1BBOA

High-resolution solution structure of the double cys2*his2 zinc finger from the human enhancer binding protein mbp-1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
56
Chain Sequence
KYICEECGIRKKPSMLKKHIRTHTDVRPYHCTYCNFSFKTKGNLTKHMKSKAHSKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution solution structure of the double Cys2His2 zinc finger from the human enhancer binding protein MBP-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords HUMAN ENHANCER-BINDING PROTEIN MBP-1
total genus 11
structure length 56
sequence length 57
ec nomenclature
pdb deposition date 1992-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1bboA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1bboA01
3EPJA 2EOIA 2YTNA 4R2EA 2CT1A 2EMWA 3MHHC 1X3CA 2WBTA 2YTJA 2RSIA 2EMGA 2YTEA 4WSGA 1ZR9A 2GLIA 1TN9A 2PRTA 1DGCA 2DMIA 2EMXA 2I13A 1X6FA 1F2IG 2EN2A 2EN1A 1KJKA 2EN3A 2YTDA 2EM8A 2YTPA 2EN8A 2YTQA 2EPCA 2EMAA 4R2DA 2LCEA 1TF3A 2EE8A 2MKNA 2YSPA 2EPPA 2EOOA 2EQ1A 2EPRA 2D9HA 2LV2A 3VHTB 4M9VC 2EN4A 1MEYC 2EOSA 2YTFA 2ADRA 2EMZA 3EPKA 1ZAAC 1LLMC 4F6NA 1X6HA 2EM2A 3EPLA 2EM0A 1A1JA 2CSHA 2YRHA 5KL6A 1A1KA 4R2SA 2EM6A 2ELZA 1JK2A 2DLKA 1UN6B 5KL4A 2R1FA 2EOEA 2EN7A 2EPUA 4F6MA 2EOHA 2EPZA 2LO3A 2EOXA 2YRKA 2EMYA 1P47A 2EOJA 2ENHA 2EM7A 2EMIA 2HGHA 4IS1C 2EMHA 2YTIA 4R2CA 5KL3A 3MHSC 2J7JA 4R2AA 1G2DC 1A1FA 2RPCA 2EMFA 2EOZA 1ZU1A 2JPAA 1BB8A 4R2QA 2EM9A 2EL6A 2EMLA 1B69A 1UBDC 2JP9A 5KL5A 2EJ4A 1JK1A 1A1LA 1A1HA 2M9AA 5KL2A 2YU8A 5KL7A 2GHFA 3UK3C 2NABA 1Z1BA 2EMCA 2EPAA 1X6EA 2EOYA 2EL4A 2YRMA 2EMBA 2EPXA 1BBOA 2EQ0A 1YUIA 1A1GA 2EP3A 2MDGA 2YSOA 2ENCA 2DRPA 2EOQA 2YU5A 1TF6A 1YSAC 3EPHA 2YTGA 4R2RA 2VRDA 2DGCA 2E72A 2BB8A 2EOFA 2EM5A 2WBUA 4IJDA 1WJPA 1AAYA 2EM4A 2DLQA 4X9JA 2ELYA 2WBSA 3M99B 4F2JC 1A1IA 1YUJA 2YTOA 2WCC3 2EORA 2EQ3A 2ENAA 2A25A 2CTDA 2MKDA 4GZNC 1RMDA 4R2PA 2EOMA 1NCSA 1X5WA 2EMKA 2LVHA 4FK5C 1G2FC 2EM3A 2EL5A 2LT7A 2EN6A
chains in the Genus database with same CATH superfamily
