1BBOA

High-resolution solution structure of the double cys2*his2 zinc finger from the human enhancer binding protein mbp-1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
56
Chain Sequence
KYICEECGIRKKPSMLKKHIRTHTDVRPYHCTYCNFSFKTKGNLTKHMKSKAHSKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN ENHANCER-BINDING PROTEIN MBP-1
publication title High-resolution solution structure of the double Cys2His2 zinc finger from the human enhancer binding protein MBP-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 11
structure length 56
sequence length 57
ec nomenclature
pdb deposition date 1992-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1bboA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1bboA01
4R2PA 2EMWA 2LV2A 2YTNA 2EM5A 1RMDA 2LT7A 2EM3A 2YU5A 3EPJA 2DGCA 2EOMA 2EPUA 4R2QA 1TF3A 2YTPA 5KL7A 2EN8A 2A25A 1DGCA 2ENHA 2EPXA 2LVHA 2YTEA 4R2SA 2YTGA 2GLIA 2EQ3A 1G2DC 4IJDA 1B69A 1BBOA 1AAYA 2D9HA 2EN4A 2WBUA 2WBTA 1MEYC 2EN6A 4R2CA 1A1GA 2EE8A 2YTOA 2EN1A 2EOEA 4FK5C 4F6NA 4M9VC 2EPZA 2EM8A 1ZU1A 1ZR9A 3VHTB 2CSHA 2EMIA 1A1KA 2MKNA 2MKDA 1X3CA 2EN7A 2EMFA 4IS1C 2PRTA 2EL5A 2EM6A 1JK1A 2EMBA 2JPAA 1X6FA 2EP3A 1A1LA 2EMGA 2EPRA 3EPKA 2YTFA 1X6HA 2DMIA 2EJ4A 2YRMA 1BB8A 2EQ0A 3MHHC 2EOZA 2EORA 4R2DA 2YTIA 2EMZA 2EN3A 1YUJA 2RSIA 1A1HA 2NABA 1ZAAC 2YRHA 2EL4A 2ENAA 2DLQA 3MHSC 2CT1A 2CTDA 2LO3A 2EOHA 2EMXA 1TF6A 2EM7A 2EPAA 2EMYA 2VRDA 2EOYA 2GHFA 2EMCA 2YTDA 2DRPA 2JP9A 3EPHA 2ELZA 1NCSA 4R2EA 2EN2A 2EQ1A 2EOQA 1X6EA 2RPCA 2EMAA 1Z1BA 4F2JC 2EOOA 1A1JA 2EOSA 1P47A 2WBSA 4F6MA 2EM9A 2YTJA 4R2RA 2HGHA 2J7JA 4WSGA 2YRKA 1X5WA 5KL2A 3EPLA 2I13A 2YU8A 2EMLA 2ENCA 2EL6A 1KJKA 2EM4A 2EOXA 4X9JA 2ELYA 1A1FA 2YTQA 2EM2A 2EPPA 2EOJA 2R1FA 2M9AA 2YSOA 2LCEA 2WCC3 1YUIA 1G2FC 2E72A 1LLMC 2EM0A 2ADRA 5KL4A 2EPCA 1A1IA 5KL3A 2EMHA 3UK3C 5KL6A 1UBDC 1F2IG 1TN9A 2BB8A 2DLKA 4R2AA 2MDGA 1WJPA 5KL5A 1YSAC 1UN6B 1JK2A 2YSPA 4GZNC 2EMKA 2EOFA 2EOIA 3M99B
chains in the Genus database with same CATH superfamily
