1BBOA

High-resolution solution structure of the double cys2*his2 zinc finger from the human enhancer binding protein mbp-1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
56
Chain Sequence
KYICEECGIRKKPSMLKKHIRTHTDVRPYHCTYCNFSFKTKGNLTKHMKSKAHSKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution solution structure of the double Cys2His2 zinc finger from the human enhancer binding protein MBP-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords HUMAN ENHANCER-BINDING PROTEIN MBP-1
total genus 11
structure length 56
sequence length 57
ec nomenclature
pdb deposition date 1992-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1bboA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1bboA01
1A1KA 3EPLA 2ADRA 2GHFA 2BB8A 2YTEA 2ELZA 2EOOA 2YSPA 2YTQA 1RMDA 3EPKA 2WBSA 1X6EA 2CTDA 4R2RA 2MDGA 2EN6A 2EPRA 2EMLA 2EMFA 2EM8A 2WCC3 1A1LA 2DLQA 1G2DC 2EMIA 2E72A 2EM3A 1A1FA 1G2FC 1BBOA 2EM0A 1DGCA 2YRHA 2YRKA 1UN6B 2EN2A 2EORA 2EOSA 1ZU1A 1A1IA 4R2CA 4R2QA 2I13A 2YTIA 2EMZA 4IJDA 1JK2A 2RSIA 2YSOA 2PRTA 2HGHA 2EE8A 1ZR9A 4M9VC 2EMWA 2MKDA 2EMBA 2YTDA 2EPAA 2EOMA 2EMYA 2EOYA 4X9JA 2EPZA 1YUJA 2EQ1A 2LV2A 2EMXA 1LLMC 2D9HA 2DRPA 2DLKA 2WBUA 2EMGA 2R1FA 2EQ0A 2LVHA 2WBTA 1A1GA 2NABA 2EPPA 4WSGA 2EM7A 4R2SA 2LCEA 1ZAAC 4R2DA 2YTGA 5KL7A 2EL5A 1B69A 2EM9A 2EOQA 2YTOA 4IS1C 2EM6A 2EOIA 2EOHA 5KL6A 4R2AA 2YTPA 2YTNA 1UBDC 2EN8A 5KL4A 2EOZA 2JPAA 1A1HA 2EN3A 2EM2A 2EL4A 2RPCA 1JK1A 2EMHA 3MHSC 2JP9A 3M99B 1BB8A 2EN1A 2ENHA 1X6HA 2MKNA 5KL5A 2EM4A 2YTJA 2EP3A 2YRMA 4F2JC 2EMAA 1A1JA 2ELYA 4F6MA 1YUIA 3EPHA 2CT1A 1NCSA 3VHTB 4F6NA 2A25A 2YU8A 1TN9A 1TF6A 2ENCA 2EOEA 4FK5C 2EMKA 1X3CA 3EPJA 2YU5A 4R2EA 1TF3A 2EMCA 2EOJA 2VRDA 2EM5A 2ENAA 2EOFA 2EQ3A 1AAYA 1P47A 2EN7A 2DMIA 3MHHC 5KL3A 4R2PA 2YTFA 5KL2A 2DGCA 2EL6A 1X5WA 1F2IG 1WJPA 2CSHA 2GLIA 1Z1BA 2EJ4A 2J7JA 2EOXA 2M9AA 2EN4A 2EPUA 2LT7A 3UK3C 2EPXA 2LO3A 4GZNC 1X6FA 2EPCA 1KJKA 1MEYC 1YSAC
chains in the Genus database with same CATH superfamily
