3C6KA

Crystal structure of human spermine synthase in complex with spermidine and 5-methylthioadenosine
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
363
structure length
335
Chain Sequence
GSRHSTLDFMLETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYEEIDSILNKVEERMKERVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human spermine synthase: implications of substrate binding and catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Spermine synthase
total genus 103
structure length 335
sequence length 363
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.22: Spermine synthase.
pdb deposition date 2008-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
A PF17950 SpmSyn_N S-adenosylmethionine decarboxylase N -terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 3c6kA02
3.30.160.110 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Siroheme synthase; domain 2 3c6kA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3c6kA03
5FTWA 2Z6AA 2OBFA 1BOOA 2BM9A 3CVOA 3THRA 2PWYA 2QY6A 5D1HA 2PWPA 3TPZA 1G60A 1G6Q1 2ZVJA 5LQUA 1SQFA 3UJDA 5GINE 3UJCA 3JWGA 3ER9A 4RTSA 4PYKA 3I58A 4HG2A 5E1MA 3LECA 3X0DA 4ER6A 3G2PA 2CWWA 3BWYA 1KP9A 3HA3A 3LCUA 2EJUA 3Q7EA 4MWZA 4EQZA 3P2EA 3FRIA 5EHIA 5CM2Z 4E31A 3BKWA 2DULA 3KPYA 4PYNA 4XUDA 2CMGA 3FUTA 4FSDA 4R8SA 4RTLA 3MERA 9MHTA 4E2WA 2ZW9A 3HNRA 4HTFA 3M6UA 5DXJA 3MB5A 4IKPA 1M0EA 2NXJA 1KYWA 4X60A 1DUSA 1SQGA 4QTUB 2N47A 1L3CA 1FBNA 1R00A 2P3OA 1JTEA 3KR0A 4PIMA 4RVGA 2ORED 4QQNA 5DTQA 2C7OA 2OY0A 5C9ZA 4X63A 3SXJA 3NTVA 3F4KA 4YUXA 3B3JA 5JR3A 2PBFA 2OO3A 2R6ZA 4FP9A 2OZVA 5DX8A 3KR2A 4R8RA 4DMGA 1VL5A 3P71T 3MTEA 3GIWA 2FPOA 5E1BA 2IBSA 3TOSA 2P7HA 4RV9A 3PVCA 5DTRA 3SX0A 5FWDA 2FHPA 2PXCA 4C08A 1I9GA 2NXCA 4FGZA 5DX0A 3LKDA 5HIJA 5T64A 5FULA 2VDVE 2P41A 1PJQA 4POOA 1ZGJA 1WS6A 4CKBA 4DCGA 2XVMA 2WA1A 2HNKA 2AN5A 4XCXA 1M6YA 1Q0SA 4QPPA 4A6DA 3E05A 1G38A 3VC2A 2IGTA 3C6MA 1ORHA 3BWMA 3LBYA 1PRYA 1SUSA 1YZHA 3B5IA 4Y30A 1AV6A 5EVJA 4AZSA 3RW9A 2V7EA 1JG3A 2G1PA 2IFTA 7MHTA 5T67A 2P40A 2GB4A 3A25A 3OFKA 4FT2A 4CTKA 3EGEA 3E8SA 5DM4A 4C06A 5K0FA 4WVLA 1T43A 1QAOA 3R9XB 2V74B 2ZBQA 3O7WA 3BUSA 2AZTA 5C1IA 1B42A 5FQOA 2XBMA 4AZTA 5K03A 2PX8A 3OE4A 1R8YA 3TKYA 1JQEA 2FYTA 4ZTBA 4PGGA 1Q0TA 2HWKA 5EKXA 5FQNA 2GLUA 2ERCA 3MCZA 5DX1A 4GUAA 4OX9Y 5KVAA 3BXOA 3FTFA 2FCAA 4RX1A 3GGDA 5E9WA 3G8BA 5GOZA 3GCZA 4A6EA 2QRVB 3EVZA 2Y1WA 1KR5A 3EMDA 1G55A 1OR8A 1P91A 3KPWA 5FA8A 10MHA 4HH4A 3DTNA 4R05A 4YUZA 1ZGAA 3ELYA 3LX6A 3KQYA 4R6XA 1KYZA 3TM5A 2O06A 3HVKA 2ZIFA 3HVIA 3KQVA 5DSXA 5CCXA 1IXKA 3GO4A 5DXAA 3QV2A 3C0KA 3GNLA 3LL7A 2XYQA 3PS9A 3R0QA 5IH3A 4CKCA 5BW5A 5K09A 3PB3A 3K6RA 5GIPE 3NDIA 1SG9A 3DOUA 3OE5A 5HIIA 5EMKA 5LQKA 5CD1A 5HZMA 5DT2A 1AQIA 2BR4A 5CIYA 1JG1A 1DCTA 5GIOE 1ZKDA 1BHJA 4C04A 1D2HA 5EEHA 2AN4A 2EX4A 3G5LA 1M6EX 1ZQ9A 4DF3A 3KQOA 1RI5A 3IEIA 4G56A 4YMHA 2GS9A 4CTJA 3KQSA 4BLVA 3VSEA 4GBED 4OQEA 3GRRA 3CCFA 4KWCA 4RTJA 3NWEA 3OFJA 2OPBA 3LBFA 4E2ZA 1XDSA 3G8AA 5E2AA 2GAFA 2PT9A 2O0LA 3LCVB 2JHAA 5EGSA 2VZ9A 4JXJA 4ISCA 1WY7A 3M6WA 1KPHA 5K8VA 3P9KA 3TKAA 3EVEA 2CMHA 5FCDA 3CJTA 3NMUF 4V0RA 4UOEA 1D2CA 1NV8A 1KIAA 3MQ2A 5DM1A 1X1BA 3JWJA 1O9HA 4KIGA 4RTNA 3SSMA 3KPVA 3PT9A 3CC8A 1XJ5A 4P7KA 4RTOA 4OA5A 5FWAA 5KS2A 5LQAA 3R24A 2OB1A 5G02A 4E70A 4P58A 1MJFA 2IBTA 3HM2A 3R6TA 5F2KA 3DUWA 4LWOA 5E9JA 1NW5A 2BR3A 2XVAA 2HTEA 4DM3A 4EKGA 2JG3A 5HOQA 2YQZA 1XCLA 1H1DA 1NW7A 2PXXA 1EAMA 1JG2A 5JUWA 4RVDA 5H02A 2AOWA 5K01A 1SVUA 5E1OA 5E2BA 5KQRA 4KW7A 1G8SA 5DTMA 4PYLA 2ZTHA 3B89A 5E8RA 4C4AA 3CJRA 5EMMA 5B1SA 1MHTA 3DULA 4PWYA 3FRHA 5F2NA 3I5UA 3T7TA 3KQMA 2GA9A 3KQTA 2G70A 5EC8A 1XDZA 3OCJA 3EGVA 5EHGA 5EZSA 5U4XA 4AZVA 4EMSA 3MHTA 3TLJA 3A27A 3TM4A 3DXXA 2UZ4A 2VDUE 4AX8A 3T7RA 2IDKA 3BKXA 3OZRA 4P7JA 4C03A 1EJ6A 1EQAA 5EZQA 4RSRA 5K0NA 3UZUA 3FPFA 4YUYA 2AOTB 5DLYA 3DLIA 3P9NA 3REOA 4RTRA 5ICCA 4YUWA 5E8JA 4M38A 2O05A 2PV0A 3DLCA 3L8DA 1HNNA 3P8ZA 1N2XA 2P35A 4LG1A 3PLAE 3JWHA 3ER8A 3C6KA 1R74A 5DWQA 2IH4A 5HIMA 3EVDA 2VS1A 4M36A 1RJEA 3KU1A 4XUCA 5GM2A 3VYWA 5ICGA 4OA8A 4EVIA 2C7PA 2AS0A 3OU6A 1R6AA 2G8NA 5DM0A 5ERGB 4E32A 3FUXA 1JQ3A 1RJDA 4FT4A 2HMYB 1O9GA 3M4XA 3FPHA 3UJ8A 1N7JA 3CGGA 3MGGA 3GDHA 1AF7A 3M6XA 3FYCA 4PONA 1QYRA 4QPNA 1FP2A 3DMGA 5K05A 1TPYA 3AXTA 3I53A 3BT7A 3M70A 2ZZNA 2C7RA 4FZVA 3IYLW 5CVEA 3UJ6A 2QYOA 3KKZA 4HC4A 5HIKA 1UWVA 2UYHA 4MHTA 2A14A 1FPQA 1ORIA 2AN3A 2YUIA 4RYLA 3NW9A 3HTXA 4ER3A 3ERCA 3SSNA 1QZZA 4RVFA 4DCMA 1XXLA 4RTKA 2ZCJA 4OBXA 2EG5A 1KYQA 3EVGA 3THSA 2JH9A 4LECA 1VPTA 3LDUA 4FS8A 1R8XA 5K0EA 2CKDA 5ICFA 1BC5A 3EGIA 3OU7A 5MHTA 4Y2HA 3FTEA 3RODA 2YVLA 1WXXA 2BH2A 4GOLD 4PYMA 3HA5A 5DPMA 2VDWA 2I9KA 2IH2A 3OU2A 1JR4A 3KQWA 2WA2A 2NXNA 2PX5A 1WZNA 3GU3A 2AR0A 1VE3A 3BGVA 4O29A 3NJRA 3TQSA 3GRZA 3PFHA 3T0IA 3O4FA 4X1OA 3C3PA 4KDRA 3BWCA 3GWZA 3KPUA 4CXMA 2IDJA 3FUUA 3JWIA 1YFLA 2YXDA 2ZBRA 3AWIA 3LSTA 4R6WA 3BGDA 2UYCA 1KPIA 2B9EA 4RWZA 2LD4A 4DQ0A 2P3LA 5HILA 4OQDA 3A4TA 4HTFB 2PJDA 4RVHA 1VP3A 2QM3A 3UJAA 5FHRA 2YXLA 3K0BA 3DMFA 4KVZA 4GC9A 2BZGA 3O31A 3LHDA 2EJTA 