1BBOA

High-resolution solution structure of the double cys2*his2 zinc finger from the human enhancer binding protein mbp-1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
56
Chain Sequence
b'KYICEECGIRKKPSMLKKHIRTHTDVRPYHCTYCNFSFKTKGNLTKHMKSKAHSKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN ENHANCER-BINDING PROTEIN MBP-1
publication title High-resolution solution structure of the double Cys2His2 zinc finger from the human enhancer binding protein MBP-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 11
structure length 56
sequence length 57
ec nomenclature
pdb deposition date 1992-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1bboA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1bboA01
2PRTA 4IS1C 1DGCA 1AAYA 1YUIA 1A1GA 2A25A 3MHSC 2EN6A 2YSOA 2EPXA 2YTNA 2EMFA 2EPUA 2EM8A 2WBTA 2E72A 2M9AA 2EMIA 1A1IA 2EMXA 2EM2A 4R2RA 4GZNC 2EOQA 2NABA 2EL5A 1JK2A 2EMAA 1YUJA 2EOOA 2DLKA 2EE8A 2YTOA 2DMIA 3EPKA 1A1FA 2EN3A 2EN1A 4R2AA 1MEYC 2CSHA 2DGCA 2BB8A 2MKDA 2EM6A 1X3CA 2EMYA 2EM3A 1A1HA 4M9VC 5KL7A 3EPHA 2I13A 2EPZA 2MKNA 2EM5A 2EOEA 1ZAAC 1F2IG 2LO3A 2WBSA 2CT1A 2YRMA 4FK5C 2LT7A 4R2EA 3VHTB 2EMHA 1ZR9A 2EM4A 4R2SA 1X6HA 2CTDA 2ENCA 2EOSA 2JPAA 2YTFA 3M99B 2YRHA 2YSPA 2EP3A 2YU8A 2ENHA 2EL4A 1BB8A 1YSAC 2EMBA 2YTIA 4F2JC 2EMGA 2EN2A 1TF3A 2JP9A 2WCC3 2VRDA 1WJPA 2YTPA 1X5WA 4F6NA 2GLIA 2EN7A 3EPJA 2MDGA 1BBOA 2ELYA 2EM7A 5KL5A 1G2DC 1JK1A 3UK3C 5KL6A 1UBDC 1ZU1A 1Z1BA 2YTGA 2EPAA 2EPRA 2YTEA 1A1KA 2LV2A 1TF6A 4R2CA 2ELZA 1LLMC 2RSIA 1KJKA 2EMZA 2YU5A 2R1FA 2EPPA 4R2PA 2DLQA 2EQ3A 2EPCA 1X6EA 1RMDA 2D9HA 2WBUA 2EQ0A 5KL4A 4IJDA 5KL3A 1X6FA 2EN4A 4R2DA 4WSGA 2RPCA 3MHHC 2HGHA 2EOJA 2EMCA 2EOFA 2EOIA 2EL6A 4R2QA 2LVHA 2EOMA 2EM0A 1A1JA 2YTJA 5KL2A 2EJ4A 2EORA 1B69A 2DRPA 1UN6B 2GHFA 1NCSA 2EOYA 1TN9A 1A1LA 3EPLA 2EN8A 2YTDA 2ADRA 4F6MA 2EMWA 2EMKA 2ENAA 2EQ1A 2J7JA 1G2FC 1P47A 2EOZA 2LCEA 2EMLA 2EM9A 2YTQA 2EOXA 2EOHA 2YRKA 4X9JA
chains in the Genus database with same CATH superfamily
