4F54A

Crystal structure of a duf4136 family protein (bt2437) from bacteroides thetaiotaomicron vpi-5482 at 1.60 a resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
183
structure length
173
Chain Sequence
DDNYLVYTNYDQANFDFSTFYLADILVISDSEPEYLEGEGAEQILAAYTENMEAGYQPAADESADLGIQVSYIASTYYFTGYTQPEWWWGYPGYWGPSYWGNWGGWYYPYAVTYSYSTNSFITEMVNLADEGEGLPVVWTSYLTGFETGSAINRTLAIEAVNQSFTQSPYLTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BT2437) from Bacteroides thetaiotaomicron VPI-5482 at 1.60 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
total genus 41
structure length 173
sequence length 183
ec nomenclature
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13590 DUF4136 Domain of unknown function (DUF4136)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.670 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4f54A00
4L8NA 4F54A
chains in the Genus database with same CATH superfamily
3EPJA 1A1KA 2L3CA 2EPUA 2V88A 2EJ4A 2RS6A 4O4KA 1UHZA 1UILA 4RHBB 3T1HE 1X49A 1WHNA 1X6HA 2JOBA 2EE8A 1RC7A 1XMOE 4GKKE 1BBGA 2VQFE 4AQYE 2YRKA 5F3WA 4LFBE 2PRTA 2NA2A 2Q8UA 2EQ1A 2EN8A 5ADZA 5LLQA 5T6JA 2RSMA 4F9BB 4BS9A 2YTEA 2L33A 4O43A 1G2DC 2E5LE 2EMFA 3AUZA 1X48A 4X9JA 3ADGA 4L8NA 4F9AB 2YTNA 5A69A 4ZYGA 4F54A 3C4TA 1A1FA 3L00A 4DR1E 2ADRA 1NCSA 4R03A 4JI2E 2LV2A 4DV3E 2CSHA 2JOXA 2NUGA 4OOGC 3MSWA 2EM6A 5KL2A 4BCAA 1KJKA 5AASA 4DV6E 4WSPA 3LLHA 1XNQE 1SFEA 5KL4A 2UU9E 4NXNE 4R2EA 1WJPA 1AH5A 2ZM6E 2R76A 3BGHA 2NUFA 2LE2A 2HJJA 2M9AA 1P47A 2MDGA 2R1FA 1TF6A 2WCC3 2GLIA 4JV5E 1YUIA 2F4VE 2DMYA 2LUPB 2YWQA 4O24A 2BB8A 3THNA 3J7Yp 2RPCA 4DV0E 3EQ1A 2EOIA 2EMKA 2EL5A 4DR4E 2YT4A 2CPNA 2EMGA 2N8XA 2YTDA 2CTDA 4Q28A 2EM2A 2LTSA 2LO3A 3J81C 5LMNE 1UBDC 2JP9A 4YHHE 2CT1A 2ENHA 4LFAE 2YRHA 3T1YE 4GKJE 2EM0A 2EOXA 1J5EE 5A6AA 4J8ZA 4ZYHA 2UUAE 1N33E 2EPZA 5KL5A 2YTPA 4DR2E 4IS1C 4M2ZA 2EM4A 2EOMA 3RMPA 1SR9A 2LBSB 1T38A 1LLMC 2EOFA 3IWBA 2EPCA 4X8WA 4B3RE 2MC5A 4BHCA 2EMWA 4R2SA 3K6QA 4KWYA 4X65E 1DQ3A 4BHBA 3C6KA 2EM9A 2KHXA 4ZYDA 4L5NC 1TN9A 3BIDA 1DGCA 2A25A 1DI2A 4F6NA 2EL6A 2V83A 2B3TB 2L2KB 4DUZE 4JI7E 2EPMX 