4HSGA 4YV2A 2IIPA 2PY6A 3HEMA 2P8JA 3FPJA 5EIWA 2ZIEA 3P9IA 4HGYA 3SM3A 2PT6A 1JG4A 2B3TA 5DM2A 3TRKA 5F2OA 4E33A 5DRYA 3DXYA 2VP3A 1P1BA 2NP7A 1L3BA 1RI2A 5IKMA 1R18A 2JH8A 5FADA 4B17A 1F38A 1NV9A 3HP7A 3KHKA 3PX3A 2ZFUA 3ME5A 5GWXA 2Z6UA 1EJ0A 3G7UA 5K0LA 4GOOD 1YB2A 2PX2A 3A7DA 1F3LA 2GH1A 2B25A 3KR1A 4PYIA 4F84A 3EEOA 2AOTA 2PXAA 4QDKA 1I1NA 3PTAA 3QOWA 2AOUB 1PJTA 4CWAA 1N7IA 3DMHA 3NVMB 4PYQA 2CL5A 5GP1A 3V8VA 3ID6C 3UA4A 2YTZA 5LR6A 2ZZMA 1L1EA 3FYDA 4WXHA 2HV9A 3KR9A 4E30A 2XYRA 1QAMA 3P2KA 1IY9A 1AQJA 2DPMA 3G2MA 1NW8A 4BP3A 5EPEA 2YR0A 1UFKA 2OB2A 3ELDA 3V97A 3OZTA 1KXZA 2AVNA 2B2CA 1X1DA 3B3GA 1VQ1A 2ZBPA 3HCFA 2AOXA 5EMLA 3EEYA 2PGXA 3D2LA 3TMAA 4M37A 3EPPA 4AZWA 3HCAA 3HVHA 2HR1A 2ADMA 5EIFA 4QDJA 2JHPA 2ONYA 5CVDA 4FR0A 3EVBA 5HFJA 2KW5A 3EVFA 1P39A 2JHCA 3BWBA 3G88A 4GEKA 4HRAA 1V39A 4OBWA 4PGHA 5EOVA 2UYOA 4K6MA 5BP7A 4U7TB 1QANA 5K0BA 4PINA 1HMYA 3ELWA 3FPGA 3P2IA 1VLMA 3P97A 3HCBA 5DRTA 1UIRA 3GRVA 1O54A 3A7EA 4E2YA 4P7GA 5BXYA 1NW3A 5CCBA 3UJ7A 1BKYA 4FSXA 4KIFA 3A26A 3VC1A 2ZULA 3OZSA 5K0CA 3H2BA 1KPGA 4BY9E 2JJQA 4MIKA 5LQJA 3LKZA 2I7CA 4KRGA 2E5WA 5CUQA 1SKMA 3AY0A 4GQBA 3T7SA 1EG2A 1SUIA 3HCDA 2OYRA 4PNEA 4DKJA 1YFJA 4KDCA 3AXSA 1XDUA 2QRVA 4L7VA 2NP6A 4GOMD 3GJYA 2P1DA 4RTPA 5CVUA 4IV0A 3FPEA 3NWBA 2ZWVA 4GOND 4C05A 4AUKA 3GXOA 3S68A 3KPJA 2I6GA 3DR5A 2Y1XA 3P9CA 1WXWA 1L9KA 2OKCA 1NT2A 2ZIGA 3EVAA 3Q87B 4YUVA 4HGZA 3R3HA 3WSTA 5DSTA 4PIPA 4XUEA 3LDFA 4ER0A 1YUBA 3LCCA 5EKUA 3HVJA 4Z2YA 8MHTA 2B78A 1JTFA 2IPXA 4ATNA 3NVKI 4YV1A 4X61A 1NKVA 5E9QA 4PYJA 2BR5A 5K0JA 1JSZA 3CKKA 3G89A 3BGIA 5FUBA 4RTMA 1RJFA 4IV8A 5P8WA 2O07A 3G2QA 3GRUA 3NDJA 1NBHA 5CVJA 5LQNA 4DA4A 1G8AA 3EVCA 4E2XA 3IHTA 4LWPA 2IH5A 1RJGA 1PJSA 1D2GA 2C7QA 1TW2A 5CVVA 5EEGA 1NBIA 2WK1A 3RIEA 1Y8CA 2BM8A 3KQPA 3QOXA 2G71A 5GM1A 4DZRA 2P7IA 4BP1A 2YXEA 3FTDA 2AOUA 3SSOA 4PCAA 4F85A 5FHQA 3HA7A 2EFJA 4EKIA 2G72A 3LGAA 4QTTB 1X1CA 5EG5A 5HEKA 2OXTA 2ONZA 3UJ9A 5LSAA 2R3SA 1KHHA 3DH0A 4H0NA 1QAQA 3OPNA 2O57A 2PX4A 5T6BA 3DP7A 4ER7A 3C3YA 2PLWA 4BLUA 1XVAA 2ZSUA 3BZBA 4V0QA 5EQJB 3M6VA 2PSSA 1RI4A 2FK7A 3HCEA 4EK9A 2F8LA 1IM8A 3ELUA 5BW4A 3B7PA 4YMGA 1Z3CA 3LPMA 1YF3A 1NW6A 5KQSA 1EIZA 5EMJA 5LQRA 1X19A 1RI1A 3MAGA 3UFBA 1DL5A 4X41A 4PYOA 2PVCA 1VIDA 1WG8A 3UJBA 2AOVA 3I9FA 4P7FA 2H00A 4QVKA 3B3FA 4M7RA 2AVDA 4QQKA 2NYUA 4F86A 2NNWB 2ZLBA 3DXZA 3UA3A 5ICEA 3AJDA 2Z6QA 1P1CA 1JQDA 3SVZA 3U81A 3G5TA 1ZHFA 1NE2A 5D1NA 2I62A 2K4MA 3CJQA 3I64A 3FZGA 1VP9A 2ZWAA 4IWNA 4RTQA 2GPYA 3ORHA 1U2ZA 3IV6A 1X1AA 4C07A 3ANXA 1FP1D 1XCJA 4ER5A 5KYGA 1FJXA 3FTCA 3SMQA 3E7PA 1VBFA 3PX2A 2H11A 2NXEA 3G2OA 3M33A 4QVGA 1JSXA 2Q41A 3TR6A 4NECA 2FRXA 3HCCA 1RI3A 1XTPA 2P3QA 3LDGA 4PCLA 3SR4A 2IP2A 3GRYA 2ZZKA 5K0GA 4YV0A 2ESRA 2YX1A 5LQCA 1I4WA 1PJZA 5M5BA 1TW3A 3MTIA 3KQQA 2PKWA 4MTLA 3EMBA 1YZ3A 4GF5A 2H1RA 5E1DA 1ZG3A 2UYQA 3TFWA 3PFGA 3CBGA 3MCTA 3UWPA 3UBTA 2FK8A 3E23A 3FUVA 4U7PB 3SGLA 5C0OE 4BLWA 1INLA 2QE6A 4GC5A 4CKEA 5FA5A 2XYVA 3FUWA 1L3IA 4MQ4A
chains in the Genus database with same CATH superfamily
4BDTA 2QN1A 1BCRB 4W6QA 4BQSA 1RT9A 1Y3BE 1UCFA 3ZD6A 2Q6IA 3EDQA 4TTIA 5K2MA 4TTJA 1JHPA 2Q5EA 3BFJA 1C3OB 3OQHA 3PNVA 2VA9A 1GN8A 1QZXA 3K09A 3KYJB 3DNFA 3MAAC 3SQMA 2AMYA 2O3TA 4C89A 1L6IA 2QN7A 3X0DA 1ZOSA 3IJ5A 5SYNA 1D4OA 3V2UA 4WOKA 3I0NA 1TC2A 4FFPA 3TD6A 4O43A 1DJLA 4R2RA 3FMPB 5E3IA 5KPJA 1EIWA 3F74A 4E31A 4GS5A 3BKWA 1H93A 5ENDA 3R0JA 5EP4A 1LPPA 2UYYA 4E2WA 5BR8E 3A32A 4GFDA 5L51A 4HTFA 1QFZA 4C6SA 4DYDA 3MB5A 4S04A 3O21A 4NV3A 4JI7E 2SKCA 5TEVA 2GN1A 4G25A 3LFUA 1RLMA 2C61A 3FF4A 1K6XA 4Q3DA 1MOSA 4TKLA 3TW0A 3SIPA 3FTQA 3ZH9B 1V8PA 2OXIA 4KXXA 4DMFA 1XZDA 5HYVA 3FDZB 3G2JA 5J47A 1MO4A 3DLBA 2FPPB 3L1JA 4LSMA 2OESA 3ZE0B 2RSLA 4M1MA 1M34B 2E2WA 1CJSA 3B3JA 2OBYA 1JKJB 1U2RA 2VJDA 1E9DA 4PC3A 2C8KA 3L6BA 4LYAA 3DEKA 1RLTA 5IC6A 1RRPA 4M76B 1VL5A 1CEYA 4J0DA 4L0DA 3E84A 5HF5A 3JQ9C 3JU3A 4Z5XA 3GZNB 3LUFA 1JUDA 3GMTA 3PDJA 4P3OA 2O2HA 2XNCA 3OIGA 4E11A 1IBKE 3IUJA 2HLNA 5LMUE 2VDWB 4FZJA 1GN9A 1RPJA 1NUPA 4POOA 2YU8A 1LK7A 3AHCA 1CR2A 1PLLA 3JQ8B 5KTKA 1EHCA 1CQPA 2O50A 5CLFA 2E9SA 4OGFA 4QOHA 1YI0A 1FB5A 1X5WA 1GTL1 2P4EA 1TCVA 2OHHA 4L28A 4QPPA 3WDLA 5KOJB 1GIAA 1ULHA 3ITNA 4HLCA 2MKNA 2PBLA 2PJZA 3RFUA 1BHO1 1WMBA 2BFMA 2ZREA 4RD0A 1SUSA 1HK7A 2C2WA 2R48A 2GDJA 3CN7A 2AG1A 4NMWA 1J8DA 1OZ0A 2X4IA 3ZHZA 1JG3A 3LT4A 1IOZA 1BMFA 4EHJA 3H86A 3ITKA 2O4CA 4MV7A 2BFCB 3WJ1A 3OFKA 4B81A 1Q50A 4JEHA 2X5KO 4ZQEA 2HC9A 2YQ5A 1FU4A 3BQNB 3A9VA 3HGTA 1UKBA 2H9AA 3HXMA 5LD2B 5FB3A 1BEUB 2V74B 1HGXA 3O7WA 1B15A 3CUKA 1GG2A 3OAAA 4V2UA 5FD8A 3H2ZA 3V8RA 1MX5A 3OX1A 1TKAA 3SHWA 4M0EA 4YRSA 2PX8A 1MNAA 4BQFA 3E2IA 2HBRA 3TKYA 3F4BA 1RRCA 1PUXA 4FLMA 2CCGA 1UL1X 4PAWA 5L7WA 1MAWA 2PU5A 1NQWA 2EOOA 2XMSA 3EBPA 3N3BC 5CLHA 4J0IA 1QBKC 4GUAA 2LCQA 2IOFA 1X3CA 2CLOB 1P29A 3V34A 3R76A 1SR8A 2X8LA 3PEYA 5GOZA 3BM5A 3I4FA 2VDKB 3OEED 3ZX5A 1AK2A 1E1DA 1L5WA 4DC1A 1U8ZA 4YJHA 4LW8A 4JEMA 4CZ2A 4M4SA 1OR8A 2PDAA 10MHA 1I13A 2WIDA 1NN5A 4BVHA 5IS2A 2YTOA 2NUBA 3A1NA 4YUZA 1I6LA 4MA5A 4RIGA 4QAJA 4XPIB 1R50A 4I8IA 4UVEA 