4DV0E 2V85A 1AH5A 5A6JA 4WYQB 4R8OA 1MGTA 2EN6A 2RS6A 1X48A 2K4VA 2WBTA 2LRSA 1A1IA 4R2RA 2EM2A 4GZNC 5LLQA 5A6KA 2M1SA 1QNTA 2G7HA 2DMIA 3EPKA 5CFFE 2EN1A 3ECRA 1PJQA 2EM6A 3HXLA 2K7IA 4X65E 1A1HA 1PJSA 2JOBA 4ZYDA 4DR4E 2I13A 2EPZA 2EM5A 4R03A 3IWBA 2CT1A 1HNXE 4K0KE 3VHTB 2EMHA 4MLVA 1QU6A 1X6HA 3C4BA 4KWYA 2JPAA 2YSPA 1J26A 5A6BA 1STUA 2DMYA 2KHXA 1T4LB 3P1XA 4F2JC 1O0WA 2LUQA 5TSEA 2NUFA 2EN7A 3MSWA 2ELYA 3UK3C 2V83A 1PDAA 4JI8E 2V8QB 2JWOA 1UBDC 3C6MA 2FGGA 3OMLA 2CPNA 4WX9A 2L6MA 2LV2A 2EMZA 2JY9A 3DJWA 2YU5A 1IBKE 2MC6A 3VK6A 2EPCA 3K6QA 2WBUA 1BBGA 2UXBE 4TUGA 2L2KB 1HR0E 1WHNA 2L92A 1X6FA 2M4IA 4R2DA 2RSMA 4WSGA 2RPCA 5AASA 4ZYGA 1GQEA 2EL6A 1J5EE 2EOMA 2YTJA 1UN6B 2L3JA 1NCSA 2EOYA 2E5LE 2ODRC 2EPLX 2V88A 1IQSA 2YTDA 4F6MA 2EMKA 2EQ1A 4DV1E 2LCEA 4M2ZA 2EM9A 2EOHA 4HEIA 4LFBE 1ZBQA 5FLXC 4X62E 5IV8B 1PKPA 1N34E 4TUIA 3OTOE 1RC7A 2VQFE 3ADGA 4BMJA 1YYOA 4DR6E 2B7VA 1T4OA 3TQMA 5LMUE 4RHBB 2NABA 4O24A 2HJJA 4YY3E 1JK2A 1YUJA 2EOOA 4P7DA 1DI2A 2YTOA 3QG5C 2H36X 4WXDA 5F3WA 2L33A 5A69A 4OOGC 4GKJE 4M9VC 3EPHA 4JV5E 2MKNA 1YZ9A 2VE7C 2B3TB 1F2IG 4LF8E 4LF6E 2WBSA 2F4VE 2DB2A 4FK5C 4WXCA 1N36E 3JAMC 4DV4E 2EM4A 2DSYA 5LMNE 4B3TE 1UHZA 2KOUA 2UXDE 2EOSA 4F9BB 3JU0A 2ENHA 4L8NA 2EL4A 2RTXA 1BB8A 4DV3E 5ADZA 2YTIA 2EMGA 1TF3A 4JI5E 4B3ME 2L3CA 5A6BD 2B7TA 3EPJA 4DR1E 4DV6E 2L2MA 2LBSB 3THOB 2N3HA 2JXPA 2N3GA 4GKKE 1T4NA 3ZOQB 2YTGA 4NHRA 1PJTA 2Q8UA 3THNA 5LL6R 2LJHA 2ELZA 3ADIA 2EPKX 4NXME 1YPNA 1KJKA 2MC5A 2EPPA 2R1FA 4DR5E 4LFCE 2EQ3A 2LUPB 2EQ0A 2V87A 1X47A 2EPNA 2FV4B 2LJUA 4BHCA 2IHR1 5KL3A 3L00A 2LTSA 1EH8A 2NA2A 1IQOA 2LE2A 1I94E 2EMCA 4OX9E 5T6JA 1YYKA 2UU9E 5KL2A 2DRPA 2EJ4A 3FIGA 4DUZE 5IWAE 1A1LA 4L5NC 2EN8A 2RS7A 1UILA 2J7JA 1P47A 5AC4A 4X8WA 2EOXA 1IBME 2PRTA 4IS1C 4DR3E 4WSPA 4BC7A 1T39A 1DGCA 1AAYA 3VYXA 1YUIA 1A1GA 4LU9A 2A25A 4BBYA 4BC9A 2EPXA 2EMFA 2EPUA 4BCAA 2V89A 2EM8A 4X66E 4AQYE 2M9AA 2EMXA 5AC5A 4DMIA 4X64E 1FKAE 2EMAA 1IMUA 2BBGA 2VF1A 1HNWE 4R2AA 3VYYA 1MEYC 2BB8A 2MKDA 3C6KA 4M0VA 