2YZTA 3MHHC 2RSMA 2YTJA 3ADLA 2KOUA 2YTEA 2GLIA 2LMZA 1T38A 2N8XA 4O24A 2ODRD 2PRTA 1J26A 1WHNA 3BBGA 3C4TA 1UILA 2EMXA 2EN1A 3HPSA 1AH5A 1DQ3A 5AC5A 2YTQA 5A6JA 4R2DA 4KZSA 2DMYA 2L33A 2MKNA 1YPNA 4LFBE 1RC7A 3LMLA 4LF5E 4I8OA 2ZM6E 4JI1E 4Q35B 3ZOQB 2JOBA 2EOSA 4MLQA 3EPKA 2V8QB 1YYKA 2UUCE 4F9BB 3THNA 2EM0A 3IWCA 5A2QC 3OTOE 4LFAE 1L4SA 2L8TA 1A1KA 3HPZA 5KL4A 4JI3E 3KWRA 2R76A 2JY9A 1N33E 3OMLA 4IS1C 2YTIA 5AC4A 2F8BA 4R2AA 3QG5C 4DMIA 2EMFA 2L2NA 4X66E 2EZ6A 4DUZE 2EPMX 1N3GA 2BBGA 2LUQA 4R2QA 4NXNE 3J7Yp 2NUFA 2EJ4A 1A1LA 4RH8A 2YU8A 1J5EE 4BS9A 1EH8A 2V89A 1HNZE 2EPKX 2L2MA 1IQOA 3TQMA 2EPAA 4M2ZA 2CPNA 4BC9A 2L2KB 2EL4A 2EP3A 4LF7E 2YSOA 1PKPA 2KONA 4P7DA 4K0KE 4NXME 1MGTA 2YU5A 1TF6A 1YSAC 3JAMC 4X62E 1EH6A 2KHXA 3K6QA 1N34E 4JI4E 4B3SE 3JU0A 4GEQB 2EOFA 2EM5A 1X49A 4IJDA 1AAYA 2EM4A 4JI6E 4WSPA 4X9JA 2WBSA 2YT4A 4F2JC 1YUJA 5AASA 1YZ9A 2IHR1 4R2PA 2EOMA 1IBKE 4FK5C 4AQYE 2NA2A 2EMWA 1XNRE 5IT9C 2EMGA 4WSGA 4JI5E 2HJJA 3BIDA 2EWLA 4WYQB 4JI8E 4B3ME 2Q8UA 3ECRA 2UU9E 1KJKA 2YTPA 4DKKA 4JI7E 2EN8A 1XMQE 1DI2A 2EPPA 2EQ1A 4YHHE 4LF8E 2LV2A 1X48A 1MEYC 4LU9A 1YFHA 3BF2A 2FV4B 2JXPA 3EPLA 4GKJE 2HC5A 4LF4E 2DLKA 4TUGA 1SFEA 1ZBQA 2EPUA 2L3JA 4F6MA 5LMNE 2G7HA 1HNXE 5ADZA 4DR2E 2EOXA 2YRKA 3JTZA 4HEIA 1HNWE 4DR1E 2HGHA 4DV5E 3MSWA 1STUA 2H36X 1A1FA 2L92A 1QU6A 1GQEA 2V86A 5A6BD 4M30A 5KL5A 4RHBB 4DV3E 4L5NC 2M9AA 1EKZA 4M0VA 5KL7A 4WX9A 4X65E 1FJGE 1WXRA 3HTXA 4OOGC 1X47A 1Z1BA 4B3RE 2EMCA 4DV6E 1X6EA 3IWBA 4B3TE 2YRMA 2EMBA 2EPXA 2LJUA 1YUIA 3AV0A 1T4LB 4ZYDA 3T1YE 1IMUA 2DRPA 2EOQA 3DF6A 4NZVA 4DV0E 2YTGA 2VE7C 2VRDA 5IV8B 2UUAE 4NHRA 5AE2A 2WBUA 2V88A 1WJPA 5LMUE 2M4IA 2LRSA 4BMJA 1HR0E 3M99B 4WXDA 2YTOA 2WCC3 2EQ3A 2CTDA 2FGGA 1X5WA 3KZZA 1G2FC 2EL5A 2E5LE 2L3CA 2F4VE 2YTDA 4N4RB 2V87A 2YTNA 4R2EA 2UXBE 2WBTA 3F6GA 5LL6R 4DR6E 3T1HE 4ZYGA 1TN9A 4DR7E 4ZYHA 1DGCA 2DMIA 2LUPB 2VF1A 2I13A 3C4BA 1F2IG 2ODRC 2EM8A 4YY3E 5T6JA 3RMPA 2EPCA 2EMAA 2RS6A 2LCEA 2EE8A 2N3HA 2YSPA 2EOOA 2EPRA 3VHTB 2RQLA 3J80C 5DNYA 4J8ZA 