1BBOA

High-resolution solution structure of the double cys2*his2 zinc finger from the human enhancer binding protein mbp-1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
56
Chain Sequence
KYICEECGIRKKPSMLKKHIRTHTDVRPYHCTYCNFSFKTKGNLTKHMKSKAHSKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords HUMAN ENHANCER-BINDING PROTEIN MBP-1
publication title High-resolution solution structure of the double Cys2His2 zinc finger from the human enhancer binding protein MBP-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 56
sequence length 57
ec nomenclature
pdb deposition date 1992-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1bboA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1bboA01
2RPCA 2CSHA 2EN3A 2YTFA 4IJDA 1YSAC 1WJPA 2EOMA 2EM3A 2EMAA 4IS1C 2EPAA 2EOYA 1X3CA 2ENCA 2EPZA 4R2SA 2EM4A 5KL5A 2LVHA 2YRMA 1A1LA 2A25A 2ADRA 2YTPA 2LT7A 2JPAA 5KL2A 2BB8A 1A1JA 2EQ0A 2YTOA 2EQ3A 3M99B 4R2PA 4F6NA 4GZNC 1UBDC 2D9HA 2EE8A 2M9AA 2EM6A 2YTEA 2JP9A 2EMKA 2EMCA 5KL3A 2EOEA 2MKDA 2R1FA 2EM9A 2EM8A 2WBTA 2EMIA 1A1FA 2EMYA 4FK5C 2EOSA 1BB8A 2CT1A 4WSGA 2EMHA 2EM5A 1YUIA 2HGHA 1DGCA 2I13A 2DMIA 1RMDA 2WCC3 2EMXA 2EN7A 2GLIA 1X6FA 2ENAA 2EOHA 2DLKA 2EN4A 2EPCA 1NCSA 5KL6A 2EQ1A 1ZAAC 2EPPA 1A1KA 4M9VC 2DGCA 3EPKA 2MDGA 1A1HA 2EN1A 2YSPA 2EPUA 2WBUA 1B69A 2ENHA 2EP3A 1X6EA 1ZR9A 1ZU1A 2EMGA 4R2CA 2J7JA 3UK3C 1BBOA 1AAYA 1JK2A 2ELZA 2EN2A 2EOOA 2YTQA 4R2QA 5KL4A 2EMZA 2DLQA 1A1IA 2YTDA 2EOFA 2EOZA 2ELYA 2EOIA 2EOQA 1Z1BA 3MHSC 1P47A 1JK1A 2EN6A 2E72A 3MHHC 4R2EA 4F6MA 2EMBA 1F2IG 3EPHA 2YRKA 2EOXA 2DRPA 2CTDA 2LV2A 1KJKA 5KL7A 4R2RA 1YUJA 2LCEA 2EN8A 3VHTB 2YTJA 1MEYC 2PRTA 1LLMC 4F2JC 1G2DC 4X9JA 2YTGA 2MKNA 2EM2A 2EMWA 4R2DA 2RSIA 2YU8A 1A1GA 2EM7A 2EL6A 2VRDA 2LO3A 2WBSA 2EMFA 1TN9A 2EL5A 1G2FC 2YU5A 2EOJA 1X5WA 2EPRA 2EPXA 2NABA 2YTIA 2YRHA 1TF3A 1X6HA 4R2AA 2EORA 1UN6B 3EPLA 2GHFA 2EJ4A 2EMLA 3EPJA 2YSOA 2YTNA 1TF6A 2EM0A 2EL4A
chains in the Genus database with same CATH superfamily