2L6MA 3BGHA 4X66E 2ELZA 4JV5E 2EZ6A 3EPKA 1X6EA 4R2RA 2MDGA 2EM8A 3C6MA 1A1LA 2L2KB 3H09A 2MC6A 2VE7C 5AC5A 1A1FA 1X48A 2EM0A 3THOB 1DGCA 4DV4E 1XMOE 2YRHA 2YRKA 1UN6B 2F8BA 1PJSA 1PJTA 4DKKA 1A1IA 4JYAE 2UXCE 2V86A 2YTIA 3P1XA 2EMZA 4DV7E 2EPOA 2L3CA 3THNA 2MKDA 2EMBA 2WZOA 2YTDA 4GEQB 4N4RB 4TUGA 4X9JA 2EQ1A 3ADLA 1J5EE 4DR2E 3HQ1A 4RH8A 2D9HA 2FTXB 4LTYA 2EMGA 3ADJA 2WBTA 5CFFE 1A1GA 1I94E 2EPPA 5ADZA 4R2SA 2LCEA 1DQ3A 4JI1E 2UXDE 1IQSA 2LBSB 2IHR1 4LF9E 1T38A 2G7HA 5KL6A 2YT4A 4LFCE 5A2QC 1UBDC 2NUFA 5KL4A 4BHBA 2JPAA 3C6KA 1JK1A 2VQFE 2ENHA 1X6HA 4M30A 1HNWE 1PKPA 4DV5E 1YUIA 1A1JA 2ELYA 3VHTB 1N3GA 2EOEA 2EMKA 2RS6A 3HPSA 4LF5E 3K6QA 3JAMC 4WXDA 1YZ9A 2DMIA 4R2PA 2DGCA 2B3TB 1AH5A 4LF4E 3T1YE 4DV2E 2JVAA 2HHHE 2L8TA 2EPUA 2LT7A 2RSMA 4DV1E 1GZ6A 2F4VE 1YSAC 3ECRA 4NZVA 4M2ZA 2JXPA 1HNZE 1IBME 1RMDA 2YWQA 4AQYE 3EQ1A 5TSEA 1GTKA 3C4TA 3JTZA 2LJUA 2I9IA 2MDRA 3BIDA 1IBKE 2DLQA 1G2DC 2EMIA 3OMLA 2YPNA 3QG5C 4BCAA 4NXME 4KWYA 4DR7E 2NA2A 4DMIA 1BBOA 2UXBE 2UUCE 1PJQA 2EORA 2JOBA 2V88A 4KZSA 2EOSA 4RHBB 1HNXE 1T39A 5T6JA 2I13A 4L8NA 4KHPE 4IJDA 2KOUA 5F3WA 2HC5A 1WRJA 4HTGA 3J80C 4B3SE 2EE8A 1ZR9A 2UUBE 2MC5A 3DJWA 2V87A 4O24A 2NUGA 1WHQA 2K4VA 2EOYA 2EPZA 4R8OA 4BBYA 1LLMC 5A69A 1EH7A 4X64E 2LTSA 3DF6A 2DRPA 3BF2A 4ZYDA 2EQ0A 4GKJE 4B3RE 2NABA 3J7Yp 4R2DA 2YTGA 4LF8E 2GPIA 4ZYGA 2EOQA 2M1SA 2RS7A 4F9BB 2EOHA 3TQMA 1EKZA 4DR6E 2K7IA 4DV0E 2EN8A 3HTXA 1RQ0A 2RTXA 4YY3E 2LTRA 3M99B 2L33A 2EN1A 2V85A 4BS9A 5KL5A 2JR1A 3KZZA 2YTJA 2EP3A 5AASA 5A6JA 5LLQA 4X62E 1NEIA 4WSPA 3ADIA 2LE2A 1EH8A 3EPJA 2YU5A 2L2NA 2EMCA 2EOJA 4F9CB 5DNYA 2EM5A 2L3JA 5A6BD 2EOFA 2EQ3A 4Q35B 3MHHC 5KL3A 5KL2A 3LLHA 4DV6E 3AV0A 4WPYA 2L92A 1YPNA 2KHXA 1Z1BA 2EJ4A 2B7TA 1BBGA 4O5GA 1KYQA 2V8QB 1FKAE 1YYWA 1X6FA 1MEYC 3VK6A 4DR3E 3EPLA 2ADRA 2GHFA 2BB8A 5LMNE 2YTEA 2EOOA 2LJHA 2EPKX 4YHHE 1O0WA 2EN6A 4K0KE 5IT9C 4O4KA 2RQLA 4NXNE 2V83A 2UU9E 3C4BA 2KONA 2E1MA 4MLQA 2JWOA 1G2FC 1FJGE 5A6KA 2ODRD 2R76A 1ZU1A 1SR9A 4WXCA 2N3HA 4BHCA 4F9AB 2YSOA 4TUIA 