1IBLE 1QTQA 5C31A 3L7IA 2BD0A 4Y1RB 4JGBA 4OK6A 5DXAA 2A5LA 4C4XA 3E03A 3ADDA 4QO8A 4U3JA 1EDOA 3PS9A 4GICA 1T4NA 4C87A 5BW5A 5CB4B 2J07A 2H1LA 2QNRA 2NV6A 2Z8XA 3E22A 4AMGA 4J8ZA 1SU4A 1L4MA 3OQIA 2NSHA 3GAZA 3WDMA 4Q9NA 4NXMB 2WKSA 1IEVA 5GIOE 1QMGA 4LF5E 1ODSA 5EEHA 3IV9A 4AUMA 1L7DA 2ARKA 1V5WA 2O5RA 4MWEA 3CZ9A 4OJYA 2PWBA 3I6YA 4WCFB 5G0UA 2HU2A 4MROA 5C8VA 1WP9A 2QENA 1XX6A 3LUPA 4P31A 5G1PA 3K6JA 4HYQA 1J97A 3GRRA 3W1VA 2GZ1A 3EGCA 4B6QA 1P7WA 1SULA 2FFBA 5DISB 3UKJA 5CA0A 3I23A 1S2OA 5E2AA 5B1IA 2CV0A 2I3ZA 1JG7A 2J9GA 3M3DA 1AKMA 4UPEA 1S2NA 4RPKA 1DQYA 2MMCA 4JXJA 3RIGA 2CHEA 5TS3A 4DN6A 1Y37A 1HETA 1BWSA 3T1TA 1I80A 1C8LA 4RJKA 5KSPA 4HLQB 1C9EA 3FKSA 4RF2A 5KNBH 3LT0A 2CSUA 3FNIA 1RXSA 3TWOA 1BVYF 3T4UA 3LNCA 4JA2A 5TGZA 3ETHA 5ADHA 2GN9A 1BS2A 1JHVA 1G1MA 1GZ3A 1NHGA 2AK3A 3U7GA 5JCOA 2NU7A 1Q74A 2F3UA 4M6WA 5FPHA 4IMRA 4DJTA 1Z4PX 2ROQA 3DPIA 2RCYA 4DV0E 1UK6A 4EKGA 3KEOA 3MD9A 1A5TA 4JBGA 3HBNA 1AD2A 1QU2A 2AFIA 1VL6A 5LP6F 3V4SA 2WKWA 3HMQA 2W2LA 2FZLA 5E2BA 1Z88A 5HQJA 1B74A 3ESDA 4JI2B 4BUCA 3QHQA 4BMYA 1QGYA 2CW5A 2FR8A 2JFOA 3W9BA 4E1BA 1Y3DE 4KLCA 5A9RA 2HCRA 2OOKA 2GZHA 4FDMA 3PFKA 4EGAA 2J59A 2EL6A 3URMA 3MCUA 2HF9A 2QE7D 4R31A 3ZY5A 3DWIA 4NFHA 1NUUA 2FOLA 3QPWA 5EZSA 1EUQA 5ABPA 3TNDA 1QHFA 2RGWA 5HUQA 1P8JA 3K5PA 1WSWA 1U04A 1Z62A 3MPUA 5K0NA 4BRUA 5CM9C 2I3BA 1FYWA 4RSHA 1HTWA 5DLYA 3TTSA 4OLAA 2NV0A 2X2EA 3JR3A 3R41A 4BO8A 5FPKA 2Q4EA 1TT7A 2GK6A 3OZ7A 2W48A 1D1PA 4KPGA 3PQ5A 5DB4A 3L5OA 4B35A 1CQIB 3FA2A 2W2KB 4BWGA 1KNQA 2OE2A 4PR3A 4D9HA 4M36A 5IMSA 4H6XA 4FYMA 4CG0A 1TF2A 2C9MA 3VQTA 3BIWA 2XE4A 4GWKA 3MGAA 4RNCA 4ND1A 4OH1A 3VYWA 4XDZA 4ZMRA 3SQNA 5JXWA 1HA3A 1QM5A 1E6MA 2AS0A 3CLSC 3BE4A 3EQ9A 5ERGB 3TLMA 3PQ8A 2H4XA 1YDHA 3BOSA 6PFKA 4F38A 3A3KA 3PGMA 2O0HA 2J41A 4WMLA 3EW7A 5C8YB 1UZAA 4AZ3B 3WK8A 3K15A 3H99A 3O8NA 2YJ4A 3MCVA 3ORQA 1ZEMA 4FNOA 4HR7A 1CZKA 1FX0A 4H27A 5K3OA 5A6SB 4U00A 2ST1A 3GYBA 1WUJS 2NX2A 5JCJA 3ZTTA 1WXHA 2VNKA 4G5QA 1PK9A 3ASYA 1NRWA 3I9V6 1M8JA 5DASA 3QBEA 4G0OA 3TR5A 2PUGA 1R27A 2V98A 4B3IA 1V45E 1X1QA 4X97A 3JYPA 3L1UA 4ZHSA 1HOXA 1ZU4A 5CCDA 3E9NA 5IZCC 4F6NA 1RRMA 1KYQA 1GGKA 3GD7A 1XQYA 2I54A 2FWBA 2GK4A 4KI7A 4CIWA 1VDZA 4V1CB 3ZE7A 5LDDC 4G0WA 1XCGB 4CIVA 3NYRA 3ZX4A 2BE7A 5TPZD 2GN0A 2Q1WA 5B6PA 3PUXA 3QIAA 1YQTA 2PX3A 2ZJFA 2PZBA 3OU2A 3J7AC 1KEEB 5FKJA 3C5VA 4LRUA 3GU3A 2I4OA 4HB2A 3S1AB 4GOJA 1GSHA 2EZTA 2WU1A 4KBGA 2JGFA 4JWKA 2EBHX 5IDVA 5ECGC 4OJNA 4M46A 4MW2A 1BW9B 2IHUA 4XB1A 4XM0A 1I7SB 1E1NA 2LVHA 3OCZA 1IYZA 4U9IS 1MG5A 4CXMA 3D5TA 4GSKA 1WKVA 2BT4A 3RS7A 1QR2A 1TD9A 2HCTA 2PGLA 1E0AA 3BGOS 3U7IA 2R4UA 3OE7D 4RWZA 5EXDA 1XMQB 4U6NA 4QJ3A 2WJYA 5JDIA 3BA6A 1JS1X 1RW4A 3Q1KA 3O82A 3HHPA 5B53A 2WJWA 2ZJ1A 4F2PA 1CZOA 4KVZA 4JXKA 4QGFA 3F46A 1G3QA 2QZJA 2PY6A 1OYVA 3FPJA 2X9GA 2B1QA 4CUZA 2CDBA 3EJWA 5C18A 2VP3A 2WBSA 4PHFA 5EA2A 1D7OA 1LI4A 2J30A 1B0ZA 2JH8A 3H2IA 4YACA 2EMZA 5JAPA 5E7QA 4EGQA 2OV6A 4WZ6A 2X4GA 4OL9A 3UMRA 4KJXA 4HN2A 2I6XA 4B4UA 1GUAA 3ZHYA 3LYLA 4ND8B 3O2SB 2AOTA 2RDMA 3PPXA 5IASA 3O92A 4EHBA 1C3VA 2PKYX 3GR6A 2X23A 3I1FA 4C01A 5B57C 3L06A 4K0KB 4URWR 3EVNA 3LJKA 2KOUA 1V6AA 3EODA 1V7ZA 4OIMA 4Z4HA 4HXYA 4O5AA 3UA4A 2Q3JA 3ECSA 5BSVA 5J5VA 3ZGNA 5IVPA 1MX1A 4I5FA 4LRXA 3SC2B 2DPMA 2PMCA 2V9PA 3KB6A 1E18A 1NW8A 1PGJA 4DUZE 3DFFA 3V6MA 1IHXA 1NFQA 3FNHA 3ELDA 1TJ3A 1RADA 1NQAO 3ZXUB 4PG8A 5JW6A 2CXNA 2VR1A 2V96A 3E7XA 2PNFA 3GFFA 4E12A 3E6AA 4JI5E 3ONDA 1GDDA 1LXCA 4Z0HO 3TMAA 4AZWA 4GMHA 4NXNB 3QVJA 1Z2PX 4I55B 2EPCA 1PD1A 1UC5B 3BIFA 2KW5A 2ZITA 4IH1A 2GWRA 4JUBA 2G6TA 1FU7A 4K6MA 4NSNA 1UFQA 2ZIXB 4DCPA 2HZ7A 4YNBA 1HEYA 1LV8A 1KJQA 1P0CA 2ID9A 2VEOA 3BDAA 4O02B 4PRYA 3SZRA 3QKIA 1UT8A 2A0XA 1QRAA 1ZS9A 1MR3F 1R6XA 2IU4A 3PLRA 4J29A 4R1NA 2DJIA 4LC1A 3C70A 1XLUA 3I5YA 3FCAA 2IS1A 3H7IA 2GLXA 4I6EA 3WTCA 3HL0A 2EMIA 4GBJA 2MYUA 3B70A 2RGRA 2GXSA 5F73A 3T7SA 4KDCA 2D1FA 3KOUA 1G63A 4Q5IA 3OMXA 5EYPA 3AR9A 5BN4A 1L5ZA 2CKMA 4AY5A 1DUVG 4MJLA 5JAIA 2ZWVA 2HPAA 2V6FA 1PZEA 3E9DA 4BBJA 1J23A 1R0LA 3JPWA 3KT3A 4LDQA 3TYXA 3EZNA 3ROMA 2I78A 3WBJA 4D43A 4DLNA 1RWBA 3DDOA 4D81A 1I3CA 4YCAA 1EFDN 5ITSA 1A5SB 4MIEA 1B2RA 2ZK7A 3DKPA 1GZ7A 2V7PA 4NLLA 4PLGA 4Z2YA 2X86A 2HJSA 4Q18A 1SBHA 1HR0B 5E9QA 2LNDA 3CEMA 3K7EA 4QYSA 1L5KA 2YJNA 5A4FS 4RTMA 1Q77A 2Q50A 1F2UA 2EC5A 3L7OA 3NDJA 4IQ4A 1Z07A 3L7DA 4QBTA 5P8WA 3LQQA 3WRYC 1G8AA 1WCWA 4U4AA 3WWPA 4E2XA 4B6EA 3LQFA 1EFUA 1M1YB 3QF7A 1TW2A 3Q3CA 4P4SB 1XNRB 4H59A 4B5KA 2RS7A 3VR2A 4BWFB 5INTA 3CNLA 3SDZA 3DUFB 4BP1A 3RUAA 3FTDA 4L4SA 3K1YA 3CEJA 1T2CA 2VQEE 1H94A 4JC4A 3PV0A 4H6PA 4ZCMA 2HF7A 2XGGA 4MCAA 4EVQA 5EZYA 4B2PA 1ZK4A 4NCNA 1HFJA 5G2OA 2EFDB 1C4OA 3WK5A 3E1KA 1DBPA 4WFKA 2IUTA 1Q7GA 2VDOB 3PUJA 3K9WA 4RPGA 3KZZA 3HCEA 4DLXA 4F91B 1I3NA 3TCKA 4OI0A 2J4CA 4L8GA 2WUVA 3FYUC 4X6XA 1EIZA 2OAEA 3EZ7A 3EA0A 5LQRA 5A3QA 1F14A 4MGIR 2J5XA 2G76A 4GKVA 3MGKA 4X5OA 3LT1A 1XZJA 1ZH0A 4K03A 1P1IA 2EG9A 3KYBA 2VTEA 2VHWA 1VHDA 3B6JA 5DHSA 2WSIA 5BSUA 1W4ZA 4BFWA 2DT8A 2XNDA 1G8GA 2VP2A 3ORFA 3CEPB 3HJHA 1M7BA 3C97A 4YMIA 3Q10A 2FQQA 4RESA 4ZJPA 