1X3CA 1IBLE 4JI3E 2EM3A 2EPMX 3J7Yp 1YYWA 2EOEA 3F6HA 1ZAAC 2NUEA 4DKKA 4F9CB 2B9DA 2LO3A 3BF2A 5AE3A 2LT7A 4R2EA 2UUBE 3BGHA 2LMZA 4NXNE 2L2NA 4R2SA 2CTDA 2ENCA 2F8BA 2YTFA 4JI7E 2YRHA 3J7AG 3KZYA 1YSAC 4LTYA 5IXMB 2JP9A 3IWCA 3HTXA 1KYQA 2VRDA 1WJPA 4LF4E 4JYAE 4ZYEA 2R76A 4F6NA 5A2QC 1BBOA 2JYAA 5IT9C 2EM7A 4O4KA 5KL5A 1G2DC 1JK1A 4LF5E 5KL6A 1ZU1A 2JR1A 4WFTA 4M30A 4WPYA 2EPAA 1SR9A 2EPRA 4B3SE 4F54A 2M7QA 4R2CA 1EH7A 2DIXA 3T1HE 2UUCE 4P78A 4R2PA 2DLQA 2YWQA 2RQLA 1RMDA 1EKZA 2HHHE 1HNZE 4Q35B 4YHHE 2NUGA 4IJDA 3HPZA 1DQ3A 1GTKA 2EN4A 4HTGA 3MHHC 3EQ1A 2HGHA 3LMLA 2EOJA 2EOIA 1XNQE 2EORA 1B69A 1EH6A 4Q28A 3J81C 3EPLA 2ADRA 4BHBA 2EMWA 3RMPA 1G2FC 4N4RB 4O43A 4MLQA 2YTPA 5KL4A 3MHSC 2YRKA 4O5GA 4X9JA 4JI1E 4ZYHA 2EWLA 3HQ1A 4BS9A 4KZSA 3F6GA 2YSOA 1WXRA 1XMOE 4LF7E 2YTNA 1NEIA 5DNYA 2KONA 2L8TA 1XMQE 2E72A 2EMIA 4B3RE 4F9AB 2EOQA 2EL5A 2UUAE 2DLKA 2UXCE 2EE8A 1X49A 4DV7E 4JI6E 1A1FA 2EN3A 2CSHA 2DGCA 3AV0A 3T1YE 4JI4E 3AUZA 2EMYA 5KL7A 2EPOA 3ADJA 4LF9E 3J80C 1N3GA 4J8ZA 2YRMA 2EZ6A 1ZR9A 4DUYE 4NZVA 1GZ6A 3ADLA 3BIDA 1RQ0A 1ZBTA 3KWRA 5AE2A 2YT4A 1T38A 3M99B 2JVAA 2EP3A 2YU8A 2ZM6E 2N8XA 3BBGA 2ODRD 1FJGE 2EMBA 3KZZA 5AE1A 1N32E 2EN2A 4GEQB 1SFEA 2WCC3 1X5WA 3HPSA 2GLIA 2MDGA 4JI0E 4RH8A 5BR8E 5A6AA 3C4TA 3H09A 3JTZA 3LLHA 1WRJA 2V86A 2VQEE 4DR2E 2HC5A 1Z1BA 2YTEA 1A1KA 2I9IA 4KHPE 1TF6A 1LLMC 2LTRA 2RSIA 1X6EA 1XNRE 2D9HA 3DF6A 2WZOA 3IWDA 2YPNA 4DV5E 2EOFA 1WHQA 2GPIA 4R2QA 2LVHA 1L4SA 2EM0A 1A1JA 4JI2E 2YZTA 2GHFA 2E1MA 1TN9A 2MDRA 1N33E 2JOXA 2ENAA 4DV2E 4DR7E 4LFAE 1YFHA 2EOZA 2EMLA 4I8OA 2YTQA 2FTXB
chains in the Genus database with same CATH topology
2PRTA 4IS1C 1DGCA 1AAYA 1YUIA 1A1GA 2A25A 3MHSC 2EN6A 2YSOA 2EPXA 2YTNA 2EMFA 2EPUA 2EM8A 2WBTA 2E72A 2M9AA 2EMIA 1A1IA 2EMXA 2EM2A 4R2RA 4GZNC 2EOQA 2NABA 2EL5A 1JK2A 2EMAA 1YUJA 2EOOA 2DLKA 2EE8A 2YTOA 2DMIA 3EPKA 1A1FA 2EN3A 2EN1A 4R2AA 1MEYC 2CSHA 2DGCA 2BB8A 2MKDA 2EM6A 1X3CA 2EMYA 2EM3A 1A1HA 4M9VC 5KL7A 3EPHA 2I13A 2EPZA 2MKNA 2EM5A 2EOEA 1ZAAC 