1T4OA 1N32E 2M7QA 2N3GA 4M9VC 1N34E 3IWDA 1ZBQA 4DR4E 1XNQE 2EPAA 2EMYA 3KWRA 1T4LB 4X8WA 1YUJA 2LV2A 2EMXA 5A6BA 1X49A 2DLKA 3F6HA 2WBUA 5BR8E 1YYKA 2R1FA 1DI2A 2LVHA 3LMLA 3MSWA 2LUQA 1J26A 2N8XA 3BBGA 5KL7A 1IMUA 2EL5A 1B69A 2EM9A 4BC7A 1XMQE 4JI2E 4JI7E 4IS1C 2ODRC 5FLXC 4JI5E 3RMPA 4NHRA 2M4IA 4R2AA 3J7AG 2YTNA 1A1HA 2EM2A 1PDAA 1BB8A 2MKNA 2EM4A 2YRMA 4F2JC 3L00A 2EMAA 4DUZE 3EPHA 4B3TE 2CT1A 3AUZA 4WYQB 1NCSA 2A25A 3J81C 2YU8A 4DUYE 4JI6E 1TN9A 2ENCA 4FK5C 2H36X 5IV8B 4R2EA 1IBLE 2VRDA 2LMZA 2CPNA 2EPLX 2JYAA 2B9DA 1P47A 1AAYA 2YTFA 2EL6A 1F2IG 4ZYEA 3VYXA 1WJPA 1GQEA 2J7JA 2EOXA 3ZOQB 2EN4A 2ZM6E 4GZNC 4JI0E 5IXMB 4B3ME 2LRSA 2DIXA 1A1KA 4L5NC 4LFBE 4JI8E 2Q8UA 2YSPA 4JI4E 2YTQA 2WBSA 5AC4A 1IQOA 2CTDA 3T1HE 2EPRA 2EMLA 4P7DA 2EMFA 2DB2A 2WCC3 3F6GA 2DSYA 2BBGA 4J8ZA 2E72A 2EM3A 2VQEE 1YFHA 4WFTA 2HJJA 4F54A 3VYYA 4R03A 2EN2A 1T4NA 4BC9A 4R2CA 4R2QA 3HXLA 2EPMX 4M0VA 1JK2A 2RSIA 2PRTA 5AE2A 1N36E 4BMJA 3OTOE 5LL6R 5LMUE 5AE1A 2EMWA 2FGGA 2NUEA 4I8OA 2B7VA 2EOMA 1QU6A 4LF6E 2V89A 1STUA 2DMYA 1UILA 2FV4B 4MLVA 1XNRE 3KZYA 4WSGA 2EM7A 1ZAAC 4LF7E 4OOGC 4HEIA 2UUAE 1HR0E 3JU0A 1WHNA 1X47A 2YTOA 4ZYHA 2EWLA 4OX9E 2VF1A 2EM6A 2EOIA 4DR5E 2L2MA 2E5LE 1L4SA 3FIGA 1ZBTA 2YTPA 1YYOA 4DV3E 3IWCA 1EH6A 2EOZA 4GKKE 2EN3A 2RPCA 2EL4A 2EMHA 3MHSC 5AE3A 5IWAE 4X65E 4P78A 2JP9A 3IWBA 3ADGA 2EPNA 1SFEA 3HPZA 4F6MA 2JY9A 4F6NA 1TF6A 4DR1E 1X3CA 4Q28A 1TF3A 1MGTA 2ENAA 4LU9A 1UHZA 2YZTA 4WX9A 2EN7A 2JOXA 1X5WA 2CSHA 2GLIA 1WXRA 4LFAE 2M9AA 5A6AA 4O43A 1QNTA 3UK3C 2EPXA 1RC7A 2LO3A 4JI3E 1N33E 2EPCA 1KJKA 2LUPB 2HGHA
chains in the Genus database with same CATH topology
1A1KA 3EPLA 2ADRA 2GHFA 2BB8A 2YTEA 2ELZA 2EOOA 2YSPA 2YTQA 1RMDA 3EPKA 2WBSA 1X6EA 2CTDA 4R2RA 2MDGA 2EN6A 2EPRA 2EMLA 2EMFA 2EM8A 2WCC3 1A1LA 2DLQA 1G2DC 2EMIA 2E72A 2EM3A 1A1FA 1G2FC 1BBOA 2EM0A 1DGCA 2YRHA 2YRKA 1UN6B 2EN2A 2EORA 2EOSA 1ZU1A 1A1IA 4R2CA 4R2QA 2I13A 2YTIA 2EMZA 4IJDA 1JK2A 2RSIA 2YSOA 2PRTA 2HGHA 2EE8A 1ZR9A 4M9VC 2EMWA 2MKDA 2EMBA 2YTDA 