3T1YE 1PJTA 2EMWA 2L2KB 2LV2A 4I8OA 4BBYA 3EPJA 3TQMA 4B3ME 1IQSA 2EPUA 1RQ0A 3K6QA 4R2QA 1L4SA 2EPXA 2LVHA 2HHHE 1N3GA 2EQ3A 2LMZA 3C6MA 4DR2E 3ADJA 2UXBE 1BBOA 1AAYA 4NZVA 1ZBTA 2D9HA 2DSYA 4F9AB 2WBUA 2JVAA 2EN6A 2EE8A 4GEQB 2EN1A 4FK5C 2ZM6E 1HNZE 2BBGA 4F9BB 4M9VC 5A6AA 1I94E 4LF5E 2K4VA 2ODRD 2YZTA 2RTXA 1X48A 1X3CA 1IBLE 1SR9A 2JOXA 2EL5A 3C6KA 2EM6A 4WSPA 1EKZA 3L00A 4R03A 1A1LA 3IWBA 4KWYA 4P7DA 1X6HA 3BIDA 3KWRA 4DV0E 2RQLA 2L6MA 2N3GA 4R2DA 2EMZA 2JXPA 4X64E 4X65E 3MHSC 2F4VE 2N8XA 2CT1A 2EOHA 2VE7C 2EMXA 3OMLA 4F54A 2EMCA 2DRPA 2JP9A 2B9DA 4JI5E 2EQ1A 4BHBA 2HC5A 5A69A 4JI7E 1X6EA 4ZYHA 1A1JA 1YZ9A 2LUPB 2L3JA 2EM9A 4R2RA 2UXCE 1QNTA 5AE2A 3ADLA 1X5WA 5KL2A 2I13A 1J5EE 3C4TA 1KJKA 2KHXA 2EOXA 4TUIA 1SFEA 4JI8E 1STUA 2EOJA 2L33A 4ZYEA 2YSOA 2LCEA 1YUIA 1T38A 3EQ1A 1G2FC 4OX9E 3J7Yp 2EPCA 3IWCA 3UK3C 2IHR1 5LLQA 3VK6A 4LTYA 2VF1A 1WJPA 5KL5A 5AE3A 1IQOA 4GKJE 1IMUA 3AV0A 2F8BA 1ZU1A 4DV7E 4JV5E 2MC6A 2LRSA 4DV2E 2V87A 4DUZE 2L3CA 2YTPA 5KL7A 2LTRA 1HNWE 1DGCA 2ENHA 2UU9E 2ODRC 2EPMX 1FJGE 1GQEA 3FIGA 4IJDA 1J26A 4BC9A 4B3RE 4LFBE 3JU0A 4B3SE 2WBTA 1BBGA 3QG5C 4BMJA 2EZ6A 2L8TA 2EPNA 2V8QB 4F6NA 3VHTB 2CSHA 2EMIA 2FTXB 1PDAA 2MC5A 1WHQA 4DV5E 2MKDA 2FV4B 2EN7A 2EMFA 4IS1C 1PJSA 4GKKE 2V86A 1JK1A 2JPAA 2EP3A 5AC4A 4BS9A 1X47A 4DR3E 2EMGA 1KYQA 1N32E 3EPKA 4JI3E 4JI6E 3ADIA 1BB8A 2EOZA 4DV6E 1PKPA 2YTIA 3IWDA 5AE1A 1XMQE 2EN3A 2LJUA 3JTZA 4WX9A 5F3WA 5CFFE 2V83A 4L5NC 3KZZA 4OOGC 5IT9C 4NHRA 2EPKX 2EPAA 2VRDA 2JWOA 2CPNA 1MGTA 2YTDA 4Q35B 5T6JA 4NXME 3EPHA 3ZOQB 3P1XA 2RPCA 4F9CB 1Z1BA 4F2JC 2Q8UA 2EWLA 2JY9A 3THNA 2WBSA 4F6MA 2HGHA 2J7JA 3HPSA 1WRJA 2YPNA 4DV4E 2L2NA 2YU8A 2EMLA 1RC7A 4O43A 2B7TA 4JI1E 5A6KA 2V88A 3LLHA 2L2MA 4DV1E 2UUCE 1LLMC 4DR7E 2EPOA 4JI4E 2EMHA 4DV3E 5KL6A 4DUYE 5AASA 4R2AA 1T4NA 4DR1E 2YSPA 4R8OA 1YYWA 2RS7A 2EMKA 2KONA 2B7VA 3M99B 4R2PA 2EM5A 2YT4A 4LU9A 4LFAE 1YYOA 2DGCA 2EOMA 5FLXC 1TF3A 4ZYGA 5BR8E 2EN8A 2A25A 3HQ1A 2B3TB 4R2SA 2GLIA 4JYAE 3BGHA 1ZBQA 2MDRA 1B69A 5LL6R 2EN4A 