1F2IG 2LO3A 2WBSA 2CT1A 2YRMA 4FK5C 2LT7A 4R2EA 3VHTB 2EMHA 1ZR9A 2EM4A 4R2SA 1X6HA 2CTDA 2ENCA 2EOSA 2JPAA 2YTFA 3M99B 2YRHA 2YSPA 2EP3A 2YU8A 2ENHA 2EL4A 1BB8A 1YSAC 2EMBA 2YTIA 4F2JC 2EMGA 2EN2A 1TF3A 2JP9A 2WCC3 2VRDA 1WJPA 2YTPA 1X5WA 4F6NA 2GLIA 2EN7A 3EPJA 2MDGA 1BBOA 2ELYA 2EM7A 5KL5A 1G2DC 1JK1A 3UK3C 5KL6A 1UBDC 1ZU1A 1Z1BA 2YTGA 2EPAA 2EPRA 2YTEA 1A1KA 2LV2A 1TF6A 4R2CA 2ELZA 1LLMC 2RSIA 1KJKA 2EMZA 2YU5A 2R1FA 2EPPA 4R2PA 2DLQA 2EQ3A 2EPCA 1X6EA 1RMDA 2D9HA 2WBUA 2EQ0A 5KL4A 4IJDA 5KL3A 1X6FA 2EN4A 4R2DA 4WSGA 2RPCA 3MHHC 2HGHA 2EOJA 2EMCA 2EOFA 2EOIA 2EL6A 4R2QA 2LVHA 2EOMA 2EM0A 1A1JA 2YTJA 5KL2A 2EJ4A 2EORA 1B69A 2DRPA 1UN6B 2GHFA 1NCSA 2EOYA 1TN9A 1A1LA 3EPLA 2EN8A 2YTDA 2ADRA 4F6MA 2EMWA 2EMKA 2ENAA 2EQ1A 2J7JA 1G2FC 1P47A 2EOZA 2LCEA 2EMLA 2EM9A 2YTQA 2EOXA 2EOHA 2YRKA 4X9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PRT A;  4IS1 C;  1DGC A;  1AAY A;  1YUI A;  1A1G A;  2A25 A;  3MHS C;  2EN6 A;  2YSO A;  2EPX A;  2YTN A;  2EMF A;  2EPU A;  2EM8 A;  2WBT A;  2E72 A;  2M9A A;  2EMI A;  1A1I A;  2EMX A;  2EM2 A;  4R2R A;  4GZN C;  2EOQ A;  2NAB A;  2EL5 A;  1JK2 A;  2EMA A;  1YUJ A;  2EOO A;  2DLK A;  2EE8 A;  2YTO A;  2DMI A;  3EPK A;  1A1F A;  2EN3 A;  2EN1 A;  4R2A A;  1MEY C;  2CSH A;  2DGC A;  2BB8 A;  2MKD A;  2EM6 A;  1X3C A;  2EMY A;  2EM3 A;  1A1H A;  4M9V C;  5KL7 A;  3EPH A;  2I13 A;  2EPZ A;  2MKN A;  2EM5 A;  2EOE A;  1ZAA C;  1F2I G;  2LO3 A;  2WBS A;  2CT1 A;  2YRM A;  4FK5 C;  2LT7 A;  4R2E A;  3VHT B;  2EMH A;  1ZR9 A;  2EM4 A;  4R2S A;  1X6H A;  2CTD A;  2ENC A;  2EOS A;  2JPA A;  2YTF A;  3M99 B;  2YRH A;  2YSP A;  2EP3 A;  2YU8 A;  2ENH A;  2EL4 A;  1BB8 A;  1YSA C;  2EMB A;  2YTI A;  4F2J C;  2EMG A;  2EN2 A;  1TF3 A;  2JP9 A;  2WCC 3;  2VRD A;  1WJP A;  2YTP A;  1X5W A;  4F6N A;  2GLI A;  2EN7 A;  3EPJ A;  2MDG A;  1BBO A;  2ELY A;  2EM7 A;  5KL5 A;  1G2D C;  1JK1 A;  3UK3 C;  5KL6 A;  1UBD C;  1ZU1 A;  1Z1B A;  2YTG A;  2EPA A;  2EPR A;  2YTE A;  1A1K A;  2LV2 