3C6KA

Crystal structure of human spermine synthase in complex with spermidine and 5-methylthioadenosine
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
363
structure length
335
Chain Sequence
GSRHSTLDFMLETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYEEIDSILNKVEERMKERVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermine synthase
publication title Crystal structure of human spermine synthase: implications of substrate binding and catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 103
structure length 335
sequence length 363
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.22: Spermine synthase.
pdb deposition date 2008-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
A PF17950 SpmSyn_N S-adenosylmethionine decarboxylase N -terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 3c6kA02
3.30.160.110 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Siroheme synthase; domain 2 3c6kA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3c6kA03
1JTFA 4RTSA 4IKPA 4X1OA 5DX1A 4RWZA 3KPJA 1WY7A 3LBYA 2V7EA 3CKKA 5GINE 1R18A 1Y8CA 3T0IA 3SX0A 5HIKA 4KWCA 10MHA 2EFJA 3KPUA 4FP9A 3V8VA 4DA4A 1ZQ9A 4C4AA 3C6MA 4X60A 3T7RA 2P7IA 5DTRA 3DXXA 3K6RA 2WK1A 3LCCA 5ERGB 1M0EA 5FTWA 3LDFA 2I62A 4FSXA 1AV6A 2ONZA 2G72A 2GPYA 4BY9E 1R74A 5EIWA 4DCMA 3G8AA 1SQGA 3GCZA 3HCBA 5DSXA 3VC1A 3A7EA 2B3TA 3DLIA 2ZBRA 1FJXA 5K0NA 2AOXA 3FPGA 2QRVB 5E9QA 4E33A 4HTFB 3A26A 3FZGA 3TRKA 1EAMA 4YMHA 4MHTA 4C04A 3MQ2A 1XDSA 3NMUF 4RTPA 1SG9A 2ZIEA 3DH0A 4F85A 3EVEA 3KQWA 2VZ9A 2ZVJA 3GIWA 2AN4A 3NW9A 4GOMD 1YF3A 3OPNA 3LPMA 1BKYA 5D1NA 3SMQA 2JHAA 3G5TA 3QOXA 5DM0A 5C0OE 5DWQA 4M36A 1AF7A 3GNLA 3KU1A 4P7GA 2G70A 3MERA 5K0LA 1TW3A 3HCCA 3T7TA 3HA3A 5FA8A 5EKXA 3MTIA 4V0QA 4MWZA 2OYRA 5F2KA 3RODA 4C08A 5EG5A 3HTXA 2QRVA 2CL5A 3HA5A 4HTFA 2OO3A 5K03A 1SUIA 3SXJA 4XCXA 1VE3A 3ME5A 3BKXA 3P97A 2CMGA 1X1DA 5HIMA 4BLWA 5E2AA 3UJDA 2K4MA 2PGXA 3B3FA 2PSSA 2B25A 5ICEA 3OCJA 4PYKA 5FADA 4DZRA 2EJUA 3Q7EA 5H02A 4POOA 5HOQA 2ZWAA 3E23A 3PFGA 2IFTA 3EVFA 4ISCA 5FHRA 5D1HA 3REOA 8MHTA 3FTCA 3G8BA 1Q0TA 4FGZA 2BZGA 1EIZA 2XVAA 5HZMA 4R8SA 2IDJA 3BKWA 1RI3A 3DLCA 5EMLA 1KIAA 1X1CA 2B78A 3LCVB 3OZRA 1JG1A 1YZHA 1MJFA 5BW5A 1FPQA 4PGHA 3IEIA 4QVGA 1AQIA 4E2XA 2P8JA 5FCDA 3UJ9A 1NW5A 1M6YA 5EEHA 4RTRA 2LD4A 3IYLW 1YUBA 3BT7A 4E32A 2UYHA 1XXLA 5DRYA 4E30A 2O06A 5E8JA 2ZTHA 4XUEA 3TQSA 4PYJA 3BWBA 2GLUA 1Q0SA 3LX6A 2AOWA 4E2ZA 4OA8A 1KXZA 1NV9A 3ERCA 3GRVA 4ER6A 2CKDA 3GRYA 2PT9A 5CVUA 2ESRA 1O9HA 2R6ZA 4U7TB 2OXTA 1XJ5A 4ER5A 3MGGA 1NE2A 3B7PA 1BOOA 1XCJA 3JWHA 3NVMB 3O31A 2PY6A 3FRIA 3E7PA 2JHPA 3HCAA 4FZVA 3VSEA 5MHTA 4OQEA 3UBTA 4A6EA 3CJTA 4QPNA 2HWKA 2ZBQA 3V97A 1NW7A 5K05A 3ER9A 1KR5A 3G5LA 1VPTA 5FUBA 4DQ0A 2YR0A 5CVJA 5CVEA 5FWAA 5HEKA 2E5WA 1P39A 3HCDA 4C06A 3OE5A 3A4TA 5DX8A 4YV0A 2ZIGA 3DMFA 2JH8A 2IIPA 3FUUA 3CBGA 4C03A 3EGEA 4B17A 5DT2A 3THRA 1JQ3A 2IGTA 5E1BA 4PYIA 1JQEA 3FPHA 3AJDA 2ZZMA 3FTDA 2EG5A 3P9IA 1KYWA 5FQOA 3TPZA 4GEKA 3R24A 5LQCA 4ER7A 4YV1A 1ZGAA 3TR6A 3C6KA 4RVGA 2O0LA 3EMDA 1JG3A 3FYCA 4RTKA 4LWPA 2NXCA 3CGGA 4KIGA 1WZNA 4RTNA 1SQFA 1YB2A 5K0JA 5EMJA 2Z6QA 2GB4A 2I6GA 2Z6AA 1DL5A 3BGDA 5CCBA 4IWNA 2GAFA 3UA4A 5CIYA 2BR4A 2O05A 1X1BA 1NV8A 3O7WA 5K0EA 2PVCA 1NW3A 3LGAA 4PINA 4AZSA 2FCAA 5GIPE 4U7PB 1RJGA 5E9JA 1BC5A 1QANA 5T64A 2G71A 2G1PA 2YTZA 5KS2A 4YUZA 1HMYA 4RVHA 4HSGA 5EZQA 5KQSA 1UIRA 2BH2A 2AOTA 3MTEA 5DXAA 2NXJA 3HVJA 2G8NA 4C07A 3LKZA 4XUDA 2NXNA 3NDIA 3NWBA 5K0FA 2O07A 1T43A 2ZLBA 3EMBA 3HVHA 5HFJA 5CD1A 4C05A 3FTFA 3BWCA 4YV2A 1TW2A 5CM2Z 3EVAA 4P58A 4YUYA 5E1OA 3VYWA 3KQTA 2ORED 3PTAA 1N7IA 1D2GA 2BR3A 5FQNA 4R6WA 2P1DA 3D2LA 4PYNA 3UJAA 1R8YA 2PX2A 3B5IA 1NBIA 2P41A 3R9XB 5FA5A 3TKYA 1D2CA 3OU7A 2XBMA 2NP7A 5GM2A 3EVGA 2BR5A 3ID6C 3UJ7A 3LBFA 5HIJA 2EJTA 2FHPA 5IKMA 5EOVA 2O57A 3G2OA 4KRGA 2C7QA 2AN3A 3KQMA 1AQJA 3LCUA 2BM9A 4R6XA 5C9ZA 2PWYA 5EHGA 5T6BA 5HILA 2ZULA 4CKCA 5K09A 1VIDA 2VP3A 3HCFA 4DMGA 3MCZA 3QV2A 4E70A 5DRTA 4EQZA 1XDZA 4IV8A 2UYOA 2AR0A 5CVVA 3VC2A 4RTLA 1EJ0A 1L3IA 1QZZA 4OBWA 2R3SA 2VDUE 4F84A 3I64A 4X61A 5JUWA 3G2QA 1L3CA 2YXEA 3GRUA 3EEOA 3G2PA 1XTPA 4HGZA 1ZGJA 3GRZA 3IHTA 5FWDA 2Z6UA 3CC8A 4P7FA 2YQZA 3CJRA 5HIIA 2JG3A 3OE4A 1I4WA 1KHHA 4P7KA 1YFJA 4FT4A 3U81A 5KQRA 2ONYA 3MB5A 3ANXA 3TM4A 3EEYA 3A25A 1WXXA 4FS8A 4FSDA 2XVMA 4BLVA 5GOZA 1YFLA 5DSTA 5BW4A 2C7OA 4QQKA 5CUQA 2IPXA 3PX2A 4QPPA 1I1NA 1XDUA 5FULA 4CTKA 4E2YA 2PJDA 4Y30A 3JWJA 5E8RA 2QY6A 3KR0A 1JSZA 4EMSA 1G8AA 2ZSUA 1P1BA 3KQOA 2IH2A 3ELDA 1INLA 4YUWA 3P2KA 3I5UA 4GOLD 5DTQA 1WG8A 4PYOA 2QM3A 3L8DA 5DM2A 4FT2A 3P2EA 1I9GA 1FP1D 2HV9A 3C3YA 4H0NA 7MHTA 5EMMA 5BP7A 2P3QA 2AZTA 1EJ6A 2PT6A 3PS9A 4E31A 2HMYB 3FUVA 4HC4A 4RVDA 2YVLA 3DXYA 3G88A 2PXCA 4RTJA 4LWOA 4RX1A 2NYUA 3OU2A 1NW6A 4EVIA 1JSXA 1RI2A 3HNRA 2P40A 3DR5A 1QYRA 3HEMA 4LG1A 2XYQA 9MHTA 3H2BA 1DUSA 3NTVA 3AWIA 3PLAE 3KR9A 3DOUA 4P7JA 1N2XA 3GXOA 3O4FA 4HRAA 5GIOE 3M6VA 5F2OA 3FRHA 4EKIA 2IH5A 3LDUA 2GH1A 4OBXA 3C0KA 4PYLA 5DTMA 3EVBA 4A6DA 1H1DA 2ERCA 4HGYA 5LQNA 1L9KA 5C1IA 3G2MA 5DXJA 2QE6A 3OFKA 2PXAA 