02
3.30.160.110 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Siroheme synthase; domain 2 3c6kA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3c6kA03
4KVZA 1FJXA 2HNKA 4QPPA 5K0GA 4BLVA 4DCGA 3HA3A 1QAOA 3FZGA 2OYRA 1KXZA 3DTNA 3ME5A 1L3CA 5LQNA 5U4XA 1YFLA 2OPBA 2XYRA 3KQVA 4GF5A 3U81A 2ZSUA 1ZKDA 2B78A 3OFKA 4CKEA 3KU1A 5FCDA 5BP7A 4E70A 2XVMA 3LL7A 1NW3A 2PWYA 5JR3A 3E05A 3HCEA 2QRVB 3HA5A 2PXCA 3R6TA 4EMSA 4E32A 3UA4A 1NBHA 2VP3A 3T7SA 2IH2A 2HMYB 3SXJA 2IP2A 4HTFA 3BT7A 3MTIA 1SQGA 1QYRA 2PLWA 3BGDA 2PX8A 2AN5A 5E1OA 3K6RA 3A7DA 5LQAA 1RJGA 2LD4A 2P3LA 1L3IA 1AQIA 3ELDA 4E2XA 5GM2A 1O9HA 3QOWA 3V97A 2O07A 2PX5A 2GLUA 4YMHA 2I7CA 1ZG3A 2XYQA 1D2CA 3DLCA 4PYNA 5DM1A 3BKXA 5DRYA 3BGVA 2PV0A 2DPMA 3LPMA 3I53A 3TKYA 3DMHA 2PWPA 3G8BA 4RTPA 3GRZA 3G88A 1KYQA 4G56A 5GP1A 1M6YA 5DTQA 2YUIA 3MCZA 3GXOA 1M6EX 2G1PA 4C08A 5CCXA 2ZWAA 4P7KA 4AZVA 1I9GA 3TLJA 3GGDA 2XBMA 7MHTA 5CVVA 3LGAA 1XXLA 1JTFA 3WSTA 4EQZA 2IDJA 3I64A 3KQTA 3PB3A 4GOMD 1G60A 5EMJA 2B2CA 3LX6A 1BKYA 5EMLA 2Z6QA 1YB2A 3O31A 4Y30A 4YUVA 3P2IA 2QE6A 3OCJA 3OE5A 1N7IA 1QZZA 1VQ1A 4RTKA 2IBSA 3I9FA 3HA7A 3EMBA 2YVLA 5B1SA 1YF3A 8MHTA 3VC2A 1AV6A 4AZWA 3NMUF 2PXAA 3M33A 4RV9A 3B3GA 5EHGA 2E5WA 1R00A 3CGGA 3EMDA 4QVKA 3LKDA 3OPNA 3LCVB 3DP7A 3P9IA 3LBYA 4CTJA 1SG9A 2NP7A 2BR4A 3A26A 3GO4A 5HIIA 2NXJA 2YTZA 4LWPA 3A7EA 4HGYA 1VP3A 1FPQA 4V0QA 3DXZA 4P7FA 4PONA 2PSSA 5EOVA 1L3BA 2VZ9A 4KDCA 5DX0A 1X1CA 4OQEA 5FA5A 4DM3A 4HH4A 4M36A 4R6WA 1PJTA 2HV9A 4PWYA 3KQYA 1WS6A 1IY9A 2CKDA 4RX1A 5KYGA 5LQKA 3KQSA 5K0NA 4M7RA 4GUAA 3NWEA 5DPMA 1IM8A 4YUZA 2QM3A 3CJQA 4MWZA 1KR5A 1VBFA 2AOTB 2BH2A 3AJDA 3FPHA 3DH0A 1JQDA 3E8SA 1FP1D 3FRIA 3LCCA 4RWZA 3G2QA 5EKUA 5EZSA 1JTEA 3KQPA 5KVAA 2H11A 5HIMA 1XDUA 1WXXA 3EGIA 3DULA 3KR0A 3P9CA 4GOOD 4HG2A 3L8DA 3FTCA 3KHKA 5FA8A 3M6WA 3KQQA 4KWCA 5HEKA 1P39A 3REOA 3K0BA 4PYMA 3PX2A 2PX2A 4IWNA 3UJBA 3ER8A 1NV9A 3HVHA 2AOXA 1EJ0A 4R05A 10MHA 3HCFA 5F2NA 3UJDA 4GOLD 4EVIA 4BY9E 3VC1A 5IH3A 3EVDA 5FQNA 3UJ9A 1VL5A 5BW4A 5EGSA 2WA2A 4PINA 5H02A 2VDUE 2P8JA 3DLIA 4MQ4A 5DTMA 3SX0A 3UJ7A 3KKZA 2IFTA 2O05A 2I62A 5BXYA 5ICGA 3IYLW 3GNLA 3KR1A 1R6AA 3KPVA 5EEGA 2P40A 1P91A 1G55A 2JHCA 5K0EA 3TR6A 4FS8A 2ZIGA 3LHDA 4OBWA 3JWIA 4R8SA 3ELYA 3BWMA 2OY0A 2EFJA 3QV2A 5D1NA 3G7UA 3MCTA 4PIMA 5GWXA 1INLA 4C03A 4MTLA 3NWBA 4FSDA 4E33A 1M0EA 3PVCA 4FT2A 2ZTHA 1HMYA 1RJEA 2PVCA 2ZVJA 5LSAA 5DX8A 4GOND 5K0LA 1NW8A 3M6UA 5E9JA 3LDFA 1EAMA 3SR4A 4XUEA 3EVEA 1UIRA 3MHTA 2HTEA 5CVDA 4PGGA 5DT2A 1NKVA 2H1RA 5CVJA 3KR9A 2DULA 3FTEA 1SVUA 1WG8A 5K0BA 5K0FA 1EQAA 3GRVA 3C6KA 1YUBA 2BM8A 2EG5A 5HILA 1F3LA 1TW2A 2JJQA 3DOUA 5CIYA 5HIKA 4NECA 2Q41A 3THSA 1JG1A 2V74B 3LCUA 2CL5A 3EVAA 2BR3A 1NW7A 2ZW9A 2BR5A 3BZBA 4X1OA 4EKIA 5FHRA 5DM2A 4C4AA 3FRHA 1ZGJA 5DX1A 3P2EA 3P9KA 5E1MA 4RTJA 4IKPA 3MTEA 4QPNA 5E9QA 4Z2YA 4RTOA 3LBFA 4RVFA 3SMQA 2F8LA 4DCMA 3A27A 3OZSA 3TRKA 3ELUA 2AVNA 3G5LA 5CCBA 5T64A 1X19A 4ZTBA 3GJYA 4UOEA 3BXOA 3LDUA 1KIAA 4GC9A 2IDKA 3PLAE 1T43A 2ORED 4CKBA 3GIWA 4WXHA 2ZBRA 2NXNA 1P1CA 2OB2A 2P41A 3I58A 3R0QA 2ERCA 1FP2A 3DXYA 4B17A 3C6MA 1YZ3A 3F4KA 5CVEA 2P3OA 3PT9A 5LQUA 5ICFA 1ORIA 3UJ6A 3Q87B 4PNEA 2EX4A 2GB4A 1L9KA 3VSEA 4A6EA 5K09A 4GQBA 4KIGA 1U2ZA 3MB5A 4DMGA 5CVUA 3AXTA 5FHQA 1YZHA 5HOQA 3C3YA 4AUKA 1MJFA 3EVBA 4ER5A 3OU2A 1KPGA 2PT9A 4PYIA 4RTSA 3VYWA 4KW7A 3CVOA 4DKJA 2ADMA 3BKWA 5P8WA 5K8VA 5C0OE 3MERA 3LDGA 1G38A 3ER9A 3KQOA 2P3QA 2Y1WA 3THRA 1EG2A 3KPYA 5EKXA 1BHJA 1RI3A 5E8JA 3G89A 3C3PA 3OU6A 5K0CA 5CUQA 1PJQA 1XTPA 3LECA 5EMMA 2UYHA 3TM5A 2CMGA 5LR6A 2PKWA 2AOWA 2UZ4A 2JH8A 3OZRA 4BLUA 4OX9Y 4YV1A 1XCJA 2FK7A 1QAQA 3RIEA 4R6XA 3T7TA 4ATNA 1WY7A 5HFJA 1TW3A 5T6BA 1VPTA 5EIFA 3P9NA 2HR1A 2N47A 5EVJA 3EGEA 1JG3A 4FR0A 3UWPA 4YUWA 3KPJA 2PX4A 2AVDA 3B89A 4QDKA 5FTWA 5GIOE 3TOSA 4E2WA 1MHTA 3MQ2A 4FP9A 4JXJA 2HWKA 3NDIA 5E2BA 5DLYA 4E2ZA 4F85A 1R8YA 3EEOA 2C7PA 2P1DA 9MHTA 4HRAA 1JSZA 4XCXA 2FPOA 4FZVA 4FGZA 2K4MA 2GH1A 2NP6A 2R6ZA 2PT6A 3G2MA 3NDJA 4XUCA 1SUIA 2ESRA 3TM4A 4WVLA 1DL5A 1OR8A 1EIZA 2ZIFA 3KQWA 4AZTA 4ER7A 2ZZMA 3E23A 2G71A 2GS9A 3KPWA 4HTFB 3V8VA 5K03A 5KS2A 5GOZA 3UA3A 3IV6A 1R8XA 5CM2Z 4KDRA 2PJDA 4A6DA 4C06A 2EJUA 4ER6A 3SSMA 3SSNA 1X1DA 3BWBA 4RSRA 2FCAA 2ZULA 2G70A 1VIDA 1XCLA 3ORHA 5E9WA 3FYCA 2VDWA 4RYLA 2WA1A 2Y1XA 5FWDA 4E2YA 1Z3CA 5LQCA 5FULA 1Q0TA 4QVGA 4PYJA 1P1BA 1IXKA 1RJDA 2O06A 2CWWA 3UJCA 5G02A 5ICCA 3HP7A 4BP3A 3OU7A 5MHTA 1X1BA 4RTNA 4X60A 4PYOA 1UFKA 3LSTA 3T0IA 2ZBPA 2YR0A 3A25A 4LG1A 1NBIA 1O9GA 3EVGA 4HC4A 4ER3A 2XYVA 5K0JA 5KQSA 2O0LA 3EPPA 3GCZA 3PFGA 3OE4A 4DQ0A 2JH9A 4PYLA 2ONYA 2GPYA 2O57A 1XJ5A 3FPJA 3FYDA 1JSXA 3O4FA 4M37A 4DA4A 3KR2A 2H00A 1DCTA 1H1DA 3EVFA 4IV8A 5ICEA 3EGVA 4E30A 2Z6AA 3SGLA 1I1NA 5DSTA 5C9ZA 1EJ6A 5DWQA 3HTXA 3FUXA 2UYCA 4BP1A 3PFHA 2XVAA 1VE3A 2BZGA 3AWIA 2BM9A 1QAMA 3ID6C 3P97A 4L7VA 1JQ3A 1X1AA 2P7IA 2IH5A 4OBXA 1NE2A 3MGGA 2VDVE 4YV2A 1RI5A 1KPIA 4OQDA 4QDJA 4GBED 4ISCA 5EQJB 4AZSA 3JWHA 1O54A 4HSGA 3FUWA 5HIJA 