A;  1TF6 A;  4R2C A;  2ELZ A;  1LLM C;  2RSI A;  1KJK A;  2EMZ A;  2YU5 A;  2R1F A;  2EPP A;  4R2P A;  2DLQ A;  2EQ3 A;  2EPC A;  1X6E A;  1RMD A;  2D9H A;  2WBU A;  2EQ0 A;  5KL4 A;  4IJD A;  5KL3 A;  1X6F A;  2EN4 A;  4R2D A;  4WSG A;  2RPC A;  3MHH C;  2HGH A;  2EOJ A;  2EMC A;  2EOF A;  2EOI A;  2EL6 A;  4R2Q A;  2LVH A;  2EOM A;  2EM0 A;  1A1J A;  2YTJ A;  5KL2 A;  2EJ4 A;  2EOR A;  1B69 A;  2DRP A;  1UN6 B;  2GHF A;  1NCS A;  2EOY A;  1TN9 A;  1A1L A;  3EPL A;  2EN8 A;  2YTD A;  2ADR A;  4F6M A;  2EMW A;  2EMK A;  2ENA A;  2EQ1 A;  2J7J A;  1G2F C;  1P47 A;  2EOZ A;  2LCE A;  2EML A;  2EM9 A;  2YTQ A;  2EOX A;  2EOH A;  2YRK A;  4X9J A; 
#chains in the Genus database with same CATH topology
 4DV0 E;  2V85 A;  1AH5 A;  5A6J A;  4WYQ B;  4R8O A;  1MGT A;  2EN6 A;  2RS6 A;  1X48 A;  2K4V A;  2WBT A;  2LRS A;  1A1I A;  4R2R A;  2EM2 A;  4GZN C;  5LLQ A;  5A6K A;  2M1S A;  1QNT A;  2G7H A;  2DMI A;  3EPK A;  5CFF E;  2EN1 A;  3ECR A;  1PJQ A;  2EM6 A;  3HXL A;  2K7I A;  4X65 E;  1A1H A;  1PJS A;  2JOB A;  4ZYD A;  4DR4 E;  2I13 A;  2EPZ A;  2EM5 A;  4R03 A;  3IWB A;  2CT1 A;  1HNX E;  4K0K E;  3VHT B;  2EMH A;  4MLV A;  1QU6 A;  1X6H A;  3C4B A;  4KWY A;  2JPA A;  2YSP A;  1J26 A;  5A6B A;  1STU A;  2DMY A;  2KHX A;  1T4L B;  3P1X A;  4F2J C;  1O0W A;  2LUQ A;  5TSE A;  2NUF A;  2EN7 A;  3MSW A;  2ELY A;  3UK3 C;  2V83 A;  1PDA A;  4JI8 E;  2V8Q B;  2JWO A;  1UBD C;  3C6M A;  2FGG A;  3OML A;  2CPN A;  4WX9 A;  2L6M A;  2LV2 A;  2EMZ A;  2JY9 A;  3DJW A;  2YU5 A;  1IBK E;  2MC6 A;  3VK6 A;  2EPC A;  3K6Q A;  2WBU A;  1BBG A;  2UXB E;  4TUG A;  2L2K B;  1HR0 E;  1WHN A;  2L92 A;  1X6F A;  2M4I A;  4R2D A;  2RSM A;  4WSG A;  2RPC A;  5AAS A;  4ZYG A;  1GQE A;  2EL6 A;  1J5E E;  2EOM A;  2YTJ A;  1UN6 B;  2L3J A;  1NCS A;  2EOY A;  2E5L E;  2ODR C;  2EPL X;  2V88 A;  1IQS A;  2YTD A;  4F6M A;  2EMK A;  2EQ1 A;  4DV1 E;  2LCE A;  4M2Z A;  2EM9 A;  2EOH A;  4HEI A;  4LFB E;  1ZBQ A;  5FLX C;  4X62 E;  5IV8 B;  1PKP