5AE1A 3BBGA 2V83A 4F9CB 1YYKA 2CSHA 2FTXB 5F3WA 4BC7A 2YTFA 5A6JA 2ODRC 2EPAA 3HPZA 1X3CA 2M1SA 2EPZA 3KWRA 2DSYA 1HNWE 3F6GA 2YRMA 4BC9A 2N3GA 2EWLA 2JVAA 1A1JA 1WXRA 3IWCA 4MLQA 4R2PA 4X64E 4GZNC 5LMUE 2EE8A 5A6BA 2M9AA 1IBLE 2L3CA 5LL6R 2MKDA 2YPNA 4O4KA 2MC5A 2EMYA 2NUGA 2EOSA 2R76A 1IQOA 3JU0A 2B7TA 2HHHE 1YUIA 1KYQA 2HGHA 2I13A 2EOHA 2EN4A 2DIXA 2EQ1A 4GKJE 3L00A 2UXDE 2KONA 2MDGA 3KZYA 4R8OA 2EP3A 2ZM6E 4DV6E 2RTXA 1AAYA 2EN2A 3P1XA 2YTDA 2EOFA 2ELYA 2EOQA 1P47A 1EH8A 4B3ME 4RHBB 2E72A 3MHHC 4R2EA 1YPNA 2EMBA 1XMQE 2E5LE 1EH7A 4LFAE 4R2RA 1WRJA 2YTJA 2LBSB 4WYQB 3J81C 4JI8E 2PRTA 2NUFA 4F2JC 4N4RB 3RMPA 3VYXA 4LFBE 2EMWA 1A1GA 1T4LB 3AV0A 2G7HA 1T4OA 2LTRA 4LF5E 2LUQA 4B3SE 2YRHA 1TF3A 3IWDA 4R2AA 2L3JA 2FGGA 2LJUA 2EJ4A 1NEIA 2YTNA 3MSWA 2EM0A 5IWAE 2D9HA 2RPCA 4LF7E 2B7VA 1ZBTA 2CPNA 4HTGA 2UXCE 4WXDA 4IJDA 1WJPA 4ZYHA 2EMAA 4IS1C 5T6JA 1GQEA 5A6KA 4NXNE 1STUA 2EM4A 4M0VA 1A1LA 2YTPA 2LT7A 2UU9E 2JPAA 1IQSA 2YTOA 1YYOA 3QG5C 2UUBE 2VF1A 3AUZA 2EPNA 4DR5E 1SFEA 2RSMA 4NHRA 4F6NA 1N36E 4DUYE 2EM6A 4DR2E 2EMKA 2EMCA 1RQ0A 4LF8E 2EOEA 2I9IA 1XNQE 2EM9A 3JAMC 2L2NA 3TQMA 2B9DA 2BBGA 4FK5C 2RS7A 1FJGE 1T39A 4WSGA 1WHQA 3C4BA 4BBYA 4LFCE 4DV2E 2DMIA 4DV7E 2EMXA 2JY9A 4X66E 1X6FA 4B3RE 2B3TB 2ENAA 1X48A 2EPCA 1NCSA 2L8TA 5KL6A 4DV4E 3K6QA 3JTZA 2UUCE 1A1KA 4M9VC 1SR9A 4LTYA 2LJHA 2YT4A 1EKZA 2V85A 4KHPE 2HC5A 1B69A 1X6EA 4R2CA 2EMGA 3UK3C 4DR7E 5KL4A 5FLXC 1A1IA 4GKKE 2LRSA 5IT9C 2E1MA 1X49A 2JXPA 3C6KA 1IBME 1HR0E 3LMLA 4F9AB 3ADLA 2L33A 4JI4E 1L4SA 4WSPA 4WFTA 2FV4B 2LUPB 3THOB 3VYYA 1YFHA 1QU6A 1MEYC 1LLMC 4F54A 2MKNA 1N33E 4R2DA 5A6BD 2N8XA 2WBSA 2EZ6A 4TUIA 1TN9A 4P78A 2EL5A 1G2FC 2YU5A 2EOJA 2EPRA 2YTIA 4MLVA 4WPYA 3EPJA 3J7Yp 2L2KB 4RH8A 1TF6A 4JI0E 4O43A 5ADZA 4LF6E 1T4NA 4WXCA 2EN3A 1MGTA 4LU9A 2ODRD 4R03A 2EOMA 2EM3A 4F9BB 2EOYA 1T38A 2ENCA 4R2SA 1RC7A 3BIDA 3J80C 1QNTA 3T1HE 2EQ0A 2L2MA 2V87A 3FIGA 3LLHA 5IXMB 2EQ3A 3DF6A 3M99B 4M30A 2LMZA 4L5NC 4GEQB 1UBDC 2DMYA 4ZYDA 2HJJA 5A6AA 3ADIA 4JI7E 2JP9A 2V88A 4JI1E 