3C6KA

Crystal structure of human spermine synthase in complex with spermidine and 5-methylthioadenosine
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
363
structure length
335
Chain Sequence
GSRHSTLDFMLETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYEEIDSILNKVEERMKERVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human spermine synthase: implications of substrate binding and catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Spermine synthase
total genus 103
structure length 335
sequence length 363
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.22: Spermine synthase.
pdb deposition date 2008-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
A PF17950 SpmSyn_N S-adenosylmethionine decarboxylase N -terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 3c6kA02
3.30.160.110 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Siroheme synthase; domain 2 3c6kA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3c6kA03
4C06A 1TPYA 4YV0A 2H00A 2IP2A 2XVAA 5FWAA 4C08A 2G71A 4QPPA 4E33A 4ER7A 2I9KA 2B9EA 2IH2A 1WS6A 5DSTA 3BGVA 5E1BA 2ESRA 2G70A 2YR0A 2YVLA 3GGDA 1PJQA 2XYRA 3KPJA 3LCCA 4CKEA 5EEHA 5DRYA 4YV1A 1VE3A 3JWJA 4PYNA 4E2YA 3P2EA 3P9NA 4B17A 4BLVA 3EVEA 2OB1A 1AQJA 1G6Q1 4GEKA 2BM9A 5K01A 3QOWA 3LPMA 4PCAA 3IYLW 2ERCA 3P8ZA 4X63A 5F2OA 3EVFA 4BP3A 1D2HA 3G2OA 2ZFUA 2DULA 5K0JA 3KR9A 5DM1A 3UJ7A 4F84A 1XCJA 1L3IA 2G8NA 4AZWA 2PT6A 5GP1A 4DCMA 3HP7A 3E23A 2Q41A 4HTFA 3AXSA 1ORIA 5DM4A 2IDJA 3DULA 5GM2A 3UJ6A 5HOQA 2N47A 5FUBA 4CKBA 3KR1A 3HNRA 3I64A 4GC5A 3VYWA 1YF3A 3G89A 3E05A 3T7TA 4EMSA 4GUAA 4H0NA 2EJUA 4EKIA 5BW5A 1BKYA 1XXLA 4DKJA 1ZGAA 3MGGA 2ZWAA 3CKKA 3KQSA 4E32A 1VBFA 5FQNA 3FPJA 2CMHA 3KQPA 2QRVA 1BC5A 4RX1A 5E2AA 4PWYA 3NWBA 4RTQA 4R8RA 9MHTA 1JG2A 2HNKA 5ICFA 1JG4A 2JJQA 2CMGA 4ER5A 2P40A 3B5IA 3ELDA 3DXYA 4HG2A 3FUWA 5EQJB 4MQ4A 2K4MA 3B3JA 2WK1A 4RWZA 2LD4A 2YXDA 5EGSA 4EVIA 2PV0A 3FTCA 3P2KA 2YX1A 4AZVA 2AOUB 3NDJA 5T64A 3ER9A 3RW9A 3MTEA 3REOA 2PSSA 3SR4A 3KKZA 3LX6A 4A6EA 1N7IA 5LQUA 3M70A 4QTUB 1AV6A 2AN5A 3GCZA 3DMGA 3FUVA 1QYRA 1L9KA 1X1DA 4IKPA 3V97A 3TM5A 2CKDA 1R8YA 5EEGA 1IY9A 1R6AA 3EEYA 2VDVE 1KPIA 5DTRA 1KYZA 2NXNA 3EVCA 5DTMA 3KPVA 4WVLA 3DOUA 1H1DA 1P1CA 3HCFA 3LBFA 4AUKA 4OBXA 3HCCA 5JR3A 5CIYA 1U2ZA 3UJ9A 3FYDA 3LECA 2WA1A 3EMBA 2PGXA 2VDUE 3BZBA 5EIFA 3TFWA 2B25A 2PBFA 4F85A 3R24A 4RVDA 3PFHA 4XUCA 3ELYA 2OO3A 2OZVA 3TPZA 1JTEA 2UZ4A 3KHKA 1UWVA 3LHDA 3TLJA 1NBIA 3G8AA 3KPWA 10MHA 1IM8A 1X1CA 5C1IA 4M38A 5K0NA 4BLUA 3C6MA 5P8WA 1JTFA 1AQIA 5CVEA 3BUSA 2PT9A 1FP2A 1YB2A 4GOLD 4HTFB 5GIPE 1NV8A 1NV9A 2G1PA 1QANA 3HVIA 4RV9A 4P7FA 1UFKA 5C9ZA 5LQAA 3M33A 1JSXA 4NECA 5GM1A 2PXAA 3FTEA 4XUDA 4PYQA 2UYCA 2P35A 2I6GA 1G55A 2P3QA 5C0OE 3ORHA 2O0LA 5D1HA 5K05A 1WXWA 2IDKA 5K0BA 2Z6AA 2FCAA 5FHRA 1NW3A 1O9HA 1X1BA 1RI5A 3A27A 2QY6A 4OA5A 3MAGA 5DSXA 5BXYA 2IBSA 3I9FA 1JQ3A 4FT2A 2PY6A 2JHPA 3UFBA 3BWCA 5T67A 4PINA 3EPPA 2V7EA 2P1DA 4KDRA 3GO4A 2B3TA 3LDGA 2FHPA 2UYQA 1L3CA 4RTPA 3O7WA 3BKWA 3FYCA 2YQZA 3FRHA 4LWPA 3FPGA 2CL5A 2R3SA 3MB5A 3NMUF 2IPXA 3CBGA 2GH1A 2YXEA 1AF7A 1I1NA 2I62A 3LDFA 3UJDA 3ME5A 5FTWA 3A7EA 2NXJA 4KIGA 3KQMA 3TMAA 1FBNA 4PYMA 3A25A 2C7QA 4DQ0A 4XCXA 4E2XA 2NP6A 1ZQ9A 3SSNA 3G2PA 1HMYA 4PNEA 1SUIA 4C05A 1VPTA 2YXLA 2P7HA 4P58A 3EVBA 1I4WA 2GB4A 2VDWA 2QE6A 2ZIEA 4KWCA 3UA4A 1P91A 1KPGA 3NW9A 2QRVB 3PVCA 4AZSA 5EKUA 1VP9A 5U4XA 4YUXA 1KIAA 1M0EA 2QYOA 5IKMA 1SKMA 4IWNA 2XBMA 2ZTHA 1VP3A 2BR5A 2ZBRA 1WG8A 3B89A 4FGZA 4KW7A 5K0GA 4BLWA 2AZTA 3EVAA 3BXOA 4FZVA 1XDZA 2O57A 2PXCA 1DCTA 2JHCA 2AVDA 2JHAA 1G8SA 4DMGA 5G02A 2FPOA 4GBED 1F38A 1EIZA 5BP7A 4PIPA 3GJYA 4PYLA 4QDJA 5DLYA 3M6XA 4PYIA 4FSDA 3GDHA 3OPNA 3IHTA 3LKZA 2ZSUA 5EKXA 4CWAA 3TQSA 3GIWA 3BT7A 3Q7EA 4KIFA 4Y2HA 7MHTA 5EC8A 2C7RA 1TW3A 1KYQA 3C6KA 1VL5A 5LSAA 2FK8A 4P7JA 1P39A 3B3FA 1D2CA 2BR4A 1NT2A 3OFKA 4C03A 4BY9E 5E9WA 2HV9A 5CM2Z 2A14A 2IGTA 4BP1A 3OE5A 4DA4A 3OU6A 1VIDA 4MIKA 3P2IA 3ELWA 3SXJA 1PJTA 4GOND 5D1NA 3TKAA 4CTJA 3GU3A 4RTSA 1WZNA 1Y8CA 5EZSA 4R6XA 4R6WA 3SM3A 1XTPA 2NXCA 5HIMA 1YUBA 3B3GA 3CJRA 5E9QA 3VC2A 4AX8A 3ELUA 5LQJA 3HCDA 4QTTB 3LL7A 1QAOA 1NE2A 2OPBA 4FT4A 2IBTA 3PLAE 1Q0SA 2E5WA 1ZKDA 3BGDA 3MERA 1XVAA 3TM4A 2JH8A 1MHTA 3IV6A 1SG9A 2IIPA 3EGVA 3KQOA 4GQBA 2O06A 5E1MA 4OBWA 4M36A 5K0FA 5EOVA 5B1SA 3IEIA 2C7OA 1N7JA 1X19A 2XVMA 3BKXA 3TOSA 4P7GA 4E2WA 3PS9A 2Y1XA 1JR4A 2F8LA 5T6BA 2PX5A 3ID6C 5K8VA 1BHJA 2PX4A 3T0IA 5LQCA 1N2XA 3KQQA 1NW7A 5K0EA 3FUTA 4C4AA 5KS2A 3Q87B 5HZMA 1WXXA 1B42A 3DLCA 3PT9A 2ZVJA 4R8SA 1R18A 3FPFA 2BM8A 1FP1D 3SVZA 2ZIFA 4C04A 2GPYA 5HIIA 3HVHA 3NTVA 1RI1A 4ER3A 5LQRA 4M37A 3FPHA 2XYQA 3LKDA 1QAMA 3CVOA 3G7UA 1JG1A 5HIKA 3FTFA 3THSA 3KQWA 1EG2A 2ONZA 2Z6QA 4YMGA 4GC9A 5DX0A 3VSEA 2ONYA 2P3OA 3S68A 4HH4A 3C3PA 2ZBQA 5M5BA 2ZW9A 5ICCA 2PX2A 3GXOA 3GRVA 4QVKA 1NW6A 1WY7A 1XJ5A 3FZGA 2YTZA 5EG5A 5EMLA 1R74A 4Y30A 4UOEA 5H02A 3X0DA 1DL5A 2P7IA 3P97A 3NJRA 2ZZNA 4CTKA 3LCVB 3P9CA 4K6MA 4U7TB 2C7PA 4U7PB 5CVDA 1KP9A 2B78A 5EPEA 1DUSA 1JG3A 5KYGA 1ZG3A 5F2NA 5KQSA 3KPUA 2GAFA 1IXKA 