A;  1N34 E;  4TUI A;  3OTO E;  1RC7 A;  2VQF E;  3ADG A;  4BMJ A;  1YYO A;  4DR6 E;  2B7V A;  1T4O A;  3TQM A;  5LMU E;  4RHB B;  2NAB A;  4O24 A;  2HJJ A;  4YY3 E;  1JK2 A;  1YUJ A;  2EOO A;  4P7D A;  1DI2 A;  2YTO A;  3QG5 C;  2H36 X;  4WXD A;  5F3W A;  2L33 A;  5A69 A;  4OOG C;  4GKJ E;  4M9V C;  3EPH A;  4JV5 E;  2MKN A;  1YZ9 A;  2VE7 C;  2B3T B;  1F2I G;  4LF8 E;  4LF6 E;  2WBS A;  2F4V E;  2DB2 A;  4FK5 C;  4WXC A;  1N36 E;  3JAM C;  4DV4 E;  2EM4 A;  2DSY A;  5LMN E;  4B3T E;  1UHZ A;  2KOU A;  2UXD E;  2EOS A;  4F9B B;  3JU0 A;  2ENH A;  4L8N A;  2EL4 A;  2RTX A;  1BB8 A;  4DV3 E;  5ADZ A;  2YTI A;  2EMG A;  1TF3 A;  4JI5 E;  4B3M E;  2L3C A;  5A6B D;  2B7T A;  3EPJ A;  4DR1 E;  4DV6 E;  2L2M A;  2LBS B;  3THO B;  2N3H A;  2JXP A;  2N3G A;  4GKK E;  1T4N A;  3ZOQ B;  2YTG A;  4NHR A;  1PJT A;  2Q8U A;  3THN A;  5LL6 R;  2LJH A;  2ELZ A;  3ADI A;  2EPK X;  4NXM E;  1YPN A;  1KJK A;  2MC5 A;  2EPP A;  2R1F A;  4DR5 E;  4LFC E;  2EQ3 A;  2LUP B;  2EQ0 A;  2V87 A;  1X47 A;  2EPN A;  2FV4 B;  2LJU A;  4BHC A;  2IHR 1;  5KL3 A;  3L00 A;  2LTS A;  1EH8 A;  2NA2 A;  1IQO A;  2LE2 A;  1I94 E;  2EMC A;  4OX9 E;  5T6J A;  1YYK A;  2UU9 E;  5KL2 A;  2DRP A;  2EJ4 A;  3FIG A;  4DUZ E;  5IWA E;  1A1L A;  4L5N C;  2EN8 A;  2RS7 A;  1UIL A;  2J7J A;  1P47 A;  5AC4 A;  4X8W A;  2EOX A;  1IBM E;  2PRT A;  4IS1 C;  4DR3 E;  4WSP A;  4BC7 A;  1T39 A;  1DGC A;  1AAY A;  3VYX A;  1YUI A;  1A1G A;  4LU9 A;  2A25 A;  4BBY A;  4BC9 A;  2EPX A;  2EMF A;  2EPU A;  4BCA A;  2V89 A;  2EM8 A;  4X66 E;  4AQY E;  2M9A A;  2EMX A;  5AC5 A;  4DMI A;  4X64 E;  1FKA E;  2EMA A;  1IMU A;  2BBG A;  2VF1 A;  1HNW E;  4R2A A;  3VYY A;  1MEY C;  2BB8 A;  2MKD A;  3C6K A;  4M0V A;  1X3C A;  1IBL E;  4JI3 E;  2EM3 A;  2EPM X;  3J7Y p;  1YYW A;  2EOE A;  3F6H A;  1ZAA C;  2NUE A;  4DKK A;  4F9C B;  2B9D A;  2LO3 A;  3BF2 A;  5AE3 A;  2LT7 A;  4R2E A;  2UUB E;  3BGH A;  2LMZ A;  4NXN E;  2L2N A;  4R2S A;  2CTD A;  2ENC A;  2F8B A;  2YTF A;  4JI7 E;  2YRH A;  3J7A G;  3KZY A;  1YSA C;  4LTY A;  5IXM B;  2JP9 A;  3IWC A;  3HTX A;  1KYQ A;  2VRD A;  1WJP A;  4LF4 E;  4JYA E;  4ZYE A;  2R76 A;  4F6N A;  5A2Q C;  1BBO A;  2JYA A;  5IT9 C;  2EM7 A;  4O4K A;  5KL5 A;  1G2D C;  1JK1 A;  4LF5 E;  5KL6 A;  1ZU1 A;  2JR1 A;  4WFT A;  4M30 A;  4WPY A;  2EPA A;  1SR9 A;  2EPR A;  4B3S E;  4F54 A;  2M7Q A;  4R2C A;  1EH7 A;  2DIX A;  3T1H E;  2UUC E;  4P78 A;  4R2P A;  2DLQ A;  2YWQ A;  2RQL A;  1RMD A;  1EKZ A;  2HHH E;  1HNZ E;  4Q35 B;  4YHH E;  2NUG A;  4IJD A;  3HPZ A;  1DQ3 A;  1GTK A;  2EN4 A;  4HTG A;  3MHH C;  3EQ1 A;  2HGH A;  3LML A;  2EOJ A;  2EOI A;  1XNQ E;  2EOR A;  1B69 A;  1EH6 A;  4Q28 A;  3J81 C;  3EPL A;  2ADR A;  4BHB A;  2EMW A;  3RMP A;  1G2F C;  4N4R B;  4O43 A;  4MLQ A;  2YTP A;  5KL4 A;  3MHS C;  2YRK A;  4O5G A;  4X9J A;  4JI1 E;  4ZYH A;  2EWL A;  3HQ1 A;  4BS9 A;  4KZS A;  3F6G A;  2YSO A;  1WXR A;  1XMO E;  4LF7 E;  2YTN A;  1NEI A;  5DNY A;  2KON A;  2L8T A;  1XMQ E;  2E72 A;  2EMI A;  4B3R E;  4F9A B;  2EOQ A;  2EL5 A;  2UUA E;  2DLK A;  2UXC E;  2EE8 A;  1X49 A;  4DV7 E;  4JI6 E;  1A1F A;  2EN3 A;  2CSH A;  2DGC A;  3AV0 A;  3T1Y E;  4JI4 E;  3AUZ A;  2EMY A;  5KL7 A;  2EPO A;  3ADJ A;  4LF9 E;  3J80 C;  1N3G A;  4J8Z A;  2YRM A;  2EZ6 A;  1ZR9 A;  4DUY E;  4NZV A;  1GZ6 A;  3ADL A;  3BID A;  1RQ0 A;  1ZBT A;  3KWR A;  5AE2 A;  2YT4 A;  1T38 A;  3M99 B;  2JVA A;  2EP3 A;  2YU8 A;  2ZM6 E;  2N8X A;  3BBG A;  2ODR D;  1FJG E;  2EMB A;  3KZZ A;  5AE1 A;  1N32 E;  2EN2 A;  4GEQ B;  1SFE A;  2WCC 3;  1X5W A;  3HPS A;  2GLI A;  2MDG A;  4JI0 E;  4RH8 A;  5BR8 E;  5A6A A;  3C4T A;  3H09 A;  3JTZ A;  3LLH A;  1WRJ A;  2V86 A;  2VQE E;  4DR2 E;  2HC5 A;  1Z1B A;  2YTE A;  1A1K A;  2I9I A;  4KHP E;  1TF6 A;  1LLM C;  2LTR A;  2RSI A;  1X6E A;  1XNR E;  2D9H A;  3DF6 A;  2WZO A;  3IWD A;  2YPN A;  4DV5 E;  2EOF A;  1WHQ A;  2GPI A;  4R2Q A;  2LVH A;  1L4S A;  2EM0 A;  1A1J A;  4JI2 E;  2YZT A;  2GHF A;  2E1M A;  1TN9 A;  2MDR A;  1N33 E;  2JOX A;  2ENA A;  4DV2 E;  4DR7 E;  4LFA E;  1YFH A;  2EOZ A;  2EML A;  4I8O A;  2YTQ A;  2FTX B; 