3CBGA 3O7WA 5EZQA 5FQOA 5JUWA 2OZVA 1N2XA 3NTVA 1XDZA 5CD1A 1NW6A 1ZHFA 3NW9A 3R3HA 5FUBA 4OA8A 1D2GA 3D2LA 3UJ8A 2V7EA 2OXTA 3GRRA 5LQJA 4POOA 3DUWA 2P7HA 3BWCA 3HVJA 3GU3A 2PXXA 4YUYA 3G2OA 2B25A 1SUSA 1R18A 2OB1A 1XDSA 3AY0A 3B3JA 3DXXA 3M6XA 4CTKA 2WK1A 3PS9A 3FUUA 3UBTA 2JG3A 4QQNA 4C05A 1AF7A 3FPGA 4Y2HA 4C04A 5KQRA 1ORHA 5DRTA 3RW9A 1B42A 4P7GA 1DUSA 1KPHA 1RI2A 2AS0A 2FYTA 4X61A 4K6MA 4DZRA 2CMHA 3CC8A 3GWZA 1NT2A 3P71T 4PGHA 4DF3A 3ELWA 4LWOA 4U7TB 5EG5A 3TPZA 1I4WA 3X0DA 4RTMA 2VS1A 2OO3A 3T7RA 1ZGAA 2ZFUA 2C7RA 5EEHA 4QTTB 3BGIA 3B3FA 4KRGA 1QANA 2Z6UA 3UZUA 3R24A 4X63A 3CJRA 3HVIA 1ZQ9A 3DMGA 5IKMA 5GM1A 1AQJA 2AR0A 4PIPA 4YUXA 4EKGA 4RVHA 5HZMA 3HVKA 3FPFA 2KW5A 2B9EA 2EJTA 1NW5A 4MHTA 2B3TA 3FUTA 5DM4A 5DXJA 2AN4A 1Y8CA 4FT4A 3IHTA 3ERCA 2YXEA 4U7PB 1SKMA 2P35A 3Q7EA 1PJZA 1KYZA 5K05A 3FTFA 2IH4A 2UYQA 3M70A 2AOUA 4YV0A 1G6Q1 3DMFA 4X41A 3SM3A 3BUSA 2G72A 4PYKA 5D1HA 2PGXA 4PCLA 3P8ZA 5T67A 3M4XA 1HNNA 4CKCA 3JWGA 4GC5A 3TKAA 1JG2A 2ZIEA 3GRUA 1UWVA 2A14A 3NVMB 3JWJA 3GDHA 4RTQA 3EEYA 2AZTA 5DM0A 3KQMA 2FRXA 2GAFA 4V0RA 2YX1A 2PY6A 2QY6A 5E1DA 3HCBA 3ANXA 4ER0A 3HCAA 1KHHA 3MAGA 5M5BA 2I9KA 1V39A 3HNRA 3OZTA 2ZBQA 3TQSA 4F86A 2ZCJA 3GRYA 4KIFA 4RVGA 3TMAA 2NXEA 3S68A 3G2PA 2ZZNA 3A4TA 4C07A 2IPXA 3UJAA 3DR5A 5FWAA 4EK9A 3EVZA 1BOOA 3OFJA 1R74A 1RI4A 4XUDA 5K01A 1G8SA 4H0NA 3TFWA 4CXMA 2NYUA 2OKCA 5EHIA 2IIPA 3FUVA 5E2AA 2OBFA 3RODA 1L1EA 2I6GA 5EPEA 3CKKA 1XVAA 2PBFA 3I5UA 5C1IA 1BC5A 4AX8A 2IGTA 1PRYA 5DSXA 4E31A 4YMGA 1TPYA 4RTLA 5GIPE 2C7QA 3LKZA 5GINE 3E7PA 1VLMA 4BLWA 4O29A 4R8RA 2JHAA 3HEMA 2NNWB 5EC8A 4F84A 1SQFA 3B7PA 4PYQA 5FADA 2C7OA 4PCAA 5EMKA 1D2HA 3PX3A 2JHPA 3C0KA 3UFBA 3B5IA 4FSXA 5ERGB 3R9XB 2QRVA 3NJRA 1N7JA 2AOUB 2QYOA 3G5TA 4RVDA 3P2KA 1KP9A 2AOVA 2YXDA 3H2BA 3CCFA 2AN3A 3SSOA 5LQRA 1RJFA 4P58A 3FPEA 2FHPA 1F38A 2ZWVA 2G8NA 3AXSA 4GEKA 2UYOA 5EIWA 4IV0A 1KYWA 1Q0SA 3HCCA 5DTRA 5F2OA 3SVZA 3KPUA 5BW5A 5E8RA 1YFJA 3G8AA 4QTUB 2ZZKA 3HM2A 2GA9A 1FBNA 3CJTA 3HCDA 3QOXA 5F2KA 3BWYA 4RTRA 5E1BA 4P7JA 4CWAA 1WXWA 3M6VA 2FK8A 4LECA 5DXAA 1RI1A 1G8AA 3PTAA 1JQEA 2YXLA 4M38A 4OA5A 3IEIA 1JG4A 2ONZA 1PJSA 4MIKA 3EVCA 4QQKA 1VP9A 3FTDA 3NVKI 2ZLBA 2NXCA 2IBTA 2YQZA 2AOTA 1JR4A 1NV8A 2R3SA 1WZNA 4HGZA
chains in the Genus database with same CATH superfamily
4QPPA 4OJTA 2WWVD 4LGYA 3WIBA 1ONOA 3C2QA 4WCFB 4UEWA 2NV6A 5DGHA 3UCXA 2JJMA 5KL7A 4DLZA 2WM2A 4MR7B 4GYKA 2OHHA 4H16A 5DHQA 4Z4IA 2DP4E 3P45A 2K7FA 3PNKA 3OTWA 3THOB 1XQYA 1GQRA 2W4MA 3EPRA 2QZ4A 3EYWA 4M8LA 2C9MA 3OC0A 3PC4A 4GS5A 4NOJA 4QPZA 1EE9A 4G0UA 3E05A 3ECAA 3UO8B 4YO7A 4DIDA 3D6NB 1DXHA 1M1XB 1CQWA 2R2GA 4ZRDA 3KVVA 2IH2A 1OVMA 3MT8A 1DAFA 3A9WA 3D64A 1T3HA 3O8QB 4RM3A 4B82A 3F6BX 1SQGA 3E84A 3BGDA 2WWFA 4HZUA 1S89A 4W7HA 4UU7A 4D8VA 2JS7A 3NHLA 2LD4A 2P3LA 4M9UA 5DTIA 4DJ5X 4ZI3A 1N2CB 3RRMA 3KVOA 3V97A 1MH1A 4MS4B 1JDBB 2P5YA 2YKGA 4B5LA 3H19A 3DMHA 4IGAA 1O94D 3B2QA 4DZTA 3IGFA 3M9LA 5DTQA 2BBWA 1CP3A 1M6EX 3AU8A 5KSWB 3NAQA 2C5HA 3TD2A 5F1KA 5T4HA 1M1ZA 1U4OA 3F6CA 4QIHA 3TLJA 4ZYUA 1IULA 4JYPA 4WECA 1PJ8A 3PK0A 2ZUBA 1V5WA 3BCSA 3L8GA 1GV0A 4G6ZA 4AN1A 2FDCA 2IBMA 3KD2A 4FGWA 3PB3A 4YP6A 521PA 4B46A 3C8MA 4EABA 3LX6A 2CT1A 2X5JO 5JXHA 1Z5NA 2V6JA 3WDMA 1MPTA 2RH4A 3S55A 3RT1A 4PC3A 1MT0A 3A28A 2P79A 3F6YA 2VPZA 5I9BA 3VZCA 5KJCA 3R6WA 2ZE5A 2BH9A 3C8HA 3D81A 1WMAA 1YQGA 2X8AA 3H1FA 5EQFA 1DKMA 2RH8A 3N6RA 1PYDA 3K73O 5EHGA 3QLTA 4F1WA 4MB6A 1VSTA 4TQAA 3L8FA 2RG1A 2AH5A 4N0PA 1Z4JA 1NLYA 2X0JA 4I5IA 5A05A 1G0OA 1KBQA 3LS2A 3RRYA 5BUSA 1EINA 3ST7A 4MYHA 3HPZA 5C3MA 2PWZA 5C4IA 1I94E 3C7CB 4Q4LA 1RAGA 4H6XA 2XRFA 3GPCA 2WWGA 3INTA 3HYLA 2EM9A 5AT1A 4HWGA 1X1CA 4C6TA 1KIMA 4HH4A 1PJTA 1L4NA 3GG9A 1LPAB 3LZCA 4HS9A 4YCDA 1BXRB 5DNEA 1W44A 4AO6A 3A1UA 3EF1A 3EIWA 1ODFA 2VWQA 3ET5A 4L75A 2OT3B 3NBXX 4X44A 3FFXA 5K3FA 2D0PB 2QM3A 2FLVA 4LE2A 4UASA 1LEHA 2XGSA 3G2QA 4ZAXA 3ZOQB 1A7UA 1N0UA 3AR5A 1YL5A 1I0LA 3R09A 4HEJA 4YCJA 3P9CA 5JAPA 5LLTA 4G81A 3JZAA 3L8DA 3ANNA 1E2LA 2OSVA 2NTYC 5CXXA 4K1XA 4Z5XA 3N86A 5L95A 3REOA 1GL7A 3NTUA 3SOZA 1ZBTA 4PYMA 4WE3A 3UJBA 2KS6A 2Q7XA 4EVSA 4JLBA 2EORA 1KRWA 4R05A 1WMFA 1UPFA 4EVIA 2OCKA 1BG6A 2F3PA 3TQRA 1YZNA 2UZ1A 4YMWA 4F4CA 5IKEA 1MQ8B 1KU6A 1RQPA 1E0SA 3DFZA 2B5WA 3V8MA 4D2IA 5KTSA 4Y9DA 4C2UA 1UXJA 4MOWA 4MQ4A 2NU8B 4AFNA 4E88A 5L6LB 4PQFA 3PQDA 4YN3A 5HP4A 1UM8A 3PUKA 3QU4A 1GKKA 2D62A 2QWXA 1DTWB 1P91A 2RHMA 3MEQA 3R7SA 3TR6A 4BQIA 4E21A 5H83A 4FS8A 1I5EA 1QWOA 4RKEA 2DUUA 1RLUA 4YRAA 3ELYA 2PKQO 3RGGA 2A30A 5B53A 3QV2A 4CKZA 1YKFA 2QRKA 3GDFA 2CFRA 2HU2A 3DD5A 2G07A 1TYEB 4GI2A 3BDIA 5DVZA 2QGZA 5C4MA 1BKDR 4U2EA 1MA0A 5GONB 2FEOA 2ZVJA 3WWPA 1HLDA 4ZN6A 2Q6LA 2PDAA 1GDTA 1EAMA 3ROQA 1LX7A 4XSGA 2BCGY 4LZZA 1G0NA 1GIAA 3PHGA 5CVJA 1KVSA 1SHUX 1FUYB 1SVUA 1J4AA 2WKRA 3KS9A 4GU5A 4CDGA 4R71A 2BRUC 5T6JA 5HZHA 4LF4E 2QG9A 1XTQA 5JNSA 1XVUA 5DTEA 1BX0A 5J47A 4EG0A 3BZBA 4QULA 4YQEA 3OQIA 4C4AA 4FB4A 2Z56A 1X92A 3R3JA 2EM7A 4PLFA 5AJUA 5KNLA 3I6IA 