2YTFA 2M1SA 2EMZA 1IQSA 1YYWA 5TSEA 1LLMC 1X6HA 1A1JA 1KYQA 5KL6A 2EM6A 4WPYA 4X8WA 5A6BA 2EOEA 4P78A 2EOHA 5A6AA 2LO3A 2EMYA 2EM7A 2EMIA 4BCAA 4DR4E 2LTSA 2GPIA 1ZBTA 2J7JA 2DSYA 4DUYE 1YYOA 1G2DC 2UUBE 2RPCA 4O4KA 1T4NA 2JPAA 1BB8A 2N3GA 4JYAE 1N36E 2YWQA 2K4VA 2EM9A 2EMLA 1B69A 5AE3A 2RS7A 1UBDC 2JP9A 4JI2E 2HHHE 5A69A 1EH7A 5KL2A 1XMOE 1T4OA 2V85A 3VK6A 3UK3C 5A6KA 2LBSB 2K7IA 4JV5E 2JOXA 2EOYA 2B7VA 1BBOA 2JWOA 2EPNA 2VQEE 3LLHA 2MDGA 2ENCA 2UXCE 2MC5A 4TUIA 5LLQA 2B7TA 4R2RA 2DIXA 2B9DA 2L6MA 2BB8A 2YPNA 4DV4E 2V83A 1GZ6A 2DLQA 1GTKA 3IWDA 4DR3E 2EORA 2ENAA 2MKDA 4GZNC 1RMDA 3EQ1A 4BHCA 2EMKA 2NUEA 2LT7A 2EN6A 3EPJA 2EOIA 4LTYA 2CT1A 2B3TB 1IBLE 1NEIA 3AUZA 1X3CA 2EM3A 1N32E 2RSIA 4WXCA 1ZR9A 4F9CB 4BC7A 5FLXC 2JYAA 4DV7E 1X6FA 2EN2A 4BBYA 2EN3A 4L8NA 2JVAA 1TF3A 5BR8E 4DV2E 2EPLX 1PJQA 1UHZA 4BHBA 4O43A 2D9HA 4M9VC 2EPOA 2EN4A 4X64E 5IXMB 2ADRA 1ZAAC 2WZOA 1O0WA 4LF6E 4F6NA 2VQFE 2EM2A 1XNQE 2MDRA 2CSHA 2LTRA 2YRHA 1BBGA 3C6MA 4R2SA 2ELZA 1IBME 1JK2A 3ADJA 1UN6B 2R1FA 4DV1E 2EN7A 3F6HA 1PJTA 4WFTA 2EPZA 3BGHA 1QNTA 1P47A 2EOJA 1WHQA 2ENHA 1FKAE 2EMHA 4R8OA 3J7AG 4R2CA 3VYXA 5KL3A 3MHSC 4R03A 5IWAE 3J81C 2NUGA 3ADGA 4GKKE 2EOZA 1ZU1A 2JR1A 4LFCE 2FTXB 2EL6A 4F54A 4HTGA 1JK1A 4ZYEA 2E1MA 1A1HA 4LF9E 4Q28A 4KHPE 4DR5E 2RTXA 2GHFA 2NABA 2UXDE 3HQ1A 3P1XA 3C6KA 5CFFE 1I94E 3HXLA 3ADIA 3VYYA 2EQ0A 5AE1A 2I9IA 1A1GA 2M7QA 1PJSA 2LJHA 3KZYA 4O5GA 3EPHA 3DJWA 1WRJA 2DGCA 2E72A 3L00A 2DB2A 2LE2A 4OX9E 1T39A 4MLVA 5F3WA 2ELYA 1A1IA 2A25A 3THOB 4JI0E 1NCSA 2LVHA 1RQ0A 3FIGA 4KWYA 3H09A 2MC6A 1PDAA 4F9AB 1SR9A
chains in the Genus database with same CATH topology
3EPJA 2EOIA 2YTNA 4R2EA 2CT1A 2EMWA 3MHHC 1X3CA 2WBTA 2YTJA 2RSIA 2EMGA 2YTEA 4WSGA 1ZR9A 2GLIA 1TN9A 2PRTA 1DGCA 2DMIA 2EMXA 2I13A 1X6FA 1F2IG 2EN2A 2EN1A 1KJKA 2EN3A 2YTDA 2EM8A 2YTPA 2EN8A 2YTQA 2EPCA 2EMAA 4R2DA 2LCEA 1TF3A 2EE8A 2MKNA 2YSPA 2EPPA 2EOOA 2EQ1A 2EPRA 2D9HA 2LV2A 3VHTB 4M9VC 2EN4A 1MEYC 2EOSA 2YTFA 2ADRA 2EMZA 3EPKA 1ZAAC 1LLMC 4F6NA 1X6HA 