1INLA 3R9XB 2ORED 4Z2YA 3ER8A 2ZBPA 2IH4A 2PX8A 3FUUA 5CD1A 5KVAA 3HVKA 3DH0A 5FULA 4GOMD 3CJQA 5HILA 1YZHA 3EGEA 3D2LA 3OU2A 3OU7A 4OA8A 5EVJA 2R6ZA 4PGHA 2EG5A 3B7PA 3AWIA 1PRYA 3A26A 3HCAA 4CXMA 1M6EX 3DXZA 5CVVA 1M6YA 4YUYA 4YUWA 4X61A 3DXXA 5ICGA 2AOWA 1YFLA 3ANXA 3BWMA 1MJFA 1SUSA 2OKCA 3L8DA 4AZTA 5DXAA 1PJZA 5FA8A 3OZRA 3M6VA 4RSRA 1OR8A 4QPNA 1UIRA 2WA2A 4RTMA 4X60A 3M4XA 1G60A 3SGLA 2ZCJA 3EMDA 3EVDA 4R05A 3O4FA 2DPMA 2I7CA 3R0QA 4O29A 5FCDA 3U81A 3JWHA 1EJ6A 1R00A 4E70A 1TW2A 3AJDA 3HCBA 3OFJA 5K03A 2NXEA 1KXZA 2QM3A 3DR5A 3I53A 5CVJA 3MCZA 5K0CA 5EMMA 5E1OA 3T7RA 3KU1A 2O07A 1ORHA 3G5LA 3HVJA 4OQDA 5DXJA 2PVCA 5K0LA 5EHIA 5DM2A 2G72A 4E2ZA 2HMYB 4MTLA 1EJ0A 5E8RA 5HIJA 2HTEA 2B2CA 1EAMA 1L3BA 1SQFA 2HWKA 2AOTB 3E7PA 3FUXA 3C0KA 4C07A 4OX9Y 4EKGA 5CCBA 3A7DA 3G88A 1G8AA 3RODA 2JH9A 1SQGA 5BW4A 1I9GA 3UA3A 3THRA 4MHTA 4DZRA 1SVUA 3SMQA 5JUWA 1HNNA 4GOOD 4DM3A 1RJDA 3PX3A 3G2MA 4HRAA 2IFTA 3MTIA 1Z3CA 5DT2A 5IH3A 5GIOE 4HSGA 5EMJA 3AXTA 4JXJA 3R3HA 4PGGA 4PCLA 4QQKA 5DWQA 5HEKA 5KQRA 3ERCA 3UJAA 4YV2A 3HCEA 4ATNA 4POOA 3NVMB 4LECA 3R6TA 4YMHA 3UWPA 1NKVA 4X41A 1EQAA 2EX4A 1ZHFA 5GINE 1XDUA 3OZTA 3K0BA 5DM0A 4IV0A 4OQEA 4FS8A 2PLWA 3GRUA 2FRXA 5DPMA 4PYKA 2ZZMA 3NVKI 4V0QA 4PYJA 5DRTA 4PYOA 1O54A 4RTKA 3GRYA 5FWDA 3GRZA 3UZUA 3EEOA 5LQNA 2OY0A 5F2KA 4RTJA 3LDUA 3I58A 2VS1A 3PTAA 2NNWB 2Y1WA 1PJSA 2NYUA 3SSOA 2HR1A 4IV8A 2GA9A 2P8JA 2AN4A 2ZIGA 2KW5A 4XUEA 3I5UA 5MHTA 4PONA 4HGYA 3KQYA 3EVZA 4KDCA 4HC4A 4WXHA 3FRIA 4ZTBA 3H2BA 5GWXA 1RJFA 1RJGA 1QZZA 4QVGA 2PJDA 3MCTA 4LG1A 1FJXA 3AY0A 3QOXA 4LWOA 1KPHA 3MQ2A 3V8VA 3QV2A 4E31A 3KQTA 5ICEA 3LBYA 4G56A 1RI3A 1VQ1A 4MWZA 5E1DA 3T7SA 2JG3A 2PXXA 3P9IA 2O05A 3DP7A 3G2QA 3KR0A 1F3LA 1YZ3A 3G5TA 3OE4A 3P9KA 4M7RA 3K6RA 2AS0A 2OBFA 3A4TA 1BOOA 3G8BA 3LSTA 3NDIA 3P71T 5LR6A 2ZZKA 1P1BA 4RTOA 3JWIA 1T43A 3VC1A 3SSMA 5CUQA 2AR0A 3LGAA 5HFJA 4GF5A 3C3YA 2UYOA 1NW8A 2GLUA 1KHHA 2AOXA 3CJTA 3SX0A 1NBHA 1VLMA 5E8JA 3BWYA 3E8SA 3MHTA 3DMHA 1JQEA 2PWYA 2EJTA 2IH5A 2V74B 3CCFA 5CVUA 3DLIA 4X1OA 2AOVA 2FK7A 1X1AA 2OB2A 4YUVA 2AN3A 5E2BA 4KRGA 4HGZA 1R8XA 5EHGA 4YUZA 4EK9A 3GWZA 3KR2A 2BR3A 2VZ9A 1RJEA 2BZGA 1D2GA 1JSZA 3PFGA 4P7KA 3DTNA 4RVGA 4RTNA 2Z6UA 4F86A 2PKWA 2ZULA 1QAQA 2VP3A 2AVNA 1Q0TA 3HEMA 2OXTA 8MHTA 2AOUA 3HA3A 2AOTA 4L7VA 5FHQA 3UBTA 2BH2A 3WSTA 2GS9A 1JQDA 3EGIA 3RIEA 2ZWVA 3HM2A 3F4KA 1NW5A 3KPYA 3UJBA 1O9GA 3HA5A 3PB3A 2P41A 3JWGA 2CWWA 3BGIA 3PX2A 4QQNA 1FPQA 5E9JA 5DX8A 5FADA 3CC8A 3LCUA 3OCJA 4ISCA 3FTDA 4RTLA 5LQKA 3DMFA 3NWEA 5CCXA 2PWPA 4EQZA 4V0RA 3UJ8A 2NP7A 2ZLBA 5EMKA 3TKYA 1V39A 3TR6A 3HTXA 1YFJA 1RI2A 2YUIA 3M6WA 4RVFA 2UYHA 4FR0A 5K09A 5DX1A 1G38A 5FA5A 4FP9A 5GOZA 2OYRA 3TRKA 1XDSA 1RI4A 4CKCA 5FQOA 4DCGA 4E30A 1XCLA 2H11A 4ER0A 1ZGJA 2H1RA 3GNLA 3GRRA 4RVHA 5DTQA 4A6DA 4ER6A 2XYVA 5EZQA 1KR5A 3CGGA 2EFJA 4FSXA 3UJCA 3M6UA 1L1EA 3KQVA 5EIWA 4RYLA 4DF3A 3BWBA 3FPEA 4PIMA 2P3LA 3OZSA 4KVZA 3DUWA 2FYTA 3HA7A 1KYWA 3O31A 5ERGB 3EVGA 2ADMA 4QDKA 4RTRA
chains in the Genus database with same CATH superfamily
4UQOA 5EP2A 5BR7A 3Q0TA 2VDJA 1SXJC 4J0JA 4TKZA 2REQB 3WL6A 1SBTA 3PCTA 3A6LA 3O90A 3HU5A 3OWOA 3H83A 5HX7A 1MVLA 4OXKA 3L77A 2LXNA 1KO8A 4C0JA 3JWJA 1MJ5A 3X44A 2Y77A 3UCFA 4E2YA 3C3AA 5E6SA 2BDTA 1XNQB 3DZHA 5EXDA 3TIXB 2CMDA 3B8EA 1IJEA 4ZRNA 5JRZA 3O1JC 3VSAA 1KK0A 3KUCA 4MVXA 4TVSA 2CTDA 4Q1FA 4EJSC 4L9AA 1DAMA 1HDGO 4HX2A 3F5QA 2D8MA 3FIUA 4GD3Q 3U4GA 4RPGA 4CKBA 2VYVA 1CUXA 1WZIA 3ANSA 3QUSA 1DPFA 1QH0A 2P6NA 4MKFA 1R64A 4BFWA 3AKCA 4XTCS 1GZVA 4J9UE 2DPGA 4PAMA 4U2FA 3QA3E 3RG8A 3VNRA 1W4CA 5HOEA 3J7AG 5ITZB 3H1AA 3PRYA 5ALJA 3WMFA 4LN1A 4UMVA 4MUAA 4HPWA 1NT4A 3GLHA 1ST3A 3DFFA 1VHJA 2HWWA 1KGDA 1WCV1 1X7WA 4PWYA 5F9MA 1XZPA 4J8PA 1IATA 3U7FB 2ELZA 2V58A 2PGNA 3EZGA 2VHUA 1ZXLA 1XN1A 3QLUC 2X0EA 3ELBA 4IH9A 4BNDA 1KBQA 2GESA 5IPFA 3ROXA 3W2IA 4FX2A 4CCYA 2XRZA 4N41A 3AVYA 4OUKX 1JA1A 3CH5A 1QTRA 3SIRA 3W79A 4ZYTA 4ZTUB 1AOXA 1X47A 1VL8A 4XOUA 1NX9A 2A9QA 3VU0A 3VR4A 2VJMB 4WK4B 1RYZA 1M6WA 2CJPA 4GW3A 1EJ2A 5EWJA 3ZU2A 1WPGA 3UPTA 1N7IA 3OPYI 4MUEA 2UXDE 1W0CA 2JGNA 1YIDA 3U40A 4EFKA 5AOCA 3V97A 1TGVA 5CFZA 4HMOA 2OGTA 2G6TA 3SD7A 2NUTB 3DM9B 4KLRA 2E1PA 5BRNA 4UMDA 4TOIA 1GTVA 4AFNA 3ZNPA 1WDKA 3X2FA 2LV8A 4Q9NA 4WKNA 5CIYA 1NSYA 1U2ZA 1GTRA 1SRRA 2PQ2A 1UBRS 4DDWA 1OA0A 2PGXA 3IDOA 3JAWA 3W5UA 1A9TA 3RYFA 3BWVA 1SUDA 3EXEA 3JR3A 1KVQA 1XDWA 3FOCA 3WV5A 1TGYA 5A9TA 5BSVA 2CBGA 1Y5NA 5G53C 3TLJA 5MN5A 1SG0A 3E15A 3EZYA 3LTNC 4KVAA 3KJXA 3B3QA 2JCBA 3U37A 3L84A 5FT9A 2WFLB 5K0NA 5B6IA 4AY2A 2ZR8A 1O6GA 3FSJX 4TRRA 5D86A 3GLFE 2H06A 3KLPX 5MDHA 1ADCA 1FRZA 2YJNA 4JA2A 4LMRA 3SIXA 4B4OA 2SHKA 2H3HA 2WYWA 3RSGA 2E9SA 3REQA 3WRXA 1Z0UA 2DJ5A 4DV4E 4YWJA 4EVQA 3KVYA 5D5QA 4M1QA 1BDIA 3FTEA 1EA7A 3NC0C 1BBOA 3QLEA 3AH8A 2HWYA 3H2KA 3PNOA 1G55A 4M1YA 4M49A 3TDKA 5IDWA 4ESVA 1SXQA 1MABA 2IYTA 2H4HA 2CCKA 3T0FA 1S3SA 2JFZA 2YICA 5J9FA 1YOVA 4LXIA 2QTZA 2YOHA 4EYGA 4INZA 1T3HA 1EM8A 1EFVA 3C8MA 3QMWA 3UFXB 4DA7A 1YKSA 4KDRA 1AV7A 2XTJA 3S7ZA 1Y3IA 1CIPA 2X7HA 1A2OA 4NYJR 3ND9A 2FB9A 3WLMA 5KHLB 3N5KA 4J43A 