3KAQA 1IIBA 2WP0A 4K28A 1I7NA 2RHHA 4RVFA 2O8DA 3ZQ4A 1D8TA 3QLVC 5C8DA 1IE3A 3BRWD 2QAJA 4GPIB 3EQ8A 4Q28A 1VHTA 2NUTB 2VTEA 2JIRA 2WT8A 3EOBI 3F71A 3HQ4O 2HPHA 3MRXA 2OHIA 2OQ2A 1QNFA 1P72A 2QTRA 3HWX1 4EQ6A 1XJWA 2XXJA 3MYYA 4ZHQB 5J58A 5LDHA 5MN5A 1P1CA 3DDUA 4TUGA 1PO7A 3G2IA 4EA9A 3CZ5A 4IOMA 2NQTA 1SGWA 3JVUA 4DMIA 4F2DA 1Y37A 2JPDA 4R2KA 1NVAA 2PUEA 2CFSA 2I4IA 3PT9A 5LC1A 3BAZA 2HRDA 2VAMA 3BX1A 3BD8A 4QHTA 1XMQE 1DC7A 1IJEA 2IZOA 2RI6A 4GAEA 4NZZA 4TX1A 3CNHA 4A6EA 5CAEA 1TF6A 2CVZA 1GRRA 5JD6A 2VVTA 4BRSA 3EQ2A 3T9FA 3GUUA 2JGDA 2P5SA 4NZNA 3SC6A 2BFOA 3R7DA 2O7NA 4KNVA 3SDBA 2OTCA 3GJ4A 2J9XB 3H0KA 2JGIA 4NH0A 3ZX4A 2R1FA 4AO7A 1PTJA 3QW2A 1P80A 2PM8A 3HACA 1YR8A 3A6GA 1K5HA 3HSSA 1RZRA 1T9BA 2VT6A 2ZE6A 1CRQA 5JNRA 4J1TC 1KEPA 3OEWA 2Y93A 3C15C 3F2IA 5CFZA 2VF2A 1LLDA 3S5UA 1I10A 1LK7A 2CDNA 2QR3A 3MXOA 4QYIA 3DCNA 4WOBA 5T8KC 3SF0A 2YV4A 4M0PA 3ZKWB 2IIVA 1UXHA 1B0PA 4EY5A 1RC1A 1E6MA 1P73A 3T5TA 2FG5A 1TT5A 1K6EA 3IAFA 1DG9A 4YRFA 5HKBA 1MJHA 2J7PD 4OUDA 3OZEA 4GOKA 5EZYA 1KRHA 4CMJA 5KTNA 1VG0B 4ZYHA 3KXIA 4ZPJA 2X76A 5HFJA 1VPTA 5F73A 2NN3C 1H6DA 2HR1A 5COAA 1XTUA 3GAZA 5HRCA 4QATA 4EYGA 1NZJA 1L0BA 1UJNA 2IY8A 1WF3A 4L8FA 4PHCA 1IAQA 2B3DA 1Y7LA 2X41A 4IRUB 1C3EA 4MI9A 5AMXA 1PS8A 4HGQA 2B8WA 4IH4A 3VSCA 3K9LA 1R8YA 3OX4A 4R0MA 2B7LA 1G4UR 3TCKA 3E3NA 1OZGA 1R0RE 4XCXA 4FZVA 2JFFA 2AMFA 1HDGO 1VG9B 1XD2B 4OBEA 4B6OA 4WI1A 4G0PA 2UXCE 1EIZA 1MDBA 4HNTA 3IE0A 4TZ6A 4BBYA 4KAJA 1U7WA 4H1TA 5EINA 4PG6A 1XMOB 3KSDO 4RK5A 5KREA 2QMHA 2Q46A 2VP5A 3FAKA 2VXOA 2HK6A 4IQFA 1K92A 3TZKA 1X7YB 3RVJA 2FFQA 4L8YA 3JQAB 4X8WA 3MWFA 3U9LA 3EXEA 4JHXA 2Q8UA 4Q9KA 5HTOA 3O21A 3BGWA 3D8SA 2XDQA 1DARA 1ODLA 1YUNA 2Q4BA 3DNPA 1AAYA 1NYLA 3IVXA 4IJUA 5B37A 3IURA 3TD9A 5J2UF 1M2VB 4OXNA 3ZHSA 1M1YA 2RSLA 5J5CA 1UDRA 3G0GA 2H1LA 1CS4C 2HSGA 4I9GA 4MKFA 2FTKE 3ONWA 4XA8A 2FVYA 5NLLA 4X3PA 4AO8A 1LB1B 4NNOA 3A58B 5CT9A 3TZHA 3LO5A 3O4HA 4XARA 4WH0A 3W2IA 5KQSA 3RFFA 4R2DA 3RMPA 2OXEA 3CF2A 3RHZA 2WJHA 3RYCB 3WGTA 3DVSX 2PYZA 3ZV5A 3FF4A 1RAFA 4UUAA 1TE2A 3A05A 4IINA 4N41A 5ILGA 2YRKA 2BBGA 2YU8A 1AKUA 4TKUA 3F49S 3N74A 2X5XA 3N8KA 3PCTA 2QD2A 1VPVA 2M4IA 1WR8A 1BMDA 1YCFA 3T3IA 4YLYA 3U4QA 2CV2A 4LISA 1F7UA 4BP1A 4WX9A 2X7JA 4D8WA 3B1FA 3AWIA 4XQ9A 5IYZA 1WW2A 5FB3A 2P7IA 4LDNA 3R3UA 1IPFA 3VNUA 3MHSC 3AEQA 2IOFA 1V4NA 4PRYA 3W1EA 1XNRB 3KYIB 2HRBA 4RSHA 2FJUA 5JCOA 1OH5A 4HF7A 2JLVA 5KNBA 5HKLA 2RGNA 2FWJA 1O2DA 4PC7A 1FNNA 1C3JA 1G6HA 1XRMA 3JD4A 4H7IA 1CJVC 5JADA 5LM3A 2GCGA 2GSDA 3ICQB 1P3DA 2P9TA 2E4YA 1EUCB 3AVOA 1SG0A 3O47A 4HQNA 1OIVA 4NCIA 5CVCA 2AR7A 2OUIA 2GAAA 3IUNA 3ADIA 2BMAA 1Q2XA 3DA8A 1JU9A 2AUNA 2V54A 5DT9A 5GZ3A 4LC9A 3GRRA 3OCXA 2C82A 4OGWA 4DMMA 1DLJA 1X2EA 2ILVA 5FEMA 3KWFA 2A0XA 2B94A 4J3FA 4YRSA 1GSIA 1T5BA 4Y2GA 5F1PA 4RZIA 3V6MA 4E1VA 2J3DA 3T7AA 2QIPA 1IMOA 2CXPA 1NE7A 2F3QA 4HZIA 2RIPA 3DDNA 4P4LA 3RE1A 4WLEA 4B2PA 4E2FA 4B3SB 4MUHA 4EJSC 1ORHA 4ISBA 1H2FA 1KPHA 1RI2A 4M88A 4Q1AA 4X61A 4CW7A 4DV6E 2ZB2A 3R5SA 4AS1A 2WU1A 4LZNA 5IAKA 1ARZA 3GUCA 2CZCA 1FY2A 4OGGA 1BRTA 5H3CA 4DBZA 1MD9A 4JKYA 4KE8A 5CLIA 4FR2A 4YYEA 2DQKA 1H2HA 2OV2A 1WHQA 2J41A 2R79A 1L5GB 2ZYSA 4GR5A 2NWQA 3QY0A 2Q2QA 2Q1TA 3SYKA 3WGVA 1U9ZA 4BO6A 3CVYA 3FPBA 3U7HB 2ZI7A 1XU9A 4U2GA 4NYJQ 3TZCA 4OYLA 1BCSB 2AQHA 4E1BA 1L7EA 1C5KA 2KW5A 2B9EA 1BDJA 2EJTA 3JWEA 3W6PA 1A88A 1GFSA 4MUNA 5AKJA 1QOPB 1AMNA 3RRBA 1OV4A 4X7MA 1HRDA 4DBLC 4DIOA 2CCKA 3Q1LA 1KQFA 3OLYA 5AI4A 1KYZA 3AFMA 3MC1A 3F8TA 1WXGA 5K45A 3RG8A 1JPVA 2B37A 3F9CA 1Y6JA 2RBGA 2R6JA 3BMXA 3DMFA 3BJEA 4HWKA 3CSSA 1VJDA 4YCBA 4ZIRB 2W90A 3LHFA 3URMA 5LYJA 4XIIA 2WUVA 3QXCA 2DX7A 2LTAA 2WM9B 2Y68A 2AG1A 3M49A 3NBKA 1OXKB 1KNXA 4RYDA 3PQ5A 2BGRA 4Q05A 5C8ZA 1PFYA 4DV1E 1YQEA 3L7BA 3UWSA 3U09A 1A4XA 2ZSAA 3KQMA 2C2GA 4HLNA 2VTKA 1IMJA 2YX1A 4XVHA 1JFLA 2PY6A 5K99A 1F06A 4KRXA 4MPTA 1DFIA 3HNRA 3OZTA 4NKRA 1M8JA 2YHUA 4KO3S 3GLTA 3SBXA 1E0AA 3ENVA 6ABPA 2ZI5A 2LZ0A 1EDOA 1XZ8A 3G2PA 4S1PA 4ZDWA 3SSAA 4ECAA 2BEWB 5JRDS 3WYFA 1Y7HA 1WKBA 4X6LA 1OBOA 3G68A 1PFUA 4QJIA 3OFJA 3IVMA 1AY0A 2RAFA 2PCJA 3Q9UA 4U2KA 4AF6A 5JXGA 1PX0A 3LYLA 2Q6IA 1W85A 1XD2A 2B9VA 1D07A 1XVAA 4MQ5A 5CK4A 4CN9A 1H6AA 1TPYA 1ZHOA 2JZCA 3HYNA 2IVFA 1F5SA 3LDHA 4UMFA 4YP9A 2GHQA 3MIZA 2PQ2A 5HMMA 4M9ZA 5EXTA 3UYKA 3K94A 4C4TA 3F96A 4FI3F 2XZLA 1AS0A 5FADA 5EMKA 5FO0A 1BVRA 4IGEA 3C0KA 2R2AA 4MB2A 4CDRA 5TRTA 1H94A 4PZZA 3CV3A 4OCZA 3H2KA 4QODA 5EIEA 4AKSA 4OX9E 3G5TA 5JTTA 1EGHA 1K3TA 3TKLA 2CCJA 4W5WA 2PL3A 3T7CA 1H5QA 1M0TA 5LWQA 5H02A 1EESA 4QVIA 1L4EA 3QE2A 2AN3A 4BX9A 4BO2A 1Q0QA 1UOEA 3BG5A 3RVDA 5JG7A 3FPEA 4RJ2A 3ZVKA 1Q0RA 1VPLA 3RAEC 3N59A 1T4MA 2E21A 4MGEA 5FBZA 3QWBA 4A9AA 4ZYYA 3N6VA 2CL7X 3CLUD 3EXFB 3L0BA 3DOOA 3LQFA 3QKIA 4HWSA 4Q19A 3RC9A 1YS1X 5I4BA 4LF8E 5CH3A 3KKOA 3OPVA 4DCVA 2GA9A 2H5LA 1SZJG 2HBYA 4TQGA 1GEEA 1NI5A 4BMJA 3ILYA 3HUTA 3TLKA 1KVUA 1WV0A 1L4YA 1RRKA 2Q0QA 3IQWA 3QNWA 3QLJA 3LWBA 3L1HA 4L4XA 4RJJA 3DMPA 5IT5A 5EP1A 4QXRA 2JJ2A 