5DI3A 3T12A 3KXIA 4L8WB 1ZEJA 3HBAA 5H59A 5EINA 2Q21A 1X74A 1FFSA 3D7NA 1BKSB 3G2OA 2ZWIA 3KXLA 3EPLA 3N6VA 1Z56C 4G81A 2QN9A 4X00A 5P21A 5TJ9A 4C4ZA 4YRKA 3KSRA 1MU0A 1TCCA 2XZPA 3WNDA 4BLSA 5TEWA 1KMNA 5H5JA 4E09A 3JQPA 5G0SA 3VO8A 2ESRA 4O8ZA 4BNMA 2WSBA 2XEXA 2Y2UA 1PUIA 4CBVA 3A2MA 3KXKA 2WWWA 3GBPA 3HDQA 3NC1C 1B23P 4FKZA 1GV0A 2I0FA 3HL4A 1TTPB 5AW8A 5C7IO 4UTNA 3EAFA 5GZ3A 3PC8A 1RMDA 2BI4A 3AR8A 1VCOA 4MW4A 3NHSA 3A0RB 2IUSA 3KD2A 4WFJA 4AURA 1UZNA 2XT6A 3FPAA 2BMJA 1VMDA 2C2MA 4O0LA 1JHMA 1KETA 1PAUA 1XIVA 4TVOA 4C29A 2Q6OA 1RVV1 1A5AB 2IZ1A 3M99B 3SM9A 4AL4A 2NUTB 1XN1A 2CXRA 3LI2A 4KBYA 4P5EA 3T5MA 5DM60 3HDVA 5IUNC 3RYFB 1C4XA 4HDCA 3T7JA 3L2OB 1KR2A 2R2GA 1D4ZA 5IM4F 3UWMA 1W5BA 1KOGA 1BROA 3P2EA 1AUVA 2NLOA 2O2YA 3PQ4A 1KJIA 2DULA 4D0RA 3K9GA 5C32A 4CMAA 1FZTA 2AHOA 1TMYA 1Z16A 2V88A 4RLQA 3O1JC 2YWHA 1DS6A 5IM4A 4TTAA 1CFZA 4Q93A 3M6LA 3QOYA 1N4DA 2CE7A 2OTCA 5A6KA 2P3OA 4LS3A 1I4DD 3TW8B 2XQIA 3GLSA 4QQNA 4CM5A 2WAMA 4MKFA 4X63A 5M7EA 4DUYE 1NUAA 1FUIA 3AV3A 3ABOB 5F5XA 3ZYCA 5MFZA 1LTKA 1YPNA 1MZVA 2ZB2A 1FRQA 1FQKA 4LXIA 2R6ZA 3N8GA 2OZVA 2NAPA 4GPD1 3ADLA 3I9JA 1ZR9A 3GA7A 4JJKA 4YP5A 4RELA 1Q0UA 3U44A 4FHFA 2IBSA 3S29A 1VE1A 3EDYA 3PVCA 4ENQA 3KQUA 4WTOA 3BILA 3NJ8A 2AI1A 5AW2A 1SQ5A 4ZU3A 2C1XA 2GZMA 3UW3A 4NQRA 2Z9BA 1PDVA 2IYAA 3G0IA 4TTQA 5F4BA 2RAFA 2ZYDA 5K0TA 3BC1A 3WZMA 3DA8A 2B4RO 5IABA 2C77A 2PIDA 3VZPA 1G2DC 3A6HA 4G8DA 4JJEA 3MW8A 1Y4SA 1IB6A 1RLOA 1VKRA 4LZJA 2D1TA 4LRQA 3FF1A 2CHUA 1H2RS 4Q1VA 1TEVA 3JAMC 4OCZA 4Q24A 4LTNA 3PCRB 3B3AA 4G5RA 4M99A 5J4KA 2V7EA 1PFWA 1SBIA 3O84A 1FXWA 2GETA 1JNXX 1Y8ZA 1DQZA 1R9JA 3KOYA 4H16A 4QJ4A 5AHRA 2GEJA 3T52A 2QE7A 3IAS1 5J40A 4DWJA 3S8YA 5CFZA 1QQAA 1ZWKA 4LIPD 4XQEA 4U7GA 4GGOA 1AN9A 1PR5A 2ZVQX 1GPYA 3COVA 2JARA 1G5RA 4Z4GA 3DTTA 4F5DA 2HXSA 3UN1A 1R8YA 3KL2A 2LKCA 4FFMA 4UTVA 1SN7A 4I1SA 4C1BA 4ERXA 2BHRA 3EIOA 3K5IA 3GGOA 3RTGA 1JFSA 1SC3A 2YWEA 2NVUA 4WPYA 3KEGA 2GPAA 2QTBA 2ZJ5A 1U5BB 2NVBA 3O4GA 1XZKA 2C9BA 2CLMB 2HWXA 3I05A 4FEGA 4FS3A 2F9LA 1E6LA 3FMFA 4V3CA 3RJTA 2B37A 2EWVA 4TWZA 4XOIA 3LPDA 4YRDA 4KR9A 1M6VA 2PWZA 3EOAI 3AF4A 3HDGA 5BMVF 4QYTA 1VPEA 1HDCA 2NU9A 2Q8UA 4R2LA 2IYYA 2JA1A 3ABSB 1E9VA 2WBTA 1EFTA 3RU2A 4BPRA 4F21A 1BBGA 1QSGA 2V58A 5JRZA 2VDLB 2WMOB 5ALMA 3DE0X 3QITA 4L6AA 4GZNC 1E5LA 5EWMA 1MVNA 4GIBA 4AX4A 5K4GA 2EEZA 1HRDA 3AQIA 3EOBI 4ZO7A 3UQZA 4NCKA 3Q15C 4ZZ3A 2Q3LA 3INNA 4KCGA 5IEBA 4ND3A 2B4YA 2XB9A 4EUKA 2PV7A 4L8YA 4CT5A 5DVZA 3NPAA 3R7DA 4CJXA 2VJBA 2B3TB 3HQ1A 3L6OO 2ZJAA 4DSNA 1UDXA 4QUIA 1HEIA 5AVKA 1LNSA 3RFXA 2ETVA 2YPNA 4J9UE 4M0DA 2GS9A 1J0CA 4IQFA 4CLXA 1E2JA 4YAIA 5IKEA 3I1IA 3R5XA 5A6JA 4OQEA 4YAUA 1YZKA 3ETEA 2ECOA 2LUQA 1S1MA 2QYHA 2BI8A 2GESA 1L8XA 5CJPA 4TVSA 3MT9A 1CZLA 4YCJA 3K94A 3G2KA 3GW8A 2VXCA 1UK7A 3BMOA 4S05A 4ISBA 5KTPA 4KGDA 1PJLA 2VZ9A 5EGSA 2D7JA 1QIIA 1OIXA 2CF6A 4UUQA 4I4TF 5ARDA 1U94A 1CR6A 1YI8A 4TVKA 4RWEA 3TLZA 2D1RA 3GG2A 1OI2A 4AROA 5CDSA 3K73O 2Q3FA 4O2BB 4BC9A 3DZHA 4RTNA 1GSAA 1R0BA 3KT0A 2Y1OA 1EJBA 4KPYA 1WMDA 2PG3A 2LUOA 3FX2A 1BD4A 1GCAA 5JI3E 2HOQA 4RUKA 2YW2A 2P1RA 3H2GA 1WSDA 3D7KA 4ANFA 4DSOA 4JUCA 3DHEA 3BK7A 3SP1A 1FYXA 3ABIA 3MWLA 2FW0A 2GXQA 4I0WB 3CUUA 1XCLA 1NW9B 5A1TA 4PZZA 2UU9B 5AM1A 4EHNA 5K01A 1HWYA 4R1LA 4PPGA 4KW7A 4L9SA 2R6FA 4HAXA 4YFYA 1OBOA 2NZ8A 1T91A 4RU1A 4JL5A 1Y5IA 4HN9A 3K5WA 1T38A 1JDZA 2A9QA 4DQLA 1RKXA 4QGAA 4J07A 3TI9A 2ZIUB 1P6XA 1L4SA 2VCEA 1HT3A 3PQ6A 1OMOA 2VT2A 5DEIA 4AZVA 1IQSA 1SA0A 2ZATA 4U7DA 3F6CA 2UZ4A 1G5IA 3Q7RA 2HSJA 4AX8A 1VCNA 5BORA 4BHBA 1VIMA 1XL0A 4G5SA 1NTOA 2RK3A 2QW8A 3R5TA 3ZCXA 5BSEA 2JPDA 2HYIC 1H1TA 2PK3A 4RDIA 2Y27A 1B1CA 1UXJA 5F64A 2JIZA 3KVYA 1J0XO 1Z7BA 3K8YA 3Q5GA 3VMMA 3X1JA 1Z6ZA 1XZQA 1D2AA 1XVIA 3PLAE 1Z8NA 3A10A 1SBZA 1QLJA 4IIFA 3DS8A 2PNJA 2BEJA 2KBEA 2HCFA 3EZXA 1WXEA 3C8UA 2XCQA 5HIMA 3TD9A 2E6UX 3QEKA 4NZVA 1D3AA 2L17A 2EQ5A 2O8FB 4LJSA 3ABRB 4URYR 3KZMA 3ISTA 4OHYA 2VRBA 5E0OA 4EVIA 4KVGA 3M82A 3HY3A 4MP8A 4P4GA 1HF3A 3HHEA 3PC7A 4WE3A 3I30X 1RXWA 4BX9A 4IJMA 2AKYA 1BEEA 2O23A 2ZSJA 4JLNA 4AMBA 2ET6A 3JAKA 5ARCA 3FPHA 3WISA 1MMFB 3WLPA 5JJIA 4CFSA 4HQNA 3SQLA 4QOGA 4EB6B 1SBCA 1O96A 1DFGA 1UOOA 2VT6A 4IMPA 1MNQA 1TM1E 2QP3A 4MHOA 4C21A 1B43A 2DFPA 2Y1FA 1P1FA 3WIVA 3L40A 4F9EA 2DSYA 3KELA 4BIIA 3BX1A 3TIVA 4A16A 1F5NA 5KPDA 1GQQA 3EIUA 3RC9A 1XDBA 1GPBA 2Z9DA 4R8KA 5KTRA 1YFHA 4IVNA 3GVIA 4JIMA 4B71A 5A6VA 2B36A 1OE0A 1XXLA 1Q0ZA 4TXJA 3EDOA 5C7LO 3AF6A 1GQOA 1J5PA 4UVDA 1QJCA 4N3NA 4QARA 1DWOA 1PF7E 2WAOA 3HKCA 1JNYA 4KSYA 4AWXA 1KVTA 3OEYA 2R2AA 1P47A 2H4FA 1A1GA 3JRXA 3FTEA 1ULSA 2GJ8A 2REXB 5KL2A 1XNQB 3C41J 2A9JA 2AQKA 3HR8A 1XHEA 3ACCA 3GCDA 3PSHA 5DXFA 4G41A 4I5DA 3OO1A 2OSVA 1YYOA 1WTAA 3NJRA 4RO0A 1WZIA 2RGUA 1XVTA 1Y7TA 1UAGA 1GPUA 2IU3A 3EGDB 3KJZA 3OIWA 4FONA 4HDKA 4WNIA 4X8LA 2YOFA 4OHZA 2P30A 4CM4A 3LYUA 5KNCD 4KN6A 4C76A 3GVPA 4ZOLA 1KPIA 1K97A 3H19A 2XDQB 2Q9CA 4G4GA 5TT1A 5IJXA 2I22A 1YE5A 1AB5A 2Q49A 4HTFB 4JBIA 1BH2A 3TD2A 4PICA 4Y2RA 4JAVC 3K0BA 4RS3A 4U2KA 3O31A 3ZE1B 2N1MA 4HSGA 4MLVA 1O97D 4HVTA 3HEMA 2E4UA 3QE4A 3LUJA 4GW3A 