2EPAA 2EOMA 2EMYA 2EOYA 4X9JA 2EPZA 1YUJA 2EQ1A 2LV2A 2EMXA 1LLMC 2D9HA 2DRPA 2DLKA 2WBUA 2EMGA 2R1FA 2EQ0A 2LVHA 2WBTA 1A1GA 2NABA 2EPPA 4WSGA 2EM7A 4R2SA 2LCEA 1ZAAC 4R2DA 2YTGA 5KL7A 2EL5A 1B69A 2EM9A 2EOQA 2YTOA 4IS1C 2EM6A 2EOIA 2EOHA 5KL6A 4R2AA 2YTPA 2YTNA 1UBDC 2EN8A 5KL4A 2EOZA 2JPAA 1A1HA 2EN3A 2EM2A 2EL4A 2RPCA 1JK1A 2EMHA 3MHSC 2JP9A 3M99B 1BB8A 2EN1A 2ENHA 1X6HA 2MKNA 5KL5A 2EM4A 2YTJA 2EP3A 2YRMA 4F2JC 2EMAA 1A1JA 2ELYA 4F6MA 1YUIA 3EPHA 2CT1A 1NCSA 3VHTB 4F6NA 2A25A 2YU8A 1TN9A 1TF6A 2ENCA 2EOEA 4FK5C 2EMKA 1X3CA 3EPJA 2YU5A 4R2EA 1TF3A 2EMCA 2EOJA 2VRDA 2EM5A 2ENAA 2EOFA 2EQ3A 1AAYA 1P47A 2EN7A 2DMIA 3MHHC 5KL3A 4R2PA 2YTFA 5KL2A 2DGCA 2EL6A 1X5WA 1F2IG 1WJPA 2CSHA 2GLIA 1Z1BA 2EJ4A 2J7JA 2EOXA 2M9AA 2EN4A 2EPUA 2LT7A 3UK3C 2EPXA 2LO3A 4GZNC 1X6FA 2EPCA 1KJKA 1MEYC 1YSAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A1K A;  3EPL A;  2ADR A;  2GHF A;  2BB8 A;  2YTE A;  2ELZ A;  2EOO A;  2YSP A;  2YTQ A;  1RMD A;  3EPK A;  2WBS A;  1X6E A;  2CTD A;  4R2R A;  2MDG A;  2EN6 A;  2EPR A;  2EML A;  2EMF A;  2EM8 A;  2WCC 3;  1A1L A;  2DLQ A;  1G2D C;  2EMI A;  2E72 A;  2EM3 A;  1A1F A;  1G2F C;  1BBO A;  2EM0 A;  1DGC A;  2YRH A;  2YRK A;  1UN6 B;  2EN2 A;  2EOR A;  2EOS A;  1ZU1 A;  1A1I A;  4R2C A;  4R2Q A;  2I13 A;  2YTI A;  2EMZ A;  4IJD A;  1JK2 A;  2RSI A;  2YSO A;  2PRT A;  2HGH A;  2EE8 A;  1ZR9 A;  4M9V C;  2EMW A;  2MKD A;  2EMB A;  2YTD A;  2EPA A;  2EOM A;  2EMY A;  2EOY A;  4X9J A;  2EPZ A;  1YUJ A;  2EQ1 A;  2LV2 A;  2EMX A;  1LLM C;  2D9H A;  2DRP A;  2DLK A;  2WBU A;  2EMG A;  2R1F A;  2EQ0 A;  2LVH A;  2WBT A;  1A1G A;  2NAB A;  2EPP A;  4WSG A;  2EM7 A;  4R2S A;  2LCE A;  1ZAA C;  4R2D A;  2YTG A;  5KL7 A;  2EL5 A;  1B69 A;  2EM9 A;  2EOQ A;  2YTO A;  4IS1 C;  2EM6 A;  2EOI A;  2EOH A;  5KL6 A;  4R2A A;  2YTP A;  2YTN A;  1UBD C;  2EN8 A;  5KL4 A;  2EOZ A;  2JPA A;  1A1H A;  2EN3 A;  2EM2 A;  2EL4 A;  2RPC A;  1JK1 A;  2EMH A;  3MHS C;  2JP9 A;  3M99 B;  1BB8 A;  2EN1 A;  2ENH