5ADZA 4YHHE 1MEYC 2M7QA 1WHNA 3J81C 2VQEE 1A1GA 4LFCE 2YTOA 2LTSA 2EPZA 1T4OA 2EM8A 3F6GA 2MKNA 4NXNE 1DI2A 4DMIA 2YWQA 2PRTA 2E5LE 2NUEA 1T4LB 4B3TE 2EPRA 4P78A 1XMOE 2YRMA 1N36E 4JI0E 2EORA 1O0WA 1YUJA 1AH5A 1QU6A 2YRHA 3H09A 2DMYA 4O5GA 4LF6E 2RSMA 3JAMC 2LO3A 2CTDA 5A6BA 2RS6A 1FKAE 2EMYA 2EOYA 2EPLX 2KOUA 4M2ZA 2ELZA 1NCSA 1DQ3A 2EOQA 2EMAA 4TUGA 2LUQA 4WFTA 1X49A 5LMUE 3MSWA 4WSGA 2H36X 3J80C 3EPLA 2ENCA 2UUBE 2EL6A 5DNYA 2EM4A 4HTGA 4X9JA 2ELYA 5A2QC 2GPIA 2JR1A 3DJWA 4BHCA 2YTQA 1T39A 2M9AA 4L8NA 4M0VA 2E72A 2DB2A 2VQFE 2EM0A 4O4KA 5KL4A 3C4BA 1A1IA 5KL3A 1EH6A 2WZOA 5TSEA 1F2IG 1TN9A 3J7AG 2DLKA 1XNRE 1YFHA 1YSAC 1UN6B 2EOFA 2M1SA 4BC7A 2YTNA 3BBGA 1RMDA 2LT7A 2EM3A 2YU5A 4LF4E 4X8WA 2I9IA 4WPYA 5IV8B 4YY3E 4N4RB 2YTEA 2YTGA 1YPNA 1G2DC 2LJHA 3AUZA 2JYAA 2LE2A 5IWAE 2NA2A 4J8ZA 3T1HE 2E1MA 2UUAE 1WXRA 4WXDA 4R2CA 1N34E 4KZSA 4ZYDA 5A6BD 2EOEA 4JI2E 2DIXA 2JOBA 3THOB 1ZR9A 4MLVA 1IBKE 2V89A 1A1KA 1N33E 5A6JA 2K7IA 2EMBA 1HR0E 4DR6E 1PJQA 1X6FA 2L92A 4RH8A 1UILA 4RHBB 2YTFA 2LBSB 3VYXA 2DMIA 2UXDE 4O24A 1EH7A 2EJ4A 4M30A 2EQ0A 3MHHC 4AQYE 2RSIA 1A1HA 4LF9E 3ECRA 4HEIA 2NABA 1ZAAC 1IBME 3DF6A 2EL4A 2ENAA 4DR5E 2NUGA 2DLQA 3KZYA 1TF6A 2EM7A 1EH8A 1UHZA 2GHFA 1XNQE 1NEIA 4X62E 3VYYA 4R2EA 2EN2A 2NUFA 3HTXA 2M4IA 4MLQA 2R76A 2G7HA 2HJJA 2EOOA 2EOSA 3HXLA 4DR4E 1P47A 4KHPE 2YTJA 4DKKA 5LMNE 2YRKA 5AC5A 4X66E 4WYQB 3HPZA 2N3HA 1A1FA 2V85A 3F6HA 1YYKA 3BF2A 2EM2A 2EPPA 2R1FA 4K0KE 2WCC3 4LF8E 3RMPA 2ADRA 1HNXE 3ADGA 3LMLA 1UBDC 2FGGA 5IXMB 3OTOE 2BB8A 2MDGA 4Q28A 4WXCA 4BCAA 4LF7E 1JK2A 1GZ6A 4GZNC 2EOIA 1GTKA
chains in the Genus database with same CATH topology
4R2PA 2EMWA 2LV2A 2YTNA 2EM5A 1RMDA 2LT7A 2EM3A 2YU5A 3EPJA 2DGCA 2EOMA 2EPUA 4R2QA 1TF3A 2YTPA 5KL7A 2EN8A 2A25A 1DGCA 2ENHA 2EPXA 2LVHA 2YTEA 4R2SA 2YTGA 2GLIA 2EQ3A 1G2DC 4IJDA 1B69A 1BBOA 1AAYA 2D9HA 2EN4A 2WBUA 2WBTA 1MEYC 2EN6A 4R2CA 1A1GA 2EE8A 2YTOA 2EN1A 2EOEA 4FK5C 4F6NA 4M9VC 2EPZA 2EM8A 1ZU1A 1ZR9A 3VHTB 2CSHA 2EMIA 1A1KA 2MKNA 2MKDA 1X3CA 