2K7IA 2EMIA 5A6KA 2EOYA 4WX9A 1X5WA 3OTOE 4DMIA 4GEQB 4NHRA 2MKNA 2D9HA 3HPZA 1XMQE 2V89A 1ZBTA 4WXCA 4TUGA 2DLKA 3HTXA 3EPHA 3J7AG 1YSAC 1A1HA 3P1XA 4WPYA 2JY9A 1MEYC 1X47A 2EPRA 1TF3A 1PKPA 1XNRE 3THOB 2L6MA 2EPAA 1EH8A 4DR6E 1MGTA 2EN1A 1G2FC 2NUEA 2EL4A 1B69A 1IBKE 3EPKA 2VRDA 1YYKA 2EMAA 3JU0A 2EM5A 2EOZA 2EM3A 2LJHA 2NABA 1ZU1A 2EMYA 2L2NA 4B3ME 2EMHA 3AV0A 2RS7A 1HR0E 2LMZA 2EN2A 4R2RA 3H09A 2UUCE 4ZYEA 4JYAE 4R2PA 1WRJA 1AAYA 2VQEE 2E1MA 2MC6A 3ADJA 5AE1A 1A1IA 2HGHA 2BBGA 1FKAE 1T4NA 2EM7A 4Q35B 2EMXA 1X6EA 2WBSA 5TSEA 1IQSA 2EPNA 4MLVA 5IV8B 1N3GA 4JI3E 1IMUA 4P78A 1HNWE 1O0WA 3J80C 2JWOA 1QU6A 2DMIA 4F9CB 3KWRA 4DR5E 3JAMC 1HNZE 3M99B 2ODRD 1I94E 2YTGA 1X6FA 3BF2A 3JTZA 2DRPA 3FIGA 2EM8A 3MHHC 1YZ9A 4LF6E 2YTOA 2UXCE 5A6BA 4LF5E 2L92A 3LMLA 4LF7E 2UXDE 2EOQA 3VK6A 2LUQA 4BMJA 4RH8A 1FJGE 3ADLA 4NZVA 2KOUA 2ELZA 2EN3A 2K4VA 3ZOQB 4X62E 2V8QB 2UXBE 1RMDA 1IBME 5A6JA 4LF4E 2YTJA 1N34E 1N36E 2ODRC 5IXMB 3IWCA 2L2MA 1YFHA 4IJDA 2EWLA 3HXLA 2HC5A 2YSPA 4R2CA 2WBTA 4DV2E 4I8OA 5A2QC 2F8BA 4TUIA 2G7HA 2EPXA 3QG5C 1JK1A 2EZ6A 2IHR1 2LCEA 2N3GA 4F6MA 2YTFA 2EOHA 3C4BA 3UK3C 1GQEA 1KYQA 5CFFE 3IWDA 3DF6A 2LT7A 3HPSA 4R2QA 4HTGA 3KZZA 1J26A 4FK5C 1NEIA 4WYQB 2EOOA 5AE2A 3VYXA 2RQLA 2DIXA 1T4LB 1BBOA 2V85A 3HQ1A 4M30A 1GZ6A 1A1GA 1STUA 5IWAE 2EPLX 2EORA 2JYAA 4DUYE 1BB8A 1EH6A 4DV1E 4JI0E 4DKKA 2YZTA 2V87A 5LMUE 5IT9C 5BR8E 5FLXC 2I13A 1T39A 4R8OA 4MLQA 4JI8E 4B3SE 5AC4A 2DB2A 1EKZA 2J7JA 3C6MA 2M7QA 1YYWA 2LRSA 4JI4E 2WBUA 4LU9A 4R2DA 2JVAA 2L8TA 2B9DA 4JI5E 2EMBA 2FV4B 2JR1A 1RQ0A 2EMCA 2B7TA 4M0VA 2B7VA 2N3HA 1JK2A 3DJWA 2EPKX 1IBLE 3VHTB 2EN7A 3KZYA 2EP3A 2EOSA 1Z1BA 3MHSC 4LTYA 5KL6A 2EN4A 2DSYA 4DV5E 2EPOA 1ZBQA 1ZR9A 2DLQA 2YU5A 3EPLA 4O5GA 2LVHA 4JI1E 3F6HA 4N4RB 2GHFA 4GZNC 4LFCE 2RTXA 3BBGA 4NXME 2FGGA 5KL7A 4WFTA 1IQOA 1PJTA 3TQMA 4KZSA 4KHPE 4R2AA 3OMLA 1WHQA 4F2JC 2LJUA 1N32E 2EPPA 3F6GA 2JPAA 4K0KE 1ZAAC 4P7DA 4X64E 5LL6R 5A6BD 1HNXE 4OX9E 2EQ0A 1YUJA 3VYYA 2YTIA 1WXRA 1PJSA 2GPIA 2E72A 2LTRA 4BC9A 4BBYA 1X3CA 1QNTA 4HEIA 4YY3E 2JXPA 1YYOA 4JI6E 1L4SA 2YPNA 2ENCA 4WSGA 2HHHE 2I9IA 2H36X 