1L3CA 2ZXFA 4PS0A 3C8ZA 3O7WA 4M9SA 1HWYA 4S2UA 1L6RA 2YQZA 3FYCA 4YRSA 2CL5A 4G65A 3NMUF 3D0OA 3T3OA 4G8DA 1PZGA 3AY6A 1RMYA 3E4DA 5EZ6B 2Z8XA 4BQNA 1DBIA 3FMIA 2EATA 5SY9A 3GVHA 1MQAA 5LBUA 1U28C 5AKKA 3LWNA 5TMPA 2X4DA 2VL7A 3I12A 1YR6A 3A25A 1C7QA 1NQOA 2Q9UA 3A4VA 3IOBA 3KYBA 5EZYF 5BUZA 4C6TB 4UBKA 4PNEA 1O94D 2PS1A 4K8OA 3D4IA 4Z4CA 4N5DA 1WW8A 1A76A 2P7HA 4B3HA 1YDHA 1XD2B 2YHIA 1T9KA 3EVBA 4AZSA 5I7EA 4Z53A 4F45A 3SXUB 5FOQA 4O2RA 4O2BA 3KZXA 2GXUA 2G0TA 4W63A 2RKOA 1QRSA 1VIAA 1OXXK 1J5EB 4BMVA 1NP6A 3QH4A 3RS9A 1SKMA 1VB3A 1DCFA 3TX2A 4L4YA 4X20B 5FDFA 1RAFA 1NSFA 2QTLA 1ONPA 1MFZA 2XT0A 4MX8A 2R79A 1JAHA 2YJ4A 1M2OA 4KACA 3C87A 4U7WA 4WDQA 4WX2B 2PXCA 3V4PB 2IWRA 5I3CA 1ZI6A 4QG7A 1C9MA 1JWBB 3WL4A 5JAHA 5KC9A 2QD1A 5KBYA 4MVWA 3B1XA 1K7YA 4AB1A 2IZ6A 3I3SR 3HO1A 2H0RA 2QM7A 4BX3A 1RWKA 5ADVA 2TYSB 4OP1A 1Y1PA 4WL0A 3X43A 1HFEL 2J33A 1AZWA 3IHTA 4HYYA 4E13A 3HUMA 4OF4A 2O8NA 1YCHA 3PPYA 2B4YA 3BT7A 3V00A 1O5TA 2FETA 2YC4C 3I4FA 3ZWBA 3KSMA 3IPRA 3F4BA 2GHQA 1G6OA 3UAZA 5DBHX 2PAAA 4FFBB 2DQSA 1NRJB 1SOUA 2C5EA 2BIFA 4IGFA 4EECA 2H36X 1T4MA 4HGPA 4JN6B 3EXEB 2R62A 4E7PA 3R6DA 5MN6A 4GI7A 4R9RA 3SXJA 4MA5A 3U4AA 1ZOOA 3PC8A 1JDSA 3SYNA 3WXMA 4EHAA 4Q47A 4HNSA 4M9UA 4HWKA 4OHOA 1C7EA 1NDHA 1XTPA 5FEUA 4JBGA 5IUKC 2ID7A 4PVCA 2FUG1 2DR3A 3J7AC 5DMXA 2Y1FA 4UXIA 1D4ZA 2PJRA 3KB1A 2BEWB 2O20A 5K8JB 1II8A 4M9ZA 5JDCC 3H5AA 3F3YA 3MERA 3P96A 5TVKA 2YIMA 4KXVA 2RJNA 5C3MA 2C8VA 1J26A 5KQMA 1RYBA 1VI2A 1QGDA 3HJUA 4G5RA 2XVMA 1MEEA 5EP1A 4D9KA 1TKCA 2Q5OA 2CHFA 1Q14A 3CT4A 1KZ1A 4K6FA 2G06A 4MAMA 1ZYUA 3RO7A 4A92A 1LPSA 4HTGA 1XPJA 2ECOA 2IYLD 3ZEAA 2WCC3 4BHCA 1J42A 3M89A 1X7WB 5DULA 2NNLD 4M99A 2GN9A 1ZR2A 2AD1A 4QXMA 3FIJA 5H7XA 4CM4A 2YOFA 4ERNA 4QSHA 4GKJE 1I14A 1SZDA 2V5AA 3C7CB 4QL3A 4TV9A 3V7UA 3WZMA 2JJ1D 3EXG1 3SEAA 4GEQB 1WXFA 1I4TD 2Z1DA 2EKZA 1EZ1A 3KJIA 3QVVA 4G1BA 4KN5A 4WZBE 1B41A 5CLHA 4B4VA 1TVKB 1VKZA 1X39A 2OK7A 4QX6A 1MC5A 1DTSA 3NTUA 1U8AA 4Q9JA 2OFWA 1QHNA 5HK8A 2LIPA 3GBVA 4E07A 4YMGA 1YU6A 4CMKA 1ACJA 2GGSA 2VF1A 4NCBA 2JIBA 5BWBA 2ZW9A 4N6OA 2X6RA 3A1TA 2O0HA 4ZVMA 2WNSA 1LV8A 4KV7A 5DNUA 5J40A 1UMDA 2W0SA 4MITA 2UUBB 1U7TA 4FIZA 5DGHA 5K3DA 4QRDA 4CTKA 4IQ0A 5A5DA 4E6EA 1XFAA 3I6YA 2XMZA 2ENCA 2VH2A 4EY4A 4K8RB 5LB2A 5JJBA 4BMXA 2QTHA 2EL5A 3LMLA 3HI6A 3I23A 3QVGA 3W4JA 1RC7A 3IIKA 2CL0X 4A7PA 4C89A 2H31A 4IOMA 2ZBPA 1I94E 4X3OA 3OKAA 3RROA 5BY2A 1QKJA 1SO8A 4EW6A 1GAXA 1BX3A 2MSNA 5DV9A 2VQFE 2D2VA 5C52B 1X9IA 2P6RA 2I7TA 4LE1A 1O9BA 2XLBA 4RANA 2AW3A 2RHWA 3N5CA 2WSMA 4LZZA 5BQPA 3JWPA 4MQ5A 4YLGA 3RVNA 4BKMA 5IHPA 5JJ5A 4LF4E 2FZ5A 4ASUA 3AWIA 4KOAA 4LRYA 2AE1A 1TL7C 5ED0A 2OFPA 2ZSJA 5FLKA 4PG8A 2B8WA 3WC4A 1KOGA 5B7GA 1M6YA 1J8YF 1LBIA 3L4EA 1XVTA 4H77A 5COBA 3HSKA 4MXDA 5FPTA 3VDQA 4JU8A 2VRBA 2CHVA 1ZCFA 2BWJA 4P54A 5AHRA 3LRXA 5DXAA 2WWWA 1ONSA 2QMUA 1NDQA 4HY3A 3VJLA 5HTOA 1N9GA 1F9EA 2P2LA 4HN2A 1UIRA 3GDFA 1GL7A 1PTJA 4PEVA 4XWKA 4RTMA 2FLWA 3QTBA 3V2GA 4JR2A 3KQNA 1G64A 2A5FA 4GPIB 3MWEA 4X8WA 2OBNA 2OHIA 1IY1A 1C9YA 2OXEA 4JC4A 1S01A 2Y93A 1QMGA 4OXYA 1CDOA 4L8WB 4XASA 3SNHA 2IEBA 4CLEA 5KTSA 4LPKA 4G9EA 1ZQ1A 3BHJA 3E0QA 4R2LA 3AUYA 5E7MA 1E1DA 1P2UA 5GZ6A 3UXMA 4M9XA 4V0OA 2B4AA 4PLPA 4MZXA 3WGQA 2IA5A 4B33A 1N3LA 2G4CA 4QU8A 1DQSA 5IABA 1Q0QA 1JMVA 3HR7A 4H7HA 4IVPA 4AJLA 4TUGA 3S8YA 3NM6B 2JS7A 4FE7A 4V03A 3CTMA 1N5DA 3F78A 4O4JB 2IXFA 5EGNA 4BN0A 3AB7A 5DLDA 1ZX1A 4PRZA 2HWKA 2YS7A 3FUXA 1HI9A 3Q5DA 3N05A 3I73A 4EKGA 3HPSA 3A7DA 4UHFA 4HB2A 3RJ5A 4WHMA 4F8JA 4D43A 4N0DA 4G0QA 3IX7A 1I9GA 3ZWXA 3PCRB 3U7EB 5AVXA 4GZ6A 1BVHA 1ZO8A 2DY1A 2WYVA 3TAUA 2W2LD 4RENA 1I80A 1P4JA 2VYND 2QPAA 2WFLA 3C7AA 3FFTA 4JQOA 5U4QA 1ORRA 1XWWA 5A2GA 5LMZA 5IH7A 5LUAA 4TVOA 1P6UA 5KQRA 4MH0R 2ZB4A 4LTDA 1NUHA 3UJAA 3ZTYA 4AKTA 1Y89A 4C6RA 4CV1A 1QE0A 3D3EA 2I54A 1J9EA 1QX4A 1PHRA 2E5LB 4KHZA 4AVYA 2AYXA 5HKKD 3K0HA 2C0CA 2VHYA 5THQA 2PL5A 5SY6A 2A9RA 4RU1A 1N77A 4PYJA 3U9SA 1T4CA 4BNUA 1CB0A 3BF8A 3TECE 4HUQB 2QGNA 3ZW7A 1UBLS 2XA2A 3G79A 1G0NA 3MCAA 1OBFO 2O4CA 2DT8A 2V0NA 4Z8XA 2CXQA 3PTAA 1OX4A 4J0CA 1SUFA 1IZ7A 4FWIB 3GA5A 2W70A 4EY6A 2ZIGA 2KW5A 1Y5MA 1WVIA 2IYUA 3I5UA 1P2VA 3JASB 4HDMA 5GONF 3HDJA 4KDCA 2X8AA 1X77A 1FVXA 3H2BA 4H3VA 2F1HA 4RABA 3C43A 1M74A 4GG1A 1M8KA 3D8SA 4XI9A 5AKXA 2I6FA 5D5HA 4OVKA 1H6DA 5B53A 2W71A 1O94A 4MWZA 3T7SA 4YA6A 3I83A 4HXGA 4WLUA 3ZJUA 4KR6A 4IEIA 3IAXA 3VNUA 3RVKA 1F3LA 3CPSA 1AJEA 2C4KA 4KTTE 1AURA 3ZIUA 1HFWA 4JX8A 4EX7A 3AI1A 4ZQBA 3DVQX 2A1TS 2W00A 4DIUA 5JDCA 2LPMA 4C3OB 4CNQA 2GFQA 3BRCA 2GK4A 3ECSA 4HAXA 2ZEJA 3C3YA 2UYOA 621PA 2DERA 5F33A 3UATA 2Z6VA 1N57A 3V1MA 3E8SA 4C7XA 3L0CA 2W2XA 1Z5WA 2ZAGA 3DMHA 3QUTA 4G1CA 3OAAD 4DWOA 3PI6A 1CQPA 4P3KA 4ZOAA 3HCNA 4QASA 1BJKA 1M2HA 2EXXA 3LIPA 4QOJA 1NJ1A 2FXVA 2E3JA 3G23A 3SX2A 3QF4B 2WI8A 2D4AA 1U2SA 4MVJM 4PX3A 2F8SA 4X8HA 4B34A 5FNVB 3BTUA 3MBOA 2B82A 4O5GA 3AYXB 3CH7A 4O08A 1UHZA 3GIDA 1M1UA 3R3UA 1P1HA 3BIJA 1P74A 2O2EA 3U4DA 2BGUA 4PZAA 3EQZA 1E8DA 5GADl 1L4MA 2BC9A 4FQ7A 3F97A 2YQ5A 3KZMA 4I14A 2H1CA 3PNMA 4BAZA 1TEHA 4CI9A 3AL3A 1E2GA 4M1EA 3S29A 