1KYQA 1JR4A 3FUWA 4HG2A 2OZVA 3GWZA 1ZKDA 3JWGA 3KQYA 1PJSA 3DTNA 4G56A 1ORHA 5DM4A 4DCGA 2ZZKA 4JXJA 4KDCA 2YXLA 3BXOA 5P8WA 3TLJA 3DUWA 1F38A 3PX3A 3B3JA 2PBFA 3I9FA 3KKZA 4NECA 2OB2A 4CWAA 4PWYA 2AOTB 1V39A 3HA7A 3M4XA 3R3HA 4V0RA 3TKAA 5T67A 3SGLA 3I53A 1B42A 1O54A 3NWEA 3BGIA 2FK7A 3FUTA 4AZVA 4KVZA 3EGIA 4AX8A 2AVNA 3PFHA 2F8LA 1OR8A 3SSNA 3BGVA 1WXWA 3SVZA 2NNWB 1TPYA 3A27A 5IH3A 3UFBA 3NVKI 2EX4A 2GS9A 3TM5A 3ER8A 4CTJA 5JR3A 3P9NA 3BWYA 1F3LA 1R00A 4IV0A 1KPGA 4QDKA 2I9KA 3DP7A 5EMKA 5K0BA 4QDJA 4GC5A 4Y2HA 4QVKA 1NKVA 1P1CA 2ZFUA 4LECA 1XVAA 5GP1A 4AZTA 5LR6A 3LSTA 4F86A 5LQKA 4PYQA 4O29A 2Y1WA 4FR0A 3ELUA 5G02A 5ICFA 1DCTA 1JG4A 4PIMA 3T7SA 3GJYA 5ICCA 2N47A 3C3PA 3FPFA 3Q87B 5F2NA 5DLYA 2WA2A 4R05A 2YX1A 3A7DA 1M6EX 2ZWVA 2ZIFA 5B1SA 1R8XA 2GA9A 3AXTA 3G89A 3P8ZA 4CKBA 3BZBA 3LDGA 5EIFA 3OFJA 4Z2YA 2QYOA 1PJZA 1VLMA 3QOWA 4QQNA 2HNKA 4X63A 5EVJA 4GF5A 2DULA 4WVLA 4GUAA 3SSMA 4AZWA 4UOEA 1EQAA 1BHJA 4OX9Y 3RW9A 2P3OA 3DXZA 5FHQA 2Q41A 2AOVA 1P91A 2UYQA 4OA5A 4E2WA 5LQUA 4PYMA 1UWVA 1SKMA 2B9EA 3EVCA 3P71T 1ZG3A 3KQQA 3KPVA 3NDJA 3OZSA 4CKEA 2PWPA 2VS1A 4GOOD 2FPOA 3HVKA 2JH9A 3KR1A 2B2CA 4BP3A 3PVCA 2ZZNA 4PONA 5EQJB 4DF3A 3SSOA 5E2BA 4L7VA 3WSTA 1XCLA 2OB1A 4KIFA 3FYDA 3CJQA 3UZUA 5LSAA 5K01A 1RI5A 5E1MA 1JTEA 4XUCA 1RI4A 2HTEA 3DULA 1FBNA 3I58A 3LL7A 5DPMA 4DM3A 5KVAA 5EZSA 3UJ6A 3EGVA 2P35A 3GDHA 3HP7A 4M38A 3E8SA 4YMGA 2JHCA 3CCFA 2JJQA 5CVDA 3M6UA 2A14A 3UJBA 2C7RA 3KHKA 3HM2A 5EEGA 2H11A 3FUXA 1KP9A 1R6AA 4PIPA 1SUSA 4GBED 3PT9A 2IBTA 3GO4A 2ZCJA 2FRXA 2FK8A 3R6TA 2XYVA 1N7JA 5K8VA 1X19A 1PJQA 2BM8A 1RJFA 2PKWA 4DKJA 3IV6A 1KYZA 2HR1A 4PGGA 2PX8A 3THSA 2PLWA 2I7CA 4MIKA 4PCAA 1G55A 2IDKA 1L1EA 1VP9A 3GU3A 5EHIA 5BXYA 2C7PA 3HCEA 5LQJA 4YUXA 2OY0A 2CMHA 3KQSA 1MHTA 2CWWA 1G60A 5DM1A 3UA3A 4GC9A 5LQAA 1G38A 4CXMA 2V74B 3MCTA 3BUSA 3FPEA 1L3BA 4GOND 3K0BA 4YUVA 3EPPA 2ADMA 4RTQA 1HNNA 1KPHA 3KPYA 2IH4A 2VDWA 3TOSA 4ER3A 4OQDA 3M70A 1U2ZA 2OKCA 2ZBPA 3X0DA 3JWIA 5K0CA 3ELWA 3GGDA 4K6MA 1EG2A 2VDVE 4KW7A 2IP2A 2P3LA 1NW8A 3UWPA 1JG2A 3ELYA 3M6XA 4ER0A 3AXSA 1WS6A 2WA1A 3MAGA 3M33A 3S68A 4ZTBA 1QAMA 1RI1A 2AS0A 1KPIA 3FPJA 3P2IA 4MTLA 3EVDA 4R8RA 3UJCA 5KYGA 4WXHA 5M5BA 4GQBA 5CCXA 1VBFA 3OU6A 5EC8A 1ORIA 1VL5A 2AVDA 5EKUA 2DPMA 4EKGA 5E1DA 2PX4A 4QTTB 1X1AA 5EGSA 3SR4A 4BLUA 2PV0A 2OBFA 1RJEA 3GRRA 1IXKA 1PJTA 1RJDA 4RV9A 4RYLA 2PXXA 2AOUB 2IBSA 4AUKA 2XYRA 1PRYA 3RIEA 1O9GA 1D2HA 2FYTA 3PB3A 3R0QA 2Y1XA 1UFKA 4X41A 3TMAA 1VQ1A 5K0GA 1ZHFA 5DX0A 1NT2A 3B89A 3SM3A 5EPEA 3E05A 2YUIA 2PX5A 4PCLA 1QAQA 3EVZA 3KPWA 4RVFA 3LECA 5GM1A 4MQ4A 1SVUA 5LQRA 4BP1A 2H00A 2P7HA 4PNEA 2NXEA 2ZW9A 3CVOA 5GWXA 3LKDA 1FP2A 3KR2A 4M37A 2AOUA 3HVIA 4M7RA 2UZ4A 3BWMA 5U4XA 4HH4A 4EK9A 3F4KA 5ICGA 3MHTA 1NBHA 1YZ3A 4ATNA 2NP6A 4KDRA 2OPBA 3DMHA 3OZTA 2AN5A 3UJ8A 4RTMA 2UYCA 4RSRA 3G7UA 3DMGA 1G6Q1 1VP3A 5E9WA 1QAOA 2KW5A 2YXDA 1G8SA 3KQVA 3FTEA 3KQPA 3LHDA 3TFWA 3M6WA 3NJRA 1IY9A 3B3GA 2H1RA 1IM8A 3P9CA 4QTUB 4RTOA 3AY0A 1JQDA 3ORHA 3P9KA 1Z3CA
chains in the Genus database with same CATH superfamily
4IKPA 4N5IX 3DEKA 3T35A 2XUFA 3E18A 4MYRA 1LBIA 2H0RA 1WDWB 4JLMA 4DCTA 2OV3A 4FTWA 3GLFB 1DARA 3H4IA 5BVGB 3DBRA 2X2EA 4BTEA 1CF4A 3PJGA 2CK3D 4JJGA 1IQUA 5CJ2A 1QGED 3DMTA 5LZ4A 2M9AA 4I4CA 2WK1A 1LBSA 1PS9A 2CDNA 2ZR9A 2C9DA 4MUIA 3SY8A 3L8GA 1ELOA 1QFZA 2J4FA 3TSWA 3ZJVA 1NBMD 2BEWB 3DYVA 2DUJA 2PHZA 1SQ0A 2GF9A 3HDHA 4QC2A 5C7OO 4DV2B 1MW8X 1S1MA 5F4ZA 1VLJA 2G1JA 1M6WA 1ZCBA 1V1MB 3BJEA 3KHSA 1T5IA 3P2MA 3ZYCA 1ZMBA 1S3GA 2RHDA 5EJ5A 4RGBA 1REQA 4L1KA 2AOXA 2C9OA 3FPGA 3C8HA 4KQHA 1EAMA 3S4YA 1KJ8A 2RHLA 1P7ZA 2WTNA 1WAMA 3C74A 1IHDA 3GT0A 2CNDA 2QV7A 3PR2B 4LBVA 5DH9A 1GRVA 5ELXA 2Q0HA 4F85A 2ZJFA 4PYRA 3P9QA 3RYHB 3NW9A 2YWEA 1TD1A 2EQBA 2IYOA 1TK2A 2ANCA 2W8ZA 3B48A 3G5TA 4DR6E 1Z29A 4JWKA 4PNZA 3T3NA 2HYIC 2GRAA 1JDNA 2OK7A 2P27A 5MN4A 3ZU6A 2F4NA 2PCJA 4PLCA 1IBRA 2W22A 4KHPE 5I3CA 1XZLA 4XARA 2FVYA 3HTXA 1I2AA 2BGKA 4QNNA 3WB2A 1X9HA 3WLEA 2X9NA 3PDIB 2JD0A 3PD0A 3SBDA 5IJWA 2H7XA 5T6JA 1FU7A 1OSNA 4MZDA 1CXZA 3FTQA 3WK7A 2XE6A 4YT8A 2EARA 4Q03A 2JZNA 5HIMA 2EFDB 1XMQB 3FLEA 4DXDA 1XN1A 1AHPA 2OXCA 3KFLA 1GTMA 2GASA 5E0OA 4ZIRB 2O7SA 4CDGA 3S0JA 4DUGD 3SOPA 4UC0A 3GCGA 2GSWA 1LRLA 2LGJA 2EOHA 1HFKA 2FSFA 2ZE8A 4UNSA 4Z0PA 5KWEA 3ILSA 1BS2A 2XIJA 1NM5A 4JI2B 1WMDA 4N9QA 4LXUA 1J2JA 1X1CA 4FHEA 3W04A 5HKOA 2JIOA 4GZ3A 1KEEB 5K3BA 1ZRSA 4DA8A 5JJ5A 2Q7XA 3N0VA 3F6YA 3STWA 1VMIA 2Z4RA 2KM1A 4LHWA 4RZSA 3TL2A 4FYYA 5DYWA 4RF5A 2Q1UA 3QYPA 3BHJA 4YCCA 2P8JA 2VF2A 1JKJA 3G59A 4KE8A 5HGJA 2Q9UA 1TT7A 4RTRA 4BC9A 1DWQA 1GYPA 2Z8YM 4NNJA 4UNNA 2XF8A 1V3UA 1UXIA 2J9XB 1QVWA 2OUIA 2QA5A 5G3YA 5GZ3A 3ZFOA 1YNOA 3FOAA 1QHIA 3RRNA 2Q6TA 4V0SA 1T36A 3V1NA 1QP8A 4NF2A 1HYBA 3GMIA 3TVDA 4OA8A 4NCBA 1KJNA 1DIBA 5FOQA 1IZ8A 8ADHA 1PFYA 3I9V6 1LVGA 1WBBA 3UUEA 2E1MA 1TRHA 2FTKE 4XD2A 3TW0A 4U7TB 5ALKA 1M2VB 5A6SB 2OYCA 1TU3A 2OVFA 1A04A 2ET6A 2VUHB 4TMFA 5J47A 2FW1A 5JC8A 4HMOA 2NUPA 1PAUA 2Q1TA 4LTMA 5H3CA 2XGMA 3V8MA 1A2OA 3AG5A 4JZKA 5FNVF 2CJPA 1KAHA 2L8TA 4MS1B 3Q5EA 4LZJA 1MF7A 3ER9A 3R7WA 