2KONA 4M9VC 2UUBE 4B3TE 2RSIA 5AE3A 2MDRA 2V86A 1UN6B 5DNYA 2M1SA 1F2IG 2EN6A 4DR3E 2EMZA 2WZOA 2EQ3A 4BC7A 5AC5A 4DV4E 1YPNA 4LF8E 1A1LA 4X66E 1EH7A 2YRMA 4WXDA 5KL3A 3ADIA 1GTKA 3ECRA 4LF9E 1PJQA 4DR7E 2EMLA 2YU8A 2EOJA 2ELYA 2DGCA 2VF1A 2MKDA 1A1JA 2YSOA 2EOEA 2FTXB 2L3JA 1PDAA 1T4OA 2M4IA 4DV7E 2VE7C 2YTQA 2ENAA
chains in the Genus database with same CATH topology
2JWOA 1QU6A 4F9CB 3IWBA 2L3CA 2V88A 3KWRA 4DR5E 1RQ0A 4X8WA 3JAMC 2B7TA 2MC5A 2B7VA 2N3HA 2RS6A 4M0VA 3DJWA 1HNZE 4B3RE 2ODRD 1UHZA 1UILA 3T1HE 1I94E 1X49A 1WHNA 3JTZA 2JOBA 3K6QA 1RC7A 3FIGA 1IBLE 1XMOE 4GKKE 5F3WA 2VQFE 4AQYE 1YZ9A 4LF6E 4LFBE 2UXCE 2NA2A 4LTYA 4LF5E 2L92A 2DSYA 3LMLA 4X65E 5ADZA 4DV5E 1DQ3A 4LF7E 2UXDE 5T6JA 1ZBQA 2RSMA 2KHXA 4L5NC 4F9BB 3VK6A 2LUQA 4BMJA 1FJGE 4BS9A 1DI2A 3ADLA 2L33A 4JI1E 2KOUA 2V83A 2B3TB 3F6HA 3AUZA 1X48A 2L2KB 2E5LE 3ADGA 4L8NA 4DUZE 4LFCE 4F9AB 2RTXA 4NXME 2K4VA 2FGGA 3ZOQB 4JI7E 4F54A 2V8QB 4X62E 4WFTA 2UXBE 3C4TA 1IBME 4DR1E 4KZSA 4KHPE 4LF4E 3OMLA 1WHQA 4R03A 4DMIA 3OTOE 1N34E 4GEQB 1N36E 4JI2E 2ODRC 3HPZA 4DV3E 2JOXA 1N32E 4K0KE 3F6GA 3IWCA 2L2MA 2NUGA 4OOGC 2EWLA 3MSWA 4P7DA 4X64E 5LL6R 2V89A 1XMQE 3HXLA 1HNXE 4OX9E 4DV2E 1ZBTA 4BCAA 4TUGA 3VYYA 4I8OA 5A2QC 1WXRA 3HTXA 2F8BA 5AASA 4DV6E 4TUIA 2G7HA 3J7AG 3P1XA 2EZ6A 2IHR1 2N3GA 3LLHA 4WSPA 2LTRA 3C4BA 4WPYA 2JY9A 4BC9A 1XNQE 1X47A 4BBYA 1GQEA 1PKPA 2UU9E 5CFFE 2L6MA 4NXNE 3IWDA 3DF6A 1XNRE 1HNWE 4DR6E 2ZM6E 4YY3E 3HPSA 1YYOA 2NUFA 4JI6E 2NUEA 2LE2A 1J26A 2HHHE 2H36X 2KONA 4WYQB 1IBKE 2UUBE 5AE2A 4B3TE 3VYXA 4JV5E 5AE3A 1YYKA 2MDRA 3JU0A 4P78A 2V86A 2DIXA 2F4VE 2DMYA 2LUPB 1T4LB 5DNYA 2M1SA 2LJHA 3J7Yp 2V85A 3HQ1A 4M30A 1GZ6A 4DV0E 4DR3E 2WZOA 2L2NA 4B3ME 3AV0A 2RS7A 1STUA 1HR0E 2LMZA 4BC7A 5IWAE 4DR4E 4DV4E 2YT4A 2CPNA 3H09A 2UUCE 4LF8E 4X66E 4JYAE 4DUYE 4Q28A 2LTSA 4DV1E 3J81C 5LMNE 4JI0E 3ADIA 4DKKA 2YZTA 4YHHE 2VQEE 2E1MA 4LF9E 2V87A 5LMUE 5IT9C 4DR7E 5BR8E 2MC6A 4LFAE 3ADJA 5AE1A 5FLXC 3T1YE 4GKJE 4R8OA 1FKAE 1T4NA 4JI8E 4B3SE 2DB2A 1J5EE 2VF1A 4J8ZA 1EKZA 2FTXB 2UUAE 1YYWA 2M7QA 2L3JA 2LRSA 1N33E 1T4OA 4JI4E 4LU9A 2M4IA 4DR2E 2JVAA 2L8TA 4DV7E 2B9DA 2LBSB 3RMPA 4JI3E 4M2ZA 2VE7C 4JI5E 1SR9A 2FV4B 2JR1A 1O0WA 3J80C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L8N A;  4F54 A; 