A;  1X6H A;  2MKN A;  5KL5 A;  2EM4 A;  2YTJ A;  2EP3 A;  2YRM A;  4F2J C;  2EMA A;  1A1J A;  2ELY A;  4F6M A;  1YUI A;  3EPH A;  2CT1 A;  1NCS A;  3VHT B;  4F6N A;  2A25 A;  2YU8 A;  1TN9 A;  1TF6 A;  2ENC A;  2EOE A;  4FK5 C;  2EMK A;  1X3C A;  3EPJ A;  2YU5 A;  4R2E A;  1TF3 A;  2EMC A;  2EOJ A;  2VRD A;  2EM5 A;  2ENA A;  2EOF A;  2EQ3 A;  1AAY A;  1P47 A;  2EN7 A;  2DMI A;  3MHH C;  5KL3 A;  4R2P A;  2YTF A;  5KL2 A;  2DGC A;  2EL6 A;  1X5W A;  1F2I G;  1WJP A;  2CSH A;  2GLI A;  1Z1B A;  2EJ4 A;  2J7J A;  2EOX A;  2M9A A;  2EN4 A;  2EPU A;  2LT7 A;  3UK3 C;  2EPX A;  2LO3 A;  4GZN C;  1X6F A;  2EPC A;  1KJK A;  1MEY C;  1YSA C; 
#chains in the Genus database with same CATH topology
 2L6M A;  3BGH A;  4X66 E;  2ELZ A;  4JV5 E;  2EZ6 A;  3EPK A;  1X6E A;  4R2R A;  2MDG A;  2EM8 A;  3C6M A;  1A1L A;  2L2K B;  3H09 A;  2MC6 A;  2VE7 C;  5AC5 A;  1A1F A;  1X48 A;  2EM0 A;  3THO B;  1DGC A;  4DV4 E;  1XMO E;  2YRH A;  2YRK A;  1UN6 B;  2F8B A;  1PJS A;  1PJT A;  4DKK A;  1A1I A;  4JYA E;  2UXC E;  2V86 A;  2YTI A;  3P1X A;  2EMZ A;  4DV7 E;  2EPO A;  2L3C A;  3THN A;  2MKD A;  2EMB A;  2WZO A;  2YTD A;  4GEQ B;  4N4R B;  4TUG A;  4X9J A;  2EQ1 A;  3ADL A;  1J5E E;  4DR2 E;  3HQ1 A;  4RH8 A;  2D9H A;  2FTX B;  4LTY A;  2EMG A;  3ADJ A;  2WBT A;  5CFF E;  1A1G A;  1I94 E;  2EPP A;  5ADZ A;  4R2S A;  2LCE A;  1DQ3 A;  4JI1 E;  2UXD E;  1IQS A;  2LBS B;  2IHR 1;  4LF9 E;  1T38 A;  2G7H A;  5KL6 A;  2YT4 A;  4LFC E;  5A2Q C;  1UBD C;  2NUF A;  5KL4 A;  4BHB A;  2JPA A;  3C6K A;  1JK1 A;  2VQF E;  2ENH A;  1X6H A;  4M30 A;  1HNW E;  1PKP A;  4DV5 E;  1YUI A;  1A1J A;  2ELY A;  3VHT B;  1N3G A;  2EOE A;  2EMK A;  2RS6 A;  3HPS A;  4LF5 E;  3K6Q A;  3JAM C;  4WXD A;  1YZ9 A;  2DMI A;  4R2P A;  2DGC A;  2B3T B;  1AH5 A;  4LF4 E;  3T1Y E;  4DV2 E;  2JVA A;  2HHH E;  2L8T A;  2EPU A;  2LT7 A;  2RSM A;  4DV1 E;  1GZ6 A;  2F4V E;  1YSA C;  3ECR A;  4NZV A;  4M2Z A;  2JXP A;  1HNZ E;  1IBM E;  1RMD A;  2YWQ A;  4AQY E;  