2EM2A 3EPLA 2EM0A 1A1JA 2CSHA 2YRHA 5KL6A 1A1KA 4R2SA 2EM6A 2ELZA 1JK2A 2DLKA 1UN6B 5KL4A 2R1FA 2EOEA 2EN7A 2EPUA 4F6MA 2EOHA 2EPZA 2LO3A 2EOXA 2YRKA 2EMYA 1P47A 2EOJA 2ENHA 2EM7A 2EMIA 2HGHA 4IS1C 2EMHA 2YTIA 4R2CA 5KL3A 3MHSC 2J7JA 4R2AA 1G2DC 1A1FA 2RPCA 2EMFA 2EOZA 1ZU1A 2JPAA 1BB8A 4R2QA 2EM9A 2EL6A 2EMLA 1B69A 1UBDC 2JP9A 5KL5A 2EJ4A 1JK1A 1A1LA 1A1HA 2M9AA 5KL2A 2YU8A 5KL7A 2GHFA 3UK3C 2NABA 1Z1BA 2EMCA 2EPAA 1X6EA 2EOYA 2EL4A 2YRMA 2EMBA 2EPXA 1BBOA 2EQ0A 1YUIA 1A1GA 2EP3A 2MDGA 2YSOA 2ENCA 2DRPA 2EOQA 2YU5A 1TF6A 1YSAC 3EPHA 2YTGA 4R2RA 2VRDA 2DGCA 2E72A 2BB8A 2EOFA 2EM5A 2WBUA 4IJDA 1WJPA 1AAYA 2EM4A 2DLQA 4X9JA 2ELYA 2WBSA 3M99B 4F2JC 1A1IA 1YUJA 2YTOA 2WCC3 2EORA 2EQ3A 2ENAA 2A25A 2CTDA 2MKDA 4GZNC 1RMDA 4R2PA 2EOMA 1NCSA 1X5WA 2EMKA 2LVHA 4FK5C 1G2FC 2EM3A 2EL5A 2LT7A 2EN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EPJ A;  2EOI A;  2YTN A;  4R2E A;  2CT1 A;  2EMW A;  3MHH C;  1X3C A;  2WBT A;  2YTJ A;  2RSI A;  2EMG A;  2YTE A;  4WSG A;  1ZR9 A;  2GLI A;  1TN9 A;  2PRT A;  1DGC A;  2DMI A;  2EMX A;  2I13 A;  1X6F A;  1F2I G;  2EN2 A;  2EN1 A;  1KJK A;  2EN3 A;  2YTD A;  2EM8 A;  2YTP A;  2EN8 A;  2YTQ A;  2EPC A;  2EMA A;  4R2D A;  2LCE A;  1TF3 A;  2EE8 A;  2MKN A;  2YSP A;  2EPP A;  2EOO A;  2EQ1 A;  2EPR A;  2D9H A;  2LV2 A;  3VHT B;  4M9V C;  2EN4 A;  1MEY C;  2EOS A;  2YTF A;  2ADR A;  2EMZ A;  3EPK A;  1ZAA C;  1LLM C;  4F6N A;  1X6H A;  2EM2 A;  3EPL A;  2EM0 A;  1A1J A;  2CSH A;  2YRH A;  5KL6 A;  1A1K A;  4R2S A;  2EM6 A;  2ELZ A;  1JK2 A;  2DLK A;  1UN6 B;  5KL4 A;  2R1F A;  2EOE A;  2EN7 A;  2EPU A;  4F6M A;  2EOH A;  2EPZ A;  2LO3 A;  2EOX A;  2YRK A;  2EMY A;  1P47 A;  2EOJ A;  2ENH A;  2EM7 A;  2EMI A;  2HGH A;  4IS1 C;  2EMH A;  2YTI A;  4R2C A;  5KL3 A;  3MHS C;  2J7J A;  4R2A A;  1G2D C;  1A1F A;  2RPC A;  2EMF A;  2EOZ A;  1ZU1 A;  2JPA A;  1BB8 A;  4R2Q A;  2EM9 A;  2EL6 A;  2EML A;  1B69 A;  1UBD C;  2JP9 A;  5KL5 A;  2EJ4 A;  1JK1 A;  1A1L A;  1A1H A;  2M9A A;  5KL2 