#chains in the Genus database with same CATH topology
 3EPJ A;  1A1K A;  2L3C A;  2EPU A;  2V88 A;  2EJ4 A;  2RS6 A;  4O4K A;  1UHZ A;  1UIL A;  4RHB B;  3T1H E;  1X49 A;  1WHN A;  1X6H A;  2JOB A;  2EE8 A;  1RC7 A;  1XMO E;  4GKK E;  1BBG A;  2VQF E;  4AQY E;  2YRK A;  5F3W A;  4LFB E;  2PRT A;  2NA2 A;  2Q8U A;  2EQ1 A;  2EN8 A;  5ADZ A;  5LLQ A;  5T6J A;  2RSM A;  4F9B B;  4BS9 A;  2YTE A;  2L33 A;  4O43 A;  1G2D C;  2E5L E;  2EMF A;  3AUZ A;  1X48 A;  4X9J A;  3ADG A;  4L8N A;  4F9A B;  2YTN A;  5A69 A;  4ZYG A;  4F54 A;  3C4T A;  1A1F A;  3L00 A;  4DR1 E;  2ADR A;  1NCS A;  4R03 A;  4JI2 E;  2LV2 A;  4DV3 E;  2CSH A;  2JOX A;  2NUG A;  4OOG C;  3MSW A;  2EM6 A;  5KL2 A;  4BCA A;  1KJK A;  5AAS A;  4DV6 E;  4WSP A;  3LLH A;  1XNQ E;  1SFE A;  5KL4 A;  2UU9 E;  4NXN E;  4R2E A;  1WJP A;  1AH5 A;  2ZM6 E;  2R76 A;  3BGH A;  2NUF A;  2LE2 A;  2HJJ A;  2M9A A;  1P47 A;  2MDG A;  2R1F A;  1TF6 A;  2WCC 3;  2GLI A;  4JV5 E;  1YUI A;  2F4V E;  2DMY A;  2LUP B;  2YWQ A;  4O24 A;  2BB8 A;  3THN A;  3J7Y p;  2RPC A;  4DV0 E;  3EQ1 A;  2EOI A;  2EMK A;  2EL5 A;  4DR4 E;  2YT4 A;  2CPN A;  2EMG A;  2N8X A;  2YTD A;  2CTD A;  4Q28 A;  2EM2 A;  2LTS A;  2LO3 A;  3J81 C;  5LMN E;  1UBD C;  2JP9 A;  4YHH E;  2CT1 A;  2ENH A;  4LFA E;  2YRH A;  3T1Y E;  4GKJ E;  2EM0 A;  2EOX A;  1J5E E;  5A6A A;  4J8Z A;  4ZYH A;  2UUA E;  1N33 E;  2EPZ A;  5KL5 A;  2YTP A;  4DR2 E;  4IS1 C;  4M2Z A;  2EM4 A;  2EOM A;  3RMP A;  1SR9 A;  2LBS B;  1T38 A;  1LLM C;  2EOF A;  3IWB A;  2EPC A;  4X8W A;  4B3R E;  2MC5 A;  4BHC A;  2EMW A;  4R2S A;  3K6Q A;  4KWY A;  4X65 E;  1DQ3 A;  4BHB A;  3C6K A;  2EM9 A;  2KHX A;  4ZYD A;  4L5N C;  1TN9 A;  3BID A;  1DGC A;  2A25 A;  1DI2 A;  4F6N A;  2EL6 A;  2V83 A;  2B3T B;  2L2K B;  4DUZ E;  4JI7 E;  2EPM X;  2K7I A;  2EMI A;  5A6K A;  2EOY A;  4WX9 A;  1X5W A;  3OTO E;  4DMI A;  4GEQ B;  4NHR A;  2MKN A;  2D9H A;  3HPZ A;  1XMQ E;  2V89 A;  1ZBT A;  