1G1AA 1KH3A 1BJTA 1IHOA 2CLKB 2PFKA 1WOYA 3D8TA 4LXTA 4TMWA 5K05A 3MGBA 1JBQA 4W5HA 1KJWA 5SYNA 2RGDA 4URXR 5J1SB 1Y4UA 1W87A 1YBMA 4PE5B 2HRDA 1Y7LA 3KZYA 3HB9A 3DT6A 3IOBA 3DMFA 1TA0A 4DCJA 5IK2D 4ZV7A 2A7QA 4UEKA 2EORA 3VNUA 2O14A 3ZNNA 3K7EA 2Q3MA 1JQ3A 3GUUA 3T9FA 3D3WA 2KLHA 4KO3S 1SVKA 5DYGA 3TPZA 4F3KA 4CKWA 2QJOA 1TFUA 2DLKA 3A32A 3GLTA 2VTBB 1H4QA 5AW8A 1UODA 3FPKA 2DBYA 4OB6A 5C5CA 2E85A 3PXUA 4JKIA 3VR2D 1PWYE 1ZRNA 4CEIA 2NAPA 2ST1A 4B3TE 2P9TA 2QNBA 5ALNA 1Z0KA 1FDOA 1L4KA 1XNJA 2PKRA 5EMJA 3QVSA 5KJFA 4OIFA 3KOZA 2G80A 5FI0B 1ODJA 1MVNA 5TQ0B 3SEQA 2P9BA 3WDLA 3GJRA 4UU0A 3F90A 5A3VA 3PLRA 3IVAA 2PGIA 2RDMA 2VT6A 4JJ6A 2PRJA 4ND4A 5I9SA 2MDTA 4L5YA 1DJMA 4WA8A 4ZZIA 3LYUA 5J2TB 3PPIA 1MT3A 2FXIA 1J22A 1UJ5A 3CRMA 3HBJA 3OO1A 4DFDA 4MDEA 4TQ9A 1E4VA 2RK3A 3PFFA 4HVAA 1ZITA 2FPGA 1PT7A 1NN1A 3WGUA 1KFCB 1DGQA 1GFWA 1K86A 1KVUA 1T43A 3A6FA 1E1QA 4JUAA 3BXHA 2H2IA 1K7EB 1CE8B 2FMKA 4K5QA 4KK3A 1VE6A 3PR1A 4L5BA 1Y7PA 2YS6A 3EMKA 5LXTF 3ZC3A 4KZPA 4IGIA 2RKBA 1DC6A 3ICPA 3OHMA 3DW1X 1QQ7A 2BR3A 3WGOA 2FW7A 3MFQA 1UEXC 1O0WA 3VBCA 2YYSA 2GBGA 3A1FA 3I45A 5I4KA 3LO8A 2X0EA 4BMSA 2WJ6A 4B80A 3H11B 5AIAA 5FA5A 1JXOA 3TKYA 1D2CA 5LDDC 3OIDA 3O0DA 3NNNA 4B3JA 1F6DA 3TZ6A 4FDMA 3LBFA 4F6LA 3DZGA 3EUFA 4Y0NA 2FPIB 4WZBA 5EOVA 1V4NA 5B57C 4OI1A 3N07A 3IQZA 1IONA 4FCTA 1ZJ4A 4LEIA 4YRFA 3S1SA 1RPJA 3B36A 4MVJP 2H31A 4DW8A 3QI2A 4K81B 1I36A 3EY4A 1EZZA 2XCRB 2RGYA 4L50A 3DDSA 1Q44A 4JI7E 1JP7A 2BSAA 2CYCA 3VSAA 3EIXA 4HVTA 4DLRA 5LYJB 1NPDA 1ORRA 2QN8A 1PI3A 2OECA 2OV2A 4K9MA 3ITKA 4F84A 5DNVA 5EJ6A 2C04A 5TV2A 1BMTA 1L4YA 3SHFA 2X5XA 4PTZA 1KEWA 3EEOA 4WLFA 1QPGA 2AFIA 4TVSA 2W6JD 3JSAA 4GM0A 4QWMA 4X1IA 4NMLA 3TXYA 4UNRA 4P98A 3RUPA 2HXYA 1CJKC 1DX4A 3QVGB 1NVVQ 1D1PA 3MTBA 1FMFA 4B40A 5DBIA 2JG3A 1QIFA 2R6GA 2WBSA 2VNKA 4D8YA 3IKTA 5JTTA 1Z5GA 4FKMA 3KB6A 3TX6A 4F38A 4UUOA 5EWMA 1O4WA 1QU3A 4B0PA 3FJOA 2WF9A 3LJKA 2OQRA 4QPPA 4ARVA 3ZE0B 4UCXA 1NG1A 1AS0A 4E1AA 2XHZA 3BL5A 4TYMA 4ZV9A 2C61A 3BE8A 3ZHTA 3A9TA 2OLKA 5C51B 2UYGA 4RH8A 4IQ8A 1KI1A 1UKAA 4GP9A 5MGBA 4F5WA 3K8OE 3VKFA 1B6SA 6YASA 3ILVA 4FIZA 4KR9A 3IPYA 2H29A 2N42A 3NPAA 5B2EA 5FOTA 2C2BA 3FYHA 2I22A 1JIQA 3FZYA 3LKBA 4KQ6A 4DQKA 3CMMA 2GSDA 1KZYC 5AK3A 1K7SN 1O4VA 4GWGA 2NADA 5D5PA 2FMXA 2PT6A 2ELYA 1YI8A 2RI1A 2NN3C 4G0QA 4RVDA 3R7FA 1J5XA 1Z5VA 3H86A 3CUWA 3V42A 4QGHA 3F1KA 2JCBA 5JCZA 2I2FA 2BEVB 4PZ9A 3FVWA 4KLCA 3L8ZA 3ZBUA 2FSHA 2UU9B 1OLUB 3OZWA 4RSMA 2G76A 4E46A 2XI4A 4DA0A 2H36X 4F98A 1NDUA 1PBTA 3GOQA 3RRMA 4B71A 4IDDA 2OCIA 2HEIA 2WIFA 3B60A 3D3QA 1A97A 1ZK3A 3JX9A 3LUDA 4MW7A 3AUXA 1VG0B 1MD9A 5MF6A 1PFWA 3V8RA 2CPNA 2H4WA 1J7JA 2QGZA 4G4SO 4O2BB 2NXWA 3NC1C 4X3OA 4OJYA 1X7WB 1V7QA 4URWR 3AY3A 3DAFA 1TKAA 5EWLB 5KYXA 3V1UA 4CL8A 2GXSA 3TBKA 1AN9A 4M89A 1DTWA 3COVA 1Z45A 3GWZA 5U1PA 4F72A 1ZKDA 2K7ZA 4QOGA 4G0MA 3SE0A 4QBHA 5F9HA 3D43A 3HB5X 1SOUA 3INNA 3Q6NA 5IAJA 5LA6A 5K8CA 2PE5A 3ZVKA 3V1KA 2ZJ0A 4IDGA 4PAOA 3W5JA 1N4AA 1V3QE 3W6OA 1AKVA 5K8IA 4M9CA 1SD5A 5FYQA 5TPZD 2LUOA 2IEYA 3MVEA 2AOTB 3FCXA 1DQSA 4B6OA 4KGVA 4EO9A 3CB2A 2PNJA 1GVHA 1SVIA 4PPFA 5G1PA 4HNVA 1XK6A 4JJEA 1F4PA 2XUZA 3EQZA 3GGGA 2ZYRA 1ZKMA 4GYJA 3L4BA 3TUIC 1PVVA 2P11A 4BQNA 4BZWA 5B1YA 1E1DA 5A4IS 1LC0A 4D6PA 2JI4A 3B2EA 2CF5A 2WP0A 3CR3C 3OIVA 3IPAA 4M1EA 3TM5A 4F7DA 2FW9A 1THTA 2H0AA 4IJMA 4X64B 2ZIAA 1D6MA 1F3LA 1KOFA 2QQGA 4W6ZA 2B61A 2PBLA 3GA0A 1CNFA 1P7VA 2JLAA 2NVUA 4ZGBA 4C7OA 1I9CA 4LECA 2ZFUA 4NBNA 4BX9A 1UKBA 2WAAA 4KQFA 1SG6A 3L6RA 4D9KA 3U3DA 1YJXA 1G5IA 3G5MA 2CY0A 3M6FA 1GGVA 4PLGA 1NMYA 2CJFA 2ODWA 2HLPA 2G9VA 3ELUA 5KL6A 4FS3A 3WICA 4WFKA 3HC7A 5DOVA 1DCTA 3KSZO 3GPBA 5FTKA 3QXJA 3TLBA 3WJ1A 4Q7JB 1NQOA 1EVIA 4D4MA 3OMWA 3BJRA 3OZXA 3VU1A 2HK6A 4G2NA 1A95A 4WJKB 4I6GA 4UJ3A 3ZQ6A 1M6EX 3OWHA 4B4UA 4JI1E 3KYJB 3H4VA 3U39A 1RHUA 2GA9A 2Q6OA 5JAQA 3VTFA 5I7OA 3CF4A 4EHFA 1PV4A 3T5DA 1BS1A 1NRXA 2Z58A 2O50A 1ZOOA 3NC4A 1S8FA 4FOTA 1H4TA 5HBRA 5J40A 2P5UA 1N2GA 3LC7O 2H4HA 1QK4A 1GL3A 1VYVA 2CB9A 3P7MA 2VN8A 1C9DB 1P2UA 2WHRA 3HHPA 3KT8A 4YN3A 4LVCA 1H6CA 4MWCA 1P0CA 4EG6A 1KVSA 3EPRA 3BJZA 3ZDXB 5AJYA 4ZVOA 1XI2A 2RAFA 3EBPA 3DCJA 3KPVA 2VATA 1OU0A 3NEYA 2PQ0A 4L08A 3TBFA 2VQEB 3HXPA 4XM2A 3H9JA 2YJNA 4YJHA 1GV1A 2BSXA 2R8YA 4JI5E 1IBLB 3H4TA 5KTPA 2Q27A 2NTNA 3NWOA 2EPRA 4AQYE 1YQUA 4KWTA 1KZ4A 4JJAA 3DBIA 4QT0A 3RJTA 2Y93A 4OQPA 1EK0A 1SG0A 1H65A 2EIXA 1WW3A 2ZJBA 1B76A 2FSPA 2NV2B 4NEGA 3W5SA 4DDKA 2FP4A 1TN9A 1A2BA 1QX3A 3WMGA 3EZ9A 2PS3A 3QLTA 1YZLA 3NJ8A 3ICVA 4A91A 5KVAA 4KXVA 1EA7A 4EB0A 1I7NA 2FFRA 4BNDA 4BNIA 5FEUA 3QBDA 4KZSA 2PRTA 2XTNA 3M5PA 4IYJA 4WOKA 1W96A 5IF3A 2ZUSA 1PKEA 4PEVA 3QE0A 4TMVA 2C92A 4GBED 3LXUX 2QRPA 3GJTA 1BMDA 3GRAA 4HH1A 4MMYB 4TSKA 3JWPA 4V2UA 2FRXA 2J0SA 1WDTA 4R3UC 1R5BA 4BU1A 3C7KA 1TAUA 3U5ZB 1NNLA 3ZVRA 2XMRA 5AVWA 4UM5A 1U1EA 2ZYVX 3KD3A 4BNXA 4YJFB 5EHIA 5BSFA 2IU6A 4Q4JB 1YA6A 2GPNA 2NQ2C 1L5WA 1QGZA 1Z18A 2GBCA 2QJTA 2QVBA 3OBIA 4Z7NB 1WO8A 2JYAA 2WSMA 4R3NA 3QW4B 4CLHA 2JARA 1PDWA 1N2CB 2HDWA 4GFDA 2OQVA 4YJ3A 1BE1A 1HNNA 1OX5A 2BFBA 3ZIUA 3TOSA 1JFFB 3QPVA 3DKRA 