3EQ1 A;  5TSE A;  1GTK A;  3C4T A;  3JTZ A;  2LJU A;  2I9I A;  2MDR A;  3BID A;  1IBK E;  2DLQ A;  1G2D C;  2EMI A;  3OML A;  2YPN A;  3QG5 C;  4BCA A;  4NXM E;  4KWY A;  4DR7 E;  2NA2 A;  4DMI A;  1BBO A;  2UXB E;  2UUC E;  1PJQ A;  2EOR A;  2JOB A;  2V88 A;  4KZS A;  2EOS A;  4RHB B;  1HNX E;  1T39 A;  5T6J A;  2I13 A;  4L8N A;  4KHP E;  4IJD A;  2KOU A;  5F3W A;  2HC5 A;  1WRJ A;  4HTG A;  3J80 C;  4B3S E;  2EE8 A;  1ZR9 A;  2UUB E;  2MC5 A;  3DJW A;  2V87 A;  4O24 A;  2NUG A;  1WHQ A;  2K4V A;  2EOY A;  2EPZ A;  4R8O A;  4BBY A;  1LLM C;  5A69 A;  1EH7 A;  4X64 E;  2LTS A;  3DF6 A;  2DRP A;  3BF2 A;  4ZYD A;  2EQ0 A;  4GKJ E;  4B3R E;  2NAB A;  3J7Y p;  4R2D A;  2YTG A;  4LF8 E;  2GPI A;  4ZYG A;  2EOQ A;  2M1S A;  2RS7 A;  4F9B B;  2EOH A;  3TQM A;  1EKZ A;  4DR6 E;  2K7I A;  4DV0 E;  2EN8 A;  3HTX A;  1RQ0 A;  2RTX A;  4YY3 E;  2LTR A;  3M99 B;  2L33 A;  2EN1 A;  2V85 A;  4BS9 A;  5KL5 A;  2JR1 A;  3KZZ A;  2YTJ A;  2EP3 A;  5AAS A;  5A6J A;  5LLQ A;  4X62 E;  1NEI A;  4WSP A;  3ADI A;  2LE2 A;  1EH8 A;  3EPJ A;  2YU5 A;  2L2N A;  2EMC A;  2EOJ A;  4F9C B;  5DNY A;  2EM5 A;  2L3J A;  5A6B D;  2EOF A;  2EQ3 A;  4Q35 B;  3MHH C;  5KL3 A;  5KL2 A;  3LLH A;  4DV6 E;  3AV0 A;  4WPY A;  2L92 A;  1YPN A;  2KHX A;  1Z1B A;  2EJ4 A;  2B7T A;  1BBG A;  4O5G A;  1KYQ A;  2V8Q B;  1FKA E;  1YYW A;  1X6F A;  1MEY C;  3VK6 A;  4DR3 E;  3EPL A;  2ADR A;  2GHF A;  2BB8 A;  5LMN E;  2YTE A;  2EOO A;  2LJH A;  2EPK X;  4YHH E;  1O0W A;  2EN6 A;  4K0K E;  5IT9 C;  4O4K A;  2RQL A;  4NXN E;  2V83 A;  2UU9 E;  3C4B A;  2KON A;  2E1M A;  4MLQ A;  2JWO A;  1G2F C;  1FJG E;  5A6K A;  2ODR D;  2R76 A;  1ZU1 A;  1SR9 A;  4WXC A;  2N3H A;  4BHC A;  4F9A B;  2YSO A;  4TUI A;  1T4O A;  1N32 E;  2M7Q A;  2N3G A;  4M9V C;  1N34 E;  3IWD A;  1ZBQ A;  4DR4 E;  1XNQ E;  2EPA A;  2EMY A;  3KWR A;  1T4L B;  4X8W A;  1YUJ A;  2LV2 A;  2EMX A;  5A6B A;  1X49 A;  2DLK A;  3F6H A;  2WBU A;  5BR8 E;  1YYK A;  2R1F A;  1DI2 A;  2LVH A;  3LML