4IQ4A 3TF5A 3B2EA 3ROEA 4OMDA 3OM1A 4JB8A 2HJHA 4CI9A 1X1TA 1JEQA 3E58A 1OZAA 4MZXA 4PLTA 5AVRA 1QF7A 3SZMA 3W2GA 2PE5A 2GD0A 2ZWOA 2JIMA 3DOIA 4DIEA 4M8KA 1KZ7B 1HT0A 2L33A 2QN9A 1GAQA 4G0VA 1QK5A 3LF1A 4JT2A 4E4TA 3DSRA 5BW8A 2HT6A 3I6BA 4Q1DA 2UUAE 1PEYA 1FNSA 2NO9A 3KQVA 3KKLA 4HX5A 2ZSUA 4OXQA 2YFKA 3AEUB 4Z0TA 2CSUA 5IVDA 3AW9A 5A1TA 1L5ZA 2PWYA 4ICIA 1Q7RA 3TVYA 3QXXA 3H11B 1ZK3A 3OE7D 3AKZA 3QELB 3IOCA 4DUZB 3Q8MA 5EE1A 1E9RA 2J59A 4JITA 5FPPA 3X1XA 5AUPB 2BFFA 3SDZA 3T5MA 4DDVA 1PNOA 3F5FA 2CXNA 1Z4MA 4A0GA 3BRQA 5GJBA 3AVYA 1G9TA 2H4YA 2O5VA 3GJSA 1UINA 2WJYA 2X2OA 2Z2YA 4DCTA 2PX8A 1SB8A 4U6NA 3AGQA 4P78A 3K6RA 4MR8A 3A7DA 4YACA 2O20A 5CDFA 4N7BA 1RJGA 2EPOA 3L7LA 5FYQA 5E3IA 1NGSA 1AQIA 3ER6A 1FDIA 4X90A 3TPFA 4E2XA 1T34A 1AGRA 2GYUA 1AK9A 2GYVA 2PX3A 2LCQA 2O07A 2YJ4A 4NZPA 2P4UA 3BWXA 4YP0A 1H93A 3Q3CA 2BUCA 4JBXA 3LPMA 4P2GA 2I8LA 3CLSD 1XKQA 5KVCA 4G56A 3P96A 1O1YA 2UVQA 2BTEA 1SVWA 4KO4S 5GP1A 3H3FA 2Q5FA 3OQ6A 1SUBA 1YS9A 3SHWA 3UUGA 4NE9A 1JJ7A 1U6IA 4L6CA 4ALLA 4M2ZA 3J7AC 3M5WA 4K6FA 4CI0B 3M0EA 3OEHD 4QWWA 3MPOA 4J2TA 3DJYA 2R96A 5L3ZA 2J3HA 3ASUA 3MXTA 4PBRA 2AMYA 4RD1A 1XD9A 1EFRD 3OIFA 5HJEA 2ES4A 3W78A 1GM5A 2B1QA 1XZQA 5IP5A 1XVLA 3EDRA 2GZ1A 1G8MA 4Q4AB 4Z4QA 1YULA 3T7IA 3TX2A 4IRXA 1KAOA 1UJBA 5IBPA 1ZESA 1QH9A 2Z08A 3PC8A 4Y9UA 1XMXA 5KQPA 1T0HB 1UWLA 3E3AA 3H04A 2C94A 3M33A 3PGVA 2AFHB 4U9IS 3PGLA 3GX1A 1T4DA 1U28A 3H1BA 1Z33A 2LBPA 3DPIA 3KJFA 2EDCA 4ZOLA 2JK1A 6PFKA 2G0NA 3SC4A 5JMWA 4C3UA 2OCAA 1FF9A 1VP3A 2G9UA 2R5NA 4H9KA 4RY8A 2YZKA 2OORA 4WZAE 1Q15A 1J0DA 5EY5B 2EP7A 3L18A 3RVQA 1EXVA 1RLOA 1N2CE 4DLVA 3L8CA 4DANA 4RDHA 4MVCA 4M1TA 5DX0A 4EO7A 1OH6A 4E15A 1U9IA 1PDVA 2DQZA 1QGUB 1GPLA 4MEBA 3AIKA 4PTZA 2EKZA 4IIEA 5FPYA 5AW9A 1LDGA 3I04M 4UU8A 4C4YA 4F9BB 3FTPA 3N0RA 4YRKA 1MMFB 4QDTA 3WL8A 4HV4A 1VMAA 1YTLA 4YUZA 1X38A 1G63A 4EG8A 1YT5A 4D8TA 1ISHA 1RBQA 5EZSA 3TN7A 3GZTB 2JLWA 4G1MB 3LKBA 5KVAA 4ND6A 3THYA 2X23A 3KL2A 4RIGA 1WRJA 4JAVC 4KP7A 4X6UA 3F1LA 3AEZA 5K4AA 3KHKA 4C1NA 4MRPA 4LF4B 3HK2A 2Y27A 1HR0E 2RIRA 1Y33E 4MJXA 1GNPA 1KOJA 4RFSA 2Y8EA 4ASUD 1S3GA 1TQ4A 1IBCA 1NVVR 4H08A 2O19A 1SU6A 1CUXA 5L3QB 1EX6A 1ACLA 1CQPA 3HB0A 3VC1A 1EFAA 2FMTA 1F2UA 2NU6B 4WNAB 5IZCA 5C53B 4ZQGA 2JAWA 3EGXB 1UXKA 2C58A 3EXIA 3W3AA 5AHWA 2Y0EA 3DYVA 4CVNA 2X9QA 3QPWA 3RRZA 4INZA 4UKDA 3RUPA 1NN0A 4AWBA 1U3VA 4XWGA 3OWOA 4C3VA 1R2QA 2ORVA 4D5EA 2A0WA 2BTQB 2HW8A 3WLHA 3BSYA 3AR8A 3M1LA 1X3SA 2ZTMA 3NH9A 1P5JA 1XL0A 5KL3A 2IEIA 2NVBA 2PBLA 2ZSEA 3G9TA 5E4FA 2XYHA 3WP1B 4C03A 1KJYA 4L6IA 2EHDA 3UG6A 5JC8A 5HUQA 5KHLB 2WIAA 1QM5A 2PVCA 4R40A 1X13A 3K16A 1P9WA 2RBEA 5DKFA 1C50A 1E3DA 2CD9A 2GBFA 3WGJA 1Y4ZA 3B51X 4AP5A 1G1MA 1C4OA 3GT7A 4JA0A 1OLXB 5SYAA 4F92B 1N2ZA 2HAEA 2BM8A 1YUBA 3DJFA 1I2AA 4HHEA 4IUDS 2PL5A 3C98A 4J0FA 3VU9B 4EKNB 4Z7JA 3PFFA 1QZ3A 2YXBA 1H8HA 1OXTA 3LAWA 1W36B 1J5XA 3KE8A 1WP9A 4BX0A 5BR1A 3OCZA 4WWHA 5E1MA 5JVDA 1J90A 3GMSA 4XH9B 3S2UA 2HHCA 3SJCA 3EAFA 3JQFA 4DCMA 1HL3A 2D2EA 4KQWA 1ZH0A 4F21A 3QU7A 3AUZA 5CFLA 1NRWA 4CFSA 4TS1A 1X19A 1NUPA 3DS8A 2I34A 1GHTA 3DZCA 3KEGA 3THOA 3NC4A 1DAMA 3L02A 2W2KB 1VIMA 2OV3A 2R87A 4MR7A 4DARA 4DV7B 1P7PA 3EGDB 2ZBRA 2JLXA 3G2LA 3PVZA 1C8LA 3DWFA 3P1JA 3DV2A 2HNAA 3PRJA 5A3JA 4D92A 2QJTA 3P5SA 2EP8A 2QIOA 1XZGA 2VH5R 3OEHA 3PUWA 3ZBTA 1B0AA 4Q35B 3TNDA 4CR6A 2H2IA 2AYYA 2F43A 5AVVA 1HZZC 4QECA 1MJFA 2BMFA 4QBFA 1DC6A 3NANA 5KNDA 3F9RA 4CLOA 1X49A 1IZZA 1RR6A 2RGGA 4GVXA 2A84A 1XEXB 3RR2A 1E2JA 1F2TB 1KEZA 1C9KA 1Z0FA 2UKDA 3MERA 3N6XA 5P8WA 3KQOA 5C5DA 2N42A 4EY6A 3BCUA 3QEAZ 2WF7A 2FV4B 1N9GB 4D9JA 1NONA 4J7CA 2A5LA 2PMCA 4WL0A 4MKXA 5FUMA 1FTSA 2HF9A 2VQDA 4OM7A 4WFKA 5KC8A 5BN4A 4BMDA 1LBHA 1JDBC 1ATZA 1ST3A 1DX4A 3ZDZB 3IPRA 2OG2A 1H1TA 4OX9Y 2YJZA 4ZGGA 4I36A 1K0UA 1YBFA 2C2HA 2GJ9A 1YZYA 3FTQA 2WTNA 1J7KA 2OD7A 2WD7B 4FZJA 1YONA 3C3WA 4KN8A 4DNOA 5KCZA 3M8KA 3DBRA 4FR0A 2D9HA 4NPAA 2J9GA 4GNRA 1H1LB 3JQGA 2WQ6A 1UIMA 3B89A 5FTWA 1AHHA 2IKQA 2QTVA 1WJPA 1NW4A 4NY1A 3NRCA 5T3UA 4E09A 4QLOA 1VC2A 5KX5F 1THZA 4HRXA 3F6EX 3QF4B 3K9NA 4JVMA 2R00A 1HDYA 4EW3A 5AW3A 3BRWA 4DR6E 1OI7A 1CLUA 2LBSB 2PT6A 2JAQA 5JEEA 2EMAA 4FBMA 2JLSA 2JVAA 1Z8HA 1G2QA 1Y9ZA 1KETA 4DY6A 1BW9B 2D2VA 5FLXA 1LVHA 2Q0SA 1B8NA 4W7IA 3DAPA 3GN2A 4F04A 3GLIE 4D4IA 1IATA 2NG1A 2PJDA 3HR4A 2W2PA 4C06A 2PKYX 1A0OA 1CULC 3EQ1A 1QG6A 5KDLA 4BZXA 1BE8A 2FCAA 2R6R1 4BWGA 1T8SA 1UK9A 4CPDA 3V4ZA 2O0KA 2M32A 3Q8XB 1SU7A 3CZQA 4MYTA 4OYHA 5TEVA 4NICA 3ZS8A 2BVNA 4DCUA 2BI8A 4QXOA 3WTCA 1YFHA 1M6VB 2RJOA 1L4GA 4JVSB 5FULA 1G6KA 4AJIA 1P2BA 4RLFA 3DEKA 2JFVA 4ND3A 4IIBA 1L4KA 4QHSA 3B9PA 1I0ZA 1JU3A 3PKIA 3BWVA 3R3ZA 1E8MA 3IMKA 5AW6A 4LG1A 3RJ9A 1U2GA 4YJDA 4A1OA 3OSUA 2GBLA 2B1GA 2XWSA 3EZ9A 3L6OO 2EC5A 1L4SA 3PFGA 1YRQA 4L6AA 2YMLA 1P29A 3GP5A 5IT4A 1Y8ZA 1JILA 4BNTA 2VNAA 3OEED 2ZUFA 2CNWA 5KL5A 2FX3A 2FZKA 3IRUA 3OF2A 1ILWA 1A95A 4MKRA 3IPXA 4NCXA 5EHXA 5ICEA 1QU2A 2Z6AA 2X13A 3KSMA 5DSTA 3O8LA 1BWQA 1UEIA 2H8KA 4WKPA 4WK6A 