3T9EA 5JAMA 5C52B 5G53C 2BVNA 2C9ZA 2E18A 3GQBB 4D8TA 2DQ4A 1PT6A 4I1OA 2WLSA 4RA9A 1X77A 5A4JA 5LBIA 2WF6A 4LZZA 2HRDA 4N41A 1MFPA 1EWRA 3SX4A 3ZW7A 4YAGA 4ZJUA 2ORVA 1YKFA 3W1WA 3QMVA 4ESOA 4G9EA 4ZV7A 1U3VA 4HMQA 4BP9A 1NJ8A 1XCMA 4P36A 2HHAA 1P5ZB 5EWMB 2QD4A 3VPHA 1CD5A 4CI9A 4MWTA 5AM3A 3CIFA 1DDIA 3AU8A 3KLPX 2CL7X 3TXYA 2JAOA 5ADZA 1HM5A 1N6KA 2GN4A 1GQRA 2ODEA 4CWAA 2ORYA 3E3MA 1NF9A 2EJVA 5ALEA 1V25A 1B6SA 1DJQA 1EM8B 4MLCA 3DONA 1U7WA 3GGGA 4QGGA 5B6JA 4FB4A 3UWSA 1AO0A 1F1BA 3GP8A 1VG0B 3WMWA 2P5YA 2QN6A 2MMGA 3FAZA 2RI6A 1XC7A 3GCGA 2XNDD 4II3A 1UFKA 2PMKA 1HDOA 4E13A 4RHUA 2ZI3A 1H22A 5B36A 5FR2A 3OJEA 1IHUA 2C2GA 2DHRA 4GZ5A 4U2BA 4ENSA 3RMPA 3NHFA 2B69A 3NBZC 4R2SA 1XXHE 4BB5A 3BGWA 4RY9A 3G82C 1MJHA 5DNCA 2XYHA 1Y33E 1ECGA 2BFCA 1PR1A 5HFJA 2F3QA 2JEOA 4FI3F 1BJRE 1NULA 2CFCA 3CG4A 4PNPA 3S28A 1GRQA 4BVLA 5BP7A 5SY4A 1XJ0A 1XTZA 2ODRC 2EPAA 2GHFA 1U9IC 1YU9A 4KRXA 1LSJA 5TXGA 3UXHA 3W8FA 2AG6A 1C1YA 1NN1A 1XD8A 1FMJA 1YB1A 3NV7A 2ADRA 3URKA 4EYOA 4R03A 3PD7A 4H0FA 4NY1A 4DYHA 2BFNA 2OG1A 2QLLA 3CZRA 4QASA 1DTSA 2IZ6A 5E6RB 2AFVA 1YBFA 4A8JA 2PKXA 1KJJA 3QRWA 4TLEA 3AFIA 3FIGA 1OFUA 1MC8A 1R88A 2H92A 2J3QA 2JJQA 3AI3A 1W73A 3CNHA 4JNKA 1AOXA 4ROSA 4ZAGA 1QPGA 1FKAE 1V7CA 4R2KA 2GEBA 1E1RA 1TTHA 3CLSD 3VR6H 3N0TA 4E5VA 2VSQA 4QU8A 4YQEA 5M3BA 3G7SA 1E32A 3F0TA 4NP6A 3EXHC 2BTEA 3ILHA 3F90A 5SZIA 4AJNA 4KODA 3RSSA 5KNLA 1IMUA 1F0KA 1I4EB 1WTCA 2R96A 3BH6A 1NT2A 4YO8A 1Z6AA 4FEYA 1SHUX 2DVMA 5CX4A 2A5DA 1RZ3A 2QGZA 4NJOA 4LOAA 5JAOA 5EKUA 1U28A 1HYHA 3UT5A 4XLTA 4ATNA 4HEQA 2A30A 3U80A 4MKGA 2BR5A 1TA9A 1JSZA 3PPIA 3R5SA 2OM6A 5FUBA 4LFCB 2WWVD 5BN5A 2EPZA 4CKYA 3PQ3A 5FDFA 3HKBA 4AP5A 4OHBA 3L6DA 4AUNA 2UXDB 2FMTA 3NDRA 4S1PA 1GZSA 3VHXB 3T8YA 1XTKA 2J1LA 5I7WA 1K8ZB 3VXKA 3GLHE 4JKIA 1O95A 2WWXA 4H18A 4C6TB 3QF4A 4DBLE 4RJLA 3P45A 2BBGA 5LA6B 3QU4A 4ETNA 4F85A 3IE1A 2VLBA 1LDBA 1RQ7A 3UNXA 1LPSA 5SYAA 2OXTA 5GTDA 2M9MA 2QX8A 4IIUA 3ICWA 2PUDA 1X70A 1H5QA 9ATCA 4BQQA 1U7XA 1EHIA 5KSWB 1YCHA 3KUUA 1REQB 4RSMA 1BCRA 1IRXA 5KHAA 2NUTA 5I51A 3GELA 3BICA 2L33A 2K7IA 1H8HA 1RQPA 3LHFA 1U1CA 1BE8A 4AMYA 2CCKA 1YVEI 3KB2A 4W99A 1JEDA 2G77B 2UXCE 2PR2A 3CB4A 5I7AA 1BOFA 4ACAA 3QFTA 4QNMA 2H3HA 1KTIA 1EAYA 3RAEC 3EW9A 3B7PA 5AVYA 2VJMA 1RBYA 1YZYA 5DHFA 1QQTA 4YDRA 2F67A 1UM9A 2BZ0A 4JX8A 1ZGGA 4RAOA 5ENVA 5FUMA 3TQMA 2CLIB 5FXMA 3GJRA 1N6LA 3DZJA 3UYLA 2Q5QA 4MB6A 3TRHA 5FBLB 3I9FA 2P0EA 3KT8A 1H8ED 3HB1A 1P3Y1 2IK8A 1Z0UA 2HO5A 1NF2A 4Y6SA 4JXXA 4DV5E 4QQKA 1EDDA 1RHQA 4W82A 3TQOA 5IVHA 3AJDA 1JAIA 4QA9A 4X6LA 4AULA 5L40A 4NS4A 4RHTA 2LDBA 2JY9A 3R7WA 4DR5B 1LRKA 5IARA 2I5PO 2REQB 3TNFA 3ZGOA 4BE7B 1TXGA 3QVSA 1BQEA 4OIFA 3S8MA 1U2ZA 3GIDA 4UBNA 3A4VA 3HDHA 1ZJ5A 2H31A 5ER9A 3ZWOA 1XXHB 2YJ5A 4GAEA 2RGGA 1IY0A 2QTVA 3EUFA 1ORVA 1GGHA 3QEOA 4GI7A 1G1AA 4KO8A 1T9BA 2PFGA 3B2EA 4N4RB 2QXTA 2E4YA 4BUZA 1ZVQA 4D6XA 3DNPA 1UEJA 3RWBA 3M8KA 2IP2A 2RBKA 4R7GA 3UK6A 4AK9A 3AJ9A 5DLEA 3CUTA 1AY0A 2LTRA 3C3EA 2ALJA 1YJAA 2R60A 3KQLA 3JSAA 1ND5A 4RABA 3FYHA 1JH8A 2W6OA 1RYFA 3K9FC 3E23A 3WHKA 2RH4A 3IWBA 2JEYA 5FOWA 3ZCUA 3KXDA 4DQVA 3CLTD 2TMDA 2ZBEA 2B8NA 1CDDA 5LYYA 1CEEA 4NENB 4D9KA 5IV8B 1GA6A 3OFND 1W1WA 2FJPA 3FKJA 3PXXA 5L8VA 2Z6AA 1BCSA 2QM7A 3UWOA 4DWVA 2B8EA 2XRYA 1OH7A 2PZAA 1YAJA 3PQCA 3H2JA 4MCJA 1LZLA 1IK6A 1YVRA 2OV8A 3GN1A 2B98A 4GXNA 4P22A 4QTYA 1V4NA 4BC0A 4D8WA 5GVSA 3KUXA 3KVRA 4BDSA 3JSXA 4IHKA 1LK5A 3GFRA 3RJ9A 1XEXB 2C9OA 3RROA 5KOIA 3K71B 2ZDGA 3TSYA 4IIJF 3FSEA 3QVXA 1MC1A 2Q1XA 1H3EA 3G2NA 3MERA 4JZYA 1N1DA 4DR4B 1CRPA 1V35A 3M5DA 1JQAA 3HJTA 2QD1A 1RM0A 3IDZA 2K6GA 4JYCA 4OQYA 4M0MA 4NZYA 4EHLA 5JFGA 3JQRA 2EF1A 5TGDA 2FGGA 3K6SA 1I6KA 1FUUA 4YLEA 3DWFA 1Y4AE 3KLBA 1PJ8A 2QLJA 3L0YA 4PXYA 2FFJA 1G7CA 1TT5B 4TSFD 2OHVA 4AXXA 2G09A 3DBLB 5HA5A 5C9ZA 1XOIA 2DFTA 2NSYA 3NOXA 5A4DA 5KHLB 1KOJA 1DRWA 3E9MA 3HZRA 4G0YA 5DYIA 3I01M 4A27A 4EGSA 2F9FA 2PRYA 4PZDA 5E1BA 3TOSA 3O1IC 2NM0A 1NMYA 1KWGA 4IFBA 4HNQA 1IJKA 3UK2A 4DR6E 2PH5A 5CB4F 2CUZA 1YIAA 3K35A 4LJ9A 2O19A 1C4WA 3AY3A 2VQFE 2V3CC 2HDNB 4NRDA 1LWOA 2BV3A 1D2RA 1UH5A 4CG1A 1PJQA 1I0ZA 1AN0A 1L5MA 4MB2A 5TQ2B 2ZSFA 3K4PA 4IS1C 3WE7A 4CKBA 4ZVMA 1AXRA 3COYA 2ECFA 2FZ5A 1KJ9A 5DBIA 3V4LA 4UU1A 4A6DA 2FWAA 4JBNA 4JUIA 4B8YA 4ZZIA 1Z12A 2QMEA 2QRMA 1PRYA 2D1YA 3U09A 2WV7A 1F7VA 2M6KA 4K1XA 1Q44A 1EQ2A 1T5BA 2I29A 1LCIA 1JYSA 3MN1A 3UT5B 1Y82A 3REFA 2CGEA 2GARA 3BRQA 3L9WA 1LBTA 3REQB 3G8DA 3VBEA 4C06A 4CCAA 4DNFA 4MVWA 4DR5E 3D3JA 2WWIA 2BSAA 3MS7A 1UJ5A 3PFNA 4AN4A 4TVBA 4WRRA 1ORDA 3EY9A 3B51X 3GEGA 3PNLA 5C1IA 2D5CA 3OT1A 4S0ZA 4EAQA 3NAMA 3VGPA 5C4MA 1L7OA 4AJ2A 1ZJYA 3IDAA 4ZTBA 4IIEA 5IZCA 3OFSA 4GR5A 4FR5A 3SS8A 3KOZA 4GYJA 4V1CA 3AOEA 5FI3A 3G59A 4EO7A 2OCPA 3W5CA 1J1UA 3BXOA 4HL6A 1JFVA 3VNBA 4BB0A 2ZS9A 2O2XA 3MFDA 2NSJA 5EESA 4MIOA 3O2NA 1E2HA 1I51A 2IHYA 5FPSA 2QRVB 3ZY3A 4A6EA 1QRUA 5I5EA 5I45A 2BEUB 1KR5A 1V71A 4A8HA 2C8VA 4HCJA 1T5SA 2FUCA 5FV7A 5BSFA 3KJIA 2RKBA 4BYGA 1APBA 2XWBF 5LBUA 1F8YA 1VYUA 5KL7A 4MKIA 1VI6A 3VZDA 3ZW8A 4RD3A 1NX9A 1M1ZA 3GNLA 3WKEA 3HKBB 3H16A 1WV1A 1T36B 1YI1A 