1ZGGA 4G0VA 2IYYA 3V2GA 2F8SA 4YDQA 4FFBA 2GHFA 3K5HA 3OLQA 2UXCE 4IUYA 3EXHA 4J8ZA 1J24A 5REQB 1ZVVA 4F93B 4J6EA 1IBKE 4BS9A 1Y5RA 1MRNA 2B4KA 4KUEA 5CH8A 3SS8A 4E22A 3JARB 3WADA 2OXIA 3DOCA 4OK5A 2CDBA 2AN1A 2WU8A 2G9NA 1QQAA 3SQDA 4ZTBA 1FL9A 1GYQA 2PT7A 3JQPA 2QVGA 4Y9DA 1OHHD 4ZOAA 3TINA 5LOVB 3KZZA 3T7EA 1N92A 2JLQA 3MBIA 4CV0A 4EOGA 5EC8A 2RHGB 2JJYA 4JJFA 4DEVA 1UAGA 3JQAD 5EGSA 1W4RA 3DOOA 3ROMA 3BK2A 3ZDDA 2VP5A 4ZT7A 4ARBA 1P9RA 4E13A 1DKNA 2HJWA 4FZ3A 4F4FA 1DC7A 1U7UA 4INOA 1O97C 4ZOLB 1HURA 3ESXA 1PR2A 5IKEA 3LSYA 2IYZA 3C7CB 3R0QA 4UQOA 3H6KA 3RRXA 4PVDA 4X41A 4D9NA 5CVCA 4HRYA 1HV8A 4KQ2A 1U0TA 2B37A 1Y7TA 2JDID 5DNAA 5DX0A 2ZXFA 3P27A 5A05A 5CDUA 1SXJA 4PAWA 1SCKA 5JZOA 3KE8A 3UIEA 2OBMA 3VVCA 2F1IA 1KXJA 3IDSA 5FO0A 2E5LE 4MWEA 2A67A 2L2QA 3HZHA 4NG4A 2JKYA 2I8CA 3NP9A 1R6TA 1NOIA 4NAVA 4Q66C 2B1GA 3AL0C 4EJSA 4ITRC 2WINI 1LVUA 3RS2A 3FM9A 2AZDA 3CTMA 3LL4A 5KU1A 1GTG1 1DCFA 1MN6A 1A8UA 1YZ3A 4NZVA 1U0OC 3JQFA 3K9CA 2C3OA 1ARZA 1P4GA 4ZVKA 1XL1A 2LW7A 3DMGA 4NARA 4MV1A 3WRXA 2CZGA 4AY2A 1FDSA 1SC3A 4GZLA 3QYJA 4G1FA 1NVUQ 1IPFA 1P3JA 3C4BA 1YK0A 2RAVA 2UZIR 4RHYA 4DLNA 1A9PA 4BGVA 2VJKA 4Z9FA 3GJQA 3I76A 1R4ZA 4L5AA 4Q01A 5KHOC 4PBTA 5A0TA 1S1CA 3OEHD 2RTXA 3BGHA 1FFCA 3T4XA 3RIXA 4Z8XA 2QX4A 4FP9A 1U0JA 3KPUA 3PC7A 3S8EA 1JVNA 2QHXA 3RREA 1KQPA 2R1ZA 2VHZA 2ZOSA 1PEAA 3IALA 4RJTA 5CEFA 4DIUA 2LCEA 1LRJA 2Y1DA 3MQFA 5GJWC 3RC3A 5JYBA 3TEFA 4IKEA 2FPUA 2W4MA 4FSXA 2PL5A 3ENKA 1M1NB 2YOGA 5LA6F 3LA8A 4LRUA 3V1YA 3AETA 4YP1A 3THOB 1MP0A 3HE3A 4LISA 5TEWA 1BQ4A 1BYUA 2O2ZA 4M7OA 4TTRA 4YC7A 2B5VA 4QEZA 5I9MA 3WDMA 1X6VA 5E3HA 3W2GA 2GILA 3AOEC 4O8CA 3WFIA 1YBHA 2A5LA 2V9CA 3E22A 1JLLB 4M0UA 4KXLA 5D87A 5IC4A 4IHKA 4KR7A 4I55A 4JV5E 3K20A 5FL7D 5CB0A 4EQ6B 1SIWA 2ZVJA 5FI3A 3A10A 1A3CA 1I1HA 4H4DA 3NBFA 4E21A 4Q5IA 4IPTA 1SU6A 1TM3E 1VRCA 3FWNA 4M36A 2D2EA 2CSHA 2NGRA 4BV8A 5B58C 4HQOA 5I9NA 2IUSA 1DDIA 5CH5A 3MTIA 4JVNA 2II6A 3AFGA 3LHSA 1E6CA 4RYDA 1C7QA 4C0WA 1AXRA 5HE9A 5KDLA 1I2ZA 1QIEA 4PZUA 3UUWA 2HQRA 2L6MA 4HXEB 2YSPA 4O24A 4HYEA 4BUZA 3NUGA 5JCOC 4P5PA 4RK1A 1FLDA 4CF7A 3VYYA 3LXXA 4I4TB 3FOZA 2GXAA 4LF6B 5J2UA 4MDHA 1ZESA 2QVZX 5E2AA 2PGXA 5T4FA 3FMGA 1I2CA 1MX1A 4MJ7A 1RDFA 1GITA 4RU1A 2ZWAA 4UDXX 5LQSA 1XAIA 2KONA 4NYIR 1Z75A 2I99A 1N33B 13PKA 1PD1A 3FTCA 5JCJD 3OFND 3DE7X 1QHHA 3FN4A 1PKXA 4S2EA 4YASA 1VE9A 2ATEA 5CIWA 4UUAA 1TC1A 3L0IB 2D0IA 2OZPA 4WD3A 4W8GA 4UREA 5BW5A 3ZFQA 5J5AA 1DO0A 1KSGA 5EI5A 4E5KA 1SVLA 3KQNA 4L0DA 5KL2A 5FCDA 3A9UA 2LT7A 1PEYA 1TK3A 4NCXA 1P4SA 1M6YA 4IMPA 4MQMA 3RKSA 4ALLA 1UQUA 5CHEA 2HSWA 1QF6A 3CLVA 1USUA 3V55A 4M1SA 5JAZA 2XRZA 3O82A 3P52A 4S1WA 1T91A 2VCHA 4MRPA 4Z99A 1SAYA 1QPZA 2GCIA 3MMZA 3SIWA 3BWBA 3R5XA 1JR2A 1QHFA 4Z0NA 5ILOA 3N28A 4IIDA 3AFMA 5TXGA 1KWKA 1VCIA 1Z33A 3I2GA 1EXMA 1HT3A 2HC5A 3IILA 4ZPXA 5AESA 1ZAKA 1O9HA 1Y6ZA 4AO7A 4BVGA 1VBNA 4DIDA 3QA3E 2G36A 4LGCA 3B20A 3L6EA 4BN4A 3TE6A 1JH9A 2XCOA 4QUBA 3ZDZB 4PM4A 3NO4A 2VPTA 3FRIA 3HCAA 2JHPA 1JNYA 2CFIA 5AJVB 3UXHA 4PQRA 3W7BA 3UBTA 5IYZF 1YZVA 3IULA 1TOAA 1IY0A 2B7VA 1NW7A 4W7HA 4PFKA 5CB8A 4FOPA 1VLLA 4DQ0A 1MAVA 3FA2A 3INRA 2W2VA 4LHYA 4TN5A 1DU4A 2PZBA 1FJ2A 3QBTA 1E1YA 3QMVA 5L4NA 5K8JB 1HQKA 1P2TA 2JH8A 4OD0A 2GX6A 2ENAA 5NLLA 1HE2A 1N36B 4J0GA 1P0IA 1RRKA 2RGWA 3ZZTA 4JI4E 1FP4B 2IVFA 3A1DA 4W4TA 4PYIA 5CLLA 3RCBA 3WTCA 3X1WA 4US2R 4KWHA 1APBA 5B2FA 2EG5A 1Q84A 4EB6B 3F46A 5HUQA 4HGQA 4BZXA 2PUVA 1QOQB 4YV1A 4FYVA 4YACA 3SBXA 3GGPA 1U9JA 2GCNA 2HJRA 3FYCA 1KARA 2NAFA 1QG6A 1MRSA 4WCFC 1WUTA 2CE7A 4P78A 2GFQA 1E2QA 1OX6A 2JI6A 2YY5A 3Q2KA 3ABQB 3QBVA 4L3OA 4WV3A 2NU8B 4GOJA 4HLUA 4KMMA 3GNQA 4CMJA 4DARA 1E2LA 2ZAMA 4QEKA 3AM3A 2N46A 1MOSA 5C35A 3UA4A 2NT3A 1ZI9A 3ESDA 3NOXA 4U5QA 5HKBA 4W5RA 5CYGA 1G7SA 1L4BA 1EVQA 2QRGA 2VHJA 2R8ZA 5COQA 5C8DA 3U6BA 3H2SA 1E4EB 2G71A 2VDQB 2OCPA 4AD8A 4IHAA 3LIIA 2MKDA 2CFTA 2XDYA 4RVHA 4UAUA 3KUKA 1UIRA 1B15A 3VR4A 3WGTA 4D99A 5TIIA 3BD8A 4EPRA 1WCWA 4OL9A 2H2HA 3NDIA 1LDYA 2H4XA 1GL9B 1H1TA 1HUQA 3AOGA 2GPIA 1EKXA 1A72A 4YV2A 4CHGA 4GGPA 3TLYA 2GZ3A 2AFVA 3EVAA 1Y33E 2QZZA 5EMHA 3T95A 4DREA 4UXIA 1F0YA 1D2GA 2B7BA 1TQ8A 2FPSA 4PAGA 1KA9H 1LLUA 5E6UA 5GVRA 3G2NA 4FZJA 3FMPB 3CZ5A 1CY8A 1OBFO 3JZFA 1X7XB 3LWBA 3N0RA 3QE2A 4IOLA 1RP1A 1D2NA 3TQRA 3DNFA 4GT1A 1DADA 2OMEA 2QN7A 2EBFX 2GZAA 2WE7A 3DYIA 3K1AB 4M0CA 3U48A 4DR3B 1JHPA 2D4AA 2V58A 4J6FA 4AYTA 2JIQA 2EN6A 2ZI5A 4BJ1A 5LMZA 4G07A 4QBIA 4H08A 3NBUA 4R6XA 2EGUA 1KNQA 3HCWA 1GL6A 3O94A 4DEXA 4W5OA 2Q8UA 5DN9A 4EZIA 1UR5A 4XVUA 1G2OA 4ZVSA 1XZKA 3U60B 5EP4A 4UOQA 3OE7A 1CUDA 4PCVA 4QRHA 5A69A 5DF1A 3R8XA 3Q8KA 2WNIA 4B0OA 3R9XA 3VU9A 4GHWA 1Y3IA 2J48A 3PCTA 2Z9BA 2C9YA 2OC4A 3ZDAA 4B8WA 3MBKA 2GTPA 3QF7A 3K0FA 1RW4A 3KNZA 4U2DA 4CQMA 2YTIA 3UK3C 2KLBA 4LRYA 5FJJA 3STYA 4P0PB 3K6JA 3ZI0A 5KQRA 1X0XA 4RD0A 1E62A 1WXXA 3K31A 1WXHA 4XFJA 3AVPA 2HF2A 3ZXUB 3CTPA 2YHIA 1EFPA 5K3EA 3NHKA 4GVPA 4K1LA 3EZ7A 4KWIA 2OSBA 4QOFA 2IZ5A 4YO8A 1U6KA 2EOXA 5TVKA 1HF3A 3L7LA 2BKXA 3Q1LA 3WGJA 3V3TA 5FX2A 3A2KA 2PYDA 4Q35B 5TPWA 4WSPA 3DJYA 3GLGE 2HPZA 4ARIA 2I80A 1UM9B 1LLQA 