4RKFA 2BP7A 5CIQA 5C81A 4H4DA 3ZJ5A 4HDRA 3TIGA 2YZGA 4BEVA 4ZVVA 1N8SA 1Z7GA 4INJA 1C2TA 3ZU6A 4L4RA 1KDZA 3SFVA 1WZCA 2Y9MB 3MGGA 4ZTUB 1Y63A 2R60A 2VYQA 1FVOA 2XB8A 3PQ6A 4P4SA 3W06A 4X54A 3AEKA 3EASA 5ESDA 1XRLA 5KYUB 3LZ6A 1U8UA 3K0FA 3VH3A 1BXZA 1NXQA 4GKVA 2FSGA 2V4MA 4KQKA 3T6KA 3ZNQA 4HVTA 4IICA 4M9RA 3RK4A 4BRWA 3IDAA 2OZVA 4YLGA 5IWCA 3COWA 3EXG1 1XU4A 2OA0A 3L7OA 3M5DA 1QTNA 1QO9A 4X20B 2I4LA 2FOLA 4YA6A 2C4WA 3HBLA 3NAMA 5HF8A 1IQSA 5BOVA 3J81A 3RADC 1GU1A 1RQNA 2IUSA 3I4CA 2W2XA 3L3BA 4NYIR 2A3NA 2IELA 2O1EA 4TLAA 1QWSA 4RD2A 2ZUTA 4G1BA 3SM9A 4ZDIA 3RIMA 5FBHA 4A92A 4FGUA 5HIAA 1R18A 5DNUA 2BF4A 1R12A 1X7XB 5A06A 3U49A 3LT1A 5AOVA 2H54A 4MJ7A 1LJLA 1A8QA 4MV0A 1VE6A 1PK9A 2GEVA 4DV1B 4W1SA 1AXEA 4BX2A 4WT7A 3W8RA 1HT2E 4Y3UA 4DAEA 2NADA 5A6KA 2V7GA 1JH8A 1TAQA 2FYTA 1G5QA 2X6RA 3U3JA 4DZRA 1TQ6A 4S04A 2YWQA 2XRMA 4DF3A 2BONA 1QHXA 5BYJA 4N9QA 3O4RA 4IEIA 5FR1A 4ETNA 3AQ4A 2XTAA 2ODEA 1PJ2A 2DWUA 4CJXA 3C48A 3W5IA 3PA6A 3K0CC 2QTMA 1MTZA 2O7QA 4KCGA 1ZGHA 2VUIB 4G2TA 1U7DA 2R68A 1XZEA 2WLTA 3HB1A 1KYIA 2V7PA 4B1FA 5JAMA 4QQRA 1AQJA 5HKKD 1Y7TA 3AB7A 3L8HA 3T1VA 1P45A 4RVHA 2IUTA 5HZMA 2GXAA 3PU6A 3IAXA 3C5EA 1JHYA 3AP2A 5I51A 1I4EB 2JPAA 1EK0A 4N4AA 2Y4OA 1QZUA 2ZU6A 4YJ3B 2RGCA 3DZHA 2OZEA 1ADCA 4LZAA 2O2ZA 3NIBA 2EKDA 1CUAA 2CLKB 1ISSA 4RIIA 3TL6A 1O95C 1YCDA 1DADA 1SUPA 4YV0A 1XCMA 2XF8A 1KFJB 5I9IA 3WA6A 2HY7A 2WTBA 2QMOA 4CQMD 3DNFA 5LKAA 3EFOA 2XCOA 5CCDA 4XRGA 4KPGA 3Q3JB 1J0CA 1YIAA 3DVAA 4WXYB 1IBSA 3QFFA 2PH1A 1NSFA 1WU8A 1JK1A 3AI3A 4EPWA 2A6PA 4F5YA 1ZAAC 1LRLA 3N0VA 4R81A 4BFUA 4N48A 3H3JA 4DTCA 3V4RA 4HSEA 1JN0A 4Y0NA 3D54D 1CZRA 4M1KA 3L6RA 1V39A 4II7A 1GXSA 4OB6A 3ZUPA 1L5SA 3SHVA 5LMNB 2J9FB 4KB5A 3VDNB 3CX3A 2BM1A 3F3SA 3ZXSA 1PKEA 1AC5A 4Q9HA 1UKEA 1HXHA 1NFQA 3WGHA 3WV4A 1ZJJA 4NQZA 1V3TA 3G5MA 2AFIE 4RZSA 3TFWA 1L2TA 1JSCA 3CKLA 3MK31 4MAFA 2AL7A 3RODA 3MS4A 4IEEA 1GSOA 2I6GA 1S4MA 3LW8A 4OSEA 2Q29A 3K72B 4JBWA 3HKCA 1KI4A 5AM4A 4DC0A 3HABA 1SCBA 3DBIA 3OHPA 2OGSA 4U00A 2VQFB 1BU8A 2JIPA 3HHPA 5ECYA 1GAJA 2QX6A 2PL1A 3E53A 2YJ6A 2ZYRA 4RA6A 3PQ7A 1LZKA 4IOJA 2VAVA 2DR0A 3EWAA 3OZIA 4HADA 1AGPA 4IVPA 4GZNC 1LKZA 2YSPA 1VL0A 1TU4A 2QRNA 4PPGA 3EH1A 5D6OA 2AOUB 1A50B 1E9AA 2FUCA 2OKGA 2R7MA 3PTZA 4P34A 5EUCA 3R74A 3BMCA 2C9OA 1BGWA 2WDZA 3GYGA 3O9ZA 1RWOA 4TL9A 1G2FC 3CCCA 2R47A 4LYGA 5LLSA 5BYAA 4DSAA 2BV3A 2A0KA 1QFMA 1AS2A 3Q7QA 3NNNA 1NPTO 3GLIB 4BBPA 2B7VA 3EVTA 1I4LD 4HATA 4O4LB 3WMEA 1PFQA 1Z56C 5F33A 2O6LA 4H6VA 4NG4A 3U60B 4ND5A 3VKFA 1OYYA 2YJNA 3ANYB 2GM4A 2OLEA 4Y1GA 3V1NA 3UMBA 4PAMA 4M0CA 1GU7A 4FMDB 3UQZA 2WBUA 3VR3A 2IYEA 4IWXA 2COKA 3RAPR 4RTRA 5E1BA 2FZWA 4XYGA 3PEEA 2WSBA 5DXAA 3A4VA 1E9DA 2X4LA 5BQOA 4BQFA 1EGVB 1PR5A 2AWOA 2ONKA 3FWPA 3ZY6A 4MUKA 1TFUA 3BIOA 1XMIA 1OC2A 4WK0B 4EB8A 3MWYW 4TWBA 3LQ4A 3UXYA 4QNRA 2CWDA 2QZPA 2J6BA 1LH0A 3T3HA 1P2VA 2I0FA 4FEYA 2HXYA 1RTTA 3H6HA 4P0TA 4QNMA 3L8ZA 1N0IA 4MGYR 4C0KA 3SSMA 4GYYA 4OQPA 3L6BA 4Q7LA 1KDVA 3UN1A 3HCOA 1JEOA 1CFZA 2DKNA 3AJRA 3FIUA 3AZPA 4L28A 2IDZA 4X1IB 3WOVA 4C6SA 5LQNA 3A9CA 2AFIA 1YFLA 2EN7A 1CD5A 1LXCA 3C3EA 4PC6A 2XNKA 2XYRA 1Y7IA 4J0JA 3A06A 1EVLA 2CHFA 1V9LA 2R8ZA 3ETCA 1WNTA 3MJCA 3KU1A 4IIYA 3TJMA 4F97A 3AM1A 5A6VA 3ZXUB 3LL7A 1E3QA 1EDZA 1ZM2A 4XZ3A 4LQCA 2J48A 1TQHA 2WHYA 3NG1A 4C88A 3WX0A 2AQIA 1GZ5A 2GHTA 5L53A 3UA4A 3LLCA 3T7SA 1X1RA 4Q7EA 3BFVA 2IXBA 4H1UA 4CQMB 1JK2A 2FG6C 1NMZA 4U0KA 4F4HA 2ZBUA 5DE3A 3IE2A 5DW3A 1LSOA 3H4MA 4KAAA 2OBNA 1QDUA 2WUDA 1BJRE 2VWPA 3ZE1B 3FGOA 1OILA 4BO0A 3PBKA 3N28A 2YY6A 3BILA 3H7IA 2P69A 1L3IA 3CO0S 2ZRDA 4M87A 2P6MA 1V4BA 3H2JA 3AF0A 3AVVA 1U3DA 3JQ9C 4RHEA 1ZG3A 2FU5C 3DYBA 4UD2A 4PYNA 1YVEI 4IR7A 1FB5A 1B00A 2WVJA 4RJLA 3GD7A 4IUCS 5F7OA 1KYQA 2P9CA 1X6FA 5K7SA 1IY1A 2YUIA 5DNYB 2O48X 4F9GA 3BXXA 2LCIA 3WJ7A 4XVUA 2BEJA 3IAUA 3C4VA 4N3AA 3TCXB 2ZR0A 4YMLA 1UODA 1MRNA 3RI3A 1C3VA 2XVYA 4RSGA 2C04A 1BJTA 5G0UA 2PNJA 4Z9FA 4D9BA 6LDHA 1IEWA 3I64A 2CTDA 5EMJA 1OXUA 3DYIA 1L5MA 3ECSA 4ECEA 1T6YA 4FJ1A 2UUAB 5WRFA 1ZJZA 4W4TA 1RLMA 5E7QA 1XNQE 1N7IA 2XUJA 1D6SA 2J6IA 4PPQA 1Z2PX 3E9ZA 3GVIA 3E18A 1U8YA 2CVQA 4KJZA 2QD3A 3TLMA 8MHTA 1GG8A 1XLVA 2B7TA 4MS3A 4DWVA 2HHHE 4DLWA 4OHMA 3BCHA 1YA8A 3OLXA 2PZGA 2Y05A 4WBSA 3ZD9A 1JLLB 4C4RA 2YZMA 3M9XA 1TX4B 1JHMA 2VDQB 2YWRA 1FBTA 1N6OA 2JIQA 3EMDA 3E3LA 3G1UA 4LJYA 4RK0A 4ERXA 3N2YA 3HBNA 2YTZA 3ZDEA 2OOKA 1PR0A 3ZE0B 4D6PA 1QQ6A 1SHZA 2VFAA 4QOIA 3AL3A 5GZ1A 1W4LA 4I50F 3ZBPA 2A2ZA 2D13A 4HYEA 3K1AB 1U5BA 4PGMA 5FA5A 3HUFA 4WZBA 1QS0A 4QA9A 1N5JA 4HWPA 4JJKA 1NBOA 4M36A 4LNUB 2FFRA 3HKEA 1L5YA 1I6KA 1VZ2A 2YIDA 2HD4A 3QEMA 2H85A 3KQYA 2XA1A 3DTVA 3O1JC 1CDDA 2W00A 4JU9A 5GV7A 4WXDA 4D44A 4F72A 1DRKA 3CJQA 1RDFA 4C0AC 4HNVA 1MO4A 3MTQA 1PLJA 4IO0A 1XPUA 3ZD6A 2A0YA 4LBVA 1DC5A 4BCCA 3F3YA 3H9UA 3W5SA 1DQNA 2HEIA 3GNTA 5J5AA 4HPXB 5AUQA 4DR7B 2QB5A 3E5HA 2QBYB 2EM2A 3CNNA 1IK6A 2PS1A 3QYPA 5KL6A 5CA0F 2JY9A 1YR9A 5F4ZA 2GCIA 1WSWA 2R7AA 2D2FA 1MO2A 2Y0DA 3FZYA 1PWYE 3N2LA 