3PB3A 4JT9A 4UUOA 4EEXA 2GN8A 4M9VC 5B5SA 4KNVA 4WK4B 4L4RA 5KINB 3GLGB 3KIPA 1NI4A 3SSAA 1X42A 4YAWA 1F60A 5HZMA 5IHPA 4PG7A 4GPEA 2O3QA 2WSLA 5JSZB 4KE7A 1XHFA 1X1SA 4DF3A 5SY9A 2ATCA 5AI4A 2G28A 4EG8A 3GDOA 1Y3CE 4M8SA 4OMDA 1P4RA 2ZUBA 4G56A 4KUHA 4L8LA 4B3RE 1EH5A 2Z58A 4HZUB 3VSEA 3AMVA 2PL1A 5JLAA 4O2AB 2QXYA 1OFUX 4YJFB 2PEYA 3NWEA 4RTJA 2OPBA 1YKGA 1KBQA 3Q2KA 1AX9A 4R98A 4CF6A 4JI5B 4MRMB 3LMKA 2A0FA 4WXPA 3BG5A 4WW0A 1HC7A 4B3TB 2NIPA 2PXHA 4EY3A 4XM2A 5A3VA 3U7QB 3DFUA 1O03A 3K92A 1DDGA 3RKUA 1X48A 1NNI1 3MWGA 3UHPA 1FSFA 3BF8A 5L3RA 1SUPA 1YYKA 2OHGA 3MQ2A 4GRDA 2FR1A 2O8EB 3P2JA 3SSMA 5KYWB 1S8FA 1QG2A 1PEDA 4NDAA 5F9MA 4CETA 1YMQA 2HHJA 1HH4A 1F5SA 3I1JA 4L51A 4Y2YA 2OM2A 1DP4A 1TJPB 2FSHA 2IDMA 5EWJB 5JXIA 1VM6A 2O2EA 1OZHA 2P2GA 3K4QA 3U9TA 1SXJA 4M55A 1YQDA 4P58A 4BNJA 2XCSB 1GPKA 1VHJA 1QDUA 1U8EA 1EEXB 2BR3A 2OC4A 1P0PA 1RWQA 1QVWA 1UKEA 3WX0A 1NW7A 1B3BA 1PFKA 4WINA 1C0LA 2H5JA 2VJKA 4NG5A 2HHHE 2YJ3A 4I66A 5BMOA 6REQB 5DN6D 3KRTA 1H0HA 4F6RB 4EJMA 3FCCA 4I46A 1A7AA 1TAQA 2BPOA 3CISA 4G5GA 4HWOA 4ON9A 1RKVA 4X6YA 5E8RA 4EGFA 1P33A 3GLTA 1ZFNA 3AI7A 4LFBE 3NGMA 3BE6A 5KNBD 5IHXA 3DT6A 2REOA 5DWVA 3ZYZA 3OPXA 1VGRA 2G70A 4N8EA 1YRLA 1NDUA 2XAUA 3OCJA 4ZVPA 2Y9MB 4WY5A 2ZJ4A 2XKKA 2W42A 4AG5A 4EARA 3TLJA 5K0ZA 3A27A 4CUJA 4F71A 1RBZA 6REQA 4JP2A 3FDIA 1GEGA 5ALHA 3KWFA 3GLHA 4IJKA 3BF7A 3WDKA 1E2QA 2GQ0A 4Z1MD 1E3WB 5DFAA 4QRHA 1SHTX 2Y77A 1ZU5A 3JQ6A 5AW3A 3HJBA 4C0XA 2ZRLA 4WOBA 3W7AA 4G36A 5DNUA 3PNYA 4E0BA 2O05A 4BBPA 1HNNA 3PUYA 4PBTA 3OC0A 3C6KA 3S2FA 2A58A 3KTOA 1OFTA 4LJYA 5EP3A 3JYNA 2PMEA 1GFIA 1JZTA 1Z7EA 4ERNA 5HM8A 1XELA 1CUCA 1FNCA 4XUCA 2P62A 3DHNA 2VJLA 1Q57A 1IWBB 1TAHA 3HEBA 3HEAA 2QT1A 1TQ2A 3MZ0A 1C3OA 3BXXA 2YXBA 3FLMA 4R7TA 4TWBA 4AQYE 1S6YA 4LE2A 3WGGA 4C3OB 3PI7A 3OESA 5C35A 2Q62A 1HQCA 3MGGA 4CM4B 1ZITA 4P0TA 4CV1A 1KEWA 2F4NA 4GOKA 1DV1A 5JH7B 5K05A 2D1SA 4PBSA 3ONNA 1NM5C 1ZNWA 1XJQA 1PS0A 2WF9A 3QWHA 4ND8A 2CLFB 4ME6A 1LS1A 1SFRA 4JJ8A 3UJNA 1IN7A 3IYLW 1QF6A 3RYCB 2VSFA 4TLDA 4RGQA 1DGCA 4BFXA 1U2DC 1CQIA 4UMEA 3H9CA 2A4MA 1JZQA 4JGIA 2GN2A 4I5IA 3I28A 3LFHA 2ZU0C 3BB3A 2YMLA 4M83A 4YCNA 1T9GR 2YS7A 4J16A 3K9HA 4X1KA 1OXXK 4NG4A 4EA7A 4RZUA 5AJYA 3KFXA 5BSGA 4Z3OA 1O89A 3ZNOA 3OLVA 3DBHA 1LBQA 1S89A 1X2EA 2ZAYA 4TSFA 3HCNA 1FNNA 1X38A 1GNPA 4PC2A 3W2FA 3GNSA 2K7FA 5TF0A 3RWMB 4AZ0B 2CK3A 4A2QA 4KXMA 4HDAA 5CLQA 3U1BA 3CX7A 1JECA 4EFMA 1CY2A 3F9IA 3Q0IA 3RASA 2I7VA 2NU6B 4Q7QA 1QKIA 1OX5A 4U0KA 3MLBA 3BEOA 1N8KA 3Q8MA 2Z3WA 1GPJA 1SOVA 4LTMA 4Q1BA 5HKLA 5I9TA 4I9NA 2YHIA 1WHNA 4X85A 4RVHA 3VTAA 4EJ6A 4YJ2F 1PDAA 5JSYA 2XXAB 1JBQA 2J85A 4UE6A 3KDSE 4ITVA 5F3DA 2RTXA 1A4IA 1JB9A 2EJTA 3O4IA 4IDPA 3SM3A 1OLUB 3I52A 3OMWA 5KX5A 1WV0A 4KQ9A 4E33A 3UC9A 4DCVA 1WHTB 2FJ0A 2VWQA 1OPRA 3OBBA 4DREA 2XLBA 1VRWA 2WWTA 4BO0A 4DJ5X 2XZLA 3QF4B 2XLCA 2NQ2C 3KHKA 4EJFA 1XWWA 1WUTA 1NVKA 1UBMS 2FZEA 2N1BA 2NT3A 3AFHA 3G7UA 3I2HA 4QRIA 3TZQA 3GWGA 2EW1A 1LLUA 1M5UA 1EX9A 1J26A 1JE0A 5C34B 3AF0A 3VYSB 2QUBA 4Q1CA 3TVYA 2YSPA 1AKWA 3A9TA 4OK3A 3WGKA 2R76A 3L0ZA 3A4IA 1TNDA 4W63A 2JLUA 1TN9A 4ZRDA 4UEWA 5AK3A 2ECQA 2ZT7A 5LQDA 3NX4A 3QXXA 3GUVA 1QAMA 3B3QA 1EKXA 4DV4E 1I2ZA 2R7KA 1GTMA 4BP3A 3GDFA 3GJSA 3EQZA 2OECA 2Q2QA 5AM2A 5J1SB 4AJHA 1WCIB 3WSWA 4HX9A 4O2AA 1CUEA 5JD4A 5AVUA 3EDRA 2X9LA 3LQ2A 4LY3A 5IWAE 3TO5A 1KJNA 3C5WP 1R0RE 4BV3A 3OPYI 4HP8A 5A5GA 4CMIA 4S2UA 1A1JA 2ADMA 3VZBA 3R7SA 1UOEA 2IXBA 3TZHA 4EI9A 5CDHA 1LQTA 4RKFA 3UFXA 3SFZA 2PMBA 1O6FA 2CJWB 1FMTA 2EMCA 3CRRA 4U7TB 3E5MA 4M0KA 4JR1A 1Z34A 4JLDA 3SJAA 3J7Yp 3OQMA 2REQA 3PR3A 4EZIA 4FC6A 5M29A 3P97A 3DQZA 4LY6A 1OROA 5CLGA 3NDPA 1ISPA 1BMDA 3JASA 1LX7A 1MEJA 4MRSA 4RA9B 1GYQA 2JLSA 2XTAA 3RAGA 4DLPA 4YRRA 4Q3BA 1JXQA 1DPGA 1JE1A 2GD1O 2CFOA 2KM1A 1NQXA 1P2VA 3V9PA 3ZJVA 4XM1A 5KYVA 3T1HB 2RG1A 4CMGA 5ALTA 3CZCA 3QJGA 4J6EA 2YV2A 3C15C 3GJYA 1IVNA 2HJGA 2WR8A 3HGMA 1G21A 3H9GA 2AI3A 4GVXA 3T0FA 3FLBA 1NLFA 2BCEA 2I6GA 1EFVA 3ZWCA 1OTYA 3WFIA 5IC4A 5TSEA 1CRWG 2QG4A 4LHVA 3G9TA 3KOOA 4CKZA 1OH6A 2PTGA 2Y1CA 3X1YA 2HO4A 3W9SA 2VPQA 3GMDA 4XUEA 2PCJA 4ER0A 1N1EA 4W7SA 1Z36A 2CJFA 3LCCA 3UATA 3VR5H 2XGJA 2B78A 3BJIC 1A9YA 3EASA 3AFNA 1IZYA 2B0JA 2LIVA 2O3UA 1U8AA 1PNOA 4CT4B 4R9UC 1EX1A 2DBQA 1NDQA 1NBHA 2WJ3A 3VU9A 2DH6A 1WEKA 4X8HA 5CFPA 1YL7A 4U2CA 4QYMA 1G5PA 1G2QA 4B84A 4Y9RA 3TQRA 1P73A 2PL3A 1Y8CA 2BM8A 4AF7A 4MZXA 1R64A 3AEZA 4V0SA 1GY8A 5FTKA 3SVLA 4S2EA 3KFVA 2ONZA 2DWUA 4YIHA 4U5QA 2Z8YA 3DWEX 1X0XA 4J91A 1L7QA 1Q14A 1N75A 1VPDA 1WM1A 2GBIA 1CQJA 1K08A 3AEQB 4EY8A 4YT4A 1H6BA 1P18A 2PTHA 3M49A 3QBJA 1TVEA 3RPEA 2IZ0A 4FQ5A 4NBVA 4ABTA 2FZGA 2EM9A 1KY4A 1Z9BA 2IIBA 3D6JA 1X7YA 1N2EA 4ZWNA 3VNVA 5T4HA 1SXHA 3W78A 2UVPA 3WQSB 2C42A 1YF3A 1YB5A 3NATA 1FE8A 1XD9A 1GVNB 4M0FA 2FLVA 2H2FA 2ZT6A 1KOLA 5JY1A 1EP3B 2G08A 4KN9S 1ZUNA 3KAQA 4L8VA 1E9EA 4UUAA 1N32E 3RU3A 3GZJA 4OKIA 5EIXA 4ZEMA 2XNSA 2A1TR 4F60A 4JLBA 1OC2A 2V85A 1IZ7A 1I33A 3N1UA 4QUGA 1G3RA 5KB3A 5EZYB 5HJ5A 4CKBB 1GUDA 2OV4A 1PVVA 5ALLA 2NXWA 4GE0A 3D64A 3QW4B 3SJ7A 2GZ3A 4C2AA 5CB6A 2GPYA 4OMCA 3UAOA 3IELA 4ER5A 