A;  2YU8 A;  5KL7 A;  2GHF A;  3UK3 C;  2NAB A;  1Z1B A;  2EMC A;  2EPA A;  1X6E A;  2EOY A;  2EL4 A;  2YRM A;  2EMB A;  2EPX A;  1BBO A;  2EQ0 A;  1YUI A;  1A1G A;  2EP3 A;  2MDG A;  2YSO A;  2ENC A;  2DRP A;  2EOQ A;  2YU5 A;  1TF6 A;  1YSA C;  3EPH A;  2YTG A;  4R2R A;  2VRD A;  2DGC A;  2E72 A;  2BB8 A;  2EOF A;  2EM5 A;  2WBU A;  4IJD A;  1WJP A;  1AAY A;  2EM4 A;  2DLQ A;  4X9J A;  2ELY A;  2WBS A;  3M99 B;  4F2J C;  1A1I A;  1YUJ A;  2YTO A;  2WCC 3;  2EOR A;  2EQ3 A;  2ENA A;  2A25 A;  2CTD A;  2MKD A;  4GZN C;  1RMD A;  4R2P A;  2EOM A;  1NCS A;  1X5W A;  2EMK A;  2LVH A;  4FK5 C;  1G2F C;  2EM3 A;  2EL5 A;  2LT7 A;  2EN6 A; 
#chains in the Genus database with same CATH topology
 2YZT A;  3MHH C;  2RSM A;  2YTJ A;  3ADL A;  2KOU A;  2YTE A;  2GLI A;  2LMZ A;  1T38 A;  2N8X A;  4O24 A;  2ODR D;  2PRT A;  1J26 A;  1WHN A;  3BBG A;  3C4T A;  1UIL A;  2EMX A;  2EN1 A;  3HPS A;  1AH5 A;  1DQ3 A;  5AC5 A;  2YTQ A;  5A6J A;  4R2D A;  4KZS A;  2DMY A;  2L33 A;  2MKN A;  1YPN A;  4LFB E;  1RC7 A;  3LML A;  4LF5 E;  4I8O A;  2ZM6 E;  4JI1 E;  4Q35 B;  3ZOQ B;  2JOB A;  2EOS A;  4MLQ A;  3EPK A;  2V8Q B;  1YYK A;  2UUC E;  4F9B B;  3THN A;  2EM0 A;  3IWC A;  5A2Q C;  3OTO E;  4LFA E;  1L4S A;  2L8T A;  1A1K A;  3HPZ A;  5KL4 A;  4JI3 E;  3KWR A;  2R76 A;  2JY9 A;  1N33 E;  3OML A;  4IS1 C;  2YTI A;  5AC4 A;  2F8B A;  4R2A A;  3QG5 C;  4DMI A;  2EMF A;  2L2N A;  4X66 E;  2EZ6 A;  4DUZ E;  2EPM X;  1N3G A;  2BBG A;  2LUQ A;  4R2Q A;  4NXN E;  3J7Y p;  2NUF A;  2EJ4 A;  1A1L A;  4RH8 A;  2YU8 A;  1J5E E;  4BS9 A;  1EH8 A;  2V89 A;  1HNZ E;  2EPK X;  2L2M A;  1IQO A;  3TQM A;  2EPA A;  4M2Z A;  2CPN A;  4BC9 A;  2L2K B;  2EL4 A;  2EP3 A;  4LF7 E;  2YSO A;  1PKP A;  2KON A;  4P7D A;  4K0K E;  4NXM E;  1MGT A;  2YU5 A;  1TF6 A;  1YSA C;  3JAM C;  4X62 E;  1EH6 A;  2KHX A;  3K6Q A;  1N34 E;  4JI4 E;  4B3S E;  3JU0 A;  4GEQ B;  2EOF A;  2EM5 A;  1X49 A;  4IJD A;  1AAY A;  2EM4 A;  4JI6 E;  4WSP A;  4X9J A;  2WBS A;  