2EN7A 2EMFA 4IS1C 2PRTA 2EL5A 2EM6A 1JK1A 2EMBA 2JPAA 1X6FA 2EP3A 1A1LA 2EMGA 2EPRA 3EPKA 2YTFA 1X6HA 2DMIA 2EJ4A 2YRMA 1BB8A 2EQ0A 3MHHC 2EOZA 2EORA 4R2DA 2YTIA 2EMZA 2EN3A 1YUJA 2RSIA 1A1HA 2NABA 1ZAAC 2YRHA 2EL4A 2ENAA 2DLQA 3MHSC 2CT1A 2CTDA 2LO3A 2EOHA 2EMXA 1TF6A 2EM7A 2EPAA 2EMYA 2VRDA 2EOYA 2GHFA 2EMCA 2YTDA 2DRPA 2JP9A 3EPHA 2ELZA 1NCSA 4R2EA 2EN2A 2EQ1A 2EOQA 1X6EA 2RPCA 2EMAA 1Z1BA 4F2JC 2EOOA 1A1JA 2EOSA 1P47A 2WBSA 4F6MA 2EM9A 2YTJA 4R2RA 2HGHA 2J7JA 4WSGA 2YRKA 1X5WA 5KL2A 3EPLA 2I13A 2YU8A 2EMLA 2ENCA 2EL6A 1KJKA 2EM4A 2EOXA 4X9JA 2ELYA 1A1FA 2YTQA 2EM2A 2EPPA 2EOJA 2R1FA 2M9AA 2YSOA 2LCEA 2WCC3 1YUIA 1G2FC 2E72A 1LLMC 2EM0A 2ADRA 5KL4A 2EPCA 1A1IA 5KL3A 2EMHA 3UK3C 5KL6A 1UBDC 1F2IG 1TN9A 2BB8A 2DLKA 4R2AA 2MDGA 1WJPA 5KL5A 1YSAC 1UN6B 1JK2A 2YSPA 4GZNC 2EMKA 2EOFA 2EOIA 3M99B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2P A;  2EMW A;  2LV2 A;  2YTN A;  2EM5 A;  1RMD A;  2LT7 A;  2EM3 A;  2YU5 A;  3EPJ A;  2DGC A;  2EOM A;  2EPU A;  4R2Q A;  1TF3 A;  2YTP A;  5KL7 A;  2EN8 A;  2A25 A;  1DGC A;  2ENH A;  2EPX A;  2LVH A;  2YTE A;  4R2S A;  2YTG A;  2GLI A;  2EQ3 A;  1G2D C;  4IJD A;  1B69 A;  1BBO A;  1AAY A;  2D9H A;  2EN4 A;  2WBU A;  2WBT A;  1MEY C;  2EN6 A;  4R2C A;  1A1G A;  2EE8 A;  2YTO A;  2EN1 A;  2EOE A;  4FK5 C;  4F6N A;  4M9V C;  2EPZ A;  2EM8 A;  1ZU1 A;  1ZR9 A;  3VHT B;  2CSH A;  2EMI A;  1A1K A;  2MKN A;  2MKD A;  1X3C A;  2EN7 A;  2EMF A;  4IS1 C;  2PRT A;  2EL5 A;  2EM6 A;  1JK1 A;  2EMB A;  2JPA A;  1X6F A;  2EP3 A;  1A1L A;  2EMG A;  2EPR A;  3EPK A;  2YTF A;  1X6H A;  2DMI A;  2EJ4 A;  2YRM A;  1BB8 A;  2EQ0 A;  3MHH C;  2EOZ A;  2EOR A;  4R2D A;  2YTI A;  2EMZ A;  2EN3 A;  1YUJ A;  2RSI A;  1A1H A;  2NAB A;  1ZAA C;  2YRH A;  2EL4 A;  2ENA A;  2DLQ A;  3MHS C;  2CT1 A;  2CTD A;  2LO3 A;  2EOH A;  2EMX A;  1TF6 A;  2EM7 A;  2EPA A;  2EMY A;  2VRD A;  2EOY A;  2GHF A;  2EMC A;  2YTD A;  2DRP A;  2JP9 A;  3EPH A;  2ELZ A;  1NCS A;  4R2E A;  2EN2 A;  2EQ1 A;  2EOQ A;  