4D9NA 1RACA 3N2YA 2RG7A 1VBFA 1L8QA 1T25A 1W9MA 4S35A 4FE4A 1IBME 2H11A 2X13A 1JJ7A 3A1VA 1JSXA 3SF0A 4FFDA 4QU5A 4DM4A 4U7WA 1QG0A 2C1ZA 4JYZA 4JLPA 3AR4A 3JQDA 1X7GA 1RZVA 2A35A 3RAJA 4BKQA 1KA9H 2QUZA 3UH0A 4LDNA 1JR6A 2R66A 2YN2A 3TTUA 4MQ6A 2JLBA 4LF5B 2GDZA 2Z4RA 1TJ4A 3EEQA 4FZRA 1OFHA 3IOCA 4JT8A 4RFSB 4UQLA 1QK3A 2OO5C 1AS2A 5KJFA 1YDFA 2WZOA 5ESXA 4F3KA 3P27A 2ACWA 3DXFA 3H3XA 5JZVA 1GU7A 4JI0E 1Y1QA 2GPSA 1W75A 3KAPA 3Q0TA 3U5TA 4NCAA 4F2HA 4KXUA 4FLEA 4Y6LA 1FX1A 2BM9A 2PUJA 1ULAA 4C2UA 4MW5A 3DKKA 2DQKA 2KS6A 2WIKA 2ENHA 1CP3A 4TOIA 3F3YA 3VX4A 3JZAA 1HDZA 1Z6PA 3JVIA 2YRHA 4QXPA 2D0PB 1SZCA 2I6QA 3JQ8A 1B93A 2AZDA 3I4CA 3OZXA 4RVNA 4PU0A 3ZIAD 2YJGA 3FR7A 3JWGA 4EB8A 4B9EA 1ACMA 4ZKDA 2FFRA 2UAGA 5LZ2A 2Z9CA 5CVTA 3Q7EA 1F0PA 3C2QA 3P9XA 1J90A 2QAIA 4AJ1A 5LL6P 3UICA 2BB8A 2EPUA 4ZO4A 3JTEA 1XZGA 4YX9A 2H7VA 2VVTA 1ZSNA 2EX1A 3D6FA 4Z8XA 4H3KB 4Z6KA 1LK0A 1LA2A 2ZEJA 2OWEA 2ERXA 2HRBA 3PHCA 3OQ1A 1ZI6A 2NXJA 2EOEA 2PZKA 2WAAA 1AKYA 4G2NA 4TMVA 4XFJA 5B1DA 5T3UA 4DXDA 5HX7A 2GJAA 4FE7A 4DGSA 3H4MA 3N7AA 3WLNA 5DTQA 1WNTA 2UUPA 3AQ4A 2CVZA 4MW0A 4ZC1A 4JI2E 2AXPA 2YWJA 5A2QA 3F4KA 1YC5A 3ZGVA 1WOYA 4ZVLA 1T36A 5AE2A 1FPMA 1SKQA 3PDWA 4H3HB 3KR2A 5EFOA 4DARA 3JVVA 4CPDA 3WWYA 1KYXA 3IVCA 2EDAA 4QFMA 3WL6A 3CT6A 4M89A 1JR3A 5LQMA 3D3NA 1O9BA 5DTRA 2FQXA 3ZDZB 1U8FO 1R5NA 1GNQA 1NBWB 1T9HA 3NTOA 5DGCA 3HN2A 3BWEA 1TUBA 1YOBA 1RIFA 4DNPA 1P3DA 4DLLA 3PE3A 4GR4A 4BTVA 2AUTA 2N46A 2HJRA 3WR5A 3R1IA 4IG4A 3UAVA 3ZK9A 4E5NA 1FDSA 5LWQA 3PDUA 4Q9JA 3T7CA 1SCJA 4BZQA 3JZMA 1SU8A 3AB8A 2EN3A 4HAZA 3RRBA 4OOGC 5DN6A 2J3EA 4MVJF 2NVOA 1G38A 1DQ3A 3KB1A 3L4KA 1VKOA 1G98A 3BWMA 3KBOA 3LBYA 4P4UA 1DXYA 1F2UB 4KL8S 4QVIA 2HT1A 3C6QA 3CMMA 3TZKA 2QGNA 3CT4A 3RW9A 4EB6A 1HYGA 1FMFA 1PJBA 1V96A 4QLBA 3RRJA 3M1IA 4MR8A 1T4OA 1M2NA 4OXRA 5CVCA 1VFPA 1CLEA 1XRSB 1CE8B 2I87A 4WVLA 5ECDA 1UAYA 5CFMA 3ZDCA 2PHZA 4CNBA 1K86A 4ILEA 2AD5A 2AZTA 2C20A 1QG6A 5F33A 1UFRA 3O74A 2EN1A 1EGAA 3VPCA 3IMEA 1ZGCA 4TRJA 4ZO9A 4CKCB 4MHSA 4DYVA 4E3ZA 1JQEA 3VYXA 4L16A 4ZGBA 2GAJA 1UQUA 2WTAA 1MJGA 3EAQA 3UAYA 1Q0TA 1XMOB 2PQ6A 3I8SA 2DB3A 1J2RA 1N1MA 4LRTB 2P78A 3HYTA 2HI0A 1K68A 2WKQA 4MR8B 4YRLA 1W48A 2KHZA 5KJ6A 3D3QA 3W9YA 3IO3A 2BSQA 1MO2A 2DHCA 3BN3A 1KDZA 3OZAA 2F64A 1IDN1 1M83A 4B40A 1YUJA 3G0GA 1EEHA 2B4TO 2QJOA 2I4RA 1GPAA 3KPWA 3QXGA 3LDHA 3NWOA 2GCGA 5JSFA 3DYIA 3TM5A 3R8FA 5LCXA 1VYVA 3HVIA 4EPTA 3U62A 1QPZA 1ITZA 3L84A 3PGJA 4ZIRA 2Y0CA 3FNEA 3BEDA 3D3WB 4I4TA 4Z53A 2ANBA 1EZ1A 3PA6A 1E2IA 2WYOA 2QOEA 1I6MA 2ECKA 1I7QB 3NDIA 4HT3B 3AL2A 2Z04A 3BHJA 5HIIA 5B7QA 1CP2A 1P9NA 1JEQB 1WZUA 3B9PA 3AWDA 3GFQA 3OD5A 4OUKX 2HYDA 3RIXA 1ZKDA 1R8SA 3LOQA 1ZINA 2BHNA 1W88A 2AN4A 2JI7A 3AP2A 4LYEA 1MPXA 3IHLA 1DAIA 3QNMA 3O2QB 1KRXA 4ZAZA 1MEYC 3UQYS 4B75A 1FDUA 3FVQA 4BLVA 5MN5A 1N36E 1MGTA 1KY2A 4KWCA 1DKNA 1XPJA 2HWUA 3I8XA 3HP4A 4E2ZA 4JUFA 1CULC 2HQRA 2AYYA 4PX5A 3E81A 4R8MA 1K7EB 1B4DA 5GADl 4JS0A 2G9RA 2DJ5A 2QSUA 1WCYA 1UBGA 2I4MA 3I3OA 4JP8A 4Y2QA 1AXGA 2VHTA 2ZR7A 5FL3A 2GVNA 4EYEA 1R0KA 1PR6A 5DO9A 3X43A 4HAUA 3OTIA 2Y4OA 1MJNA 1GT91 1DCFA 1KAMA 3IMFA 3M6IA 4KIGA 2PUHA 1ULZA 1LLDA 3GUZA 5TPWB 1E3MA 2OA0A 1GZDA 1XU7A 3K32A 2XA9A 2Y6VA 5I4BA 2ZSAA 2QU8A 3FJ1A 4NZZA 2J0UB 4GM0A 3AUYA 2R5NA 4OQPA 2Y6UA 3TLKA 4MGEA 3LCRA 3SNHA 2C4HA 1L7AA 1A71A 3C5EA 3KYDB 1KP3A 5H9VA 2AE1A 2PT5A 2XTJA 4XR4A 5FTLA 2EPLX 1O08A 1O3YA 3QEMB 3FOZA 4KTTE 4B4VA 1JG2A 4YT2A 1X7XB 4K9RA 1YJBA 4WA8A 4I36A 5HS6A 4RULA 3L7BA 1KQPA 1P4AA 1T1JA 1D0SA 3AVWA 4PYLA 3NCTA 1Q17A 1UIMA 1PD0A 4QRDA 4F4FA 3CN9A 2PAFA 3O3OB 4D1YA 2FV4B 4PWYA 4H4CA 3FFAA 3EBOA 3QLVC 4Q1FA 3EYAA 2J0SA 3ONEA 4MGYR 4R16A 4MK4A 1WABA 4E5UA 2J3KA 4HWRA 1QDEA 1EH8A 3RUDA 1M54A 2GPBA 2JFUA 1HT1E 3OPVA 5AHXA 4Y7DA 3ZLVA 5CA1A 2P90A 5D01A 4KGXA 3LM8A 1OAOA 4M53A 1Z74A 2GCIA 3F5MA 3ZLTA 3M6AA 1IU9A 4A2WA 2V97A 3BKXA 4C6RA 4C03A 5D85A 1RFGE 1SAYA 2Q0QA 2OCKA 3SWWA 3L7CA 1D4AA 5ALZA 4IVQA 3VR4H 4HEA6 2DHDA 4BO4A 4ZTUB 4WVFA 3LTNC 2PKRA 1QZUA 2RGXA 1YQEA 2FP4B 4FYJA 4JI3B 5KL6A 1WF3A 4JQCA 3VH3A 4EM6A 1L5OA 5A5FA 2R1TB 4REMA 3IUEA 2IH4A 4NVRA 2ZPAA 5PGMA 2VS1A 5E95A 1K66A 1GT6A 3LQ4A 3P4XA 3PSAA 2XA2A 4IEIA 3MCAA 5JS6A 2ZYUX 2OOSA 3ZV4A 1KORA 4F9BB 1R6AA 1AF4A 1W94A 5JQWA 2IS2A 2G1AA 1NTRA 4P98A 2X5NA 2GK7A 1N7JA 1B8OA 3BIOA 2PKQO 1NOKA 4Q9LA 4ARAA 1V9SA 1KBOA 4BMXA 1IJBA 4FGLA 4QPNA 2P69A 3EDMA 4RK6A 3KKMA 4HSEA 4I3FA 3FLAA 4YXWD 1MOZA 1J25A 2GBLC 5B3JA 3W8DA 1SU6A 2NZYA 3PR2B 4ZPXA 5LZ9A 1AVTA 3KWRA 3X3HA 1FQOA 1W25A 2I9PA 4TV9F 5CVEA 4YUAA 5JQGB 3K70C 5DHPA 2IS6A 1XQXA 1DIRA 1ICEA 2WP8J 3U4QA 1FPQA 4PO8A 2G4CA 5CJ2A 4BFSA 1DC6A 3FE2A 5LZ5A 5FV4A 1JJAA 4QYIB 4FFOA 2BCGY 3LXRA 5A3RA 2CDCA 4BNZA 3PC2A 3EGWA 1II9A 1IAVA 2ZIXA 2X1LA 4YCCA 3B2NA 1NMZA 2I7TA 3IVGA 2VOJA 4U1RA 3K9CA 4BQNA 4BASA 2J5RA 2Q5OA 4F46A 2JJYA 3UPUA 4A8JC 1WLSA 1M9NA 3I2KA 3H9EO 3WYDA 3RREA 3U44B 2BCJQ 2IH2A 2IIQA 2JS7A 5EWLB 2PUEA 1X39A 1PTKA 2O7VA 4PTZA 4QOFA 5K8TA 1JR3D 2WTEA 5DMHA 4Q4HA 3LTEA 2CF5A 3M3PA 1NYTA 1DUIA 1SRRA 2QBYB 5TS2A 2NTJA 1FVFA 3QI7A 1J42A 4OOFA 4Q7MB 3FUUA 5JS2A 5KZMB 