4WXC A;  4TUG A;  2DLK A;  3HTX A;  3EPH A;  3J7A G;  1YSA C;  1A1H A;  3P1X A;  4WPY A;  2JY9 A;  1MEY C;  1X47 A;  2EPR A;  1TF3 A;  1PKP A;  1XNR E;  3THO B;  2L6M A;  2EPA A;  1EH8 A;  4DR6 E;  1MGT A;  2EN1 A;  1G2F C;  2NUE A;  2EL4 A;  1B69 A;  1IBK E;  3EPK A;  2VRD A;  1YYK A;  2EMA A;  3JU0 A;  2EM5 A;  2EOZ A;  2EM3 A;  2LJH A;  2NAB A;  1ZU1 A;  2EMY A;  2L2N A;  4B3M E;  2EMH A;  3AV0 A;  2RS7 A;  1HR0 E;  2LMZ A;  2EN2 A;  4R2R A;  3H09 A;  2UUC E;  4ZYE A;  4JYA E;  4R2P A;  1WRJ A;  1AAY A;  2VQE E;  2E1M A;  2MC6 A;  3ADJ A;  5AE1 A;  1A1I A;  2HGH A;  2BBG A;  1FKA E;  1T4N A;  2EM7 A;  4Q35 B;  2EMX A;  1X6E A;  2WBS A;  5TSE A;  1IQS A;  2EPN A;  4MLV A;  5IV8 B;  1N3G A;  4JI3 E;  1IMU A;  4P78 A;  1HNW E;  1O0W A;  3J80 C;  2JWO A;  1QU6 A;  2DMI A;  4F9C B;  3KWR A;  4DR5 E;  3JAM C;  1HNZ E;  3M99 B;  2ODR D;  1I94 E;  2YTG A;  1X6F A;  3BF2 A;  3JTZ A;  2DRP A;  3FIG A;  2EM8 A;  3MHH C;  1YZ9 A;  4LF6 E;  2YTO A;  2UXC E;  5A6B A;  4LF5 E;  2L92 A;  3LML A;  4LF7 E;  2UXD E;  2EOQ A;  3VK6 A;  2LUQ A;  4BMJ A;  4RH8 A;  1FJG E;  3ADL A;  4NZV A;  2KOU A;  2ELZ A;  2EN3 A;  2K4V A;  3ZOQ B;  4X62 E;  2V8Q B;  2UXB E;  1RMD A;  1IBM E;  5A6J A;  4LF4 E;  2YTJ A;  1N34 E;  1N36 E;  2ODR C;  5IXM B;  3IWC A;  2L2M A;  1YFH A;  4IJD A;  2EWL A;  3HXL A;  2HC5 A;  2YSP A;  4R2C A;  2WBT A;  4DV2 E;  4I8O A;  5A2Q C;  2F8B A;  4TUI A;  2G7H A;  2EPX A;  3QG5 C;  1JK1 A;  2EZ6 A;  2IHR 1;  2LCE A;  2N3G A;  4F6M A;  2YTF A;  2EOH A;  3C4B A;  3UK3 C;  1GQE A;  1KYQ A;  5CFF E;  3IWD A;  3DF6 A;  2LT7 A;  3HPS A;  4R2Q A;  4HTG A;  3KZZ A;  1J26 A;  4FK5 C;  1NEI A;  4WYQ B;  2EOO A;  5AE2 A;  3VYX A;  2RQL A;  2DIX A;  1T4L B;  1BBO A;  2V85 A;  3HQ1 A;  4M30 A;  1GZ6 A;  1A1G A;  1STU A;  5IWA E;  2EPL X;  2EOR A;  2JYA A;  4DUY E;  1BB8 A;  1EH6 A;  4DV1 E;  4JI0 E;  4DKK A;  2YZT A;  2V87 A;  5LMU E;  5IT9 C;  5BR8 E;  5FLX C;  2I13 A;  1T39 A;  4R8O A;  4MLQ A;  4JI8 E;  4B3S E;  5AC4 A;  2DB2 A;  1EKZ A;  2J7J A;  3C6M A;  2M7Q A;  1YYW A;  2LRS A;  4JI4 E;  2WBU A;  4LU9 A;  