1X6E A;  2RPC A;  2EMA A;  1Z1B A;  4F2J C;  2EOO A;  1A1J A;  2EOS A;  1P47 A;  2WBS A;  4F6M A;  2EM9 A;  2YTJ A;  4R2R A;  2HGH A;  2J7J A;  4WSG A;  2YRK A;  1X5W A;  5KL2 A;  3EPL A;  2I13 A;  2YU8 A;  2EML A;  2ENC A;  2EL6 A;  1KJK A;  2EM4 A;  2EOX A;  4X9J A;  2ELY A;  1A1F A;  2YTQ A;  2EM2 A;  2EPP A;  2EOJ A;  2R1F A;  2M9A A;  2YSO A;  2LCE A;  2WCC 3;  1YUI A;  1G2F C;  2E72 A;  1LLM C;  2EM0 A;  2ADR A;  5KL4 A;  2EPC A;  1A1I A;  5KL3 A;  2EMH A;  3UK3 C;  5KL6 A;  1UBD C;  1F2I G;  1TN9 A;  2BB8 A;  2DLK A;  4R2A A;  2MDG A;  1WJP A;  5KL5 A;  1YSA C;  1UN6 B;  1JK2 A;  2YSP A;  4GZN C;  2EMK A;  2EOF A;  2EOI A;  3M99 B; 
#chains in the Genus database with same CATH topology
 3T1Y E;  1PJT A;  2EMW A;  2L2K B;  2LV2 A;  4I8O A;  4BBY A;  3EPJ A;  3TQM A;  4B3M E;  1IQS A;  2EPU A;  1RQ0 A;  3K6Q A;  4R2Q A;  1L4S A;  2EPX A;  2LVH A;  2HHH E;  1N3G A;  2EQ3 A;  2LMZ A;  3C6M A;  4DR2 E;  3ADJ A;  2UXB E;  1BBO A;  1AAY A;  4NZV A;  1ZBT A;  2D9H A;  2DSY A;  4F9A B;  2WBU A;  2JVA A;  2EN6 A;  2EE8 A;  4GEQ B;  2EN1 A;  4FK5 C;  2ZM6 E;  1HNZ E;  2BBG A;  4F9B B;  4M9V C;  5A6A A;  1I94 E;  4LF5 E;  2K4V A;  2ODR D;  2YZT A;  2RTX A;  1X48 A;  1X3C A;  1IBL E;  1SR9 A;  2JOX A;  2EL5 A;  3C6K A;  2EM6 A;  4WSP A;  1EKZ A;  3L00 A;  4R03 A;  1A1L A;  3IWB A;  4KWY A;  4P7D A;  1X6H A;  3BID A;  3KWR A;  4DV0 E;  2RQL A;  2L6M A;  2N3G A;  4R2D A;  2EMZ A;  2JXP A;  4X64 E;  4X65 E;  3MHS C;  2F4V E;  2N8X A;  2CT1 A;  2EOH A;  2VE7 C;  2EMX A;  3OML A;  4F54 A;  2EMC A;  2DRP A;  2JP9 A;  2B9D A;  4JI5 E;  2EQ1 A;  4BHB A;  2HC5 A;  5A69 A;  4JI7 E;  1X6E A;  4ZYH A;  1A1J A;  1YZ9 A;  2LUP B;  2L3J A;  2EM9 A;  4R2R A;  2UXC E;  1QNT A;  5AE2 A;  3ADL A;  1X5W A;  5KL2 A;  2I13 A;  1J5E E;  3C4T A;  1KJK A;  2KHX A;  2EOX A;  4TUI A;  1SFE A;  4JI8 E;  1STU A;  2EOJ A;  2L33 A;  4ZYE A;  2YSO A;  2LCE A;  1YUI A;  1T38 A;  3EQ1 A;  1G2F C;  4OX9 E;  3J7Y p;  2EPC A;  3IWC A;  3UK3 C;  2IHR 