4NAHA 4XQCA 3U4GA 4B47A 3VNSA 3GOQA 2NAFA 1FYXA 3P19A 2CJWA 3WAGA 4KWYA 3DB2A 1L1RA 1M0SA 2XMGA 2FWPA 3EUFA 4RMGA 4U4AA 2C1EA 3I2KA 2C2OA 2VDUE 4JFRA 5CLGA 2FPWA 5EGSA 2VQFE 1PZFA 3SX0A 2I62A 1HY3A 3DT8A 3E3OA 3K15A 1CLEA 5JY1A 3KR1A 2ZJBA 3TXXA 4EG3A 4U3JB 5EEGA 2RGBA 2JIOA 4YP1A 4V1CI 1OCEA 1I4DD 4WK2B 2JD2A 3VR4D 5HSGA 4RS4A 4XR9A 5CXSA 3CEAA 2V03A 3SR0A 3ADKA 3VR6D 3OF3A 1F6WA 1FFWA 1F8FA 3IBSA 1PJ3A 1BQ3A 1UAAA 4PO8A 3UMSA 1NMYA 4OIFA 1XEFA 3AHIA 1CBUA 4TM8A 4Z9AA 1I36A 3EF3A 1YUIA 4BNDB 1TAUA 3MBKA 2QV0A 2JBWA 3WQHA 1M72A 1KSJA 1DIRA 2OXIA 1KY5A 4X64E 2DHQA 2FN7A 3HKBB 1QK3A 3KB2A 1YC2A 2DU8A 5IS2A 1BO6A 2VSQA 3OTIA 1VJGA 1GTZA 1WCXA 4DR5E 4O4KA 1HYGA 3ABSB 3BE5A 2ZB3A 1FJHA 3C7AA 3H75A 3KR9A 3ABOB 4JLJA 3C6KA 2VJCA 1G21B 5HILA 5HIKA 4N3BA 4B6QA 3HUNA 3ZJVA 2BR3A 2H1HA 1FW8A 5A0TA 1TGVA 3A9SA 2NSYA 4LYJA 3GFTA 2QRHA 4HVAA 1LPBB 3BL5A 2QT1A 4YRBA 5FTLA 2VHUA 2WY2D 5EJEA 4MA4A 3DGEC 4BTVA 4EZIA 1T36A 1ECCA 1BZYA 1TYZA 1U04A 2J45A 4LPSA 3G5LA 3D4LA 4I55A 5EJ6A 3DL2A 3WRVA 4AB1A 2ZSIA 3CWZA 5C8XA 2RHCA 4IQ8A 5HWSA 4KNYA 1KIAA 4WLOA 4CKEB 2C9YA 4RFSB 1JLRA 3SQLA 2R6AA 5G0TA 1YK1A 4YP5A 1RHJA 2P1RA 4HYYA 2G5CA 3H9BA 5SZIA 3WFJA 3ZJYA 2X22A 4BWYA 1V3UA 1D1QA 3EEFA 4QJ5A 1DG1G 3S29A 3ASZA 1AK2A 5FLXC 1VG1A 1YV9A 1WPRA 2LDBA 2NT4A 3GAMA 5KMGB 4DMGA 2O8BA 3C3YA 4WLUA 3RSGA 5JQGF 2EWWA 4BVGA 4KR7A 3OU2A 3I42A 1OB5A 4BC9A 5IDVA 3OJFA 4S1VA 3IQGX 5H1YA 4URWR 3ROTA 2V86A 3KU4A 4DKJA 1TMGE 1K8QA 4LTYA 3PKZA 3TW8A 2WFAA 4I99A 4CR8A 2X6QA 1XWFA 3AI7A 4C14A 2HQRA 4S1TA 2F8SA 1TRHA 3KPYA 4EP1A 4UD6A 4BQOA 5IKPA 1P60A 5BWLA 2VYCA 3OU6A 1CUBA 4W1RA 3IA2A 1SKQA 421PA 4JL5A 3UC9A 4FM9A 4MLQA 1PZEA 3PXUA 4XJXA 4B4OA 4BNXA 4FE7A 4F1JA 2YIVX 2NVOA 4D4JA 3PNQA 3QUBA 4DR4E 3RRXA 4B34A 1MLDA 2D2XA 2QPTA 4R5MA 2I67A 3LHIA 4OAOA 5H4HA 4J8PA 3WL3A 1K4KA 2EX1A 1I4TD 1B2LA 1MB4A 1CK4A 2ZE7A 1LQTA 4ZV9A 1QPBA 3VYRB 5ALPA 2FRDC 3EIFA 3FPCA 1MHTA 3MQ2A 4ZOQI 1FFHA 3AOEA 3THNA 3PFWO 3TIIA 4NFYA 2GNPA 1DBPA 1OIWA 1PDOA 5AI9A 5E2BA 1KEKA 1LJ8A 1M2JA 1DQSA 1GKLA 1A9YA 4EHKA 1D0SA 2YASA 4HRAA 3IPAA 2WWHA 4S0ZA 1GA4A 4PS0A 2C1ZA 3SBDA 4BFXA 2CLIB 3LTEA 4OI0A 1W0CA 5DOVA 3HDYA 4BO4A 2NP6A 721PA 2A94A 1SUIA 1DTEA 2WTMA 4F60A 1D9XA 1QP0A 2O8BB 3ZWMA 3JVVA 4FFPA 4B6SA 1RLIA 2OR3A 1DBWA 2ZRIA 3FMIA 3VFDA 5GOZA 5KOHB 3FCAA 3KSZO 4X92A 2IXTA 4R2IA 3KHTA 1R0CA 3ZWXA 1P6XA 3AM5A 3TH5A 5KDDA 5DN6A 3USCS 4ARCA 2FGJA 2G70A 2QG4A 3EFHA 5B58T 3C6QA 5ALGA 3TD6A 5FAKA 1FP6A 1Z37A 2P2LA 1E98A 3MG9A 2IPMA 1KJIA 2PIAA 3A1SA 1E0KA 3DFKA 4R9NA 4E2YA 2Q9AA 4A73A 3FROA 2ENUA 3KX2A 1Z4LA 4PLHA 1M6WA 3HPSA 1N5RA 3D8HA 1UFKA 4F98A 3T0IA 1DKOA 1Z2CA 3QYAA 1FUEA 4XAQA 1Z2AA 1Z12A 2VAXA 3ZU3A 4F2HA 3ISJA 1RRPA 3FMGA 4X66E 4HC4A 4WLFA 4ER3A 5LJLA 4NULA 4KN9S 3CYFA 3GJ3A 1YRYE 3ZTYA 3ZNNA 3GCZA 3DONA 1SIUA 1FFXA 3G17A 4OVKA 1ZH4A 1VKJA 1Y0BA 3R3VA 1C3XA 1CR2A 4MP6A 4DDTA 1JHXA 2VPXA 4M37A 3LA6A 4N47A 2YJTD 4ETIA 4RPCA 1YDHA 5F76A 3U6KA 1MOZA 3A1FA 3L77A 3ISVA 4BXOB 2J4DA 1QE5A 3QKRA 3FUXA 1D1PA 1MX5A 5JJLA 1KEUA 1QYXA 3DUFA 1Z2OX 4BNNA 1JQ3A 1E2UA 4MVJF 4B4WA 1X2BA 1M2NA 1THGA 1V48A 2QT0A 1WLSA 3I3OA 5F98A 3N2IA 4XIYA 1M5RA 4FPXA 1NOKA 2YOFA 2HA6A 3G1WA 4FE3A 3E82A 4S0XA 1E3WA 4REQB 1QV7A 4OHXA 2VNKA 1A1HA 1NRXA 3CM0A 4ISCA 1YBMA 3UUWA 2LRHA 1N1MA 1I30A 4AZSA 1I2BA 2OFFA 1SJ9A 5IDWA 1Y9JA 5JUWA 3QELA 4KTTE 2D3WA 2O9JA 5CD1A 1ZHFA 4X62E 5CURA 2EERA 2WJZB 2XCSB 2WNIA 5ALOA 3O8NA 2OXTA 3AEUA 4JJZA 3A4LA 3UOGA 3LQKA 2DQ4A 3ZIAD 3ZCQA 3M1IA 4BBJA 4EX6A 2B25A 3DXXA 1J49A 5A5DA 2B4AA 1S2MA 2YV5A 3L0ZA 4QFDA 1T2FA 3UIEA 4D57A 4X5OA 3AEYA 4NPHA 4Y1EA 4RQBA 4DMHA 2BE7A 2OECA 2WIKA 1W4ZA 2R86A 2OAP1 4GM1A 3QM1A 2H4ZA 4JI7B 4RZ3A 1JDVA 2QMUA 3LDAA 1VKRA 4H7DA 5AQEA 1HI9A 1RC8A 4XASA 3VYUB 4WESA 3OG9A 1EH5A 3AY7A 4AP6A 1KO1A 1M8GA 1ZISA 3ZFUA 5HTKA 4Z9YA 3WK7A 4U7TB 3JALA 2FJ0A 3D0QA 3OO0A 2C88A 1WKCA 4ZVSA 4DR3B 1EIWA 1FS4A 3DKVA 5BNZA 9ABPA 4MKHA 4IQ0A 3LT4A 4KXNA 3KK0A 1CUVA 1E20A 4BC1A 1NC3A 2P9ZA 4N82A 1IB0A 5EL0A 3ROXA 5JASA 3H4IA 2HA0A 4KQXA 4EKGA 1XWWA 1DZ3A 5KQGA 1CR1A 3HVKA 3KZCA 4QOHA 2OLJA 4AIIA 1CJSA 1YACA 2ZSJA 3UH1A 2O8FB 4CKCB 5TNXA 3T3NA 2BMJA 2IYAA 1R9GA 2Q7OE 2IX9A 4Q1BA 4R83A 4UTOA 4EMUA 1E2KA 4DCJA 1EFUA 1R9MA 5J2TF 1UKZA 4RNCA 2FUG6 4GH5A 1SPBS 3HU3A 2FJPA 3AESA 1V6AA 1YZLA 4OYRA 5DFAA 3VJRA 4F2JC 4DCOA 4NYMQ 1GGKA 3T1YE 2J3QA 2VRDA 1E2EA 1FFBA 2FY8A 5T67A 1PVOA 4NZOA 1TVFA 2EKLA 5HBRA 3L6UA 3GRUA 2IOHA 3KLOA 5D5PA 2G28A 2ZAYA 4ZO7A 3ROPA 4DFDA 5B58C 5AK4A 4XTCS 4CETA 2EHJA 3F5SA 3CLTC 5EERA 3J7Yp 4J1QA 1L7NA 2A9RA 3GDOA 1SC6A 3KDSE 3U2QA 1YC5A 2KI5A 1EVEA 1LLQA 1QOQB 4L0MA 2VSXA 4HOYA 5C5IA 3G2HA 4F86A 2ZM5A 3N2EA 5FO1A 2GLTA 1W5SA 3HZZA 3NOOA 2C2MA 1RSZA 4O8ZA 1LNSA 4FMCF 5HZKA 2OE2A 1IZ7A 3G5AA 4JYMA 5J4LA 3OIUA 2F4VE 4BCAA 1JUDA 4UNQA 4EK9A 2XW6A 4XUDA 2H2AA 3PDCA 1SR9A 4OU4A 3D7RA 4LF5E 3UPUA 3JTZA 3MSCA 4K9LA 5CEFA 2ZJ2A 4AX8A 1Y8QA 1QVWA 1YKGA 3GJ7A 4JC8A 3M1AA 3ZDFA 2A8YA 3EGOA 1ZU5A 1CU1A 5LZ2A 5EGNA 2WHPB 1Q21A 5FUVA 