4R2D A;  2JVA A;  2L8T A;  2B9D A;  4JI5 E;  2EMB A;  2FV4 B;  2JR1 A;  1RQ0 A;  2EMC A;  2B7T A;  4M0V A;  2B7V A;  2N3H A;  1JK2 A;  3DJW A;  2EPK X;  1IBL E;  3VHT B;  2EN7 A;  3KZY A;  2EP3 A;  2EOS A;  1Z1B A;  3MHS C;  4LTY A;  5KL6 A;  2EN4 A;  2DSY A;  4DV5 E;  2EPO A;  1ZBQ A;  1ZR9 A;  2DLQ A;  2YU5 A;  3EPL A;  4O5G A;  2LVH A;  4JI1 E;  3F6H A;  4N4R B;  2GHF A;  4GZN C;  4LFC E;  2RTX A;  3BBG A;  4NXM E;  2FGG A;  5KL7 A;  4WFT A;  1IQO A;  1PJT A;  3TQM A;  4KZS A;  4KHP E;  4R2A A;  3OML A;  1WHQ A;  4F2J C;  2LJU A;  1N32 E;  2EPP A;  3F6G A;  2JPA A;  4K0K E;  1ZAA C;  4P7D A;  4X64 E;  5LL6 R;  5A6B D;  1HNX E;  4OX9 E;  2EQ0 A;  1YUJ A;  3VYY A;  2YTI A;  1WXR A;  1PJS A;  2GPI A;  2E72 A;  2LTR A;  4BC9 A;  4BBY A;  1X3C A;  1QNT A;  4HEI A;  4YY3 E;  2JXP A;  1YYO A;  4JI6 E;  1L4S A;  2YPN A;  2ENC A;  4WSG A;  2HHH E;  2I9I A;  2H36 X;  2KON A;  4M9V C;  2UUB E;  4B3T E;  2RSI A;  5AE3 A;  2MDR A;  2V86 A;  1UN6 B;  5DNY A;  2M1S A;  1F2I G;  2EN6 A;  4DR3 E;  2EMZ A;  2WZO A;  2EQ3 A;  4BC7 A;  5AC5 A;  4DV4 E;  1YPN A;  4LF8 E;  1A1L A;  4X66 E;  1EH7 A;  2YRM A;  4WXD A;  5KL3 A;  3ADI A;  1GTK A;  3ECR A;  4LF9 E;  1PJQ A;  4DR7 E;  2EML A;  2YU8 A;  2EOJ A;  2ELY A;  2DGC A;  2VF1 A;  2MKD A;  1A1J A;  2YSO A;  2EOE A;  2FTX B;  2L3J A;  1PDA A;  1T4O A;  2M4I A;  4DV7 E;  2VE7 C;  2YTQ A;  2ENA A; 
#chains in the Genus database with same CATH homology
 2JWO A;  1QU6 A;  4F9C B;  3IWB A;  2L3C A;  2V88 A;  3KWR A;  4DR5 E;  1RQ0 A;  4X8W A;  3JAM C;  2B7T A;  2MC5 A;  2B7V A;  2N3H A;  2RS6 A;  4M0V A;  3DJW A;  1HNZ E;  4B3R E;  2ODR D;  1UHZ A;  1UIL A;  3T1H E;  1I94 E;  1X49 A;  1WHN A;  3JTZ A;  2JOB A;  3K6Q A;  1RC7 A;  3FIG A;  1IBL E;  1XMO E;  4GKK E;  5F3W A;  2VQF E;  4AQY E;  1YZ9 A;  4LF6 E;  4LFB E;  2UXC E;  2NA2 A;  4LTY A;  4LF5 E;  2L92 A;  2DSY A;  3LML A;  4X65 E;  5ADZ A;  4DV5 E;  1DQ3 A;  4LF7 E;  2UXD E;  5T6J A;  1ZBQ A;  2RSM A;  2KHX A;  4L5N C;  4F9B B;  3VK6 A;  2LUQ A;  4BMJ A;  1FJG E;  4BS9 A;  1DI2 A;  3ADL A;  2L33 A;  4JI1 E;  2KOU A;  2V83 