1;  5LLQ A;  3VK6 A;  4LTY A;  2VF1 A;  1WJP A;  5KL5 A;  5AE3 A;  1IQO A;  4GKJ E;  1IMU A;  3AV0 A;  2F8B A;  1ZU1 A;  4DV7 E;  4JV5 E;  2MC6 A;  2LRS A;  4DV2 E;  2V87 A;  4DUZ E;  2L3C A;  2YTP A;  5KL7 A;  2LTR A;  1HNW E;  1DGC A;  2ENH A;  2UU9 E;  2ODR C;  2EPM X;  1FJG E;  1GQE A;  3FIG A;  4IJD A;  1J26 A;  4BC9 A;  4B3R E;  4LFB E;  3JU0 A;  4B3S E;  2WBT A;  1BBG A;  3QG5 C;  4BMJ A;  2EZ6 A;  2L8T A;  2EPN A;  2V8Q B;  4F6N A;  3VHT B;  2CSH A;  2EMI A;  2FTX B;  1PDA A;  2MC5 A;  1WHQ A;  4DV5 E;  2MKD A;  2FV4 B;  2EN7 A;  2EMF A;  4IS1 C;  1PJS A;  4GKK E;  2V86 A;  1JK1 A;  2JPA A;  2EP3 A;  5AC4 A;  4BS9 A;  1X47 A;  4DR3 E;  2EMG A;  1KYQ A;  1N32 E;  3EPK A;  4JI3 E;  4JI6 E;  3ADI A;  1BB8 A;  2EOZ A;  4DV6 E;  1PKP A;  2YTI A;  3IWD A;  5AE1 A;  1XMQ E;  2EN3 A;  2LJU A;  3JTZ A;  4WX9 A;  5F3W A;  5CFF E;  2V83 A;  4L5N C;  3KZZ A;  4OOG C;  5IT9 C;  4NHR A;  2EPK X;  2EPA A;  2VRD A;  2JWO A;  2CPN A;  1MGT A;  2YTD A;  4Q35 B;  5T6J A;  4NXM E;  3EPH A;  3ZOQ B;  3P1X A;  2RPC A;  4F9C B;  1Z1B A;  4F2J C;  2Q8U A;  2EWL A;  2JY9 A;  3THN A;  2WBS A;  4F6M A;  2HGH A;  2J7J A;  3HPS A;  1WRJ A;  2YPN A;  4DV4 E;  2L2N A;  2YU8 A;  2EML A;  1RC7 A;  4O43 A;  2B7T A;  4JI1 E;  5A6K A;  2V88 A;  3LLH A;  2L2M A;  4DV1 E;  2UUC E;  1LLM C;  4DR7 E;  2EPO A;  4JI4 E;  2EMH A;  4DV3 E;  5KL6 A;  4DUY E;  5AAS A;  4R2A A;  1T4N A;  4DR1 E;  2YSP A;  4R8O A;  1YYW A;  2RS7 A;  2EMK A;  2KON A;  2B7V A;  3M99 B;  4R2P A;  2EM5 A;  2YT4 A;  4LU9 A;  4LFA E;  1YYO A;  2DGC A;  2EOM A;  5FLX C;  1TF3 A;  4ZYG A;  5BR8 E;  2EN8 A;  2A25 A;  3HQ1 A;  2B3T B;  4R2S A;  2GLI A;  4JYA E;  3BGH A;  1ZBQ A;  2MDR A;  1B69 A;  5LL6 R;  2EN4 A;  5ADZ A;  4YHH E;  1MEY C;  2M7Q A;  1WHN A;  3J81 C;  2VQE E;  1A1G A;  4LFC E;  2YTO A;  2LTS A;  2EPZ A;  1T4O A;  2EM8 A;  3F6G A;  2MKN A;  4NXN E;  1DI2 A;  4DMI A;  2YWQ A;  2PRT A;  2E5L E;  2NUE A;  1T4L B;  4B3T E;  2EPR A;  4P78 A;  1XMO E;  2YRM A;  1N36 