3PQ4A 3G9ZA 1M6VA 2PMKA 4PZEA 1QIMA 3I37X 1XRJA 1B93A 2C8KA 1KI2A 5E9JA 2AFHA 5BYBA 4DUZB 4TMYA 4RTLA 3PFBA 2FE4A 2H54A 2RAUA 4N7MA 2E7ZA 3ZWDA 3SWWA 1YSCA 4RK6A 1SCBA 2NMVA 2F4NA 3GT3A 1AAYA 3TKYA 2QMHA 3H05A 2Y66A 4B09A 4ZMBA 1YFJA 1V1MB 2Q5HA 1W29A 2OP1A 2P2GA 3GEHA 3IALA 4AL4A 4CIDA 2C5LA 2WZCA 3OF2A 5A0FA 4CKCA 1HDOA 5JNWA 5K09A 2FR8A 5L3SB 4DA9A 3PXBA 4H1UA 2QTVB 3WISA 1DV1A 3IA2A 1EFTA 3P4XA 1FK8A 2Y3IA 3QNMA 3RG2A 2PVSA 4DV0E 4RSGA 3CGGA 3CNNA 4FSXA 3W0LB 2I1LA 5DSZA 1O0WA 5EIWA 1FMJA 4RPJA 3G2LA 4NU6A 4A27A 3DV0A 4XJVA 4IH1A 2MDTA 3ADLA 2HIMA 1YI1A 1MH1A 4RDIA 1VBNA 1AX9A 3MHSC 1UPCA 1PEAA 2YN4A 3PITA 3UK1A 2I29A 4MRMA 3RKSA 4DQVA 1V26A 3AESB 4J0IA 4GZNC 3THWB 1OX4B 1COZA 3R0IA 3GGDA 4Z4QA 2V7GA 3L0BA 1DWOA 4TUIA 4DZZA 2DH5A 1QBKC 2ZSDA 1IN8A 3EA0A 4JLVA 3AKDA 3OQ1A 5LA6B 4J2OA 3TKLA 2MIIA 3VFDA 3VR0A 2Y0CA 1KMCA 4P83A 4B17A 1AQJA 3DMTA 3SBDA 4DBLC 3ND5A 3WHKA 4P80A 2EM4A 3VMFA 5JSZB 1U4NA 4D26A 1CUYA 1V37A 1Z62A 4YHHE 1DAPA 2Y05A 3IBTA 3M9LA 4XR9A 4DDHA 4EF6A 1SCJA 4NC9A 4QOGA 2O7RA 2PQ6A 3KX2A 1NI3A 3GEGA 4FZRA 4HWTA 4Q7EA 2BMWA 4QJ5A 3NHZA 4IJUA 4YCLA 2H2GA 5GP1A 2A9PA 4BQEA 3E23A 3TEMA 3WDKA 2OCAA 1F4VA 4PQFA 5CEJA 4OHYA 1CS4C 3O38A 5EI5A 2EJ4A 5JIBA 1U5BA 1DCMA 5TEWA 1A9RA 4EMSA 1L7DA 2NZYA 2RMKA 2XOXA 3HP4A 3KVNA 5DWDA 1DBQA 5H80A 5BSKA 2UV8A 3JATA 3MTJA 1IC6A 3DEFA 3OKPA 2CFIA 4OK3A 1UKAA 1UT6A 4P4NA 3BD8A 2HC5A 5TSDA 1RS0A 2ZQ5A 3WGHA 4OAQA 3NHFA 4RTQA 4D9GA 5IEJA 3PX7A 3KQHA 3BCSA 4MIOA 2HF9A 4UDNA 4LMPA 4OAPA 3TOCA 4QZVA 3IFSA 4J7CA 4YXWD 3COYA 4ME6A 1UJCA 4IINA 3FUWA 4JMPA 5TVGA 4HMPA 4HK4A 1I7SB 2WK1A 4B9EA 3CUTA 4OGKA 4EGAA 2CDAA 3LJKA 4WFQA 3SNKA 4B8WA 4C2BA 3RW9A 3RFFA 3ILSA 2YIVX 1VHLA 1VLVA 4HNGA 4R8MA 1NVTA 1P7YA 1U9IC 2RAVA 3L43A 3W2EA 1JILA 2J6IA 3D3JA 4EMTA 2X9VA 1CRWG 1IY9A 2MMGA 2XD4A 3CW9A 4X7PA 4GLJA 4N3GA 5BRJA 4FBMA 3KNZA 4A1FA 4EHKA 5C8YA 16PKA 3JQGA 3UWDA 4ZEVA 1WD5A 5BOSA 4GZLA 4U5XA 3TH5A 3UV7A 4WY5A 3D2AA 9ABPA 5IBPA 2HMWA 3MT9A 3ZE7A 4XUCA 4DLYA 2OBMA 2PSFA 2J30A 1JTEA 4D44A 1LDBA 3CNBA 4DDMA 1IJBA 5CFNA 3GGCA 1LLUA 5IXYA 2PUAA 3AVTA 1HFKA 1VC2A 3EW7A 5BPFA 3PDCA 2UXCB 1ZCZA 5EMHA 4WPGA 1NI4B 3IMKA 1Z06A 2E4AA 2VDPB 3BUSA 3QWIA 3OA0A 4OHCA 2ZWOA 4GLFA 5CNKA 4ZKEA 3V1YA 3MXOA 2XOEA 1NVMB 3AKEA 1SU6A 4NAVA 3KOMA 3O94A 4I5FA 1FDRA 4QU0A 4R3NA 5AW4A 5ITZA 1KI6A 4ZYGA 1J7KA 3K5WA 4BJ6A 3NM5A 3I45A 4REMA 3HWX1 4RIEA 1GITA 4RZ3A 4OK6A 5FBVB 1NXXA 1Y6ZA 3H0EA 3I04A 3WA6A 4CQMD 2GA8A 2XCRB 1XHLA 2Z6AA 1OJ7A 3KAQA 4OJTA 2P2SA 1S2IA 1A4UA 3G2KA 3WB9A 1JQ3A 2YZKA 1SCQA 3FLAA 1XU7A 3UFBA 2ZIXA 4AY4A 3EZ2A 1QFSA 1PVDA 4E4RA 4ZI7F 3V32A 1HEUA 1T2DA 3IUEA 5B36A 2PKCA 1OVGA 1SVWA 2ODEA 2H4XA 2WHRA 3LDGA 3O9VA 2RE8A 4CEHA 1QFZA 3HH8A 3IPAA 1XDBA 1BU5A 3FRHA 2AC2A 3KD3A 4BJ1A 1PQWA 2QN8A 3FSEA 4UBOA 3QW2A 2OZEA 3AETA 1O95A 4EKNB 2ZSBA 2ZYTX 2G9RA 3JQRA 2QX8A 4YI5A 3IB6A 4GR4A 2CV2A 1W85B 2XQIA 4KIGA 3MMXA 2WWIA 1Y4UA 1M2NA 3A0UA 3DE2X 3DOCA 4PYMA 4MB2A 5AJVB 1YQXA 5F98A 1MMFB 1Q5PA 4FM9A 3LVQE 1SIUA 3KEMA 4MQEB 2X8JA 4P2BA 4R2JA 5JC8A 3OZCA 3H9EO 1MDBA 2QE6A 5I45A 5J4HA 1KJQA 2QRVB 1DNPA 1GUAA 2Z3ZA 3ENQA 2FPPA 1R6TA 1PZXA 3PQFA 4AY6A 4QHTA 2IHNA 5T4FA 4LAFA 3BPSA 2VF2A 3FKQA 3KC2A 3CUYA 3M5DA 4I2VA 2XF2A 1X6FA 1JVBA 3PJDA 5AHXA 5G4LA 1QIDA 3HN2A 4Y1FA 3VO1A 4AF6A 3WB0A 4NZ9A 4FZVA 1XDZA 1PQUA 4DMIA 2XMDA 2ZRFA 3DEIA 1IJFA 3IO3A 1Z17A 1CEYA 2HSZA 5TJHA 4LXXA 5ALNA 3TZQA 3ICEA 1G8SA 4JI5B 3HB1A 1THZA 2FPOA 3MG9A 1RCFA 4BKUA 1ATIA 4ARUA 1G17A 4MR7B 4DUGD 4P86A 3O2NA 4F5YA 2FW9A 2I71A 5EKXA 1QV7A 3M4ZA 5AQEA 5HYVA 4O4LF 4YJ2A 5A1TA 4JL6A 3Q7EA 4F2HA 5HFAA 1JYSA 1UDRA 4GMDA 2Q7OE 3ZOZA 4M53A 2FQWA 1TB4A 4I55F 3UFXA 1D0SA 2FK8A 1ZJWA 1KJIA 1M5RA 1EE2A 4P34A 3PA6A 3F5DA 1Z2OX 4G0MA 2V8BA 2A94A 3CN9A 4WWHA 1AKUA 4DV6E 1DJOA 2IGTA 5JDIA 1NTRA 3L5KA 4C0KA 4DA4A 1MCZA 3OU6A 2UUCB 2WJJA 1HEIA 4NBKA 3E35A 4GOND 5JARA 4RTSA 1CXZA 3IT1A 4O59O 4RELA 5D87A 4BNGA 3C70A 2ACWA 5AI0A 1K7XB 1NJ6A 1E94E 2ODTX 2XRFA 4QQ8A 3T9CA 5KVSA 2EKLA 1UMBA 3HCDA 3LL7A 3N87A 3KYDA 3MFQA 4MKGA 2EPUA 1Z47A 4CHTA 5G2OA 2E5WA 2DAPA 6CHYA 2J1LA 1J90A 2R11A 1VMDA 1HG0A 8GPBA 3IV6A 1H22A 1DUVG 3HC7A 3GEEA 3KQOA 5ESWA 1B8VA 4Z8YA 2WSLA 1TMOA 3GROA 3J7TA 1A77A 1ADGA 4D7AA 2CHEA 1L0BA 4H7FA 5CK4A 5K8VA 3N53A 5IKXA 4F1WA 5F12A 4IMIB 4K6GA 4QOEA 3EXIA 3QX7A 1JHPA 5KX5F 1ZRSA 3PFFA 3Q7QA 2GT1A 3NI2A 3PDHA 5DBIA 1QCZA 3KKMA 1JDVA 2IE8A 4TTJA 4OYRA 4GBJA 4E03A 4DTIA 4LNUB 1IZ8A 1M73E 3GW8A 1D9ZA 1M34A 3OCVA 3CNLA 4CEHB 1YE3A 2BY4A 3QEMA 2V6IA 1P3JA 1Z6PA 2ERYA 2XYQA 4HX5A 2EYQA 4IVQA 1U0OC 5B1HA 4N47A 5E4FA 4ETNA 1AQLA 4J0HA 1XTTA 3C48A 3GR6A 4ZVVA 3KLNA 3ZLUA 3KDAA 4ZJPA 4TZ0A 2CLMB 3HCWA 3ZCTA 4DR4E 3T3NA 3FA2A 3KZKA 4AX4A 2WFMA 2BJWA 3D7NA 2Q4TA 3DUFA 4Q9KA 4DTCA 3UOWA 4YMUA 4NYIQ 3ZBQA 1EWKA 3GRVA 3P0JA 2ZI3A 1L1FA 1FFAA 3FZGA 2CJWA 2JGKA 1JAZA 3KO8A 1N2HA 1NVXQ 2UVPB 3PR3A 2XGSA 2HO4A 3IAHA 4LMAA 2A5DA 3TE7A 3HY6A 5SYAA 2DUUA 4YDRA 2VJYA 2J7PA 2C78A 1P77A 2WF6A 3D3WB 4EPYA 1EXDA 2WAYA 1IXKA 2BHTA 1INLA 1IONA 4YRKA 1D4FA 3DJFA 2HRQA 3FUUA 3OFSA 4D8XA 4KPUA 1AZLA 4C3ZA 4YRNA 4RLSA 2JEZA 1OXSC 