5A69A 2NUEA 1DQ3A 1BB8A 2LE2A 2CT1A 4DV1E 5LLQA 4OX9E 1N32E 1YYWA 3KZZA 2EPOA 1AH5A 3C6MA 5AE2A 4JI5E 4Q35B 4LF9E 2GLIA 1BBGA 2YWQA 2JYAA 5A2QC 2RS6A 4ZYGA 4JV5E 2MC6A 4LF4E 1O0WA 4I8OA 3THNA 2DGCA 3EPKA 4M2ZA 2YSPA 2EPUA 2N3HA 1ZR9A 1N3GA 1XMOE 1BBOA 2LTSA 2ELZA 2IHR1 1JK2A 2YTQA 2VQFE 4DR3E 4AQYE 3ADGA 1Z1BA 3H09A 3MHSC 4X65E 2EN6A 3BF2A 3T1YE 4ZYEA 3EPHA 1F2IG 4J8ZA 1PDAA 2EOXA 2YRKA 2M4IA 2DRPA 2LV2A 1KJKA 5KL7A 4BCAA 1PJQA 1YUJA 2EN8A 4DR1E 2F4VE 1G2DC 2YTGA 2EM2A 5BR8E 5LMNE 1UHZA 2EL6A 2VRDA 4YY3E 2L92A 4K0KE 2WZOA 2EMFA 5TSEA 5AC5A 2NABA 1X5WA 1GZ6A 4WX9A 3HTXA 4TUGA 1X6HA 2KOUA 2Q8UA 1J26A 1UN6B 2DB2A 3VK6A 4B3TE 2EL4A 2GPIA 3HPSA 1PJTA 2JWOA 1J5EE 1XNRE 2JOBA 1YSAC 2EPLX 2NA2A 5AE3A 2M7QA 3HQ1A 1EH6A 5KL5A 2F8BA 1X47A 2KHXA 2LVHA 4KZSA 2A25A 2V8QB 2ADRA 4X62E 5KL2A 4JI2E 2BB8A 4DV0E 4O5GA 4JI3E 4O24A 5CFFE 2VQEE 2RQLA 1YZ9A 1I94E 2YTEA 5KL3A 3ECRA 2JR1A 4DMIA 2R1FA 1ZBQA 2EM8A 2WBTA 2EMIA 1A1FA 1N34E 4DR4E 4NZVA 2V89A 2VE7C 1DI2A 2EMHA 2EM5A 3IWBA 4BHBA 4DR6E 4YHHE 1IBKE 1DGCA 4HEIA 1GTKA 1RMDA 3HXLA 4Q28A 2WCC3 2K7IA 2EN7A 4L8NA 2DLKA 4OOGC 2JOXA 1WHNA 1ZAAC 2EPPA 3F6HA 1A1HA 2L6MA 2EN1A 1FKAE 2K4VA 4NXME 2WBUA 2UXBE 2ENHA 2YZTA 1ZU1A 4BHCA 2J7JA 2UUAE 2EOOA 4R2QA 2EMZA 2DLQA 3J7AG 2EOZA 2EOIA 2MDRA 4BMJA 1JK1A 3EQ1A 3OMLA 4F6MA 4DUZE 2CTDA 4BS9A 2V86A 2LCEA 4KWYA 4X8WA 3VHTB 4JI6E 1HNXE 2EPMX 3BGHA 2H36X 1UILA 3ZOQB 5AASA 4X9JA 3OTOE 5DNYA 3ADJA 2RSIA 2YU8A 2EM7A 1PKPA 4P7DA 2LO3A 2EPKX 4JYAE 2EPXA 3DJWA 4DKKA 2EORA 4DV5E 5AC4A 1PJSA 3EPLA 2GHFA 5IV8B 2EMLA 1HNZE 2YSOA 4DV3E 1IMUA 3C4TA
chains in the Genus database with same CATH topology
2RPCA 2CSHA 2EN3A 2YTFA 4IJDA 1YSAC 1WJPA 2EOMA 2EM3A 2EMAA 4IS1C 2EPAA 2EOYA 1X3CA 2ENCA 2EPZA 4R2SA 2EM4A 5KL5A 2LVHA 2YRMA 1A1LA 2A25A 2ADRA 2YTPA 2LT7A 2JPAA 5KL2A 2BB8A 1A1JA 2EQ0A 2YTOA 2EQ3A 3M99B 4R2PA 4F6NA 4GZNC 1UBDC 2D9HA 2EE8A 2M9AA 2EM6A 2YTEA 2JP9A 2EMKA 2EMCA 5KL3A 2EOEA 2MKDA 2R1FA 2EM9A 2EM8A 2WBTA 2EMIA 1A1FA 2EMYA 4FK5C 2EOSA 1BB8A 2CT1A 