#chains in the Genus database with same CATH homology
 2PRT A;  4IS1 C;  1DGC A;  1AAY A;  1YUI A;  1A1G A;  2A25 A;  3MHS C;  2EN6 A;  2YSO A;  2EPX A;  2YTN A;  2EMF A;  2EPU A;  2EM8 A;  2WBT A;  2E72 A;  2M9A A;  2EMI A;  1A1I A;  2EMX A;  2EM2 A;  4R2R A;  4GZN C;  2EOQ A;  2NAB A;  2EL5 A;  1JK2 A;  2EMA A;  1YUJ A;  2EOO A;  2DLK A;  2EE8 A;  2YTO A;  2DMI A;  3EPK A;  1A1F A;  2EN3 A;  2EN1 A;  4R2A A;  1MEY C;  2CSH A;  2DGC A;  2BB8 A;  2MKD A;  2EM6 A;  1X3C A;  2EMY A;  2EM3 A;  1A1H A;  4M9V C;  5KL7 A;  3EPH A;  2I13 A;  2EPZ A;  2MKN A;  2EM5 A;  2EOE A;  1ZAA C;  1F2I G;  2LO3 A;  2WBS A;  2CT1 A;  2YRM A;  4FK5 C;  2LT7 A;  4R2E A;  3VHT B;  2EMH A;  1ZR9 A;  2EM4 A;  4R2S A;  1X6H A;  2CTD A;  2ENC A;  2EOS A;  2JPA A;  2YTF A;  3M99 B;  2YRH A;  2YSP A;  2EP3 A;  2YU8 A;  2ENH A;  2EL4 A;  1BB8 A;  1YSA C;  2EMB A;  2YTI A;  4F2J C;  2EMG A;  2EN2 A;  1TF3 A;  2JP9 A;  2WCC 3;  2VRD A;  1WJP A;  2YTP A;  1X5W A;  4F6N A;  2GLI A;  2EN7 A;  3EPJ A;  2MDG A;  1BBO A;  2ELY A;  2EM7 A;  5KL5 A;  1G2D C;  1JK1 A;  3UK3 C;  5KL6 A;  1UBD C;  1ZU1 A;  1Z1B A;  2YTG A;  2EPA A;  2EPR A;  2YTE A;  1A1K A;  2LV2 A;  1TF6 A;  4R2C A;  2ELZ A;  1LLM C;  2RSI A;  1KJK A;  2EMZ A;  2YU5 A;  2R1F A;  2EPP A;  4R2P A;  2DLQ A;  2EQ3 A;  2EPC A;  1X6E A;  1RMD A;  2D9H A;  2WBU A;  2EQ0 A;  5KL4 A;  4IJD A;  5KL3 A;  1X6F A;  2EN4 A;  4R2D A;  4WSG A;  2RPC A;  3MHH C;  2HGH A;  2EOJ A;  2EMC A;  2EOF A;  2EOI A;  2EL6 A;  4R2Q A;  2LVH A;  2EOM A;  2EM0 A;  1A1J A;  2YTJ A;  5KL2 A;  2EJ4 A;  2EOR A;  1B69 A;  2DRP A;  1UN6 B;  2GHF A;  1NCS A;  2EOY A;  1TN9 A;  1A1L A;  3EPL A;  2EN8 A;  2YTD A;  2ADR A;  4F6M A;  2EMW A;  2EMK A;  2ENA A;  2EQ1 A;  2J7J A;  1G2F C;  1P47 A;  2EOZ A;  2LCE A;  2EML A;  2EM9 A;  2YTQ A;  2EOX A;  2EOH A;  2YRK A;  4X9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...