3BDAA 5CAEB 5DNYB 1HOXA 3IP8A 3SS9X 1YAJA 2HMVA 4ZYUA 4A23A 5T6JA 4TZ6A 1XZNA 4TS4A 1OAOC 1HBJA 2ZJ2A 3TLGB 2YTNA 1CZUA 1FDSA 3DAHA 4WAUA 4C2AA 2XCSB 1JMKC 1UANA 4YCBA 3SS7X 1WPRA 4XFJA 1YB1A 3JYOA 2PRTA 2KB0A 5G1PA 3B6KA 3TB6A 3VO8A 3P2OA 3CURA 3EMVA 4OH1A 4Y2TA 1AXEA 1SB8A 4GNRA 4QBHA 3LLCA 3QTTA 1IZ9A 3D8TA 1GQYA 3BQNB 2MINA 2VJDA 4JROA 4RHFA 2ZUTA 1PJZA 1OXUA 2YJ5A 4MMYB 3M6VA 2O0KA 3IMGA 3RRXA 3WQRA 3FNHA 1X70A 2HCBA 2A1TR 4MV0A 4DV4B 3CVWA 3CF6R 1R0LA 1G60A 3FLBA 3SC6A 2ZCJA 3P1JA 1SMKA 1WXIA 3D4NA 3D4OA 3MD9A 1RE0A 2F9LA 1WSWA 2HHHB 2RHRA 5K3FB 4LYJA 2AXNA 4R1LA 3SBOA 4G9BA 3OFJA 3WQHA 5F7OA 2NT4A 2WBSA 1J39A 4GFDA 4IAOA 3RPEA 3COVA 1BD3A 2VZLA 5E1OA 4E1VA 5BSEA 5J59A 4YQZA 2O07A 3UTDA 5LIRA 5F76A 4BBPA 2PUBA 3KZCA 3HZHA 3S40A 3PPIA 2XVXA 2J3LA 5F4BA 3GFFA 2JI7A 4OQPA 3TLEA 5K99A 1T2EA 5HCUA 4RA6B 2IRWA 1L3BA 2YNMC 3EMKA 1N2GA 4ZT7A 5C8YB 4ARIA 3OICA 2AIRA 2XUGA 3NIWA 5CX1B 1XX6A 1NI5A 1WBDA 4DQKA 2AMVA 4TXJA 2HTFA 1SURA 1RBMA 2V7WA 1FFXB 5CH8A 1YR8A 3CX7A 1PGNA 1C9JA 1DINA 1Q1NA 2PWBA 4E94A 3NYRA 2DHRA 3BE8A 1ST2A 4IDEA 4IYJA 4Y2GA 4YASA 4YP6A 4HVLA 3G8YA 1YB7A 5C1BA 3KS9A 4C4OA 2DBRA 4HTAA 2JNWA 4CMJA 4MI9A 1B69A 2I6QA 2R8PA 5HEKA 1ZHOA 1BBGA 1Y34E 4OQFA 4K5QA 3G0GA 5J23A 1YZGA 2SKEA 1FYFA 3ZV7A 3VPGA 3KJQA 4ZGBA 4DV6B 4YLEA 2NTNA 1BWSA 3DAPA 4PHCA 1GPH1 4H59A 3N8DA 1C7RA 3SLRA 2PLWA 3NHBA 3TSAA 2CYBA 5HJ5A 4AKIA 5CHYA 5TMBA 4D0LB 3ML1A 3LF2A 1TC1A 1XXHB 1PX2A 2P0AA 4JA0A 2YZGA 3ZD6A 3QMPA 1GV1A 3GUYA 5PNTA 4N65A 4TKMA 2VS1A 1E20A 5I51A 4TS3A 3BXXA 5HIAA 2ZJ7A 1JYEA 1K6MA 2EYUA 3GD5A 4LJRA 4W1QA 2ZKIA 2RI6A 5KVCA 4KYUA 4QXQA 1PYDA 3DAOA 3S28A 4EB8A 5F5LA 1VYHA 3MXTA 1W0KA 4TLAA 3UXEA 4RK1A 1RXSA 1E92A 1JE1A 4UUOA 5L6LB 2CXHA 1PSZA 5KREA 5L3VA 4NXMB 4E21A 1T9HA 1Z7GA 3V8VA 2O0JA 3SHQA 2C99A 2YT4A 5AJTA 4YBZA 2ZR0A 5IHXA 2HXSA 1OXVA 5LMUB 1UP7A 3DVSX 4WOBA 4O4LB 5CXUA 5LWQA 3WHPA 2NVWA 3IUNA 4HEA6 4ZHSA 2Z4TA 3NX4A 4HNVA 3HUDA 4QXOA 4RTOA 4JJ4A 5LR6A 2R5FA 2ZZKA 1N0UA 3L3BA 3U44A 1V6SA 3PQEA 1GYRA 3GMIA 3LGAA 3SC2B 5HFJA 1E0JA 4N01A 1QQBA 2GUWA 4R03A 1E60A 1NW8A 3H1FA 4YYZA 4UMEA 1II9A 4WYQB 1ZA1A 4FK5C 2EMFA 4KMOA 1AS0A 4D8TA 4CETA 4DNXA 3IVXA 1DCKA 4O43A 2GBPA 4KIWA 5AJUA 1EUDA 1GILA 1RYEA 2R1VA 3INYA 1F20A 3PL1A 2GM5A 3INNA 1ULUA 1Y7IA 2FJ0A 5BW6B 3F6EX 1ZLYA 2MYPA 3FGZA 4A6PA 4Z1MD 5JHHB 3L1VA 1WUIS 3IOYA 2UXBE 3IH5A 3LW8A 5CB4F 4CQMB 1LVGA 1XKXA 3U1BA 1GKIA 3CNOA 2O1XA 2JIQA 2Z6UA 1PFQA 2VAPA 2VP3A 2VCYA 3PUIA 3JD1A 4LFAB 3GFSA 3OZAA 3TFQA 4B6GA 1ZD1A 4HYQA 2ETXA 1M8GA 1NBWB 4KXYA 4MQMA 3ZFRA 4RORA 4LF5B 2XF8A 3LXMA 3LPLA 1F17A 4X9JA 1FZQA 1TFRA 1WKCA 3B5EA 4RM2A 4YS6A 1NW5A 1O9GA 1F5SA 2DSTA 1Y48E 5AXBA 1H1TA 1FPQA 5CYGA 3QLJA 3TL2A 4EFDA 5JY1A 5ISMA 4FR2A 1E1KA 4OB8A 4Q1DA 4FEEA 3PFWO 1ABBA 4OGFA 2PUFA 3TB4A 3V4LA 3TR6A 2LUOA 4C6SA 2DY0A 1GWNA 2Q5CA 3DL0A 1SFRA 3JQEA 2CK3D 2YY5A 3MS2A 1Y9DA 1ISJA 4FGLA 4IMRA 4N9QA 3ZXYA 1LNQA 4I50F 4PYRA 5DT9A 4ZOBA 3CF4G 5A71A 1PI3A 4LXTA 3GEIA 2WE7A 3GGSA 2AA3A 3M99B 2FMIA 3K5HA 1PJ3A 5DTQA 5HMLA 4I3GA 1KR5A 1P8AA 4LJAA 4R2MA 4OMUA 5T4EA 3UT6A 1EM6A 1X7XA 2ONKA 3M6UA 4FFNA 4Q93A 1VSBA 1XLWA 4ZEXA 3T3GA 3HADA 3HM9A 3BREA 2VNHA 1WZ2A 4LPSA 3WYGA 4INJA 4M9VC 3EVGA 1VJRA 2AG8A 2C77A 2IY8A 2R1TA 1JRLA 5DEIA 3EXIB 4KL8S 3TW4A 4LSZA 4EG5A 4C29A 4A10A 2B9EA 1KJ9A 4ZQCB 1KEUA 1QH8B 2J6HA 1JFVA 3C3KA 4X1KB 3RJ9A 3TQHA 4B83A 2YR0A 4CKWB 5IT4A 1QYIA 1Z6XA 1USUA 4MV6A 1TEVA 4I6GA 3G1TA 4DN6A 4XGQA 5KSWB 1T4LB 1HTWA 3K3PA 2PGJA 4BVKA 4CT4B 2FE1A 2ZCVA 2WSBA 4V1CI 2F1RA 1V3TA 1FU4A 2C8LA 5CDHA 1PTJC 4JVNA 2QD2A 1J5XA 4CKZA 3LS2A 4LCJA 1E89A 4CYMA 1K7EB 5DI3B 1PZHA 5K0JA 1SZPA 1XZHA 1NPDA 4NESA 2BRUC 2G6BA 2NQTA 5F64A 4G97A 3ZLJA 2F1KA 3FPSA 3HP7A 1KYTA 4ARCA 4KQMA 5KAMA 3SFZA 1FZTA 3SQWA 4ZO7A 3RBZA 1VE7A 3E05A 3LK6A 1DB3A 4D0GA 1N2CE 2R2GA 5B58T 4BQOA 2ZQZA 5DNVA 2G9VA 5FPHA 5LOVF 3D5QA 1TF2A 4CLOB 2LDBA 3GZJA 5HJEA 1A7UA 2H0QA 4AUNA 2HCRA 2ZWAA 1S9DA 4I8XA 3K0SA 1WOYA 4DM4A 5FQNA 3FPCA 3OJ0A 4MQUA 4OHPA 4R84A 3ZY3A 4P31A 2WTEA 3ZV6A 1Z5VA 3MUFA 4R8RA 1H94A 1O8CA 2AE2A 5EJ6A 1JG4A 4EA7A 2AEMA 2FPGA 2GPWA 2IIVA 3A9TA 1MW9X 2OM2A 2ZROA 4MV1A 3QKIA 4LDZA 3RF6A 5BN4A 1Y8QA 5DHFA 3LT5A 3NHKA 4CPDA 3MW8A 1A1LA 1KERA 2DHEA 2JAXA 2VP0A 3L04A 3QLTA 4ZREA 5FPQA 3TBHA 2Q1TA 1WE2A 4Z9AA 3JD4A 3I5MA 5FUWA 1NXVA 2WSYB 1ODKA 3P0HA 3IBCA 1KNXA 1NW9B 2A9FA 3ISVA 5HJ7A 2PL3A 4D74A 2R66A 3GLIA 1KGSA 4IR7A 3QWBA 4TT3A 1GPNA 3Q15C 4KYTA 3EDMA 1T8TA 3OECA 1KAEA 5F4ZA 2MINB 4FDUA 5L3RA 1FXWF 2ZJ3A 5A6SB 1J8MF 5P21A 3HHPA 3P7MA 4EUNA 3LUPA 1R8YA 3E48A 3L0DA 4I66A 4O4HB 2NXNA 4J75A 4J1QA 5I9MA 1JDBC 3ZBUA 3ZGYA 1M9NA 1W6UA 1WIWA 5DNEA 3AF6A 3OM9A 3TSWA 2PWZA 4WOPA 1Y4AE 1BG6A 3KWLA 1R66A 1EH6A 1XAGA 2B25A 3QX8A 2DJIA 1LY1A 1YJQA 1PT6A 2ZRPA 2BLLA 3PFHA 4QT0A 3V9PA 5EFOA 4AP5A 2F17A 4PM4A 3TPZA 1KH1A 2PH1A 4P82A 1EFDN 3GAAA 4RZSA 1QV6A 5IJ9B 3QRWA 3VYYA 4DJEC 3OJWA 2HGZA 3BSWA 4LZAA 1BFUA 4RH1A 2VNIA 2WBUA 3GUHA 4PG5A 4ZO8A 3S99A 1DAKA 4A91A 2ZRAA 2ZZNA 2V8QB 3SZ3A 1E4YA 1OBHA 4LBVA 4LJLA 5GV8A 5TQ2B 2OYSA 2H92A 1NDUA 3TG8A 2Y92A 2YOGA 4L15A 4IIJB 3FWYA 4KQKA 