4WSGA 2EMHA 2EM5A 1YUIA 2HGHA 1DGCA 2I13A 2DMIA 1RMDA 2WCC3 2EMXA 2EN7A 2GLIA 1X6FA 2ENAA 2EOHA 2DLKA 2EN4A 2EPCA 1NCSA 5KL6A 2EQ1A 1ZAAC 2EPPA 1A1KA 4M9VC 2DGCA 3EPKA 2MDGA 1A1HA 2EN1A 2YSPA 2EPUA 2WBUA 1B69A 2ENHA 2EP3A 1X6EA 1ZR9A 1ZU1A 2EMGA 4R2CA 2J7JA 3UK3C 1BBOA 1AAYA 1JK2A 2ELZA 2EN2A 2EOOA 2YTQA 4R2QA 5KL4A 2EMZA 2DLQA 1A1IA 2YTDA 2EOFA 2EOZA 2ELYA 2EOIA 2EOQA 1Z1BA 3MHSC 1P47A 1JK1A 2EN6A 2E72A 3MHHC 4R2EA 4F6MA 2EMBA 1F2IG 3EPHA 2YRKA 2EOXA 2DRPA 2CTDA 2LV2A 1KJKA 5KL7A 4R2RA 1YUJA 2LCEA 2EN8A 3VHTB 2YTJA 1MEYC 2PRTA 1LLMC 4F2JC 1G2DC 4X9JA 2YTGA 2MKNA 2EM2A 2EMWA 4R2DA 2RSIA 2YU8A 1A1GA 2EM7A 2EL6A 2VRDA 2LO3A 2WBSA 2EMFA 1TN9A 2EL5A 1G2FC 2YU5A 2EOJA 1X5WA 2EPRA 2EPXA 2NABA 2YTIA 2YRHA 1TF3A 1X6HA 4R2AA 2EORA 1UN6B 3EPLA 2GHFA 2EJ4A 2EMLA 3EPJA 2YSOA 2YTNA 1TF6A 2EM0A 2EL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RPC A;  2CSH A;  2EN3 A;  2YTF A;  4IJD A;  1YSA C;  1WJP A;  2EOM A;  2EM3 A;  2EMA A;  4IS1 C;  2EPA A;  2EOY A;  1X3C A;  2ENC A;  2EPZ A;  4R2S A;  2EM4 A;  5KL5 A;  2LVH A;  2YRM A;  1A1L A;  2A25 A;  2ADR A;  2YTP A;  2LT7 A;  2JPA A;  5KL2 A;  2BB8 A;  1A1J A;  2EQ0 A;  2YTO A;  2EQ3 A;  3M99 B;  4R2P A;  4F6N A;  4GZN C;  1UBD C;  2D9H A;  2EE8 A;  2M9A A;  2EM6 A;  2YTE A;  2JP9 A;  2EMK A;  2EMC A;  5KL3 A;  2EOE A;  2MKD A;  2R1F A;  2EM9 A;  2EM8 A;  2WBT A;  2EMI A;  1A1F A;  2EMY A;  4FK5 C;  2EOS A;  1BB8 A;  2CT1 A;  4WSG A;  2EMH A;  2EM5 A;  1YUI A;  2HGH A;  1DGC A;  2I13 A;  2DMI A;  1RMD A;  2WCC 3;  2EMX A;  2EN7 A;  2GLI A;  1X6F A;  2ENA A;  2EOH A;  2DLK A;  2EN4 A;  2EPC A;  1NCS A;  5KL6 A;  2EQ1 A;  1ZAA C;  2EPP A;  1A1K A;  4M9V C;  2DGC A;  3EPK A;  2MDG A;  1A1H A;  2EN1 A;  2YSP A;  2EPU A;  2WBU A;  1B69 A;  2ENH A;  2EP3 A;  1X6E A;  1ZR9 A;  1ZU1 A;  2EMG A;  4R2C A;  2J7J A;  3UK3 C;  1BBO A;  1AAY A;  1JK2 A;  2ELZ A;  2EN2 A;  2EOO A;  2YTQ A;  4R2Q A;  5KL4 A;  2EMZ A;  2DLQ A;  1A1I A;  2YTD A;  2EOF A;  2EOZ A;  2ELY A;  2EOI A;  2EOQ A;  1Z1B A;  3MHS C;  1P47 A;  1JK1 A;  2EN6 A;  2E72 A;  3MHH C;  4R2E A;  4F6M A;  2EMB A;  1F2I G;  3EPH A;  2YRK A;  2EOX A;  2DRP A;  2CTD A;  2LV2 A;  1KJK A;  5KL7 A;  4R2R A;  1YUJ A;  2LCE A;  2EN8 A;  3VHT B;  2YTJ A;  1MEY C;  2PRT A;  1LLM C;  4F2J C;  1G2D C;  4X9J A;  2YTG A;  2MKN A;  2EM2 A;  2EMW A;  4R2D A;  2RSI A;  2YU8 A;  1A1G A;  2EM7 A;  2EL6 A;  2VRD A;  2LO3 A;  2WBS A;  2EMF A;  1TN9 A;  2EL5 A;  1G2F C;  2YU5 A;  2EOJ A;  1X5W A;  2EPR A;  2EPX A;  2NAB A;  2YTI A;  2YRH A;  1TF3 A;  1X6H A;  4R2A A;  2EOR A;  1UN6 B;  3EPL A;  2GHF A;  2EJ4 A;  2EML A;  3EPJ A;  2YSO A;  2YTN A;  1TF6 A;  2EM0 A;  2EL4 A; 
#chains in the Genus database with same CATH topology
 5AE1 A;  3BBG A;  2V83 A;  4F9C B;  1YYK A;  2CSH A;  2FTX B;  5F3W A;  4BC7 A;  2YTF A;  5A6J A;  2ODR C;  2EPA A;  3HPZ A;  1X3C A;  2M1S A;  2EPZ A;  3KWR A;  2DSY A;  1HNW E;  3F6G A;  2YRM A;  4BC9 A;  2N3G A;  2EWL A;  2JVA A;  1A1J A;  1WXR A;  3IWC A;  4MLQ A;  4R2P A;  4X64 E;  4GZN C;  5LMU E;  2EE8 A;  5A6B A;  2M9A A;  1IBL E;  2L3C A;  5LL6 R;  2MKD A;  2YPN A;  4O4K A;  2MC5 A;  2EMY A;  2NUG A;  2EOS A;  2R76 A;  1IQO A;  3JU0 A;  2B7T A;  2HHH E;  1YUI A;  1KYQ A;  2HGH A;  2I13 A;  2EOH A;  2EN4 A;  2DIX A;  2EQ1 A;  4GKJ E;  3L00 A;  2UXD E;  2KON A;  2MDG A;  3KZY A;  4R8O A;  2EP3 A;  2ZM6 E;  4DV6 E;  2RTX A;  1AAY A;  2EN2 A;  3P1X A;  2YTD A;  2EOF A;  2ELY A;  2EOQ A;  1P47 A;  1EH8 A;  4B3M E;  4RHB B;  2E72 A;  3MHH C;  4R2E A;  1YPN A;  2EMB A;  1XMQ E;  2E5L E;  1EH7 A;  4LFA E;  4R2R A;  1WRJ A;  2YTJ A;  2LBS B;  4WYQ B;  3J81 C;  4JI8 E;  2PRT A;  2NUF A;  4F2J C;  4N4R B;  3RMP A;  3VYX A;  4LFB E;  2EMW A;  1A1G A;  1T4L B;  3AV0 A;  2G7H A;  1T4O A;  2LTR A;  4LF5 E;  2LUQ A;  4B3S E;  2YRH A;  1TF3 A;  3IWD A;  4R2A A;  2L3J A;  2FGG A;  2LJU A;  2EJ4 A;  1NEI A;  2YTN A;  3MSW A;  2EM0 A;  5IWA E;  2D9H A;  2RPC A;  4LF7 E;  2B7V A;  1ZBT A;  2CPN A;  4HTG A;  2UXC E;  4WXD A;  4IJD A;  