E;  4JI0 E;  2EOR A;  1O0W A;  1YUJ A;  1AH5 A;  1QU6 A;  2YRH A;  3H09 A;  2DMY A;  4O5G A;  4LF6 E;  2RSM A;  3JAM C;  2LO3 A;  2CTD A;  5A6B A;  2RS6 A;  1FKA E;  2EMY A;  2EOY A;  2EPL X;  2KOU A;  4M2Z A;  2ELZ A;  1NCS A;  1DQ3 A;  2EOQ A;  2EMA A;  4TUG A;  2LUQ A;  4WFT A;  1X49 A;  5LMU E;  3MSW A;  4WSG A;  2H36 X;  3J80 C;  3EPL A;  2ENC A;  2UUB E;  2EL6 A;  5DNY A;  2EM4 A;  4HTG A;  4X9J A;  2ELY A;  5A2Q C;  2GPI A;  2JR1 A;  3DJW A;  4BHC A;  2YTQ A;  1T39 A;  2M9A A;  4L8N A;  4M0V A;  2E72 A;  2DB2 A;  2VQF E;  2EM0 A;  4O4K A;  5KL4 A;  3C4B A;  1A1I A;  5KL3 A;  1EH6 A;  2WZO A;  5TSE A;  1F2I G;  1TN9 A;  3J7A G;  2DLK A;  1XNR E;  1YFH A;  1YSA C;  1UN6 B;  2EOF A;  2M1S A;  4BC7 A;  2YTN A;  3BBG A;  1RMD A;  2LT7 A;  2EM3 A;  2YU5 A;  4LF4 E;  4X8W A;  2I9I A;  4WPY A;  5IV8 B;  4YY3 E;  4N4R B;  2YTE A;  2YTG A;  1YPN A;  1G2D C;  2LJH A;  3AUZ A;  2JYA A;  2LE2 A;  5IWA E;  2NA2 A;  4J8Z A;  3T1H E;  2E1M A;  2UUA E;  1WXR A;  4WXD A;  4R2C A;  1N34 E;  4KZS A;  4ZYD A;  5A6B D;  2EOE A;  4JI2 E;  2DIX A;  2JOB A;  3THO B;  1ZR9 A;  4MLV A;  1IBK E;  2V89 A;  1A1K A;  1N33 E;  5A6J A;  2K7I A;  2EMB A;  1HR0 E;  4DR6 E;  1PJQ A;  1X6F A;  2L92 A;  4RH8 A;  1UIL A;  4RHB B;  2YTF A;  2LBS B;  3VYX A;  2DMI A;  2UXD E;  4O24 A;  1EH7 A;  2EJ4 A;  4M30 A;  2EQ0 A;  3MHH C;  4AQY E;  2RSI A;  1A1H A;  4LF9 E;  3ECR A;  4HEI A;  2NAB A;  1ZAA C;  1IBM E;  3DF6 A;  2EL4 A;  2ENA A;  4DR5 E;  2NUG A;  2DLQ A;  3KZY A;  1TF6 A;  2EM7 A;  1EH8 A;  1UHZ A;  2GHF A;  1XNQ E;  1NEI A;  4X62 E;  3VYY A;  4R2E A;  2EN2 A;  2NUF A;  3HTX A;  2M4I A;  4MLQ A;  2R76 A;  2G7H A;  2HJJ A;  2EOO A;  2EOS A;  3HXL A;  4DR4 E;  1P47 A;  4KHP E;  2YTJ A;  4DKK A;  5LMN E;  2YRK A;  5AC5 A;  4X66 E;  4WYQ B;  3HPZ A;  2N3H A;  1A1F A;  2V85 A;  3F6H A;  1YYK A;  3BF2 A;  2EM2 A;  2EPP A;  2R1F A;  4K0K E;  2WCC 3;  4LF8 E;  3RMP A;  2ADR A;  1HNX E;  3ADG A;  3LML A;  1UBD C;  2FGG A;  5IXM B;  3OTO E;  2BB8 A;  2MDG A;  4Q28 A;  4WXC A;  4BCA A;  4LF7 E;  1JK2 A;  1GZ6 A;  4GZN C;  2EOI A;  1GTK A; 