3UHJA 4ETMA 1Q74A 4Q1EA 3TOZA 4UM9B 2EYUA 3GUVA 1N2JA 4GP9A 1CUEA 5LBUA 3K70B 1YD7A 3UFBA 1M2GA 2QRZA 4A2WA 1EX1A 4PSCA 3SX4A 4US2R 1QGAA 3ZU2A 1NLMA 2DGDA 3KTAA 4W8GA 4EJSA 3AVWA 3ZX5A 4R5HA 1W93A 5H8WA 2DLDA 1MU0A 3QLVA 3VDQA 1OJ7A 2DWOA 5IBCA 1D7AA 1XOIA 2E4UA 4LVOA 5IVHA 3LUJA 1ZGZA 1EXWA 3JQAD 4AROA 2FHPA 5SYNA 3X2FA 3DEIA 1ATIA 4GPBA 4MHOA 2F8MA 1PW5A 2QL9A 4G1EB 3AXSA 1BCSA 2ZU0C 1GG5A 2I4TA 1HQCA 3JQ6A 3Q0TA 5DHRA 5E8RA 1YFJA 1B43A 1ZEMA 3GGOA 2P4SA 3TECE 3N58A 4MA0A 2EMIA 2EARA 3W5VA 4NDAA 4AJJA 1Q22A 3LQRA 4Z54A 5C37A 3IB6A 4OUDB 1Q77A 2L8TA 2FG7C 4X65E 1WXWA 2R6DA 2B61A 3E1GA 2HMVA 2ZRKA 3V80A 1UKCA 2FR1A 5JBIA 3MT0A 2FPIB 3IEIA 3LBHA 4LPKA 4X66B 2VATA 5I7FA 1KJ8A 1T5OA 4I4LA 1XNGA 1KMMA 4JEUA 4B7ZA 1O95D 3GLHA 1SC4A 1SQ0A 4RL6A 4UTNA 2BE9A 3UBMA 4LI3X 2WSIA 3GRPA 2E9SA 2PWAA 2PZJA 3JQCA 1SBIA 4L5NC 1SCIA 4IJWA 2AC7A 4IKEA 2RAPA 4K9RA 2AHRA 4NH4A 5IYZB 3BULA 2MYPA 1NVKA 3PD7A 1V71A 1V8OA 3DTNA 5NULA 3JARB 2QXYA 3Q7SA 4FKZA 4JSRA 4QBKA 1ZIDA 4FMBB 1PNRA 5H5JA 3L7JA 3Q41A 3I9V1 5IMBA 1G64A 3U81A 4B3RB 2EPPA 2TECE 3QGMA 2XH8A 3B78A 3A4YA 3IOBA 4RDIA 4GP7A 4P5PA 5FCDA 3BMCB 1YDGA 3RAFC 2IF0A 1PK7A 1T2AA 3KJHA 1NVGA 2D1FA 1OMOA 3UJNA 1H0KA 1U7HA 2YTOA 1F12A 1VYUA 3H84A 1Z5UA 2LVHA 1HEYA 2J5BA 2VP3A 2YICA 2ZGVA 4K6OA 2JFBA 2NX2A 2HMYB 2IP2A 3MMNA 5KOJA 1E6WA 5JDIA 1V45E 1FQOA 4YAJA 5HNKA 5CW2A 3KQNA 3PUXA 1W96A 2G4VA 5DULA 1WVMA 2HJRA 1P77A 2HIMA 2ISCA 1BE6A 1D2AA 2XDQB 3ILHA 4TTJA 3TZLA 1UWCA 2YN2A 5BNTA 1CZLA 4HAOA 3NHYA 4DG5A 4IHQA 3U17A 2H4JA 3V8QA 2QRJA 2GMWA 2CC2A 4WYQB 4TYYA 1GQQA 1VI2A 4YO8A 3BKXA 4X6YA 5P21A 1XZNA 3STWA 2PGIA 2B20A 3QVTA 5ALVA 2Q0XA 3C3AA 4DREA 8ATCA 2PMBA 3CPHA 3GXOA 2ZB4A 1S01A 4MI3A 4OHFA 2QAIA 4O63O 2BEKA 1RACA 1F48A 3DEYX 4BO3A 5AI8A 3M3PA 5KNBD 1RMTA 2XBMA 4JLOA 4QFMA 4V39A 2QN7A 5L3SA 4KLNA 5AKLA 2EZ8A 4A8HA 3KQTA 1AKRA 1G60A 2GPBA 3A1NA 1C9JA 1R8SA 1PZHA 2YV1A 1NF8A 3D2AA 4BKRA 1CUCA 2W11A 4YUVA 5D6NA 4E08A 1GZDA 1BHQ1 4M49A 1DBQA 2WEKA 1WO8A 3A37A 3HJTA 3KELA 5EJ9A 2OILA 2XEXA 2ASVA 5LYYA 5CP8A 2WVGA 1F51E 1GTJ1 1SZPA 3EUWA 3IJRA 3NV9A 4F8YA 1LBIA 3VC2A 2NYVA 2R4QA 4TRNA 2VDWB 2A5GA 5FPSA 1UBJS 5L8VA 1T6XA 3EX7C 2O3SA 3UT5B 4WHMA 5L51A 1LS1A 3ACDA 3TR5A 1DTWA 4Y6GB 2HDWA 2NXJA 2EVWX 4KBFA 1NT4A 1OLOA 2W9XA 3KTAB 5DMXA 3WK8A 1T9DA 1ZJ4A 3FWZA 1JG6A 1O5OA 2YBDA 4OJQA 2HO4A 1AO0A 3WK4A 2B35A 2DGCA 5FPQA 5MF6A 1Y4AE 1M1YE 1J9ZA 2P65A 4DM3A 4HPWA 4B7UA 5HJ5A 1S2GA 4O4LA 4EEXA 2K5UA 3SKXA 3WBJA 4N1AA 2PD4A 3KQSA 3FG9A 3NM6B 4UM9D 5LQKA 1MB0A 2AX3A 5U1PA 2JJ1A 1IM8A 1QBGA 2FE1A 1C81A 2Q2OA 1KR5A 2AOTB 4RSMA 5DK4A 1YB7A 3C87A 1UBOS 1FP1D 2BLLA 2J0UB 3HY4A 1QHHA 4LVNA 1RW4A 4DVGA 3VI3B 2M1SA 1I24A 3E03A 5EZYB 3X1DA 1ZXBA 1KAEA 3ZDRA 4BATA 4EFMA 5KOYA 2P0AA 3A9TA 4ZARA 5HK9A 2C3YA 3MSWA 4PX5A 3TQFA 4OGLA 2DVMA 1J5EB 1D4FA 1JEJA 2EJBA 1ZICA 5BV1A 3LWNA 4I2NA 1Z68A 4GKKE 1Z6QA 3GGPA 3QMMA 4EQ6B 5LLQA 3NCHA 3NHWA 1YS4A 3AYXB 1YH3A 4JQCA 4BY9E 2DXIA 2P6RA 1E5DA 2MDTA 2NUTA 5IH3A 1QR6A 3Q6NA 4BZQA 4YEDA 5LQMA 5FQNA 1JEYA 3ZDAA 4MW7A 2EW2A 1DC8A 4M7PA 1SBZA 3RHSA 2WA2A 5BW4A 5JSFA 3HXMA 3U44A 1A98A 1CY2A 1S9DA 3C3XA 5ICGA 1Z9BA 3SEFA 3K9BA 2IPLA 1PQPA 1G55A 2ACKA 5EUBA 2RGNC 1AIPA 2ZIZA 2R8BA 3EZ2A 5DMHA 5KTMA 1NDUA 5DU2A 1MW8X 2O7VA 3IFSA 2EP3A 2W2NA 4ZAGA 1VBMA 3G7UA 2EFYA 4OOGC 3MF4A 5IWAE 1JSRA 3PFNA 4HL6A 4MTLA 4PIMA 4TVOA 1P0FA 4N8EA 3VTZA 2NUBA 4QLBA 2ZTHA 4FYHA 4B32A 4NCAA 1GQYA 3CRQA 3IMEA 3ZTWA 3WB1A 4MK4A 2XCRB 5JFOA 6CHYA 1XGKA 1EBBA 4UVEA 5E9JA 3F6PA 1CCWA 1EEHA 2ZOSA 2PQMA 3CW9A 3GVPA 5JV5A 2OYCA 4HQ6A 2H4WA 4DWOA 1U90A 4YDQA 1KXJA 3FTEA 1KYVA 2C2KA 2C2BA 2CUKA 2EG5A 4CBVA 2XNCA 4DR7E 3NC0C 3FMFA 3NH6A 4UJ3A 1SKMA 4MVJM 4ZCSA 2O8DB 2X0EA 1DAOA 2PFKA 5DLQC 2ZKLA 1W36C 1CUHA 1Z16A 2LVBA 3B20A 2VPPA 1A96A 2CNKA 1E79D 4WXMA 5J59A 3VR5A 4UTRA 3BMQA 2VEDA 5B1HA 3HG7A 1WCV1 4G4GA 4JYZA 4Q7QA 1D5CA 2XOXA 3TTTA 2FX5A 1S7CA 2GYWA 1RD4A 3WR5A 2Q9BA 4IMIB 2HZBA 3ZWOA 4I55B 3MJTA 4WSOA 5EQDA 4ZVMA 4EPVA 3GIWA 3H2SA 3V8NA 3RSCA 2VA8A 5DTJA 2C1XA 4DMCA 3DDWA 4Z8XA 4TOIA 4IJ6A 3NDPA 4LJ5A 1S0UA 4YK7A 5REQB 3BYZA 3AV0A 2ET6A 2KJQA 5K3SA 2ZWPA 5LQUA 2NZ8A 1HNWE 1WY5A 3B6JA 3QOFA 1IBKE 2NIPA 3QENA 3WLLA 4ALJA 2QTZA 5K09A 4GQBA 3MLAA 4G07A 4J4HA 4OLBA 1V1RB 5CVUA 1M2FA 1M9NA 5ALQA 1YZHA 1ESEA 4LJAA 5K2MA 4AUKA 4B3HA 1ZUNB 4G41A 2PT9A 4M9SA 1LTHR 2DPGA 1T4GA 1JRLA 1OWPA 2AMLA 1IWBB 4B6EA 5DI9A 4AC9A 2H17A 4JXXA 2V3CC 1R1DA 1Z4NA 3JYHA 3ER9A 4NS4A 1E1NA 2R4UA 5LMZA 1M74A 1OXSC 4U1RA 3RUAA 3JQQA 3VZDA 6GPBA 4A36A 3FGZA 2ZYTX 3DL0A 4MYSA 3FGPA 4RY9A 1YJQA 5EMMA 3D5QA 4JUFA 1J5PA 5B55A 4IXTA 1RIIA 1B15A 4OHCA 4EKEA 5A62A 3LFUA 2RONA 4QD3A 1SUFA 5TMPA 3PRHA 3I8OA 4D9KA 2XE4A 1KZYC 4BWFB 2AE1A 2IV7A 4CF7A 4MXDA 4LXUA 1MEOA 3KYCA 3VPFA 4GMXA 3S1SA 4JLPA 1MOQA 5T6BA 1OPRA 4DWJA 3RJZA 3L7KA 4Q3NA 4J1TA 4KK3A 2R76A 4RENA 4TMZA 1NHWA 1BCRB 2H52A 2VUHB 4BO8A 4BE4A 5KTKA 3LY7A 4R4JA 2YVAA 1I7PA 2CFIA 3STHA 3M1YA 2ZT6A 3W34A 4YS6A 2XMSA 4G5SA 1EDEA 1GTVA 2B8EA 3W2HA 1MB2A 