1BBOA 3ZVMA 3WLRA 4DA9A 3KHTA 4QUAA 4EPYA 4GR9A 1OIVA 3UT0A 1WDWB 3QXHA 1DMSA 5FHRA 5HSGA 3Q40A 3O94A 2GZ2A 2HK7A 2ZCUA 4AC9A 4UQOA 2IYUA 1FNDA 3BPSA 3K6SB 1W7AA 3DF7A 4DA8A 1AH2A 2XI4A 3S2EA 5KU1A 4OYHA 5DRYA 3ZDDA 2D8MA 4OQMA 4BO7A 5FADA 4DEXA 3PFIA 4OHVA 4ZVRA 5FLEX 3LVBA 2XTZA 4WSPA 3L8ZA 1B8NA 4FSHA 1G2FC 2AEEA 3A7DA 1T4LB 2W2MA 2YRWA 1MX9A 2CFIA 3M5PA 5ILGA 4LQ4A 1ZNQO 2PKCA 3A4YA 3ADPA 1AKUA 3W6ZA 1DXOA 1EK6A 4L4YA 1J6UA 4F3CA 1HDXA 1CYEA 1V2HE 1SD5A 3AGPA 3JQ7A 3GRAA 4UEOA 4WBXC 1GFSA 5ITVA 1VTKA 2VJPA 3IUQA 1Y5NA 3PRHA 2QZSA 1QHIA 2XYRA 2GRUA 2QRZA 1A95A 2XTMA 4H7HA 3DAHA 3OWOA 1QOZA 1HDGO 2ZT8A 3F8SA 3BXHA 2JHGA 1GPLA 3GA5A 2WILA 1T9ZA 2PQ0A 1NNLA 3VDXA 3D2LA 3GGJA 4C6TA 4MKHA 1JR3E 2JD2A 4BNXA 1G3IA 1P72A 1NY6A 1SUWA 4QDJA 3X1XA 3NO4A 5FL7A 4WZAA 1YR6A 4JT4A 4PANA 2VDJA 4AICA 1DWPA 4Q82A 1C1XA 4HB3A 2R8OA 1G18A 2FSPA 1P4HA 1D8TA 3RFFA 2H5LA 4I8OA 3DGFC 3RVLA 5A6AA 1HMYA 1RAEA 2H52A 5JISA 3FPGA 1VLMA 3I0MA 4K9OA 5IUJC 3ZZMA 5DRTA 1PS8A 5GV7A 3RR2A 2EATA 4BLTA 3T1YB 3WNQA 1K4KA 3DL7A 1DO2A 3HUUA 1PEYA 3LO8A 4JX9A 4RGBA 1MABA 1Q0QA 1XCOA 1T1RA 1YR1A 1KDTA 2H06A 2HQSA 2NZJA 2VJCA 3EQ6A 2XUPA 2EMGA 2EDCA 1VRVA 2JD1A 3H2BA 2ACKA 3K1AA 3UJHA 4Q02A 2IZ7A 3LWDA 2OSBA 2E4VA 4ZVKA 5MGBA 1YFJA 3DVAB 4PNEA 4JT2A 5F78A 4ZYTA 5EUMA 3ENVA 4FDTA 3V1MA 4L4ZA 1D6MA 3AHDA 2KWIA 5H70A 3AV0B 4C0SA 1C7ZA 2RAUA 4DCJA 1EFCA 3GXOA 3G17A 2YICA 3O4VA 2HJWA 4JVSB 5KVQA 3WICA 4CIBA 2WWHA 1S1CA 1SIOA 2G4LA 3I76A 1US8B 3V2HA 4AY2A 1ZRHA 4QICA 3NHRA 1V3QE 2DAPA 2YRKA 3IA7A 3IT0A 5AD1A 5AW0A 3RUHA 1U9CA 1GKUB 2W00A 5HIAA 4RD6A 5A9TA 5DGDA 1N6NA 3W3AD 3GX1A 4E4YA 4PYJA 5JPDA 3CLRD 5K0JA 1A2KC 1CRZA 2O3RA 3IGFA 2VJOA 1KTVA 3S2SA 5JNWA 5BT9A 1TF6A 3GRFA 4BX8A 1T1SA 4LWPA 3PQ7A 4IDFA 1YWGO 3KSAC 1TCBA 4OGLA 4UEJA 5GAJA 3WGNA 2WD9A 2HLPA 4LCBA 3WLTA 2FU5C 1GAWA 1RDFA 3LYAA 5C8DA 4KZPA 2VDMB 4JMLA 3NHYA 3WADA 1MTOA 2AJTA 3NEPX 4JCCA 2BFFB 1K7FB 1MF7A 2BUAA 3QVKA 3HDTA 4ER7A 1NRJB 4EHHA 5LYJB 2DCUA 3BMXA 4UFNA 3WOHA 3ZC3A 5IULC 2E49A 2FCRA 1RLUA 4KBFA 2Z4TA 2QDKA 2FSUA 4XDHA 5B3AA 2A88A 2G9NA 1RI4A 1XU4A 4QU0A 4AKHA 1VA5A 3USZA 1IPFA 4Q37A 2GHRA 1SD2A 4YI3A 5BW4A 3ITDA 2O8BB 1SNYA 4NYJR 1P5HA 4M7OA 3BIDA 4CLRB 5AW1A 3RS3A 3QX3A 1SXPA 1K6IA 1K88A 4OFZA 1A9PA 5EMJA 3RV3A 1T3TA 3TCNA 1VJ5A 4EUFA 2NSDA 3I73A 3NUGA 4TT3D 3RARA 2IYPA 1DAEA 3OJCA 3FVWA 3RK4A 1BS1A 5JYCA 2H00A 1GNVA 1JWAB 2CXUA 1NT4A 3LBNA 4KO2S 5A03A 3NIGB 3C4VA 5FJJA 3PPVA 4J4BA 2C92A 1JQDA 1NVUQ 1BX0A 2JIMA 1QIEA 1YQXA 5IBCA 1LRLA 2B5VA 1ZCFA 2Y0EA 1CY7A 3ESQA 1ONOA 1T2EA 1VP9A 1T9KA 1V3VA 2ZT5A 4G8CA 4IWNA 3ORHA 4CQMA 3EX7C 1FJXA 1GL9B 4OQNA 3QLEA 3VBCA 4DNXA 1CUXA 4A23A 3OU6A 2AX3A 1D0VA 4LYHA 1KDRA 4DB4A 1FP6A 4BGEA 4GMKA 2ZYTX 4LDZA 3WLFA 4MAFA 3HKCB 4NBRA 2YTGA 3O8BA 3NRJA 4BVAA 4QFDA 2Z4SA 1EI9A 3WWDA 2DETA 3ZFNA 1RC1A 3K0AA 3UK0A 3WKCA 2C0PA 1NASA 1RYEA 1ID8A 1RU3A 4D8UA 4JOSA 4WCFA 3V4RA 3OZEA 1H0KA 1OHHD 2CLLB 2PKWA 5KKNB 1YZ3A 2FOXA 2AF3C 3CLTC 3DPUA 3MHPA 2BDTA 2LGJA 2X8JA 4DUZB 1FTWA 3CPJB 3EY4A 4GGMX 1D04A 1E4VA 1JHYA 4Y2PA 4YJ2B 3OCCA 1T8RA 4MV3A 2KLBA 1UWLA 3Q85A 2C31A 1CB7A 4R40A 1R15A 1UKCA 3PIRA 5H1YA 2EQAA 3WP0A 3CA8A 4I9HA 4YPVA 4XIIA 2IHTA 2AK2A 5FTWA 2HA3A 3HU1A 4HXGA 2ZYVX 4LMRA 4UMFA 3IQXA 4YCDA 5CMLA 1PJRA 1OFVA 2M1ZA 3D9QX 4NBNA 5LQUA 4PZPA 1SQFA 3LT5A 3I2YX 4KQJA 3UJDA 3W06A 4BPBA 1V95A 2PUAA 3KWMA 4TMZA 4BMNA 3RKRA 1Y5RA 3V32A 2WYVA 2ZJZA 3ZKWA 3H87A 3JQGB 4KSCA 3ZQ6A 1PL8A 3G6WA 3VVBA 2J0VA 1HXHA 3FRIA 3K2BA 2NU9B 4OHCA 3HBFA 4HV4A 2YV5A 2A0KA 2C0QA 4RTLA 3UYKA 3UENA 4RE6A 3P9SA 1OZGA 3PFCA 1AQ6A 3KJFA 2AC2A 2IP1A 2W7TA 4RH3A 4D42A 1COWA 2X3FA 3RC1A 3T1VA 4AECA 3B1KA 1FUKA 5J2TB 5K6TA 4EPWA 3KZCA 4JFAA 2XZOA 1TADA 3NKVA 4LDJA 1BXKA 1HYEA 4UD2A 3IDSA 4JI6B 2M6SA 1XMIA 1Z5NA 2PRZA 2EP3A 2OD9A 3OM0A 1RJWA 4G65A 2VZ0A 2EGUA 2DPHA 3TDMA 4F7WA 3R5HA 4IIVA 2XZTA 4IIBA 3SVTA 1T8SA 3FCSB 4CDNA 3N2EA 4UU7A 5KKAA 2OO5A 4R2PA 1PLJA 2WFLA 4OUDB 4BNYA 3CGWA 4XQ9A 2PUVA 3F2VA 3NHZA 1QFJA 4RDHA 5A4KA 3QPCA 1JA0A 3LQRA 3OM8A 3E1GA 3K30A 4O59O 4M60A 3L0CA 4W9NA 3JY6A 2OBLA 5EKDA 2OUKA 3NOQA 4I8DA 4XUGB 3UPTA 2X6RA 2XVMA 3MSWA 2AN5A 4C4YA 3IWDA 4P3KA 1U1FA 2VLIA 2QQEA 1I8TA 3BRWD 3E05A 3EFOA 1R9GA 2NV2B 2ZS7A 2VJYA 2GBFA 3E48A 3KKPA 1KEUA 3DDHA 4YRAA 3OURA 2QPAA 5AJZA 4FZ3A 4AY4A 3FDJA 3H11B 2BTQB 2B20A 1ML3A 4H9GA 4RQAA 2G07A 4DCUA 4LJ6A 3IP7A 3UKDA 3EGEA 4F6LA 1U63A 5TMPA 1CNFA 1BFDA 3VAZA 1OAAA 3TVTA 2FFAA 3TW4A 1E2MA 4XWTA 2Q29A 4Z49A 3TECE 1E1LA 5JDCC 2P9GA 3L77A 4BCDA 1WW2A 4AYXA 3C7TA 1P0IA 1A76A 2F17A 2LT7A 3DLAA 3HBLA 3UT6A 4DSZA 4KMOA 4BUJA 2IYZA 3NPMA 2LVBA 2QD5A 3IOEA 4X7MA 2W6IA 2RB5A 1KZHA 2HMAA 2CL6X 4O2LA 2C3PA 3HWSA 4BFLA 4EW6A 5B30A 5KVAA 1KJZA 3LA8A 4TTSA 4E3WA 3THXA 2IHJA 3IULA 4TMXA 5J9FA 4BMDA 4FNMA 5ICMA 4UD6A 4Y8VA 3VPDA 4PLTA 5IH7A 1CUJA 1QV7A 4JR2A 4OJQA 2FTXB 4BQPA 1JT9A 5IBQA 1CV2A 1UBLS 1W2GA 4WUVA 4ND2A 4G4IA 5DSXA 1PJ2A 2GYUA 4IDAA 1DC5A 1POXA 4GE3A 4IDHA 4I9UA 1IATA 3R0QA 1N9GB 1XYYA 2YNMA 3R3ZA 5K09A 1T26A 1HTTA 4OY3A 4BMOB 2NNLD 1S5PA 1TVKA 2JAWA 2ODQA 1IONA 2X5XA 5CX1B 5IEJA 1DCTA 1PV2A 1JPJA