A;  3MSW A;  2LUQ A;  1J26 A;  2N8X A;  3BBG A;  5KL7 A;  1IMU A;  2EL5 A;  1B69 A;  2EM9 A;  4BC7 A;  1XMQ E;  4JI2 E;  4JI7 E;  4IS1 C;  2ODR C;  5FLX C;  4JI5 E;  3RMP A;  4NHR A;  2M4I A;  4R2A A;  3J7A G;  2YTN A;  1A1H A;  2EM2 A;  1PDA A;  1BB8 A;  2MKN A;  2EM4 A;  2YRM A;  4F2J C;  3L00 A;  2EMA A;  4DUZ E;  3EPH A;  4B3T E;  2CT1 A;  3AUZ A;  4WYQ B;  1NCS A;  2A25 A;  3J81 C;  2YU8 A;  4DUY E;  4JI6 E;  1TN9 A;  2ENC A;  4FK5 C;  2H36 X;  5IV8 B;  4R2E A;  1IBL E;  2VRD A;  2LMZ A;  2CPN A;  2EPL X;  2JYA A;  2B9D A;  1P47 A;  1AAY A;  2YTF A;  2EL6 A;  1F2I G;  4ZYE A;  3VYX A;  1WJP A;  1GQE A;  2J7J A;  2EOX A;  3ZOQ B;  2EN4 A;  2ZM6 E;  4GZN C;  4JI0 E;  5IXM B;  4B3M E;  2LRS A;  2DIX A;  1A1K A;  4L5N C;  4LFB E;  4JI8 E;  2Q8U A;  2YSP A;  4JI4 E;  2YTQ A;  2WBS A;  5AC4 A;  1IQO A;  2CTD A;  3T1H E;  2EPR A;  2EML A;  4P7D A;  2EMF A;  2DB2 A;  2WCC 3;  3F6G A;  2DSY A;  2BBG A;  4J8Z A;  2E72 A;  2EM3 A;  2VQE E;  1YFH A;  4WFT A;  2HJJ A;  4F54 A;  3VYY A;  4R03 A;  2EN2 A;  1T4N A;  4BC9 A;  4R2C A;  4R2Q A;  3HXL A;  2EPM X;  4M0V A;  1JK2 A;  2RSI A;  2PRT A;  5AE2 A;  1N36 E;  4BMJ A;  3OTO E;  5LL6 R;  5LMU E;  5AE1 A;  2EMW A;  2FGG A;  2NUE A;  4I8O A;  2B7V A;  2EOM A;  1QU6 A;  4LF6 E;  2V89 A;  1STU A;  2DMY A;  1UIL A;  2FV4 B;  4MLV A;  1XNR E;  3KZY A;  4WSG A;  2EM7 A;  1ZAA C;  4LF7 E;  4OOG C;  4HEI A;  2UUA E;  1HR0 E;  3JU0 A;  1WHN A;  1X47 A;  2YTO A;  4ZYH A;  2EWL A;  4OX9 E;  2VF1 A;  2EM6 A;  2EOI A;  4DR5 E;  2L2M A;  2E5L E;  1L4S A;  3FIG A;  1ZBT A;  2YTP A;  1YYO A;  4DV3 E;  3IWC A;  1EH6 A;  2EOZ A;  4GKK E;  2EN3 A;  2RPC A;  2EL4 A;  2EMH A;  3MHS C;  5AE3 A;  5IWA E;  4X65 E;  4P78 A;  2JP9 A;  3IWB A;  3ADG A;  2EPN A;  1SFE A;  3HPZ A;  4F6M A;  2JY9 A;  4F6N A;  1TF6 A;  4DR1 E;  1X3C A;  4Q28 A;  1TF3 A;  1MGT A;  2ENA A;  4LU9 A;  1UHZ A;  2YZT A;  4WX9 A;  2EN7 A;  2JOX A;  1X5W A;  2CSH A;  2GLI A;  1WXR A;  4LFA E;  2M9A A;  5A6A A;  4O43 A;  1QNT A;  3UK3 C;  2EPX A;  1RC7 A;  2LO3 A;  4JI3 E;  1N33 E;  2EPC A;  1KJK A;  2LUP B;  2HGH A; 