1WRJA 3DDOA 1JKXA 16PKA 5F9MA 2C4WA 1B6GA 1RC0A 1YMQA 3UT5A 5D3KA 4MQ5A 2KBFA 1C8LA 5EJEA 5JFGA 1E79D 2HV9A 3FKSD 4KO1S 3K5IA 2IS4A 2GRUA 4KQGA 5A9SB 1ZK4A 2BMFA 3KSUA 3MJFA 4WH0A 3SF8A 5BP7A 2VUUA 5KZMB 3QEMA 2H4FA 4E31A 1G7TA 4RLFA 3FPLA 3L7CA 3Q7QA 3DM5A 4P22A 3VZBA 1JZQA 2YHAA 4IKOA 4BFLA 1YJCA 4RY2A 5BV1A 2V7QD 4PXSA 2WVHA 3WSVA 4EKNB 2RONA 3MWEA 3GFOA 1JSXA 4G0XA 2XA1A 1SK9A 2YYAA 2VBCA 4S05A 4AWXA 2JGJA 3ICEA 3B82A 2EKBA 2NZXA 5KTMA 5B37A 4ES6A 1PT5A 3UB2A 3PEYA 2PS1A 3UQYS 5DHSA 4A27A 4EKIA 1J0CA 5IRCD 1ORVA 4YK7A 5J2UF 3EPLA 1JU3A 1PZXA 2DLQA 1N1GA 2VJLA 2UZAA 3A28A 2GAOA 3C3WA 2WE8A 3BICA 3GAZA 4GZ6A 4DVGA 1FSSA 4A8HA 4BVBA 3QFHA 4HP8A 3VHRA 2E55A 1T2VA 1ZCJA 1UK6A 2QTAA 3JQQA 1ORHA 3PF9A 1YSAC 4M2ZA 2VF4X 2VP2A 5KNBH 4KX3A 1SCDA 2Y4OA 4PSVA 1NYQA 2XUHA 3I9FA 4NOJA 2JJMA 1W0CA 3G2KA 3IQXA 3EIOA 3LGSA 3MXOA 5EP1A 4KFCA 4GZNC 3ZWOA 4OI2A 2BHRA 2DYKA 2ATXA 3EGXB 1A50B 3RKUA 3SGLA 3ZW8A 4EY7A 1XMIA 1KAQA 3EGIA 1TMOA 3B6IA 2AVNA 2J6IA 4HRVA 1SO8A 3GCDA 4TT3D 4H7JA 2WQ6A 2J0VA 1MC1A 5CLIA 2UXBE 3I8XA 3SSNA 4XSHA 4CUZA 4HLNA 3VTZA 3WR5A 2X9GA 1ADCA 1KJQA 3U4AA 1PR1A 1KI6B 1E4OA 2JKZA 2M1SA 3KKEA 3T1TA 4R2WA 4CM8A 1KPGA 2VF5X 1YQGA 4NU5A 1IB6A 1NX9A 3G0OA 3RSZA 4MMXB 3OAAA 4GC5A 4HADA 2PA3A 4AN1A 5KEIA 3AUYA 1BN6A 3P19A 4LFCE 4IMRA 4NZNA 1VKOA 3H2JA 4YAUA 3I1JA 3QPUA 1BJKA 1BXGA 1FUYB 1T2NA 2X14A 3F4BA 2EN8A 1GDDA 1ISGA 3LPCA 4REMA 3QW2A 3ZTTA 3MOIA 1O58A 2F3TA 3Q7IA 2PZKA 5D86A 2OCAA 1GPH1 2HC9A 4KKVA 1K88A 4RPCA 2G08A 1Z4IA 2P65A 3V48A 4JA0A 5L6MB 2B1RA 2LWIA 3P8ZA 3TJRA 1TJPB 1FMCA 3N2LA 3TOXA 1Y1RA 1E61A 4CRWB 4EUFA 2Y1OA 4N8DA 3TPFA 3TNJA 1XLUA 4NEQA 5DOZA 1RVDA 3RW9A 1UMBB 1H1LB 1W8IA 1XP5A 1NVDA 1RWKA 3GQBA 3MJSA 4XLZA 3UAYA 3HKCA 2J5QA 2WT8A 3JZMA 2EMFA 1OD6A 1GP2A 1RSZA 2LTSA 1UWVA 4J2TA 4TVBA 4Y2VA 2AUNA 4AF6A 4YYEA 5JQWA 5LWQA 2IHR1 1P2BA 2VYQA 4KV9A 5FNVB 4PXYA 1N9GA 2IZ6A 1EDEA 3I34X 4Q39A 3QKWA 3DR3A 4RK6A 2AFHA 1E96A 1OYOA 4KN5A 4UAVA 2DBRA 2BHNA 2A86A 3RI3A 4PNPA 4RHEA 3KJFA 3L8MA 3X2SA 4MW9A 4X85A 4FKBA 1IY1A 2YMPA 5HPYB 1PJ3A 4EL0A 2YVUA 3FDJA 5ALJA 3D59A 2V85A 1U6JA 4Z1MA 3VR6D 1AV7A 3IUNA 3HVUA 1GAJA 1KIMA 1FP7A 2YMMA 4WPGA 2BFEA 4OK6A 4W5QA 4QARA 4COKA 3FZNA 1DRUA 3LGXA 4TL6A 1R3UA 2GYVA 1PG2A 2Q1XA 1IAQA 4D4LA 3M6UA 3JWEA 4GNKA 4IZIA 1KQOA 1UBLS 4L02A 4Y7DA 2H11A 1KRWA 4XOUA 1YPNA 1PFVA 3WNBA 3LBAA 4HEA6 1VL8A 2F1HA 3FCYA 2QW1A 4BVFA 5JJBA 1AK2A 2NU9A 4N3GA 3SU8A 1JA0A 1FLVA 5CJJA 3RC7A 3TQMA 2X8JB 4JEMA 3ORSA 1RE1A 1TVMA 2FPWA 3NBMA 5BXYA 5IH7A 2EKQA 2C2WA 4O6VA 2EW2A 3SZ3A 2AZ4A 4UPVA 1SN7A 1VPDA 1LZLA 2R47A 3IB6A 4QOEA 3RYIB 4OFZA 4RTQA 5I4CA 4A10A 4DBLC 3CR8A 1E0KA 1XD8A 3PQDA 1V3TA 2D1QA 3E3NA 4KEAA 3KD2A 1XZBA 5F52A 3RK0A 4MDFA 4N49A 3O3MB 5ARDA 1G8FA 4AM8A 3K9GA 1CUHA 2OXEA 1U6IA 3BXEA 4LSZA 4NE7A 1OIXA 3EFOA 5BN5B 4D92A 3RS8A 3ECSA 2C07A 1B8PA 4EG7A 3LT0A 4BJ6A 4J7UA 4MTLA 3IKVA 1KPIA 5J43A 1E9RA 1JXAA 3GY0A 3L8FA 2Y2VA 4HXFB 4LJKA 2LVBA 1NXPA 2Q50A 2ZBEA 4QXMA 5F1PA 4EDHA 4GL2A 2UYYA 4QVIA 3IQWA 2DPMA 2QMYA 3D3JA 4QUKA 2J3MA 3N2IA 3OO0A 4I08A 4OH1A 4UHCA 5D6OA 2A5DA 2V0GA 3UWSA 1YA4A 3CZQA 5IEBA 1HRKA 1TAQA 2EW8A 2B7TA 2NX2A 2JRCA 3MMNA 2HA7A 4WKCA 4AJLA 1G4HA 2B4AA 3HPQA 2WUDA 3ADLA 4YQEA 2W70A 4AJ2A 2O2SA 3ADJA 5AI6A 4EHDA 2V7VA 3A37A 5BPHA 1O95D 5C18A 2H9YA 1PK8A 5DU2A 3KB1A 1UWLA 4PLTA 1FUIA 4CN9A 5L95A 3GA7A 5AR1A 1BX0A 1W29A 2R7AA 3UOGA 3F7OA 3B38A 2BGGA 3B6EA 1NT2A 3B89A 3DDWA 4GZ5A 2H7CA 5EQFA 3WJ2A 3ZBPA 5DTEA 3QWFA 4LCBA 3BBGA 1DLJA 2GHTA 2XNKA 2H7VA 2EZTA 4A0SA 5KINB 3V32A 2HRBA 1YR2A 2H00A 1ZI6A 2Z5VA 3GFRA 3MLEA 3PI7A 4IDHA 1VHQA 3KV1A 4WN3A 1HT0A 3QKUA 3LZ6A 3TKLA 4ARAA 3CLTC 4UM9B 4OVKA 4M37A 3D5QA 5K3OA 5KTOA 5CTJA 3BWMA 3IV9A 3OKPA 5EXEA 2UZ4A 2EWWA 1PT8A 1RWVA 3DBRB 4CBVA 1ZCZA 5KDOA 1RZRA 5JI3E 1E6UA 1I8TA 2AN5A 4I46A 1EFHA 1IAVA 5KTYA 3AVUA 2CZQA 4GYKA 2VRBA 3PUWA 4UKDA 5FDFA 1AZWA 1Z0FA 1UUFA 2CNWD 4RENA 2I6SA 4URFA 2RIRA 1PJRA 4RVCA 1N3LA 3B3GA 4UHBA 2DBQA 2VHWA 3RBZA 3ZV7A 1GPJA 4WY5A 2EHDA 1VHLA 2EOQA 2QYHA 1H85A 3TGPA 1REQB 1TB4A 1YRWA 4BWYA 1KJYA 4HV4A 2IE8A 2J6CA 1TGVA 2MR5A 3E48A 5LU9A 5BSHA 4WOPA 4BNJA 1AOXA 1UXGA 4DLPA 1ESMA 3DF7A 4RMHA 2UXDB 4A5SA 2P7IA 5HFAA 3GT4A 3E5MA 4ZKDA 3F7NA 1UILA 3NHLA 3KQHA 5KIAA 3BHIA 3KBOA 3ZIAA 1SK8A 2GCGA 4DM7A 5K6RA 2EM4A 3TZQA 3GN1A 1R74A 1U0BB 1XNRB 4KDFA 4Y2XA 4KPFC 1B43A 3QNUA 1H2XA 3G6WA 3E53A 4Q9AA 3VDQA 1PVOA 1R15A 4AIIA 2EPAA 2ZBRA 3IAS6 3JAMC 4EA8A 5T8KC 5TNXA 4AT1A 1ACLA 3VV2A 2VSQA 2E1PA 2HTFA 2XNDA 5DISB 5NULA 4X65B 3NMUF 2V4MA 3CVXA 2CD9A 2IXGA 1KR2A 2LNDA 1L7AA 3DE0X 1I14A 4R81A 2BI4A 5KNCH 3I0MA 2Q8QA 3PC4A 4UDYX 2RI6A 4H2DA 1L7OA 4DIMA 4E5PA 1QRSA 1PG5A 2XE4A 2G9ZA 4A8JC 2OYRA 1XZFA 4A8JA 3CONA 4P4GA 4C08A 1NR5A 4NH0A 2QLTA 1T9DA 1SD2A 5B4TA 1QGDA 1ZD4A 2H6EA 1DBSA 1FYEA 4NC9A 1BA3A 2BKVA 1OWPA 3B1XA 5CPBA 5AKLA 3GZ4A 3OZGA 4EJMA 4EG4A 2PIAA 2AW3A 2PSSA 3DOJA 1X3LA 1E1CA 4X97A 5FADA 1RKUA 4ZVTA 5BWCA 4B3MB 1JKJB 4Z4IA 5KAPA 4KREA 3A6GA 1JDZA 1P6UA 1V8PA 2Q3DA 3B8EA 3EG9A 8MHTA 1BE0A 1WUYA 2FEMA 4YY3E 3BZUA 4BO8A 4PO9A 1T36B 1PW7A 1WU8A 3FDIA 1WMEA 1D4AA 1JG1A 