2FMTA 1WXDA 2FJUA 4XTRA 4XYBA 5FNZA 3V6MA 4GSKA 3V8PA 5LP6F 3V2IA 5M7EA 1F0PA 4RVOA 3UAVA 4Q7MB 4NYMR 5K0BA 2BTOA 2C4VA 3X1JA 2QPLA 2WPDD 3H2HA 5A3RA 3J81A 3P5SA 3LBNA 1L5NA 4GO1A 1RHMA 5BMVF 5F3WA 1WPQA 1GYQA 3LQRA 3MT7A 1E7WA 4DG9A 3F9RA 3YASA 4UQPA 1KDTA 2SECE 4L73A 4CN8A 2Q49A 1EGHA 3HYTA 3DMRA 1IY0A 1D4AA 1UAGA 1P9RA 3C45A 5ERYA 2JATA 2QK4A 1JWLA 3NBYC 3QPUA 2AJ8A 1UM9A 3BKWA 1H0HA 5CEFA 3H1BA 2HRCA 4GM4A 3K6SA 1RAHA 1Y5IA 1VFNA 1DARA 2G5TA 2ZR7A 4EO7A 1BW9A 3EVTA 4QC2A 2IT1A 4YMIA 1I6MA 2J3IA 3ME5A 1BU8A 3SZLA 2EQ0A 3A7EA 2EPPA 4TYNA 4CCWA 1S02A 2EW8A 5FL7A 1JT2A 2X0DA 1AGRA 3DV0B 4UM7A 4UNSA 2GX6A 1T2VA 4HPJB 1SKBA 2JD0A 4FS3A 5K51A 1MPXA 2HPZA 3NP7A 3TLAA 4TTVA 4C05A 1K97A 3GDWA 5CDFA 5BOSB 2FOIA 4GMHA 4R81A 3SYRA 2Y6VA 2Q2QA 4I9HA 1M1NB 1GKUB 2GZSA 1MJHA 1T4GA 4IIEA 4MW4A 1KIAA 2ZSIA 4WN9A 5BN1A 1M0EA 3UOGA 4HUJA 3RV4A 1NFRA 3VNSA 5FP0A 3QOYA 4JQYA 3RYHB 2EG9A 1H85A 3C5WP 1JG6A 2FN8A 2O2JA 4FQ8A 4UE3S 3TTTA 1NY5A 3QKSA 3TX6A 1HDZA 2JRCA 2OCLA 3DHYA 5CXXA 1JA0A 2YINC 1SBZA 5CDSA 1NQWA 1GHTA 1ZJ4A 5JSZA 2EPAA 4DV5B 2YJGA 2GBLC 3L8EA 3MJ4A 1CHNA 1XWFA 5IAKA 1POWA 4DY4A 4WESB 4YJ2B 4ZCRA 3RUFA 3KALA 1CY6A 1II8B 3WGLA 5BP7A 2DLKA 5LZ4A 2QI9C 2EOQA 4GGOA 5AKIA 3BFKA 4CLRB 1SQSA 4R1OA 2XW6A 3WLTA 5DHQA 3KZZA 3G6WA 1JHYA 4KIFA 4XEHA 2JFGA 2G28A 2AF4C 4YO8A 2N0SA 4M1TA 1NHGA 4IGKA 5EC8A 4RK7A 3MA0A 2VSQA 3DBOB 2VG8A 4IOJA 2QN9A 1NR1A 1A1HA 3PXXA 4O33A 4YRLA 2N3ZA 4YRQA 4YRDA 5BNTA 1N5OX 2J9FA 1CY7A 1AHIA 2CLSA 3V46A 4D57A 5L4SA 3BWEA 4L9SA 4EATA 2YHUA 1XVLA 1FFWA 3L6OO 1LRLA 4CF7A 3PNYA 2AQKA 4WK2B 4M8KA 1B0ZA 1D7AA 5T6MA 3A4MA 2QV7A 4BC0A 3JS5A 3LQYA 5ALOA 3W9BA 4ASUD 4AX8A 1K5GA 3H4TA 4L07A 3WJAA 2ISCA 5FYQA 2Z9BA 4QSMA 1J4AA 1DEOA 1YB5A 1BMFA 1C1YA 5DYIA 5FBLB 2OCPA 3B1KA 3QZUA 5C3UA 3JYLA 5T8KA 3UT0A 4REQA 2JH8A 4JR1A 1UBNA 4BLQA 1K6IA 5K8TA 3WGIA 4DHEA 5CP8A 1F14A 1E5TA 1XZEA 4I46A 2EN7A 2WDZA 3K8ZA 3OTIA 2FQYA 1EK1A 2YWEA 3GCXA 3QWFA 1VCHA 1ZIPA 3QHPA 2F8LA 4HEQA 1J70A 5C18A 2P67A 5ICCA 1BHQ1 1TYCA 2ET6A 5JS1A 1E3QA 1KI4A 3I2YX 2YZNA 3KWRA 1NW7A 3MJSA 2RC6A 1IHOA 4ZAYA 2NV2B 4HO1X 4M8LA 3Q87B 2WFAA 1MHTA 4AS1A 3BFVA 3BZUA 2XUZA 3Q3HA 3RVQA 1KBZA 1PD1A 5AVRA 3ZDEA 3OY2A 3UC5A 2O9JA 3H2IA 4C04A 2JGEA 3NHMA 1P7CA 4BE7B 2PPLA 4LS3A 1WUYA 2R4UA 3AEUA 4HQNA 5EJ2A 1RWNA 3MTBA 2W6PA 4B44A 4L3WA 3GEMA 1ODFA 3L6DA 2ONZA 3AW9A 3DOEA 1N5LA 3PI7A 7REQB 4O4JF 4V0KA 1NMSA 2IHZA 2V7VA 4Y9UA 3ZWKA 1W76A 2LTSA 5J3JA 4H4CA 1T8RA 3UVEA 1L5KA 5JXGA 4R5HA 1NUTA 1NW6A 1DKNA 1BFDA 3AM1A 2FZCA 4UOEA 1PIWA 1IQSA 1UOEA 4NNPA 1GPKA 4KTVE 2YZ2A 4K87A 3T52A 4JJKA 3TLYA 4LUCA 4WE3A 4JXKA 2VQDA 2C7PA 5FWYA 2JI8A 3O83A 3L6CA 5KYGA 5AK6A 4YAKA 2CZGA 1WV0A 3CUEF 4WN9B 5U1PA 3RSLA 1PUXA 5CDYA 1WEHA 4HDKA 2I65A 1RMTA 2G9ZA 4ABYA 2ASEA 4GKVA 2B2XA 3AC0A 4MEJA 5E0KB 1C9DB 3IA7A 2LJHA 1VCNA 1G3MA 1RACA 3IEPA 3VZRA 1SY7A 3NUZA 3GCGA 4K6CA 2EIXA 5ADHA 4F7DA 3B52X 2ZT5A 4BBAA 1QIFA 3HCAA 3ANYB 1ZBQA 1UILA 2HADA 4O5OA 1QFYA 4YUWA 3DWGA 2HMAA 2PGAA 4WKBA 1D1QA 1JG7A 4UEJA 2AOWA 3O91A 1Q1EA 1YFLA 4CEIA 4LEIA 1P5FA 5EWLB 3GQBA 4DCNA 1X80B 1PL6A 2IQIA 1TUEA 3AGQA 1KE2A 4LJ8A 4QPNA 3QYJA 5MFZA 5AI8A 1CBUA 1Z34A 2A84A 4LHVA 3QVGB 5HF8A 1LS6A 1TOAA 1RLTA 1NQUA 2NADA 2XE8A 1PT5A 5GV7A 2VPWA 4WXDA 2EMYA 4RD3A 3VR5D 3ZHRA 3F96A 3LNCA 3EEIA 3OHSX 4NYJQ 5FAXA 2M6KA 1GGEA 3EFBA 3S1AB 4EW2A 2OXFA 4X64B 4R2QA 3W5DA 1J2JA 2H3EA 1M54A 4D9EA 1WBBA 1C9KA 1T9GR 2LV2A 3LCRA 4GX1A 3PXEA 2N3HA 4MCHA 5K0CA 2EN3A 2R7MA 4MVJA 4QUHA 3NEAA 5DXJA 3OSZA 3TDNA 4BKPA 3EA5A 2EN4A 4HNRA 1QP0A 3QPCA 1MJGM 2FWRA 1EJ0A 4LRSB 4DT1A 1YE8A 1YFZA 1O6CA 2C0QA 1A4XA 2EMCA 3HXLA 1T5HX 4ZT4A 3W6OA 5KNBH 3H09A 3GOHA 4LU9A 2PS0A 2Z08A 3MJDA 1G8AA 3HKCA 2HPAA 1E6LA 1OT5A 3OE1A 2HJJA 2ALJA 1SC1A 3GCDA 1WKBA 3VVBA 4HAWA 4D9BA 3G1WA 2VSXA 3PHGA 4F1JA 1WHNA 2XKAA 2NO4A 1R5JA 2XQFA 3PHCA 1E7RA 2HIAA 3EWNA 4R98A 3PX3A 4GI3A 4D45A 4EBBA 2DR0A 4FK8A 2CXXA 3CE9A 3LY9A 2AH5A 2QRPA 4N8DA 4UZFA 3GLSA 3ZW9A 5H70A 4ZXPA 3PU6A 1SWWA 4LQCA 1JH9A 3PF8A 3E2PA 1EFHA 2G09A 4F2PA 3UWPA 1WRJA 1EQAA 1CUDA 3HEAA 1E2NA 3EZLA 2CVZA 3HYLA 5LU8A 2YWQA 1XZQA 2JW5A 3ZHCA 2FRXA 4JLKA 3SKVA 4DS3A 2F8BA 4V0QA 4KSCA 3IWBA 5FA6A 3I9MA 4TS9A 3PFKA 3GN1A 4HWGA 1ZCJA 1R4ZA 1AB5A 1VA5A 3DE3X 4F96A 1E6WA 3P9PA 3ICCA 3W6ZA 2OKGA 2O50A 2W37A 3EDYA 2KSQA 3I58A 2B35A 2H5LA 3SSOA 3QJGA 1E4EA 1E18A 1QYVA 2R48A 1J9ZA 2MWMA 4X90A 5LQDA 3L7OA 3A1CA 1W25A 1WBJB 2CJXA 2H5IA 3T06B 2XKKA 2XE4A 4EKDA 2DMYA 3U49A 4ENQA 3ABQB 1T8YA 5EERA 4QVGA 3LMKA 4LRWA 4AJ2A 2Q46A 1VBKA 3X1KA 4C88A 1QTNA 2CE7A 2BMAA 2I6XA 3KQTA 5CB4B 1HY3A 3N0RA 1P62B 1YK0A 1EBBA 1QF7A 3A14A 1P1JA 5ALQA 3LL4A 3B1ZA 3T3EA 1BDBA 3OE4A 4DIDA 4CG0A 2RGGA 1Q44A 3IAS1 4EIWA 3AFNA 3HJGA 1UKVY 4DFDA 4E12A 3W9YA 1A5AB 1RWVA 1SUPA 2R8ZA 4FN4A 1A9YA 4J6FA 2AZXA 1J8VA 5G41A 1HDXA 3Q1KA 4HAUA 3MRSA 4CKEB 4OI0A 2J5BA 3ZOQB 1HX7A 3FAZA 4G5XA 4DDUA 4IY1A 1RLIA 4Z99A 1FTNA 4X66E 1KHHA 3MSCA 5LA6F 3SX0A 4AN1A 4UNNA 4RQBA 5E6SB 2RJ3A 4DIMA 1PK7A 1K89A 2AZMA 3ON5A 2B30A 3BX1A 3ETDA 3TF5A 5JQGB 3VK6A 2YTIA 1LA2A 2C04A 3LC1O 2XNJA 5BQ5A 2OXIA 3TBFA 3ZQ6A 4WPYA 