2YT4 A;  4F2J C;  1YUJ A;  5AAS A;  1YZ9 A;  2IHR 1;  4R2P A;  2EOM A;  1IBK E;  4FK5 C;  4AQY E;  2NA2 A;  2EMW A;  1XNR E;  5IT9 C;  2EMG A;  4WSG A;  4JI5 E;  2HJJ A;  3BID A;  2EWL A;  4WYQ B;  4JI8 E;  4B3M E;  2Q8U A;  3ECR A;  2UU9 E;  1KJK A;  2YTP A;  4DKK A;  4JI7 E;  2EN8 A;  1XMQ E;  1DI2 A;  2EPP A;  2EQ1 A;  4YHH E;  4LF8 E;  2LV2 A;  1X48 A;  1MEY C;  4LU9 A;  1YFH A;  3BF2 A;  2FV4 B;  2JXP A;  3EPL A;  4GKJ E;  2HC5 A;  4LF4 E;  2DLK A;  4TUG A;  1SFE A;  1ZBQ A;  2EPU A;  2L3J A;  4F6M A;  5LMN E;  2G7H A;  1HNX E;  5ADZ A;  4DR2 E;  2EOX A;  2YRK A;  3JTZ A;  4HEI A;  1HNW E;  4DR1 E;  2HGH A;  4DV5 E;  3MSW A;  1STU A;  2H36 X;  1A1F A;  2L92 A;  1QU6 A;  1GQE A;  2V86 A;  5A6B D;  4M30 A;  5KL5 A;  4RHB B;  4DV3 E;  4L5N C;  2M9A A;  1EKZ A;  4M0V A;  5KL7 A;  4WX9 A;  4X65 E;  1FJG E;  1WXR A;  3HTX A;  4OOG C;  1X47 A;  1Z1B A;  4B3R E;  2EMC A;  4DV6 E;  1X6E A;  3IWB A;  4B3T E;  2YRM A;  2EMB A;  2EPX A;  2LJU A;  1YUI A;  3AV0 A;  1T4L B;  4ZYD A;  3T1Y E;  1IMU A;  2DRP A;  2EOQ A;  3DF6 A;  4NZV A;  4DV0 E;  2YTG A;  2VE7 C;  2VRD A;  5IV8 B;  2UUA E;  4NHR A;  5AE2 A;  2WBU A;  2V88 A;  1WJP A;  5LMU E;  2M4I A;  2LRS A;  4BMJ A;  1HR0 E;  3M99 B;  4WXD A;  2YTO A;  2WCC 3;  2EQ3 A;  2CTD A;  2FGG A;  1X5W A;  3KZZ A;  1G2F C;  2EL5 A;  2E5L E;  2L3C A;  2F4V E;  2YTD A;  4N4R B;  2V87 A;  2YTN A;  4R2E A;  2UXB E;  2WBT A;  3F6G A;  5LL6 R;  4DR6 E;  3T1H E;  4ZYG A;  1TN9 A;  4DR7 E;  4ZYH A;  1DGC A;  2DMI A;  2LUP B;  2VF1 A;  2I13 A;  3C4B A;  1F2I G;  2ODR C;  2EM8 A;  4YY3 E;  5T6J A;  3RMP A;  2EPC A;  2EMA A;  2RS6 A;  2LCE A;  2EE8 A;  2N3H A;  2YSP A;  2EOO A;  2EPR A;  3VHT B;  2RQL A;  3J80 C;  5DNY A;  4J8Z A;  2YTF A;  2M1S A;  2EMZ A;  1IQS A;  1YYW A;  5TSE A;  1LLM C;  1X6H A;  1A1J A;  1KYQ A;  5KL6 A;  2EM6 A;  4WPY A;  4X8W A;  5A6B A;  2EOE A;  4P78 A;  2EOH A;  5A6A A;  2LO3 A;  2EMY A;  2EM7 A;  2EMI A;  4BCA A;  4DR4 E;  2LTS A;  2GPI A;  1ZBT A;  2J7J