3VPDA 1MJFA 4GLFA 1J21A 1QKIA 3IRUA 3ZHUA 5LIPA 3B6MA 1RKQA 1TQDA 3WRVA 4RA9A 1Q20A 1TZJA 1CFJA 3KLOA 3O9MA 1J5EB 2ENCA 2NUPB 4C0BA 3IYLW 3FLMA 3FIGA 5EQTA 3CNQS 5DGCA 1XXLA 4BC0A 3H19A 3R7WB 1W30A 5B1EA 5AE1A 2BGTA 3J80C 1R0KA 2JAPA 1WP9A 1CZUA 3QTLA 1FW8A 4KFUA 5C1DA 2I6UA 2C4MA 4ER6A 3BM5A 5A7GA 2NO1A 1HE4A 5AE3A 1G6KA 3AC0A 3NYWA 4FD3A 4ZCSA 1UBDC 1JEOA 3D3WB 4IS3A 4QGGA 4DM4A 2VHXA 5E6SA 1JTVA 2BRUC 4ERXA 4CKWB 1GJRA 3UPUA 2AZMA 1W85A 2WD9A 2BMEA 1PUJA 3ITEA 5IXJA 4EKYA 3D2AA 3HBMA 3IB3A 4Q6WA 4C06A 2BL4A 1XU4A 1Q7TA 2R6JA 3A4TA 3GG9A 4UZSA 2JGIA 3UMSA 1VXOA 4BV9A 2FZWA 1T3ZA 2OD9A 1Y4AE 1RRGA 1DKLA 2YWDA 3CBGA 3TZBA 3IVRA 2VH2A 3I3SR 2ZZMA 1PJAA 1HFJA 5IAGA 2QGFA 3H1EA 1P4HA 3JZIA 3P0HA 3AKCA 1PSWA 2HM7A 1HZJA 1NDHA 2VQDA 2GUGA 2ZS8A 2C2OA 3K1JA 1J1ZA 2C8KA 2MSDB 1P1IA 5DHRA 1V35A 1OPRA 1GKKA 3TJMA 2FPGB 4FE3A 3YASA 2NXCA 3IWBA 1DXHA 1OF1A 1A71A 1UAYA 2CLHB 2EF1A 3EQ9A 3MYRA 3RBVA 4BFVA 4HQNA 2CL7X 4RORA 1Y6JA 2AQIA 3H16A 1ZLXA 1JEJA 2A5FA 2OZEA 3QQPA 4XUGB 1DHRA 1KFKB 1G9SA 4LCEA 5G4LA 1NXXA 4OX9B 1H2FA 4LYHA 5FPQA 3GNTA 3F2IA 4IMJB 4OXYA 4EJ6A 5JHHB 3B5JA 2LBSB 3FFXA 3CF6R 1ZGZA 3VNVA 2QI9F 3H5AA 1VPEA 4HK4A 4WZBB 1VKNA 3KAQA 1WABA 3TNFA 1Z5WA 3GDFA 4FMCF 1MO4A 3BL6A 1BFKA 4LDZA 4PVCA 4XSGA 4Y2YA 5B1DA 5KHAA 3TB6A 3KQTA 3IEMA 3K94A 3E3LA 4YDSA 2VPWA 2B7CA 3PCRB 3QU4A 4BCAA 4R6WA 4NYMQ 3D2LA 3HLKA 4KTVE 1U8FO 4BIIA 3R0IA 4Q9KA 2P41A 3PGMA 4WBNA 4ND1A 1FX0A 4FYWA 2NP7A 3N76A 3IC5A 2A0FA 3ONFA 1M8GA 3SBEA 4INJA 2AFIB 4ZK2A 3HJNA 1EFRA 2LTAA 1SOWA 4X1IB 2ETXA 1QPBA 3L6OO 1MB9A 1S8OA 3HJTA 3HU5A 3NVDA 4ND7A 1T1GA 3ZWQA 1B7GO 3BILA 2QE7A 4YRIA 2Y77A 3GFFA 5C9ZA 3H7IA 4GR9A 5CDFA 2M6LA 2IWHA 1YZYA 1U11A 3V00A 1E5LA 1OZHA 1JWLA 3TZEA 3IO3A 1IM2A 4IOJA 1JWAB 2EJ4A 3HZOA 5EWMB 2WYWA 2IV2X 3MWLA 2C9ZA 3RVJA 4LXGA 2JGMA 4EHAA 1YIOA 1HY3A 1N3BA 2FSUA 2ZWIA 3KKQA 3L7DA 5BUZA 4JSTA 3QEJA 3W6NA 4DPMA 3EGOA 5DVZA 4HB4A 1N78A 5EJMA 3L4KA 1FYFA 3AFIA 3N2GA 5L53A 3THNA 4DKXA 3TRJA 2HF8A 2YV4A 4WASA 1V8FA 1YRLA 1BH2A 2W48A 1Z36A 3MG9A 4P7FA 3SJZA 4BO9A 3E2IA 4RJIA 3CF4G 2J7KA 3BXGA 1CW2B 4FT4A 2JFHA 1KYXA 2HB6A 1I0LA 4ZU1X 3RGWS 4UBLA 1LX7A 4WFIA 2RK6A 1GZ3A 4F6NA 4B43A 1QNFA 1Q1ZA 1UDAA 4L07A 1N3GA 1E6WA 1RKXA 2GJ9A 1XDUA 2JI7A 1I80A 4KR2A 2FB9A 3RRBA 3W6ZA 4LZZA 1GFSA 3THWA 5JRZA 3O8CA 2HMWA 1T6ZA 2ZSUA 1DKOA 1IOLA 4D42A 3L1IA 3DE2X 4GOLD 5B3AA 1CVIA 3VHTB 1LBHA 4AZ0B 1SM4A 4PHHA 4XTRA 3RLFA 3O21A 1RACA 2GPJA 3CX4A 2PH1A 5ICSA 4MIEA 1ZK0A 3COPA 4RXUA 4DMFA 1SXHA 2HSGA 3AHDA 4HRXA 3W5DA 1RHKA 5CTAA 4QGAA 5DGXA 4MUXA 3L0BA 3PXBA 2WWWA 3B9BA 1J09A 4PV7A 3QITA 4RXTA 4WRRA 2FWRA 1NBME 1OZFA 4CM9A 1XCMA 2AC4A 2FZ4A 3VR5A 5MFZA 5DNUA 4JWTA 2VK2A 5KYXB 4ZARA 5T7BA 2GUWA 1ULBA 3KEMA 4D9BA 3NAQA 4TLEA 3DZIA 1DTWB 2QORA 5LCXA 4DR7B 3T99A 5C5IA 4R1OA 3FNFA 2X1HA 4HLQB 4LF7E 2KSQA 1VGVA 3GVHA 4M1WA 2EEZA 4LQCA 5LA6B 2JGFA 2H1OA 3I2FA 3RGGA 1T0IA 2JI9A 1W6UA 1N2XA 2F59A 4JQOA 3O4FA 1EGHA 2HMUA 3DMYA 4OQZA 3FRHA 2PR7A 2VAVA 1ZXBA 3B3QA 3G1UA 3PDWA 1SHKA 3RTAA 2UUBB 2ORVA 5K9ZA 1L9KA 3GEMA 3FCSB 4WOCA 5C1IA 1ZW6A 4HWKA 1KYQA 3WWYA 2APJA 1QV9A 1N7HA 1LFDB 4YA6A 1SBNE 4HT3B 1ATIA 1ORDA 3KDPA 5CX4A 3BXXA 4U00A 4X1YA 5EYPA 1OAOA 4JC0A 2J4CA 4C4PA 1C7ZA 1S4QA 1XD9A 3VDNB 4CR8A 3WYDA 4TWRA 2RB5A 5EXDA 4Z49A 1KJZA 2X4GA 3MTAA 2NVUB 3G3EA 5TGZA 3VR0A 4CLOA 4C7OB 1U2PA 1WUIS 2Y9MB 3PFIA 2YTGA 2Q6LA 5FIUA 3RU9A 4MUMA 2QU8A 1Y8RA 3A6DA 3CF0A 3FAZA 4FFVA 5H8WA 3RC8A 1RRMA 4NMXB 4U8HA 2TMDA 4C88A 1P6QA 2ZSKA 3M0EA 2PAAA 1S2IA 2FH5B 1VKRA 3KG2A 3M6IA 3PUZA 3BRCA 4NH4A 3P9NA 3W8DA 1JIXA 3VX4A 3DP7A 1JE0A 1C8BA 5K0BA 2WIGA 4QVKA 1NKVA 2YFKA 1TJYA 3ZV6A 3H84A 3LSTA 5LQKA 2D1TA 2YWXA 3BBLA 2XODA 2UAGA 1U7DA 4OHCA 1LC3A 2HAEA 4ZVLA 5ICFA 1A5AB 1P9WA 2JPAA 4N5HX 3AR7A 1VHDA 1YVUA 4M83A 4YAJA 1E5XA 3G85A 3UMYA 3T9EA 3C3PA 3FHTA 2YV3A 4JLSA 4OQMA 1BWRA 3UT6A 3MRXA 2ARKA 2QN9A 1BGXT 1NQTA 1Q95A 5JATA 2CXUA 4FFOA 1Q12A 1AN0A 4Q4LA 2AK3A 4BNTA 4YJHB 4LJSA 1OGYA 1HNWE 2X3UA 4CODB 3RTDA 4BL5A 1VYHA 2VDRB 2PUBA 3GPDG 3FOWA 1HWYA 4IYRA 5FAKA 4XX1A 3FNRA 1D9XA 1WU7A 2X6QA 3TAXA 4NIMA 4LF8B 2FZ5A 1BCSA 2LKDA 2R96A 2D4HA 4GPBA 1E94E 2XLBA 4I5DA 4IILA 3D64A 1GQSA 4KDEA 4PYMA 2C82A 2FP4B 4BNGA 1MMFB 1ZEMA 2F7SA 2A0UA 4Q15A 1ICIA 3V8EA 4F8YA 5B7NA 1CU1A 1WKVA 3NWPA 5CFMA 3WWDA 4DA6A 4EBBA 1DOZA 4L3VA 3S2EA 4BNDB 1RWQA 4L8GA 4D8TA 5KTRA 2J3HA 4OI4A 3L8CA 4FYMA 5LJLA 1GPDG 1IJBA 5G4KA 3NGXA 1WXGA 5IYZB 3A4YA 3ODGA 4PONA 4G1BA 5EQJB 4EHBA 5JSZA 3FMFA 4ZGWA 3WWEA 1QKJA 4F4UA 2CWDA 1XYVA 3E8XA 3JQRA 3U37A 5LSAA 3L1VA 4RDHA 3SYKA 4LF9B 2CMDA 1TM1E 2P90A 1RI4A 4PG5A 1IQ0A 1MAHA 4OV6B 5DPMA 1KZHA 5EINA 4M7WA 1DHTA 3PPYA 3KDSE 1P7PA 3DBHB 3PEUA 1ZA1A 2JHCA 2AC7A 4N41A 1RAFA 3KAKA 2HT6A 1XVIA 3QX9A 4IIUA 5JAIA 1W75A 3UYKA 2WKRA 4HLDA 1SUSA 3AY6A 3N58A 3R74A 3PT9A 2BFBB 4OLFA 4CLRA 4QM7A 2IBTA 1BDJA 2R7MA 2ODPA 1D07A 4LI3X 2ZCJA 1M2HA 1NI4A 3AHHA 4FFBB 1NUUA 1HTWA 3T7DA 4YRZA 7ABPA 3B6KA 3M6AA 3MTGA 3QA9A 2ZRQA 3VHXA 5I51A 4WBNF 1ZJWA 2YRKA 1I4OA 2FUG1 4Q12A 2DSTA 3O75A 1QWSA 4IVQA 4H9GA 1HR0B 3RSHA 3WHKA 1QTRA 1LDNA 1SXGA 3IGFA 3LG2A 1WP4A 1XXHE 