1YS9A 4YB8A 2OXCA 3MGAA 3N0VA 4EK9A 3A05A 2HQBA 1PDOA 4NXNE 2FW7A 2IYRA 5KJCA 1OHHA 2O2ZA 1HF3A 5BSMA 3RCBA 2Q45A 5KYYB 5BN3B 3UHPA 3C5EA 1OKKD 1NKTA 2K4VA 4F86A 4M6WB 5ITVA 3MEQA 1E3WB 2VJAA 3ZDAA 1F1BA 3HEMA 4WK0B 1PZMA 3O4RA 1SC4A 1EDEA 3HJHA 4G23A 3FPAA 3TW8B 1Y9JA 3BA6A 5TT1A 3RFUA 4DMKA 3FDFA 2V7BA 5F23A 1B8PA 5K20A 3NH6A 1YRQA 1QRAA 1S2MA 3GY0A 4QBIA 2NO5A 1WJPA 4FGKA 2ZB2A 2X0FA 1Q0ZA 3VKUA 3VMMA 3JWGA 1BGWA 3CR3C 3ZE1B 2BFFA 1TCBA 1VTKA 1XGKA 1WV1A 4EY8A 3H2JA 4YXWA 4AT1A 4BS9A 4BMPB 2XXAA 2Q2NA 4MUMA 2BGIA 1S0UA 1GGFA 1V7ZA 3FZYA 1GO2A 4WNYA 4OG2A 4V02A 2IY9A 1QPZA 2FX3A 1CJUC 2X8BA 1DIBA 2X1MA 5HDBB 3SHOA 1W87A 5HUQA 4FR0A 3MN1A 3ZW8A 1SULA 5K8UA 4KG7A 1DLJA 2OYRA 2FPLA 1F6BA 1XMPA 3BDVA 3N28A 3ZFUA 4ER0A 1Z35A 4S1WA 2Z83A 3NASA 1JHDA 3OURA 4BQPA 4DABA 5F9HA 1S8NA 1TVEA 4HZUA 1VMAA 4PZYA 2O2GA 1E2IA 1JIUA 2OSVA 5EP4A 1NRWA 1DP4A 1E1CB 2FEWB 2OBLA 3D6HA 4DF3A 1QS0A 3AO0B 5J2TB 1DXQA 1JNXX 1CE8B 1SHKA 2ZT7A 3V4SA 4C4SA 4X8LA 2LVBA 2HHHE 4F2DA 2IYPA 3UWKA 1W5AA 4I99A 1NMXA 3CINA 4GOJA 4NCJA 5FWAA 3CNEA 3UMJA 1DFIA 1YC5A 4ZOQI 2I9KA 5AI4A 1UJBA 1PLLA 3DEHA 3PFNA 1CULC 2VP5A 2WD8A 2LO3A 2Q62A 3EISA 2E5FA 2B92A 4D2IA 4TSFD 1O96A 4I4TF 4CGZA 2XUKA 2ZRJA 3A10A 4Y9DA 3W6PA 3SVTA 1MGPA 1OMOA 1K08A 1UM8A 3P9NA 5F5NA 2DLNA 1JJFA 3TW6A 4GEKA 2JLXA 2VHVA 4PCAA 1AM4D 3IQDB 3IYLW 3BSFA 4LJ6A 4M8SA 5F2OA 2WWFA 4ZO9A 3BBPA 4YMWA 1H4SA 3PE6A 2ZFUA 4AU1A 1N36E 3LXXA 1KETA 1DAGA 4UCFA 1KC3A 4FMDF 1UFQA 3C3WA 4DCMA 2IODA 3VR6D 2MJLA 2WB4A 3ICPA 4IZOA 2CFCA 4BNFA 1AN0A 1WJGA 2CLCX 2GD6A 4G24A 1N2ZA 4RAQA 4AMUA 5CFLA 1CRQA 1LPOA 2XXBA 2N1MA 3FOWA 4GC5A 1R0CA 4DSTA 1SVMA 2EGGA 5H82A 1DIGA 1DEHA 4ZI5A 3TSOA 3VVLA 1GPLA 2WF7A 3H99A 3OESA 3D59A 4COKA 5BW5A 5KJEA 1OILA 1OFIA 1YBMA 2FQQA 1GNSA 1E1RD 4HF7A 2UXDB 1WP9A 2Q5EA 2PPVA 4L4XA 1LPAB 1WHQA 3HFRA 3H9QA 4F8EA 4KQXA 2I67A 1Y6FA 3NBMA 4EYOA 5HG0A 2QGFA 4L9WA 1QGYA 1R37A 1O95D 3QFSA 2B7BA 1A1FA 4CG3A 3RREA 3BXPA 3OMWA 2EFDB 2TMGA 3VYXA 1Y1QA 4Q37A 3C3EA 1JIQA 4L5AA 3IAM1 1K75A 4HLDA 3RNLA 1NF3A 4B3IA 2PSSA 4IDAA 4F9BB 2CNKA 1AV6A 2XB9A 4JJFA 2E4WA 5EWLA 2AI2A 3GCZA 1LRJA 3KSZO 2XNDD 4TXNA 1Z83A 4PO1A 1R6AA 5BWMA 4LX8A 1POXA 3Q0IA 5DTMA 1PN3A 1H1DA 1EI9A 3FNBA 2FRDC 1IB6A 3HCFA 3HCCA 4QGGA 4TT8A 1U02A 1Z4KA 4JI6E 4U7DA 1J22A 2I6SA 5KPJA 5IX8A 4LFCB 1P2DA 1WCYA 2QE7A 9LDTA 3DNFA 2F55A 1G2OA 4RNCA 2XUJA 5FI1B 1AD2A 4RMIA 2PKYX 3FYTA 1G20A 1U4OA 3KUXA 3WYFA 4AMGA 4JJGA 3RYCB 1R0ZA 2AR9A 3PXCX 5P8WA 1JBEA 3PP8A 1BJTA 3U7IA 1RRPA 3DVAB 3WNDA 4WN3A 3THNA 3T9AA 2H2HA 3DR3A 3HB0A 5FO0A 3FJ1A 3VNQA 3WADA 2JDID 4D3FA 3CRQA 1CZLA 3OZUA 4ON9A 2EN8A 5JFTA 3KSBC 2YTOA 4NU8X 4ABTA 4PYQA 3F8TA 3VO2A 5DDIP 2YWDA 1YQTA 2GEJA 4FHDA 2HLPA 2PVPA 5G0UA 3THOA 3O8CA 1AT1A 2BFBA 3MK31 1R5OA 2QYSA 2WBTA 3EE6A 3FYUA 5JCJA 4EB6B 5JSUA 3ZS9A 2CNNA 1XQ1A 2ZSAA 3WAKA 4EY5A 1XMSA 1U3TA 3A11A 5BN4B 4QTXA 2Y1DA 3FHOA 4IVRA 5HTKA 3TBKA 2QRLA 4ARVA 4CBVA 4JEHA 1H5NA 2ATCA 1YDEA 1NY6A 2L92A 4CF5A 2ZDQA 4JI2E 4FCCA 1YC2A 5HFNA 2CFRA 2E2WA 5I7FA 3I1IA 3FPGA 1J1ZA 1Z4JA 4YRGA 4E15A 1IWOA 1O08A 3UKJA 1JSCA 1LRKA 2B98A 4MYSA 5DVZA 1Z16A 4AG3A 1UBCA 5L9AA 2C4WA 2MSLA 3EXHA 3KL4A 3LDFA 4R0NA 4P4UA 3T5TA 3L1UA 4QGAA 1UBOS 2ANCA 3FNQA 2L6MA 4A0HA 2Q9BA 2G08A 2XNCA 2XZPA 3A4NA 4MRRA 4B76A 1UBKS 4MULA 3N59A 1TQ4A 5G1OA 3ADBA 3CUUA 1W73A 1GZSA 1Z8DA 3AG5A 3EN0A 3FFXA 1I4WA 2F4VE 4Z7QB 2A9JA 1IYZA 3WMEA 3EOAI 3PKZA 3NW9A 5DU2A 4ZVPA 4EJ2A 2JARA 4PLGA 1XROA 1VP9A 4EQ6A 2PTHA 4G3XA 4IEFB 1SXHA 2XV1A 3RIXA 1M66A 4BFLA 5KZMB 1EFUA 1HYEA 2CCJA 5JE8A 2PUVA 2PXHA 4X24A 1X3CA 2W8ZA 3WR5A 3RB8A 3KAPA 4BLWA 1ZMBA 3O26A 2VF5X 3HNOA 1VSQA 3OEYA 2DP4E 3N6VA 4J3FA 3T4UA 3UUFA 4BASA 4CNBA 2J7PD 3RHSA 2C3PA 3LC0A 1S2DA 4KPUB 3UAWA 4RA9B 4NULA 2H2AA 1GZUA 1OX5A 4E08A 3NTOA 1OH5A 3ONVA 5B1IA 1P7PA 1XCBA 5AVOA 3GJRA 1B1CA 1NU6A 3W3ZB 3EASA 4EL0A 4HAVA 1MB0A 1JEDA 3D6UA 2OMKA 2CBXA 3PZBA 5I48A 3FKJA 3MBIA 3BIFA 4CWAA 2ZBUA 4OJKA 3GIWA 3RUPA 2CLKB 1RNLA 2IUFA 1N8NA 1OZHA 1SUAA 2JFFA 2VT2A 4O2AF 1FFYA 1GJRA 4YJHA 5CJJA 2PANA 2A67A 3A9SA 3BICA 5GONA 2BTEA 4DR2E 3WBKA 2UAGA 1KO7A 2F8MA 2H2WA 5HP4A 2FEMA 4OU5A 3A8TA 1KJJA 1ARZA 1Z73A 1H9BA 2RK6A 2F8TA 3HDYA 4DIOA 4GQIA 4OI2A 4OB6A 2Y9MB 3LO5A 3SM3A 1X9GA 2XBUA 2QUHA 4FEGA 5E9QA 3QEMB 1P31A 2ZUWA 2CNWA 2OD2A 1NE2A 4IG9A 2BM1A 2H5EA 1ZGBA 3HV0A 1C1XB 4KSBA 4M1MA 3BK7A 4IJMA 5BVGB 1B6RA 1E9RA 1UZMA 4MRSA 2EN1A 3S2FA 5HZGA 3BGDA 5I4KA 1XR3A 5K3SA 1B73A 2G1UA 3OTGA 1HE3A 1A27A 5B1SA 1W0JA 1Z0JA 2JL1A 1NFFA 2R8YA 4HGQA 4RE6A 2N42A 1RPNA 3TVDA 4XDGA 5J1SB 1D04A 1W8DA 2YMLA 1Z6GA 1QZ3A 1K8XB 1R8QA 2H1WA 3ES9A 2A92A 4JT8A 5EXXA 1JZTA 3ID6C 5ER6A 1AG9A 5T6BA 4Q3CA 3U3KA 4BV8A 2QJRA 4RCYA 1N2XA 1UN6B 1T36B 3P20A 4R3WA 3ESXA 4ANFA 1C30A 4G0UA 4XRRA 2RH4A 5HZMA 2IEIA 1E1LA 3R4CA 3IR6A 2WYHA 4WCFC 3FMGA 4D98A 4MWDA 4S0XA 1V0JA 4MEBA 1M1NA 5JI3E 4WNAA 5JJCA 1XC7A 3PNVA 1YRHA 3CLRD 1JVNA 2W43A 1XRNA 4JKOA 2V1XA 1V95A 5AW3A 3C8UA 1FRVA 2OA0A 3SYKA 3FR7A 2IHUA 3G5AA 3K94A 2XNHA 1GUBA 4MV5A 2EMKA 1ORWA 2INGX 4FHGA 5CH5A 5CYFA 4ETIA 4W5TA 2V8OA 3IKTA 4AY5A 4PFJA 4WKGA 5KTYA 3GFBA 