#chains in the Genus database with same CATH homology
 4R2P A;  2EMW A;  2LV2 A;  2YTN A;  2EM5 A;  1RMD A;  2LT7 A;  2EM3 A;  2YU5 A;  3EPJ A;  2DGC A;  2EOM A;  2EPU A;  4R2Q A;  1TF3 A;  2YTP A;  5KL7 A;  2EN8 A;  2A25 A;  1DGC A;  2ENH A;  2EPX A;  2LVH A;  2YTE A;  4R2S A;  2YTG A;  2GLI A;  2EQ3 A;  1G2D C;  4IJD A;  1B69 A;  1BBO A;  1AAY A;  2D9H A;  2EN4 A;  2WBU A;  2WBT A;  1MEY C;  2EN6 A;  4R2C A;  1A1G A;  2EE8 A;  2YTO A;  2EN1 A;  2EOE A;  4FK5 C;  4F6N A;  4M9V C;  2EPZ A;  2EM8 A;  1ZU1 A;  1ZR9 A;  3VHT B;  2CSH A;  2EMI A;  1A1K A;  2MKN A;  2MKD A;  1X3C A;  2EN7 A;  2EMF A;  4IS1 C;  2PRT A;  2EL5 A;  2EM6 A;  1JK1 A;  2EMB A;  2JPA A;  1X6F A;  2EP3 A;  1A1L A;  2EMG A;  2EPR A;  3EPK A;  2YTF A;  1X6H A;  2DMI A;  2EJ4 A;  2YRM A;  1BB8 A;  2EQ0 A;  3MHH C;  2EOZ A;  2EOR A;  4R2D A;  2YTI A;  2EMZ A;  2EN3 A;  1YUJ A;  2RSI A;  1A1H A;  2NAB A;  1ZAA C;  2YRH A;  2EL4 A;  2ENA A;  2DLQ A;  3MHS C;  2CT1 A;  2CTD A;  2LO3 A;  2EOH A;  2EMX A;  1TF6 A;  2EM7 A;  2EPA A;  2EMY A;  2VRD A;  2EOY A;  2GHF A;  2EMC A;  2YTD A;  2DRP A;  2JP9 A;  3EPH A;  2ELZ A;  1NCS A;  4R2E A;  2EN2 A;  2EQ1 A;  2EOQ A;  1X6E A;  2RPC A;  2EMA A;  1Z1B A;  4F2J C;  2EOO A;  1A1J A;  2EOS A;  1P47 A;  2WBS A;  4F6M A;  2EM9 A;  2YTJ A;  4R2R A;  2HGH A;  2J7J A;  4WSG A;  2YRK A;  1X5W A;  5KL2 A;  3EPL A;  2I13 A;  2YU8 A;  2EML A;  2ENC A;  2EL6 A;  1KJK A;  2EM4 A;  2EOX A;  4X9J A;  2ELY A;  1A1F A;  2YTQ A;  2EM2 A;  2EPP A;  2EOJ A;  2R1F A;  2M9A A;  2YSO A;  2LCE A;  2WCC 3;  1YUI A;  1G2F C;  2E72 A;  1LLM C;  2EM0 A;  2ADR A;  5KL4 A;  2EPC A;  1A1I A;  5KL3 A;  2EMH A;  3UK3 C;  5KL6 A;  1UBD C;  1F2I G;  1TN9 A;  2BB8 A;  2DLK A;  4R2A A;  2MDG A;  1WJP A;  5KL5 A;  1YSA C;  1UN6 B;  1JK2 A;  2YSP A;  4GZN C;  2EMK A;  2EOF A;  2EOI A;  3M99 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...