1WJP A;  4ZYH A;  2EMA A;  4IS1 C;  5T6J A;  1GQE A;  5A6K A;  4NXN E;  1STU A;  2EM4 A;  4M0V A;  1A1L A;  2YTP A;  2LT7 A;  2UU9 E;  2JPA A;  1IQS A;  2YTO A;  1YYO A;  3QG5 C;  2UUB E;  2VF1 A;  3AUZ A;  2EPN A;  4DR5 E;  1SFE A;  2RSM A;  4NHR A;  4F6N A;  1N36 E;  4DUY E;  2EM6 A;  4DR2 E;  2EMK A;  2EMC A;  1RQ0 A;  4LF8 E;  2EOE A;  2I9I A;  1XNQ E;  2EM9 A;  3JAM C;  2L2N A;  3TQM A;  2B9D A;  2BBG A;  4FK5 C;  2RS7 A;  1FJG E;  1T39 A;  4WSG A;  1WHQ A;  3C4B A;  4BBY A;  4LFC E;  4DV2 E;  2DMI A;  4DV7 E;  2EMX A;  2JY9 A;  4X66 E;  1X6F A;  4B3R E;  2B3T B;  2ENA A;  1X48 A;  2EPC A;  1NCS A;  2L8T A;  5KL6 A;  4DV4 E;  3K6Q A;  3JTZ A;  2UUC E;  1A1K A;  4M9V C;  1SR9 A;  4LTY A;  2LJH A;  2YT4 A;  1EKZ A;  2V85 A;  4KHP E;  2HC5 A;  1B69 A;  1X6E A;  4R2C A;  2EMG A;  3UK3 C;  4DR7 E;  5KL4 A;  5FLX C;  1A1I A;  4GKK E;  2LRS A;  5IT9 C;  2E1M A;  1X49 A;  2JXP A;  3C6K A;  1IBM E;  1HR0 E;  3LML A;  4F9A B;  3ADL A;  2L33 A;  4JI4 E;  1L4S A;  4WSP A;  4WFT A;  2FV4 B;  2LUP B;  3THO B;  3VYY A;  1YFH A;  1QU6 A;  1MEY C;  1LLM C;  4F54 A;  2MKN A;  1N33 E;  4R2D A;  5A6B D;  2N8X A;  2WBS A;  2EZ6 A;  4TUI A;  1TN9 A;  4P78 A;  2EL5 A;  1G2F C;  2YU5 A;  2EOJ A;  2EPR A;  2YTI A;  4MLV A;  4WPY A;  3EPJ A;  3J7Y p;  2L2K B;  4RH8 A;  1TF6 A;  4JI0 E;  4O43 A;  5ADZ A;  4LF6 E;  1T4N A;  4WXC A;  2EN3 A;  1MGT A;  4LU9 A;  2ODR D;  4R03 A;  2EOM A;  2EM3 A;  4F9B B;  2EOY A;  1T38 A;  2ENC A;  4R2S A;  1RC7 A;  3BID A;  3J80 C;  1QNT A;  3T1H E;  2EQ0 A;  2L2M A;  2V87 A;  3FIG A;  3LLH A;  5IXM B;  2EQ3 A;  3DF6 A;  3M99 B;  4M30 A;  2LMZ A;  4L5N C;  4GEQ B;  1UBD C;  2DMY A;  4ZYD A;  2HJJ A;  5A6A A;  3ADI A;  4JI7 E;  2JP9 A;  2V88 A;  4JI1 E;  5A69 A;  2NUE A;  1DQ3 A;  1BB8 A;  2LE2 A;  2CT1 A;  4DV1 E;  5LLQ A;  4OX9 E;  1N32 E;  1YYW A;  3KZZ A;  2EPO A;  1AH5 A;  3C6M A;  5AE2 A;  4JI5 E;  4Q35 B;  4LF9 E;  2GLI A;  1BBG A;  2YWQ A;  2JYA A;  5A2Q C;  2RS6 A;  4ZYG A;  4JV5 E;  2MC6 