A;  2DSY A;  4DUY E;  1YYO A;  1G2D C;  2UUB E;  2RPC A;  4O4K A;  1T4N A;  2JPA A;  1BB8 A;  2N3G A;  4JYA E;  1N36 E;  2YWQ A;  2K4V A;  2EM9 A;  2EML A;  1B69 A;  5AE3 A;  2RS7 A;  1UBD C;  2JP9 A;  4JI2 E;  2HHH E;  5A69 A;  1EH7 A;  5KL2 A;  1XMO E;  1T4O A;  2V85 A;  3VK6 A;  3UK3 C;  5A6K A;  2LBS B;  2K7I A;  4JV5 E;  2JOX A;  2EOY A;  2B7V A;  1BBO A;  2JWO A;  2EPN A;  2VQE E;  3LLH A;  2MDG A;  2ENC A;  2UXC E;  2MC5 A;  4TUI A;  5LLQ A;  2B7T A;  4R2R A;  2DIX A;  2B9D A;  2L6M A;  2BB8 A;  2YPN A;  4DV4 E;  2V83 A;  1GZ6 A;  2DLQ A;  1GTK A;  3IWD A;  4DR3 E;  2EOR A;  2ENA A;  2MKD A;  4GZN C;  1RMD A;  3EQ1 A;  4BHC A;  2EMK A;  2NUE A;  2LT7 A;  2EN6 A;  3EPJ A;  2EOI A;  4LTY A;  2CT1 A;  2B3T B;  1IBL E;  1NEI A;  3AUZ A;  1X3C A;  2EM3 A;  1N32 E;  2RSI A;  4WXC A;  1ZR9 A;  4F9C B;  4BC7 A;  5FLX C;  2JYA A;  4DV7 E;  1X6F A;  2EN2 A;  4BBY A;  2EN3 A;  4L8N A;  2JVA A;  1TF3 A;  5BR8 E;  4DV2 E;  2EPL X;  1PJQ A;  1UHZ A;  4BHB A;  4O43 A;  2D9H A;  4M9V C;  2EPO A;  2EN4 A;  4X64 E;  5IXM B;  2ADR A;  1ZAA C;  2WZO A;  1O0W A;  4LF6 E;  4F6N A;  2VQF E;  2EM2 A;  1XNQ E;  2MDR A;  2CSH A;  2LTR A;  2YRH A;  1BBG A;  3C6M A;  4R2S A;  2ELZ A;  1IBM E;  1JK2 A;  3ADJ A;  1UN6 B;  2R1F A;  4DV1 E;  2EN7 A;  3F6H A;  1PJT A;  4WFT A;  2EPZ A;  3BGH A;  1QNT A;  1P47 A;  2EOJ A;  1WHQ A;  2ENH A;  1FKA E;  2EMH A;  4R8O A;  3J7A G;  4R2C A;  3VYX A;  5KL3 A;  3MHS C;  4R03 A;  5IWA E;  3J81 C;  2NUG A;  3ADG A;  4GKK E;  2EOZ A;  1ZU1 A;  2JR1 A;  4LFC E;  2FTX B;  2EL6 A;  4F54 A;  4HTG A;  1JK1 A;  4ZYE A;  2E1M A;  1A1H A;  4LF9 E;  4Q28 A;  4KHP E;  4DR5 E;  2RTX A;  2GHF A;  2NAB A;  2UXD E;  3HQ1 A;  3P1X A;  3C6K A;  5CFF E;  1I94 E;  3HXL A;  3ADI A;  3VYY A;  2EQ0 A;  5AE1 A;  2I9I A;  1A1G A;  2M7Q A;  1PJS A;  2LJH A;  3KZY A;  4O5G A;  3EPH A;  3DJW A;  1WRJ A;  2DGC A;  2E72 A;  3L00 A;  2DB2 A;  2LE2 A;  4OX9 E;  1T39 A;  4MLV A;  5F3W A;  2ELY A;  1A1I A;  2A25 A;  3THO B;  4JI0 E;  1NCS A;  2LVH A;  1RQ0 A;  3FIG A;  4KWY A;  3H09 A;  2MC6 A;  1PDA A;  4F9A B;  1SR9 A; 