A;  2B3T B;  3F6H A;  3AUZ A;  1X48 A;  2L2K B;  2E5L E;  3ADG A;  4L8N A;  4DUZ E;  4LFC E;  4F9A B;  2RTX A;  4NXM E;  2K4V A;  2FGG A;  3ZOQ B;  4JI7 E;  4F54 A;  2V8Q B;  4X62 E;  4WFT A;  2UXB E;  3C4T A;  1IBM E;  4DR1 E;  4KZS A;  4KHP E;  4LF4 E;  3OML A;  1WHQ A;  4R03 A;  4DMI A;  3OTO E;  1N34 E;  4GEQ B;  1N36 E;  4JI2 E;  2ODR C;  3HPZ A;  4DV3 E;  2JOX A;  1N32 E;  4K0K E;  3F6G A;  3IWC A;  2L2M A;  2NUG A;  4OOG C;  2EWL A;  3MSW A;  4P7D A;  4X64 E;  5LL6 R;  2V89 A;  1XMQ E;  3HXL A;  1HNX E;  4OX9 E;  4DV2 E;  1ZBT A;  4BCA A;  4TUG A;  3VYY A;  4I8O A;  5A2Q C;  1WXR A;  3HTX A;  2F8B A;  5AAS A;  4DV6 E;  4TUI A;  2G7H A;  3J7A G;  3P1X A;  2EZ6 A;  2IHR 1;  2N3G A;  3LLH A;  4WSP A;  2LTR A;  3C4B A;  4WPY A;  2JY9 A;  4BC9 A;  1XNQ E;  1X47 A;  4BBY A;  1GQE A;  1PKP A;  2UU9 E;  5CFF E;  2L6M A;  4NXN E;  3IWD A;  3DF6 A;  1XNR E;  1HNW E;  4DR6 E;  2ZM6 E;  4YY3 E;  3HPS A;  1YYO A;  2NUF A;  4JI6 E;  2NUE A;  2LE2 A;  1J26 A;  2HHH E;  2H36 X;  2KON A;  4WYQ B;  1IBK E;  2UUB E;  5AE2 A;  4B3T E;  3VYX A;  4JV5 E;  5AE3 A;  1YYK A;  2MDR A;  3JU0 A;  4P78 A;  2V86 A;  2DIX A;  2F4V E;  2DMY A;  2LUP B;  1T4L B;  5DNY A;  2M1S A;  2LJH A;  3J7Y p;  2V85 A;  3HQ1 A;  4M30 A;  1GZ6 A;  4DV0 E;  4DR3 E;  2WZO A;  2L2N A;  4B3M E;  3AV0 A;  2RS7 A;  1STU A;  1HR0 E;  2LMZ A;  4BC7 A;  5IWA E;  4DR4 E;  4DV4 E;  2YT4 A;  2CPN A;  3H09 A;  2UUC E;  4LF8 E;  4X66 E;  4JYA E;  4DUY E;  4Q28 A;  2LTS A;  4DV1 E;  3J81 C;  5LMN E;  4JI0 E;  3ADI A;  4DKK A;  2YZT A;  4YHH E;  2VQE E;  2E1M A;  4LF9 E;  2V87 A;  5LMU E;  5IT9 C;  4DR7 E;  5BR8 E;  2MC6 A;  4LFA E;  3ADJ A;  5AE1 A;  5FLX C;  3T1Y E;  4GKJ E;  4R8O A;  1FKA E;  1T4N A;  4JI8 E;  4B3S E;  2DB2 A;  1J5E E;  2VF1 A;  4J8Z A;  1EKZ A;  2FTX B;  2UUA E;  1YYW A;  2M7Q A;  2L3J A;  2LRS A;  1N33 E;  1T4O A;  4JI4 E;  4LU9 A;  2M4I A;  4DR2 E;  2JVA A;  2L8T A;  4DV7 E;  2B9D A;  2LBS B;  3RMP A;  4JI3 E;  4M2Z A;  2VE7 C;  4JI5 E;  1SR9 A;  2FV4 B;  2JR1 A;  1O0W A;  3J80 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...