4BEJA 4K1XA 4L16A 1IBLE 3PQ3A 1Q11A 4FIDA 1KDPA 4LWQA 4B32A 3V1KA 2IDMA 1LH0A 1MRNA 3SZGA 1RTTA 3OVMA 3A58B 4JJ7A 4K6HA 4KR9A 3G85A 4KRYA 2WRZA 5KOHB 1Q1BA 3VV2A 1XJ5A 2LBSB 3LT2A 1P0PA 4RBNA 1DGQA 1G5TA 5H02A 3ADOA 4RQTA 4U4AA 4LVCA 3VR3A 1C8BA 3SQNA 1PS8A 1IQOA 3WGZA 1UDBA 2GK3A 5KO2A 1ZVQA 4DANA 3IP9A 4R2SA 1F12A 4WEOA 1DUSA 2LW7A 2NZJA 1WB9A 3VKGA 1UBFA 3IUBA 1TQ8A 5KL5A 1U7HA 2QIPA 2EBUA 3R9XB 4C0WA 5A4JA 1YR3A 3HE3A 2E4ZA 1A7KA 1N1EA 3GT7A 4AMYA 1CVIA 1AKMA 3RYCA 2FR1A 3KWFA 5HILA 2CZCA 5A3VA 3UB2A 3GJZA 2Z98A 4HQRA 4REOA 5I5GA 4OPMA 3U48A 2WWVD 3NDPA 2HSGA 4PRLA 4JDUA 4HT3B 3GPBA 3P32A 2IV7A 2EM0A 2EBHX 3TRHA 3IJPA 4JDPA 1WZUA 5B4VA 5CVVA 3A32A 3B9BA 1WA5A 4F21A 2JJ1A 3CTPA 3P0EA 4M4SA 3T94A 3FBGA 2QT0A 1DI2A 3C1UA 3DE6X 3E70C 3RRYA 4BN5A 2VWPA 4IOKA 2C94A 4GE0A 3EXAA 3CO5A 3C8DA 4FFVA 5HVNA 3U44B 2WM8A 3FYUB 3GLFA 4YJHB 3ZTWA 3P9QA 2ECKA 4HVCA 1EHCA 4RSRA 1KOLA 2XDWA 1ZUNB 1F0KA 2UKDA 2X40A 4MUBA 1N6OA 5IAGA 3R7NA 4CF3A 2OORC 4RF5A 1BXRA 4KR0A 3OTQA 4WI1A 1TUGA 1T24A 3SEZA 2I13A 4BE9A 3NAGA 3K15A 4HH1A 3OF5A 1GG8A 4C0XA 1YBVA 4O29A 5FCDA 3A1EA 1G41A 1PZNA 1QP4A 5L40A 1FY2A 1EJ6A 1U6IA 2R6DA 1DJQA 4C3UA 2R9VA 3AJDA 2XHZA 3JQ7A 3LRPA 3TMYA 4XH9B 5JALA 5LYJB 3K9FC 2WY2D 4FOLA 3JPYA 4E4YA 1OZ0A 2CFOA 1AKNA 2X9QA 4EB3A 1GU1A 3ZH9B 2FF5A 2ZUCA 1GZHB 2RTXA 3NYWA 1DZ3A 1FNNA 2X76A 3GAZA 4YREA 4FBLA 2WTUA 3C85A 3I8SA 4DLBA 2W11A 3LUHA 4C1NA 2B2CA 1B4DA 3II6X 3P0RA 4KGDA 4M88A 3SY8A 1YZLA 2OHJA 4MRMB 3F49S 3O4JA 2VCHA 4P9NA 2XQVA 5EZ5A 4IMJB 4B3XA 4EYKA 3EULA 4F92B 5CMLA 2GNOA 4UD2A 1OFVA 3FNIA 3LVBA 1NVKA 3CLTC 1XD8A 3D0KA 3Q6IA 4W1SA 1YS4A 2DUNA 4BO7A 2PZKA 2RSLA 5AW6A 2D5BA 4UZSA 1PNVA 1YOVB 4IMPA 3ZBTA 3G5MA 4GMGA 2FSUA 1UWCA 1AO3A 2VXCA 2JK1A 1IHPA 1U0GA 4Q3BA 5DT2A 3UK0A 4JXJA 4PCLA 2H0AA 3SU8A 1IHDA 4ZT2A 4ATNA 5HRUA 3OPXA 4XSHA 3UK2A 6PFKA 2NQ2C 2W9XA 3R6TA 5K0TA 4Y6QA 1DQZA 2A7QA 2L2QA 2EMZA 3ILVA 4M8NE 2VSFA 1RWOA 4FR5A 1HYBA 4QODA 5IW8A 5KYXB 4CUZA 1XSEA 3PR2B 3TLKA 5KSOA 4PHHA 1Z2EA 4PYKA 1ZPDA 1DQYA 1GAWA 1W7AA 1FPMA 3GRZA 4F98A 1Z4NA 3CG4A 3LUAA 4MV4A 5AJYA 3EEOA 3P9SA 4U63A 5IC5A 2NNWB 4CV2A 4M7OA 2AEFA 2LMZA 4G0VA 1Z2CA 2HA3A 2X23A 2RG7A 3A06A 2Y1KA 2X4IA 4DQLA 3OM0A 2CHQA 3D81A 4MIEA 3BD7A 4M1ZA 4ZTBA 1IEWA 2UDPA 3MMNA 5KYVA 2IEGA 2M1XA 4OYHA 4H31A 5A5FA 3B48A 3PHHA 1MX9A 1PYGA 4R1NA 3SMVA 1VI5A 2ZI7A 3Q7IA 1V1RB 1UQRA 2N3GA 2O3JA 3WY9A 1PP4A 4BECA 3D43A 4RVCA 4ES6A 2KX7A 4AYXA 1CYDA 3ORFA 3ZWOA 4KWHA 3AHHA 3I3OA 1CNMA 1VDZA 3MM4A 3K6RA 4W6QA 2QNBA 3VHRA 4N12A 1I1HA 3FY4A 4JJ6A 1Q20A 4XGKA 5KOIA 3UH1A 3E9ZA 3VC1A 1X1TA 3R9IA 2YSOA 2L42A 4OHXA 4XCVA 1G6HA 5ALTA 2H7XA 1ZD9A 3B9RA 3JQGB 1G3QA 5E3JA 4A73A 4DNQA 1KEVA 1S8FA 2HB6A 3VBCA 1R7RA 4A8JA 1KMHB 2GLTA 2JASA 4G37A 5CITA 4CLOA 4ESEA 2NUEA 5KKAA 5JQWA 4RHUA 1FLAA 3JD3A 2JAQA 3SQDA 3WK5A 4KQCA 2GPJA 3HQ4O 5BR8B 2LE0A 3RSCA 4B31A 5CRIA 4NYMQ 1PGPA 4NNOA 3MVEA 4F71A 3LAWA 1OI3A 1OLUA 2VTDA 2BR3A 1W88A 2PBLA 2ZBGA 5H1YA 2F00A 3DTNA 1U8YA 3IE0A 4NG5A 1W4LA 2VYFA 3IQEA 4LWZA 4R0VA 5BSTA 2YV4A 5KDDA 4XIGS 4C14A 1RBQA 4OIMA 2OVFA 2EHDA 4S1VA 3BGOS 4FYHA 2XGMA 2GS9A 1WCWA 3B13B 2XJ4A 4ZCIA 3MWFA 3AW8A 1MQ8B 3FKSD 1TE2A 3RT7A 4IJKA 4NBTA 3OE7D 3KKLA 5F5XA 1QOPB 4NEHB 3G49A 4L6CA 2GRJA 2K7FA 4ISCA 3QVMA 3IUMA 1PWYE 4L02A 1WVMA 1IN4A 4BEVA 3DTVB 2Y4NA 2CNWD 1N2OA 3OT1B 2FRVA 1JEQA 1U65A 2WOOA 4PNZA 4LF4B 1Q1AA 4JB0A 4YJGB 3RVJA 4Z3OA 4QLOA 4U0JA 2VUHB 4MWTA 4F7WA 1P5ZB 2NPIA 4ZGWA 4D8UA 4QHSA 1G7TA 2Q3JA 2Z5FA 1XP8A 4NBRA 1CSEE 1OWOA 5FQOA 1UKYA 1AMOA 4DSZA 1RWWA 1NVBA 4FUTA 2RKWA 2XHEA 1QNLA 3RWBA 4EW3A 2G67A 1FTSA 1RQ0A 3H4VA 3TLCA 4DMUB 4DR6B 3A4LA 3LNTA 1NBMA 4YJ3B 1HDCA 1JHOA 4OOFA 1P7VA 1SWVA 2YJZA 1EBFA 2AUTA 3H1GA 3M6LA 4TWZA 1QP8A 1DAFA 3CE6A 3QX3A 1ORVA 1CJBA 1PS9A 2QS9A 1HZZC 1U2PA 4QAJA 4RF3A 2P4HX 4F5EA 5AVQA 1Z33A 1ENPA 2EM8A 1U6JA 3CB4A 3WLHA 2OBXA 2I4LA 3EJ6A 3PUXA 4CKEA 1PJQA 3VSBA 4DLLA 1OY1A 1RABA 2EZ6A 2WBLC 3KVOA 3AEQA 4YV1A 4XX0B 2NSHA 4EHBA 2JC3A 4Y6RA 2VHCA 1A7JA 2P4SA 2E6UX 2RGWA 4YI3A 5EPOA 2AG6A 1UFRA 3OZWA 5H0IA 4GM0A 5I8WA 2HIGA 3FOEC 2HNBA 1A98A 3GEPA 3Q5EA 4KC0A 4LVNA 1KJNA 1XPOA 3NBZC 1I3NA 4IZHA 3VC3A 2FZGA 4LCBA 2JLCA 4JV5E 3T9FA 3OCYA 3K6SB 2ADOA 2ODRD 3BL8A 1W5BA 2H8KA 3NBUA 4EO4A 4F2GA 1QZXA 2K87A 1RADA 3ASVA 4J49A 2IZOA 4OLHA 4A1OA 3TJMA 4GI5A 2EVWX 3VU9A 2QXTA 3V1TC 3RAJA 5JFGA 2F64A 2O8DB 1PFWA 3NR2A 2IXTA 4JELA 5C7IO 4HRYA 1UOOA 1XFDA 1JAYA 2YHIB 4H0NA 2OLKA 4BZQA 5DNCA 4B4WA 5BMVB 3D5TA 1ZGAA 4JLPA 5FOXA 3WLQA 4KWIA 3NOXA 2XYPA 1T8SA 1CJVC 3KQPA 2HJWA 4EG1A 1XLVA 2E5LE 1G9XA 1JG2A 4KQ2A 5LOVB 2FSVC 2EP7A 3J7Yp 1KFBB 1RP1A 1NX6A 4AYWA 2ZIXB 4EPXA 3RK4A 4RESA 2GFHA 2WHXA 5EGSA 3MWDA 4EVIA 1U9YA 1ZNZA 2Q7DA 1KFCB 1Y82A 1VI6A 3CCCA 1V11A 5JAZA 1EFKA 1M0WA 3O3NB 2EPCA 3R5JA 4IZ6A 4QBFA 4QTUB 3E1SA 1JQJC 3SF8A 1X8XA 3PEWA 1KI1A 1CR2A 1ODJA 2P3SA 3IPYA 2IWHA 4UJ5A 3RSOA 1AH2A 3K05A 1PTKA 4MK4A 1N2JA 3L49A 2KLHA 2X0NA 2XNKA 3D1JA 3O8DA 3K09C 4EX6A 4OBXA 3GYBA 4JNKA 1C4XA 3ZZ1A 5KYKA 1G8JA 1TIBA 4ZRDA 1HETA 1XQ9A 4OFWA 2WJHA 1Q6ZA 4R9NA 3TFWA 4JJZA 1NN0A 3GYGA 4HB4A 5AVKA 5FF9A 2OZVA