3ZV4A 4OIMA 1E4EA 2VCYA 4PQYA 2R6ZA 3K05A 3H18A 3DG9A 1GTSA 3BN3A 2F43B 2SBTA 4IDGA 3KUDA 2XHEA 4MA5A 3CSDA 2I1WA 4MZDA 2M1ZA 2ZZMA 3TVDA 5A0VA 3ZHQA 4J0CA 3CRW1 4KSCA 5F3DA 3B9BA 1HE5A 2YWXA 3PDHA 3EC7A 1JLHA 1JDUA 2GAIA 2ZULA 4O08A 1UJ6A 1SIOA 1UJMA 2JJ1D 2POCA 2E18A 2Q3EA 2EQ5A 2MDGA 2EX0A 2AFVA 3P2OA 4JJFA 3EGDA 5E9WA 3ZIUA 3WIEA 4KQMA 1WZ2A 3NX4A 4G86A 1UBEA 1GT91 2OCIA 3D1VA 4FVTA 3K2EA 2QMYA 3MTGA 3UK0A 4OQZA 2YRWA 2HC5A 3L4BC 3NNSA 4GWGA 4NFSA 2VP0A 4A0HA 4B6JA 3ZXXA 1YZQA 5A1JA 4RTNA 4IJQA 4LRXA 3ZV6A 3O91A 1X39A 2A7XA 3W5HA 3WSWA 1I51A 1P81A 2YR0A 3HB4X 5KKNB 5IM4A 4LN1A 1KI7A 1MTOA 2JJ8A 1ZIXA 2XYVA 1L1FA 3EPPA 1H5NA 4FHZA 2EMHA 1RHKA 1G21A 2DUWA 2J32A 2XBUA 1MCZA 3NHRA 1K6XA 1QRSA 4OP1A 1KI8A 2ZBDA 5FNVB 4I50A 2PGNA 2QORA 3RBAA 3RU2A 4CMHA 1OLUA 1E1MA 2V7BA 5CNKA 1XF9A 1A72A 2ZI6A 3MWEA 5JFGA 3ZW8A 2OFWA 2FSFA 3ZNOA 5ILOA 1HDZA 3P97A 3EUAA 3HJAA 2GUWA 1EZZA 1PF7E 2Z3VA 3OPYA 4HN9A 2GILA 5B2ZA 3V2IA 3QFTA 4C1BA 3Q72A 2RJNA 2LE2A 1AH5A 1BMTA 4RJKA 4FCTA 4JSTA 1VLJA 2BHRA 4OXXA 4RUKA 2AN1A 4E6PA 3ICEA 3CZMA 3H0EA 3FOWA 1I94B 2VXBA 1TPZA 2X4DA 1RT9A 1TF3A 2RB4A 5T4FA 3LO8A 1WWKA 2X8JA 4UEOA 1J09A 3BBPA 4WN9B 3JQBA 4YAEA 4ZT3A 3SBEA 2TMDA 4GMHA 3UOAB 4F6LA 1KH2A 5FFNA 3R3HA 1T9CA 3L6CA 2OCBA 4UDYX 1W59A 2EN3A 1L7AA 4J29A 3CRRA 4EELA 1GPDG 4Z9XA 3VU0A 3AIIA 2XMDA 3DTYA 2RAVA 2BL4A 4PXSA 5KSZA 1IHPA 3VVBA 3A4IA 1F2TA 2ZIWB 2G4LA 4F9FA 1ZOPA 2FQQA 2I78A 3BSWA 1EQUA 3HKEB 4RH8A 5AQ1A 4TYPA 2I03A 4AZWA 1C2YA 1WD5A 5E7IA 3OM9A 4DADA 4JJGA 1SRRA 4P7GA 2OP1A 4XQ0A 4B09A 4B76A 4ABTA 2QTHA 2ERYA 3RU9A 2I87A 1QYDA 2NMVA 1JJIA 1MP0A 1D0VA 2ZBVA 4IIJF 3X0DA 1L4HA 1SH7A 2I2CA 5LA6B 1JLLA 1YZTA 2PK3A 3O5AA 5JJCA 2EOFA 2XAUA 1ULZA 5JDCC 3B8HA 1HR0B 5FJIA 4X0EA 4OI1A 3W6UA 3MRTA 5DN9A 2W6JA 2WZBA 4C7BA 1TL7C 4AZ3A 3T41A 3ZD8A 4LF9E 1IQOA 1RM3A 3LRXA 3U80A 3RT7A 4JI1E 1ZMXA 1XFAA 2B3TA 1FEZA 1AN9A 4UTVA 1N33B 5JVDB 3NORA 3AOEC 2NNLD 4AY6A 1W6UA 2PO7A 4XWOA 1ZBDA 2I6QA 2Y1FA 4PHGA 2WAMA 2YVUA 2BW0A 4R2XA 1DDOA 5DCYA 4UZSA 5KHOC 2PLAA 1CT9A 5H81A 2KHXA 3CZCA 4R1MA 3WISA 4ZICA 4MQUA 1KP3A 4MS3B 1TI7A 2VYVA 4FFWA 2IYFA 1U1DA 1MB9A 3BD9A 1AHNA 1DRUA 4BN0A 3JASB 1BFDA 3FCXA 1AB5A 3LF2A 1DKPA 3VKGA 1QIJA 5EYPA 2DKOA 5F35A 2AZTA 2DWPA 1YFZA 2AE2A 1B7GO 1W0KD 2FRXA 1XRSB 3C6ZA 1GUFA 2OHXA 3O6VA 4L57A 4NZ9A 5KQMA 3ANXA 5A71A 1XYGA 3G7NA 3OQBA 2P77A 3HCAA 1VLZA 5CW1A 3AV3A 1OZFA 2I2XB 4O2LA 1J21A 1LC3A 3D2BA 5F1YA 2H2HA 4E7PA 4B3FX 3RVMA 3PICA 4MVJP 4GL2A 4BRZA 1VB5A 1Q20A 2IPXA 3JWPA 4Q21A 4C07A 5I5GA 6NULA 1KQ3A 3ENQA 4H31A 4D0NA 1S3IA 3T1TA 1T35A 4X65B 4HXGA 1SXPA 1QFZA 2P78A 3CISA 3R8XA 2XZTA 3FFAA 5AM3A 4LTDA 3I37X 3LBIA 3LMLA 3COPA 2G3YA 3I5UA 3EQZA 4Y8VA 3UKOA 4LJSA 2AA3A 4OFXA 4OBBA 1MV8A 5BMVB 4U63A 2Q1WA 2EMFA 5LL6R 1E9FA 3GH1A 3IXLA 4UHDA 3WNDA 4KQ6A 4O29A 4WINA 5JC1A 1DBSA 1WHTB 2ZJOA 3CLHA 3U56A 1NZFA 2ODTX 3DVQX 3HNPA 4YAFA 1H0HA 2GFQA 1NF3A 2WWRA 3SHOA 2DFLA 3QXJA 5KVVA 1KO8A 4L27A 5FBVB 1MNAA 3NGMA 1YNOA 5ED4A 3NEJA 3OFND 4K0KE 4AP9A 4D3FA 1J7JA 1U3CA 1VCHA 3HDTA 3OJLA 1I1HA 1M5UA 3OIYA 1OH8A 2ZRHA 3QYJA 4XGQA 2Z9BA 3KKQA 1LFDB 1R9JA 3AW8A 1VYVA 4TV9B 3UJ7A 2IEGA 4BECA 4E13A 2REOA 1N6PA 1ZN8A 4IIGA 3CHYA 4NFHA 4PU0A 1RNLA 4TYQA 3PL5A 1W0JA 2ZWVA 3L40A 4R8MA 3LT0A 1S8OA 2NOAA 1T4BA 1KYWA 1ZOLA 2RCYA 5E4YA 5F2OA 3JATB 3T9AA 4BUCA 4A4DA 3VPAA 4D6YA 2HI0A 3G9XA 2VCEA 5K3AA 5FOQA 3AINA 4S35A 4ZI7B 2XXAB 2F3RA 1EHYA 3ZJ4A 3M82A 3TRHA 3B38A 4LE1A 4JI8B 4CTOA 4EZEA 4HB3A 2FK8A 3IALA 4F4JA 1O6BA 1RFGE 4CTMA 2QVYX 4K88A 3RV4A 1XZHA 1AXGA 1CJTC 1SUDA 2H5EA 1CY6A 4G5OA 1NR5A 4XSVA 1D8AA 3W04A 2DE0X 3UXEA 4BDSA 3KB6A 3BFJA 3UGKA 4BMSA 5JY6A 2IBTA 2YWGA 2R3SA 5B6IA 4BNHA 3I2YX 5FOWA 2EOYA 3AV0B 3STUA 3K4QA 2PG3A 3BD6A 1Q7GA 3OOEA 4D97A 3DEAA 3CTPA 4M22A 2CBZA 2E48A 2DCUA 4XE5A 3HA2A 1GTRA 3F0TA 3AUJB 4HCJA 5LU9A 1BHO1 1OFUX 4JL6A 4ZKDA 4KODA 4DS3A 2H4HA 3CO5A 1DRWA 4BNYA 2XVMA 3C6BA 4OXKA 4ZQCB 1YDMA 4H7KA 4IYJA 3RS0A 1BTOA 5DBEX 1NDHA 3JAWA 2ZIVB 4UVHA 3VA7A 1ZX1A 3DHYA 5LBTA 5TS2A 4NBUA 4L22A 1J9GA 2WV7A 1ZD9A 4RXTA 3EEQA 3RS4A 1XMQB 2PZEA 4OATA 3HRKA 2FPMA 4I4IA 1AXRA 5F5NA 4H35A 2PNFA 4L16A 3KG2A 1SZDA 1HQKA 4HVLA 2KWIA 1JZQA 3UNXA 1GCIA 1GKYA 4WACA 1W88A 4RXMA 2B1JA 4ZI2A 2QUAA 4N9WA 4I6JA 1Z17A 2HDNB 3BGVA 3DVAB 3JCZA 5FFMA 1NX9A 1RXSA 2LJHA 4DJFC 3QG5C 4KKVA 3GW8A 3WV5A 3GUZA 1C0LA 1UADA 3VVMA 5I7RA 1DVRA 1OJLA 2PH7A 4HAVA 3VHTB 5HE8A 3A6PC 4G63A 4IIHA 4EGAA 3VAZA 4NG5A 3VU1A 1PE0A 2WPDA 5BSWA 1JIXA 1K8YB 5JCJA 5CVVA 3SNKA 2WPNA 1CTQA 3WSTA 1O87A 4BO1A 1P62B 1NXSA 1A2KC 4UMDA 4BKPA 2CT8A 1YZUA 3H2IA 3QZUA 4OSPA 4TT8A 1XNRE 1LBSA 5DW0A 2O8CB 5A4DA 3JYOA 1JIQA 1M76A 2N46A 5T41A 1UPBA 1OGYA 3LHKA 3C45A 5TQ2B 2B6NA 1XMVA 4H3HB 2A9QA 4IL5A 3SLKA 2WF9A 3WNQA 5LZ9A 3D4PA 1BVHA 2SICE 3LUGA 1YDEA 4QYWA 5A2QA 1I01A 3TGPA 3B3GA 4D3XA 3F6GA 1FJGE 1E1QD 3KXPA 2PUGA 4XI9A 1ISPA 5F1OA 5IC4A 2BSAA 1VM6A 1WSAA 3TUIC 1IXZA 4X8OA 3LIIA 3A7EA 4FXPA 4GO1A 2ZREA 2PN1A 3ZFNA 3USZA 5FPKA 4RGVA 1D9ZA 4L8WB