1SUWA 4X7MA 5FAXA 3V7UA 4ZT4A 1AJEA 1K5HA 1L3BA 4DV3B 2WBTA 2G5TA 2XT6A 3EXFA 4OYHA 4CCYA 5GV8A 3DC2A 3UGKA 3PNKA 4KR3A 5JPIA 3FNBA 4BJ5A 1YZFA 2AKEA 4GE3A 3DFUA 1ECLA 4BNWA 1U0NA 1V11A 3BSFA 3G13A 3NHAA 3NTRA 4GS5A 5HRAA 2JCSA 2KI5A 2W6NA 3OLYA 3P0IA 4RKQA 4FYKA 2PRSA 3T06B 4RZ3A 4F9BB 1YJAA 4X6UA 5COAA 3ZKWA 3M6XA 1Q91A 2Q6IA 3SKVA 5KC9A 4NYJR 3U9LA 3HR4A 2IDMA 3AGPA 1QVVA 1ZMXA 1BE6A 1G3UA 4B3GA 1ODSA 1YRYE 1JDSA 1JSCA 4GQBA 1SXJB 4L4SA 3AYZB 1TYAE 2HCTA 4B09A 4U6NA 4QTTB 2BKUA 4E88A 1E7RA 4IHJA 4OP1A 3N75A 3QY9A 2Y05A 4DNXA 1O96A 1O0BA 1ECBA 1QZ3A 1YKGA 2W9XA 1CR0A 1M7BA 2I1QA 4RV9A 2PR2A 1VCNA 4HYYA 4EJSB 2WIDA 4FGLA 5H7XA 1S2DA 1DUIA 3CN7A 1N6PA 4IVPA 1KK3A 1FQKA 1N1EA 1WUKS 3AEXA 4HWGA 4IUDS 5AW5A 4DMLA 1XDDA 2YS7A 3SICE 4CM1A 4KQJA 3PD1A 4N0PA 4GLBA 2FCRA 1JEEA 5ALGA 4AO8A 3I9MA 3BH0A 2WZOA 4D82A 4EPYA 3CB4A 3QPDA 4NATA 2WF5A 4MQ4A 5LQRA 2GOYA 3OBBA 4L4XA 2OO7A 4YCBA 1H0SA 3CPEA 3CVOA 4OHBA 2O6LA 2SKEA 5AK4A 1O6FA 4PHFA 1GQQA 4RE6A 2IY9A 2IP1A 2I1VB 4C30A 2UYCA 1CUGA 2DM6A 3IEPA 3TF5A 1XRRA 4D0RA 1V16A 3AB8A 2RQLA 1W5FA 2PZGA 3DBVO 2IPNA 3EOBI 4PZDA 4V0OA 3K6KA 3R3WA 4CFZA 2GQ0A 4QTUB 3AEZA 4YCJA 4GKJE 1ZD9A 2QT0A 5BN1A 4DR2B 1OXMA 1XWWA 1Z3CA 3KOYA 4RTSA 5JS8A 3BE5A 1SZCA 3QFSA 4K26A 5DX1A 3BMOB 3R7AA 5FNZA 2YWFA 4PPGA 3UICA 3SX0A 1KEKA 2QUJA 3E22B 2ASEA 5BWBA 4J0FA 2ODQA 4YO7A 1RYEA 3T7RA 2D5IA 3BORA 5DTRA 2GKGA 2K7FA 1VCMA 3BA1A 3K6RA 3TZCA 1ECGA 1EUCB 1NXSA 3BFKA 3LUFA 1YB4A 2O0KA 4IXWA 2CXPA 5E7JA 4YAGA 5JVDA 2V0NA 2ZYWX 2D1SA 1BEZA 2G72A 3N2EA 4IVRA 3SLGA 1OROA 2Q8NA 2QPTA 1AGXA 1Z0JA 1Q57A 1AKYA 2MMCA 5IT4A 1C1XA 1ITZA 2V7XA 4FCWA 1E89A 1OAAA 3AI3A 1CERA 5TT1A 2BFNA 3U09A 1DUVG 2N3ZA 2R6AA 4R83A 4HQKA 3H5IA 2IZZA 2NO4A 2GD2A 4FDTA 4R2KA 2AG0A 4H9KA 1JILA 3X1MA 4RTPA 1UDRA 2I0FA 5J2UB 1DAPA 2C5LA 2P62A 3DJWA 2AF3C 2YOHA 4L3WA 4MITA 1DOHA 3OT5A 1VSBA 2IT1A 1RWMA 4GKAA 5ECGC 3TTWA 4BQSA 5JMWA 5IEJA 3SVTA 2X1LA 3HY3A 5GJVC 3VJLA 2QVCA 2XOEA 5IJ9A 3HA3A 3ZDRA 3DE5X 2B3DA 4RE5A 2R84A 3D9QX 3NASA 3BRSA 4R2XA 1QHHB 5EPUA 2F9MA 2G63A 2WYVA 3R6GA 1IVNA 1K7YA 4PX3A 4UOZA 1YDEA 2XYPA 3R7DA 4R1UA 2CT8A 2A9RA 3WDKA 1GDHA 5TSDA 4UQPA 1X1DA 3DC7A 5EN4A 4V02A 3WRYA 1OPXA 1SFEA 4INPA 1BGWA 4YT5A 5EJAA 1T35A 2GI4A 2QX8A 3JZAA 1IQPA 4G8DA 1J5PA 4UTOA 5H02A 5E38A 4ZCPA 4R51A 4FR5A 1R12A 1U28C 1UZAA 2EWVA 2XOKD 3E23A 4JP3A 3BB1A 2WABA 1KO4A 2C54A 3LY9A 5IARA 3V8NA 5AKXA 4AKIA 4HXYA 2Z2YA 4EIWA 2GNPA 2DFNA 3D6AA 5A5DA 1FVOA 5AW4A 2XVZA 1BBGA 1KEZA 1QVRA 2FEAA 5CCEA 1VE7A 3KXDA 4Y2GA 3SZGA 4DLBA 5IG2A 3RS5A 2PJUA 2GAIA 1VMKA 4X93A 4BVEA 3UMVA 4D3YA 3BQ9A 3O83A 1PR6A 4G85A 4N82A 3I37X 2P4UA 3FKJA 4W1SA 2PU5A 2PMWB 3Q0TA 5AH0A 5LD2C 4V2IA 4XWTA 4RMJA 1M2NA 5BV2P 2XZPA 4M30A 1TMGE 3IL2A 3MUNA 3CVYA 2E5FA 4LBWA 3K2IA 3Q8LA 3VNSA 4L78A 1PU2A 5KX5A 1D1TA 1MT0A 2MSKA 1MAWA 4JCCA 3Q3GE 5AOVA 2XQJA 4ISBA 2A30A 4XWWA 2YDXA 1L5FA 3U4GA 4XTCS 3IKLA 1CUXA 3R3YA 3OD5A 5AI0A 3RFVA 4B8YA 1XCJA 2AG8A 2OBYA 2FZVA 4W63A 2QRKA 1BE8A 2E4AA 4DV1B 1Q0PA 2VTKA 3GZTB 4F9CB 4XA8A 4ETMA 3PUJA 5JFOA 3FY4A 4L5CA 1KR5A 3IMCA 1W93A 3DV0B 5TS2A 5KNBD 4S3MA 1Z4NA 3CG4A 2V3WA 1X15A 4CF6A 4WXDA 1G291 2P68A 3PIRA 4KYTA 2OR3A 5FBVB 1QYVA 1C7IA 5A04A 1JBEA 3GFTA 1LK0A 3EGEA 3PRKE 1D2RA 2PKQO 4KLZA 4P53A 3THRA 3HB1A 4HUQA 4I2NA 1JQEA 3G0GA 2VR1A 4JI3B 1VPWA 1RZUA 1QZUA 1WZCA 3R23A 2J09A 4E7PA 4GXRA 4D6YA 1A1IA 4W99A 4KC0A 1GZHB 2HJGA 5CAEB 3UEOA 2VQFB 4BVKA 2BEUB 2HJVA 1R27A 4C0SA 1LLCA 5ENDA 1JQJC 3D2BA 5EHNA 3R6DA 4BDTA 3H1GA 3QE9Y 3RVDA 3C15C 4TRNA 1E9SA 1EDBA 1G6HA 4JT8A 2QRQA 4HTGA 4IWNA 3EF0A 5E6UB 1GZVA 2VWPA 3FPBA 5A62A 2R7KA 4J94A 4RJ2A 4WLOA 4NV0A 1PBNA 4Z9YA 4DEYA 3K9LA 4HPJB 1CZHA 1ZDMA 4FNMA 4QQ8A 4BNFA 5HCNA 1TF3A 4ACAA 2JRLA 2XNSA 2XWJI 4Z9AA 4IHJF 3ZCRA 1XAHA 3L40A 1H6BA 4U9IS 5JY1A 3V8QA 4L8NA 1ACJA 3GG2A 4P6VF 1XCPA 5K51A 3ZTWA 2UUAB 2I66A 3D02A 4XWGA 4J1TC 2ANBA 1B14A 3ZG6A 3U7EB 1GZSA 1WVIA 1O5TA 1Y9JA 2FGKA 3LX5A 3DZHA 5FUXA 2ZK7A 5I9TA 2QRUA 3LUBA 4UM7A 3K4HA 1NBIA 3CT6A 3R9XB 5AJUA 2UU9E 3AU9A 3VU9B 1V4VA 3R3UA 3JD2A 3IR7A 3WMFA 2IEIA 4TV8A 3CA8A 4U2GA 3VAAA 3ZLTA 4V1CA 2O8EB 1SCQA 3ZE9A 4FQ7A 5HIJA 2J3LA 1V2GA 5BSVA 1PJLA 3EISA 3HGMA 3K0FB 4CQMB 3KWRA 2XBUA 4D9HA 2Z2JA 1X2BA 1VL0A 1A9QA 3IE1A 2JFGA 2GYUA 2WSBA 3AF4A 2UUCE 4DMGA 3UH0A 4E70A 2PD4A 3P26A 1PO7A 4RJJA 3DFFA 3TCNA 4BO0A 1CDEA 2YHIB 1EFPB 1HL3A 3RUCA 4DV4E 4GRDA 4JLPA 4ENRA 1VIYA 2B94A 2VDOB 2ZSDA 1KDPA 4XIYA 5IN5A 5BR4A 1H9CA 4FFDA 1IN7A 2BUCA 4X61A 1UBTS 1F8GA 3BRWA 3IP6A 5KCMA 2ZUDA 3I4FA 2QJFA 4HKTA 3MLBA 4IDQA 1SGWA 5TPWB 1Z34A 2KMLA 3GRZA 4P3KA 2J7PD 2X5JO 2PAFA 1V8OA 1YHYA 2Q2OA 1ZHHA 5B4VA 1KHHA 1SWVA 2NO5A 3GYBA 2FOLA 2PQ6A 4JX8A 3UT5B 3RWMB 3QPCA 3TIVA 1ZN2A 3MB5A 1NZDA 3ANXA 3RVBA 3WKCA 4J1NA 4P3XA 4QUJA 3SF8B 4C7JA 7ADHA 1QU2A 3PEVA 2R85A 5FULA 3CLSC 4IIJA 4ZEXA 1CS4C 2VBIA 3R5TA 1P1JA 3EZXA 4NCJA 3T5MA 4EYSA 2ENWA 3PBKA 2VUSA 5JVDF 1FBTA 1IG3A 5JECA 5JAOA 1AMNA 2C0CA 3NEAA 1N32B 4DV2E 4JJ4A 1JI0A 3F0TA 2N1BA 1GCOA 5K0TA 4H4EA 1GQ2A 3OLCX 3OZEA 2HRRA 3H3FA 5DTQA 5EKDA 2HGHA 4LZNA 9GPBA 2DP4E 1QV6A 4V0LA 2NUEA 5JWHA 1G4AE 