A;  4LF4 E;  1O0W A;  4I8O A;  3THN A;  2DGC A;  3EPK A;  4M2Z A;  2YSP A;  2EPU A;  2N3H A;  1ZR9 A;  1N3G A;  1XMO E;  1BBO A;  2LTS A;  2ELZ A;  2IHR 1;  1JK2 A;  2YTQ A;  2VQF E;  4DR3 E;  4AQY E;  3ADG A;  1Z1B A;  3H09 A;  3MHS C;  4X65 E;  2EN6 A;  3BF2 A;  3T1Y E;  4ZYE A;  3EPH A;  1F2I G;  4J8Z A;  1PDA A;  2EOX A;  2YRK A;  2M4I A;  2DRP A;  2LV2 A;  1KJK A;  5KL7 A;  4BCA A;  1PJQ A;  1YUJ A;  2EN8 A;  4DR1 E;  2F4V E;  1G2D C;  2YTG A;  2EM2 A;  5BR8 E;  5LMN E;  1UHZ A;  2EL6 A;  2VRD A;  4YY3 E;  2L92 A;  4K0K E;  2WZO A;  2EMF A;  5TSE A;  5AC5 A;  2NAB A;  1X5W A;  1GZ6 A;  4WX9 A;  3HTX A;  4TUG A;  1X6H A;  2KOU A;  2Q8U A;  1J26 A;  1UN6 B;  2DB2 A;  3VK6 A;  4B3T E;  2EL4 A;  2GPI A;  3HPS A;  1PJT A;  2JWO A;  1J5E E;  1XNR E;  2JOB A;  1YSA C;  2EPL X;  2NA2 A;  5AE3 A;  2M7Q A;  3HQ1 A;  1EH6 A;  5KL5 A;  2F8B A;  1X47 A;  2KHX A;  2LVH A;  4KZS A;  2A25 A;  2V8Q B;  2ADR A;  4X62 E;  5KL2 A;  4JI2 E;  2BB8 A;  4DV0 E;  4O5G A;  4JI3 E;  4O24 A;  5CFF E;  2VQE E;  2RQL A;  1YZ9 A;  1I94 E;  2YTE A;  5KL3 A;  3ECR A;  2JR1 A;  4DMI A;  2R1F A;  1ZBQ A;  2EM8 A;  2WBT A;  2EMI A;  1A1F A;  1N34 E;  4DR4 E;  4NZV A;  2V89 A;  2VE7 C;  1DI2 A;  2EMH A;  2EM5 A;  3IWB A;  4BHB A;  4DR6 E;  4YHH E;  1IBK E;  1DGC A;  4HEI A;  1GTK A;  1RMD A;  3HXL A;  4Q28 A;  2WCC 3;  2K7I A;  2EN7 A;  4L8N A;  2DLK A;  4OOG C;  2JOX A;  1WHN A;  1ZAA C;  2EPP A;  3F6H A;  1A1H A;  2L6M A;  2EN1 A;  1FKA E;  2K4V A;  4NXM E;  2WBU A;  2UXB E;  2ENH A;  2YZT A;  1ZU1 A;  4BHC A;  2J7J A;  2UUA E;  2EOO A;  4R2Q A;  2EMZ A;  2DLQ A;  3J7A G;  2EOZ A;  2EOI A;  2MDR A;  4BMJ A;  1JK1 A;  3EQ1 A;  3OML A;  4F6M A;  4DUZ E;  2CTD A;  4BS9 A;  2V86 A;  2LCE A;  4KWY A;  4X8W A;  3VHT B;  4JI6 E;  1HNX E;  2EPM X;  3BGH A;  2H36 X;  1UIL A;  3ZOQ B;  5AAS A;  4X9J A;  3OTO E;  5DNY A;  3ADJ A;  2RSI A;  2YU8 A;  2EM7 A;  1PKP A;  4P7D A;  2LO3 A;  2EPK X;  4JYA E;  2EPX A;  3DJW A;  4DKK A;  2EOR A;  4DV5 E;  5AC4 A;  1PJS A;  3EPL A;  2GHF A;  5IV8 B;  2EML A;  1HNZ E;  2YSO A;  4DV3 E;  1IMU A;  3C4T A; 