#chains in the Genus database with same CATH homology
 1A1K A;  3EPL A;  2ADR A;  2GHF A;  2BB8 A;  2YTE A;  2ELZ A;  2EOO A;  2YSP A;  2YTQ A;  1RMD A;  3EPK A;  2WBS A;  1X6E A;  2CTD A;  4R2R A;  2MDG A;  2EN6 A;  2EPR A;  2EML A;  2EMF A;  2EM8 A;  2WCC 3;  1A1L A;  2DLQ A;  1G2D C;  2EMI A;  2E72 A;  2EM3 A;  1A1F A;  1G2F C;  1BBO A;  2EM0 A;  1DGC A;  2YRH A;  2YRK A;  1UN6 B;  2EN2 A;  2EOR A;  2EOS A;  1ZU1 A;  1A1I A;  4R2C A;  4R2Q A;  2I13 A;  2YTI A;  2EMZ A;  4IJD A;  1JK2 A;  2RSI A;  2YSO A;  2PRT A;  2HGH A;  2EE8 A;  1ZR9 A;  4M9V C;  2EMW A;  2MKD A;  2EMB A;  2YTD A;  2EPA A;  2EOM A;  2EMY A;  2EOY A;  4X9J A;  2EPZ A;  1YUJ A;  2EQ1 A;  2LV2 A;  2EMX A;  1LLM C;  2D9H A;  2DRP A;  2DLK A;  2WBU A;  2EMG A;  2R1F A;  2EQ0 A;  2LVH A;  2WBT A;  1A1G A;  2NAB A;  2EPP A;  4WSG A;  2EM7 A;  4R2S A;  2LCE A;  1ZAA C;  4R2D A;  2YTG A;  5KL7 A;  2EL5 A;  1B69 A;  2EM9 A;  2EOQ A;  2YTO A;  4IS1 C;  2EM6 A;  2EOI A;  2EOH A;  5KL6 A;  4R2A A;  2YTP A;  2YTN A;  1UBD C;  2EN8 A;  5KL4 A;  2EOZ A;  2JPA A;  1A1H A;  2EN3 A;  2EM2 A;  2EL4 A;  2RPC A;  1JK1 A;  2EMH A;  3MHS C;  2JP9 A;  3M99 B;  1BB8 A;  2EN1 A;  2ENH A;  1X6H A;  2MKN A;  5KL5 A;  2EM4 A;  2YTJ A;  2EP3 A;  2YRM A;  4F2J C;  2EMA A;  1A1J A;  2ELY A;  4F6M A;  1YUI A;  3EPH A;  2CT1 A;  1NCS A;  3VHT B;  4F6N A;  2A25 A;  2YU8 A;  1TN9 A;  1TF6 A;  2ENC A;  2EOE A;  4FK5 C;  2EMK A;  1X3C A;  3EPJ A;  2YU5 A;  4R2E A;  1TF3 A;  2EMC A;  2EOJ A;  2VRD A;  2EM5 A;  2ENA A;  2EOF A;  2EQ3 A;  1AAY A;  1P47 A;  2EN7 A;  2DMI A;  3MHH C;  5KL3 A;  4R2P A;  2YTF A;  5KL2 A;  2DGC A;  2EL6 A;  1X5W A;  1F2I G;  1WJP A;  2CSH A;  2GLI A;  1Z1B A;  2EJ4 A;  2J7J A;  2EOX A;  2M9A A;  2EN4 A;  2EPU A;  2LT7 A;  3UK3 C;  2EPX A;  2LO3 A;  4GZN C;  1X6F A;  2EPC A;  1KJK A;  1MEY C;  1YSA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...