1XTQA 5KDDA 1MB4A 3TTTA 2FHSA 1Y34E 2AZTA 5IKOA 5LVAA 1ST3A 4TQUS 4X66B 4YGYA 2AJLI 3OQ1A 2M32A 2YVLA 4RY9A 3V7YA 4PHCA 4Z86A 3J81C 4D43A 3I28A 1T5HX 5IAAA 3CMCO 5F5XA 1Z56C 4HO1X 3FWPA 4RD3A 3ZK9A 2DTDA 5FUVA 3W06A 4EVIA 3BH6A 1XHEA 3GH1A 3M2TA 1NURA 5EXSA 1TF5A 2EPUA 1OJ7A 4F6RA 3U44A 1GGHA 1QRAA 5IWCA 3VJMA 4PC6A 1FVXA 4R2JA 5K3AA 4YCSA 5IT9A 5A4AA 2VHVA 4EUSA 2XGOA 5GIOE 1MC8A 4O4JB 4R7GA 2HKIA 4A0HA 1C81A 2BBTA 3IT3A 3VC3A 3ZJ4A 4EX7A 4X0EA 5DTMA 1H1DA 1GQOA 1UF9A 1U5CA 3IQIX 3L6DA 4F71A 4IJ6A 5AXDA 2Z9CA 3FH0A 3ZWXA 4YXWA 4NZ9A 1IBSA 3NPMA 4LK2A 4HUTA 4X9XA 5HW0A 4XDYA 2O7QA 1C3EA 3FPCA 4F3CA 1NF2A 2ECKA 4BKOA 4K87A 4M76B 1Q7RA 3PVSA 1TIKA 2Z1NA 2ZYHA 1F38A 2N0SA 4KYVA 4MUEA 3W9YA 3WLHA 4C5BA 4CM8B 1IOWA 1V0JA 5F33A 2XGSA 1ML4A 2QP4A 4PWYA 1O6ZA 4NJMA 5AKJA 1PK9A 3UK6A 4YT4A 1HEIA 3JVVA 4TMXA 3U3KA 3EIQA 4WGFA 1UKCA 3E5HA 1R6UA 3FUTA 4HDNA 3FCEA 1PQ4A 5A3QA 5LLTA 2O8BA 2J33A 3N9IA 3ZXXA 2C4TA 1BXGB 4S1VA 3ANSA 3ZV5A 3QTTA 1WXWA 1UINA 2NNWB 2WUFA 3L6BA 4Y18A 1RPNA 1ZWLA 2B69A 1HNZB 1NY5A 2IXEA 4M0LA 2CC2A 4G0UA 3Q9NA 1AXEA 2GHQA 1VSQA 1R00A 3PC6A 1V2HE 4G63A 3EEIA 4QDKA 3WKAA 1F9EA 3CE6A 3VR4D 2Q3LA 3X1DA 5CG2A 4QDJA 1U90A 4KQWA 5JJCA 4QXPA 1R4NA 1RE0A 2ZRPA 3HFSA 2JLRA 4GX5A 1DEXA 3N6VA 4NMMA 4F86A 1EM6A 4CHTA 1RQPA 1O03A 1C9MA 3E03A 3IDOA 3GQBB 5G02A 4UVEA 1WHNA 3D8SA 3HKCB 3R44A 2LPMA 4A5OA 3G9ZA 2H1SA 1Q0HA 3MWYW 4EG3A 5ICCA 3TUZC 3TTYA 1M0SA 1L4NA 3AI7A 5G41A 1N6OA 2FXVA 3GIDA 2G9QA 4QU9A 3WGGA 1QK5A 1N9GB 2YY7A 4OUDA 4B4DA 2MSWA 3RHTA 1EBUA 2AFHB 5PNTA 4G5FA 2B6NA 3BJMA 2YZNA 3K6SA 3A8TA 1W34A 2QYOA 3H83A 4JBLA 5AKZA 2HMTA 2VSYA 2WWFA 1J0BA 3QOWA 4LN1A 4OU4A 4BWGA 4C7XA 2HEGA 1LSOA 1NULA 1K9SA 1R5OA 2OAP1 1L7BA 3DHEA 4QYXA 4R84A 3RROA 2OQ2A 4MCHA 5HCUA 5FHQA 1YS6A 3GLQA 2AOVA 2PT5A 3N0TA 4IWYA 3VPHA 4OA5A 4B3RB 5LQUA 1FIUA 3TRHA 4CKYA 4R2LA 1DQPA 1VPLA 1JHAA 2Q49A 4MCAA 5AQ1A 5KNCD 1ZG3A 2ONKA 4R7TA 4CCAA 3C6ZA 1CR2A 4CKEA 2FR8A 3HKBA 3H0KA 1O94D 1DZ3A 5CT4A 1FSPA 2ZZNA 3ZWMA 5JWRA 2RBKA 2MU1A 3VO1A 1W8DA 2DFLA 4RCZA 4DF3A 1OFUX 3H1PA 3ABZA 1NVTA 3GAAA 5LFAA 2NNLD 4HQ6A 2YN0A 1R9NA 1UBMS 1XZIA 5T3UA 1ZBTA 4Y3UA 4OJMX 5K01A 5C8YA 2NU9B 1L7RA 1Z8DA 2B1JA 2YWHA 1E1RA 3UQZA 1KS9A 1R8JA 1CNMA 1WEKA 2X58A 3DPUA 4IIFA 3ADPA 4EGCB 4BC7A 1QCYA 2HPHA 2ILVA 3BK1A 3PHJA 1N4DA 4JFRA 4AAYA 5DLQC 1V4BA 4ZHQA 2XNHA 3HUNA 2ZKIA 1ADFA 4MWTA 2C7RA 1FUEA 1KP9A 4K28A 5BYKA 1U2GA 1OYWA 2ZRIA 4O4IA 2AMJA 2FF7A 3AZPA 3VOSA 1OZGA 3O73A 4DABA 3EX7C 1B23P 1ONBA 2JZCA 3K35A 2XWPA 1L8OA 3FSGD 2HR1A 1BEEA 4FFMA 3EASA 3TMKA 4ZJUA 3H87A 1QG4A 1W2GA 3GU3A 1OZAA 3BGWA 2KHZA 2BBGA 3EFOB 3I05A 3JQBA 1SIOA 3MHHC 2EMLA 4TV8F 4BBYA 1IM5A 3QFTA 5E3JA 5BURA 1G60A 1J90A 2DSNA 4DLLA 1G38A 1GWNA 2H63A 1XZPA 3CZMA 3RFCA 3K0CC 4D8VA 4AJ1A 2P6RA 4GMFA 3RSCA 3KPYA 2VSXA 1ABFA 1DBQA 1NSTA 3JALA 1H2AS 1UBUS 3X44A 2LUPB 2ISSD 2DFKB 2WT9A 1TMKA 2J9YB 3ELWA 4FMCB 4JLKA 3UBMA 2AF4C 3U5TA 2ZUEA 1JQKA 2NSDA 3KDAA 3O4GA 1YR7A 2WKPA 4IDFA 4LZLA 4AZ3A 1U7ZA 3GJZA 3NWJA 1X0VA 3UWPA 4F21A 1K63A 4Q9HA 5DGTA 1EPUA 1FVFA 2WA1A 3LO5A 1FFAA 2DHEA 3WHPA 4JEHA 1UKZA 3HU1A 3JVEA 4OKNA 3S2FA 1RI1A 2SHKA 4V38A 2WMNB 4CM5A 1WA5A 4WZAA 2GTIA 4I3HA 1NMQA 1XQ1A 2PEYA 4LNHA 4DLSA 2WOOA 4NEHB 4OPMA 4Q3OA 1Q6ZA 1CRQA 3L8EA 4OOGC 1NN0A 1T6NA 2YQ5A 4MRSA 1U3UA 4ZYXA 4ALMA 4R1PA 2ZI3A 4FX2A 5HM8A 2ZM6B 3HWSA 1RZVA 4IIJF 3V4RA 2Q29A 4EHNA 4PC3A 3QI7A 2PO5A 2Q3HA 2H4JA 3AM4A 3TW6A 3W05A 4QBFA 4XGRA 4XD7A 3SYTA 4P92A 1Q1AA 3LT2A 2FEXA 4L6AA 4IEFB 3EF1A 2GEDA 2VAPA 4V1CI 2H1CA 1E9BA 3AMVA 3KXPA 2OA0A 1MB0A 2P0EA 3FCOA 4RGQA 4DJDC 1IE3A 2I8LA 4UUPA 1DRWA 1YS7A 3K2EA 3NTQA 5E6RA 5U4QA 1YQXA 1QO0A 1BVUA 2GM9A 5B3JA 3DYBA 4B6JA 2ZYAA 1W36D 1T5LA 1CV2A 2PANA 2QQ0A 3UMCA 2BV3A 2RC5A 4KCGA 1JEAA 4TKUB 2P9GA 1Z5ZA 2WFAA 2YMLA 4FW8A 3IBTA 3GEEA 2NP6A 2ZPTX 3NEJA 2C8VA 4ARSA 3PHCA 1IN4A 4F11A 2Q2VA 1G6Q1 1BD4A 1L4EA 5LJIA 3GHYA 3G8CA 3TGLA 4FINA 6REQA 1L5LA 3OX2A 1PR4A 3CVJA 4DCNA 1GSIA 1XTKA 1IMUA 3RS7A 5HKLA 1KSFX 1DLIA 3O90A 3SHWA 2P8SA 4JENA 2JFWA 2DCMA 1CYEA 3QXCA 3K6QA 1T2EA 1U8CB 1T5SA 4MWDA 4UE2A 4D25A 4BHBA 1Q16A 2JC3A 3JU3A 4IGEA 2R0QC 4Y1EA 3NAZA 4UBKA 3L7YA 4ZAZA 4YWHA 2IVZA 3ENNA 4XH9B 3QXXA 2C2YA 3R5JA 5THXA 4P33A 3RYCA 2XCIA 5U9CA 4IS2A 3QLUC 1PHRA 3T9DA 4C9BA 2ZGVA 3IWCA 1EFDN 4DCMA 1PL0A 3O4IA 1SQGA 3GCZA 1ODCA 2REQB 1XWIA 3DBLA 5IV8B 1HZZC 4A8JB 2C95A 3FZGA 2D2FA 1X9GA 4IJUA 5G3ZA 2AC2A 1N25A 1O94C 4DA7A 2GXUA 1Z7EA 4N3CA 4OQNA 1UPTA 1SG9A 6CHYA 2GAJA 1NLUA 1SMKA 1WHSA 2AN4A 3AUKA 1FQWA 4NQZA 4NSNA 1YF3A 4LDNA 4BFCA 4QQRA 3M5DA 3I1IA 4FN5A 1AF7A 3S2UA 3KU1A 1DIAA 3MERA 1UT5A 1TAGA 5FA8A 4UTPA 2ZU0C 1H93A 3LI2A 3VGJA 3ZCVA 4I0WB 3U3MA 4B34A 5E7MA 1E7QA 2CZCA 1JZSA 1KFJB 1PZEA 4YNBA 2LUQA 1NVBA 3BS4A 3IMEA 4R41A 1JWBB 3UHAA 3ASYA 1I3OA 3PQ5A 4XWAA 2MC6A 1AQUA 2PTGA 1IDOA 1N36E 1XMVA 2DHDA 2RIPA 3G2LA 3P97A 4BLWA 4TZ0A 4UBMA 1MVOA 3SDZA 3X1JA 4R01A 2HCBA 3A2LA 4RA9B 2EC5A 2PWZA 2R2AA 2IA5A 1VJGA 4C01A 4UDOA 4I1PA 2P4SA 4ISCA 4BGUA 5FHRA 3QEBZ 4ARCA 1WBDA 4I1SA 3TTUA 4Q1VA 2EPMX 1VECA 3GA5A 3X1YA 1EIZA 4B45A 5BSUA 3GP5A 4MGZR 3U0BA 4BO3A 1NMXA