#chains in the Genus database with same CATH homology
 2RPC A;  2CSH A;  2EN3 A;  2YTF A;  4IJD A;  1YSA C;  1WJP A;  2EOM A;  2EM3 A;  2EMA A;  4IS1 C;  2EPA A;  2EOY A;  1X3C A;  2ENC A;  2EPZ A;  4R2S A;  2EM4 A;  5KL5 A;  2LVH A;  2YRM A;  1A1L A;  2A25 A;  2ADR A;  2YTP A;  2LT7 A;  2JPA A;  5KL2 A;  2BB8 A;  1A1J A;  2EQ0 A;  2YTO A;  2EQ3 A;  3M99 B;  4R2P A;  4F6N A;  4GZN C;  1UBD C;  2D9H A;  2EE8 A;  2M9A A;  2EM6 A;  2YTE A;  2JP9 A;  2EMK A;  2EMC A;  5KL3 A;  2EOE A;  2MKD A;  2R1F A;  2EM9 A;  2EM8 A;  2WBT A;  2EMI A;  1A1F A;  2EMY A;  4FK5 C;  2EOS A;  1BB8 A;  2CT1 A;  4WSG A;  2EMH A;  2EM5 A;  1YUI A;  2HGH A;  1DGC A;  2I13 A;  2DMI A;  1RMD A;  2WCC 3;  2EMX A;  2EN7 A;  2GLI A;  1X6F A;  2ENA A;  2EOH A;  2DLK A;  2EN4 A;  2EPC A;  1NCS A;  5KL6 A;  2EQ1 A;  1ZAA C;  2EPP A;  1A1K A;  4M9V C;  2DGC A;  3EPK A;  2MDG A;  1A1H A;  2EN1 A;  2YSP A;  2EPU A;  2WBU A;  1B69 A;  2ENH A;  2EP3 A;  1X6E A;  1ZR9 A;  1ZU1 A;  2EMG A;  4R2C A;  2J7J A;  3UK3 C;  1BBO A;  1AAY A;  1JK2 A;  2ELZ A;  2EN2 A;  2EOO A;  2YTQ A;  4R2Q A;  5KL4 A;  2EMZ A;  2DLQ A;  1A1I A;  2YTD A;  2EOF A;  2EOZ A;  2ELY A;  2EOI A;  2EOQ A;  1Z1B A;  3MHS C;  1P47 A;  1JK1 A;  2EN6 A;  2E72 A;  3MHH C;  4R2E A;  4F6M A;  2EMB A;  1F2I G;  3EPH A;  2YRK A;  2EOX A;  2DRP A;  2CTD A;  2LV2 A;  1KJK A;  5KL7 A;  4R2R A;  1YUJ A;  2LCE A;  2EN8 A;  3VHT B;  2YTJ A;  1MEY C;  2PRT A;  1LLM C;  4F2J C;  1G2D C;  4X9J A;  2YTG A;  2MKN A;  2EM2 A;  2EMW A;  4R2D A;  2RSI A;  2YU8 A;  1A1G A;  2EM7 A;  2EL6 A;  2VRD A;  2LO3 A;  2WBS A;  2EMF A;  1TN9 A;  2EL5 A;  1G2F C;  2YU5 A;  2EOJ A;  1X5W A;  2EPR A;  2EPX A;  2NAB A;  2YTI A;  2YRH A;  1TF3 A;  1X6H A;  4R2A A;  2EOR A;  1UN6 B;  3EPL A;  2GHF A;  2EJ4 A;  2EML A;  3EPJ A;  2YSO A;  2YTN A;  1TF6 A;  2EM0 A;  2EL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...