#chains in the Genus database with same CATH homology
 3EPJ A;  2EOI A;  2YTN A;  4R2E A;  2CT1 A;  2EMW A;  3MHH C;  1X3C A;  2WBT A;  2YTJ A;  2RSI A;  2EMG A;  2YTE A;  4WSG A;  1ZR9 A;  2GLI A;  1TN9 A;  2PRT A;  1DGC A;  2DMI A;  2EMX A;  2I13 A;  1X6F A;  1F2I G;  2EN2 A;  2EN1 A;  1KJK A;  2EN3 A;  2YTD A;  2EM8 A;  2YTP A;  2EN8 A;  2YTQ A;  2EPC A;  2EMA A;  4R2D A;  2LCE A;  1TF3 A;  2EE8 A;  2MKN A;  2YSP A;  2EPP A;  2EOO A;  2EQ1 A;  2EPR A;  2D9H A;  2LV2 A;  3VHT B;  4M9V C;  2EN4 A;  1MEY C;  2EOS A;  2YTF A;  2ADR A;  2EMZ A;  3EPK A;  1ZAA C;  1LLM C;  4F6N A;  1X6H A;  2EM2 A;  3EPL A;  2EM0 A;  1A1J A;  2CSH A;  2YRH A;  5KL6 A;  1A1K A;  4R2S A;  2EM6 A;  2ELZ A;  1JK2 A;  2DLK A;  1UN6 B;  5KL4 A;  2R1F A;  2EOE A;  2EN7 A;  2EPU A;  4F6M A;  2EOH A;  2EPZ A;  2LO3 A;  2EOX A;  2YRK A;  2EMY A;  1P47 A;  2EOJ A;  2ENH A;  2EM7 A;  2EMI A;  2HGH A;  4IS1 C;  2EMH A;  2YTI A;  4R2C A;  5KL3 A;  3MHS C;  2J7J A;  4R2A A;  1G2D C;  1A1F A;  2RPC A;  2EMF A;  2EOZ A;  1ZU1 A;  2JPA A;  1BB8 A;  4R2Q A;  2EM9 A;  2EL6 A;  2EML A;  1B69 A;  1UBD C;  2JP9 A;  5KL5 A;  2EJ4 A;  1JK1 A;  1A1L A;  1A1H A;  2M9A A;  5KL2 A;  2YU8 A;  5KL7 A;  2GHF A;  3UK3 C;  2NAB A;  1Z1B A;  2EMC A;  2EPA A;  1X6E A;  2EOY A;  2EL4 A;  2YRM A;  2EMB A;  2EPX A;  1BBO A;  2EQ0 A;  1YUI A;  1A1G A;  2EP3 A;  2MDG A;  2YSO A;  2ENC A;  2DRP A;  2EOQ A;  2YU5 A;  1TF6 A;  1YSA C;  3EPH A;  2YTG A;  4R2R A;  2VRD A;  2DGC A;  2E72 A;  2BB8 A;  2EOF A;  2EM5 A;  2WBU A;  4IJD A;  1WJP A;  1AAY A;  2EM4 A;  2DLQ A;  4X9J A;  2ELY A;  2WBS A;  3M99 B;  4F2J C;  1A1I A;  1YUJ A;  2YTO A;  2WCC 3;  2EOR A;  2EQ3 A;  2ENA A;  2A25 A;  2CTD A;  2MKD A;  4GZN C;  1RMD A;  4R2P A;  2EOM A;  1NCS A;  1X5W A;  2EMK A;  2LVH A;  4FK5 C;  1G2F C;  2EM3 A;  2EL5 A;  2LT7 A;  2EN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...