4F54A

Crystal structure of a duf4136 family protein (bt2437) from bacteroides thetaiotaomicron vpi-5482 at 1.60 a resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
183
structure length
173
Chain Sequence
DDNYLVYTNYDQANFDFSTFYLADILVISDSEPEYLEGEGAEQILAAYTENMEAGYQPAADESADLGIQVSYIASTYYFTGYTQPEWWWGYPGYWGPSYWGNWGGWYYPYAVTYSYSTNSFITEMVNLADEGEGLPVVWTSYLTGFETGSAINRTLAIEAVNQSFTQSPYLTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BT2437) from Bacteroides thetaiotaomicron VPI-5482 at 1.60 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
total genus 41
structure length 173
sequence length 183
ec nomenclature
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13590 DUF4136 Domain of unknown function (DUF4136)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.670 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4f54A00
4F54A 4L8NA
chains in the Genus database with same CATH superfamily
5FLXC 4DV5E 5A69A 2JR1A 3JTZA 4LFCE 1IQSA 1EH8A 2EM2A 1X5WA 1PKPA 5TSEA 1WHQA 4J8ZA 2DMIA 2EPNA 2NABA 4M9VC 2EMFA 1T4OA 2WBUA 2EQ0A 2VRDA 4B3RE 4DR4E 5IV8B 1IBLE 3C4BA 2PRTA 2B3TB 5A6KA 3EPHA 4DR7E 2YU8A 5KL6A 2RPCA 4DV7E 2EMBA 3AV0A 4ZYHA 2JWOA 2YSOA 2KOUA 4O43A 4WXCA 2NUGA 1GTKA 5BR8E 3OMLA 3RMPA 4KWYA 2UXCE 2GLIA 2JVAA 2YTJA 5IXMB 1N36E 1HR0E 2EL6A 4WPYA 4O5GA 4X62E 2E72A 2K7IA 2DB2A 1X48A 2DLQA 1WXRA 4Q28A 4ZYDA 2H36X 2LV2A 4LFAE 4WSPA 1IMUA 2FV4B 2EN1A 2BB8A 3ZOQB 5IT9C 4DR2E 4P7DA 4DV1E 4I8OA 2V83A 4DR1E 4AQYE 2L92A 2G7HA 2HHHE 2K4VA 4DR5E 2L3CA 2V88A 5DNYA 5F3WA 3C6MA 2LVHA 4X8WA 2YRHA 4P78A 4M2ZA 3LLHA 2EMGA 5A6AA 1BBOA 2YTIA 4ZYGA 4DUYE 4JI6E 1GZ6A 2EOEA 2EOJA 1SR9A 2YTNA 2L3JA 3KWRA 2EMAA 3F6HA 2EJ4A 2EWLA 2V8QB 4BCAA 2RSMA 4LTYA 3FIGA 4YY3E 3MHHC 2BBGA 2EM0A 3KZZA 1NEIA 2LO3A 4JI7E 2E5LE 3ECRA 1EH6A 2LBSB 4Q35B 2YSPA 2LMZA 5KL3A 1N33E 4JI0E 2L6MA 2L33A 5A2QC 4M0VA 1WJPA 2ELYA 2LUPB 4JI4E 2EMXA 1NCSA 5A6BD 2UU9E 1UN6B 2EQ3A 2VQFE 2DRPA 1XNQE 4DV6E 3ADLA 4O4KA 1AH5A 2EN3A 1A1FA 2JYAA 3VYXA 2R76A 4GEQB 3HXLA 1X6EA 2YRMA 3J7Yp 2M9AA 4O24A 4R2RA 1EH7A 4M30A 1T4LB 4MLQA 5KL2A 2MKNA 4X66E 1MEYC 3THNA 2F4VE 2JY9A 2B7VA 2EPOA 4LF4E 1A1IA 4R03A 4BC9A 5AE2A 1BB8A 2RQLA 4BBYA 2EOFA 4NHRA 2CPNA 2EMKA 4N4RB 4ZYEA 2DSYA 2JP9A 1SFEA 2EQ1A 1ZBQA 2EPRA 1YFHA 3J80C 2L8TA 2UXBE 1HNZE 4K0KE 2LJUA 2R1FA 2FTXB 2MKDA 2V85A 4BMJA 4IJDA 1YUJA 1DI2A 3C6KA 2ENAA 4JV5E 4F6MA 2UUBE 4F9CB 2LTRA 2ADRA 2EMYA 2WBTA 1STUA 4BHBA 4TUIA 3EPKA 3AUZA 2UXDE 4R2AA 1YYOA 3L00A 2YRKA 1KYQA 1YPNA 2YWQA 2EM5A 2LCEA 1X3CA 2YTPA 2EN7A 3JAMC 2EPPA 2EN8A 2MDGA 2YTQA 5KL4A 2EMCA 4JI2E 2MC6A 1A1HA 2WCC3 2LUQA 5KL5A 2EOOA 2EN6A 3ADIA 2EMZA 1QU6A 1X6FA 3BGHA 2EOHA 4TUGA 2EPKX 1PJTA 3VK6A 4DR6E 2YTDA 2EM4A 2EM6A 4BHCA 1ZBTA 2VF1A 2UUAE 5LMNE 4R2PA 2EP3A 2EM7A 4F9BB 1GQEA 4RH8A 3ADJA 3C4TA 2FGGA 1P47A 4HTGA 4X65E 4F54A 4LF8E 2JXPA 4LU9A 5LL6R 4JI8E 2YTEA 1BBGA 3BBGA 4DKKA 4B3ME 2N3HA 1YZ9A 2CT1A 1HNXE 2M4IA 2YT4A 4JYAE 1ZAAC 3BF2A 1XMQE 2EOIA 2M7QA 2V86A 3MSWA 2EN2A 1HNWE 2EMIA 2EM8A 4DV0E 2NUEA 1PDAA 3VHTB 5LLQA 1PJSA 2L2NA 2VQEE 3IWDA 4R2CA 2EZ6A 2RS6A 2EL5A 4X64E 3J7AG 5A6JA 5CFFE 3EQ1A 3H09A 1O0WA 2I13A 4LF5E 3VYYA 2EPUA 1X47A 1WHNA 4B3SE 1I94E 1TN9A 3HQ1A 1L4SA 2EL4A 2B7TA 1A1KA 1J5EE 1A1GA 2M1SA 2EPLX 2HGHA 4LF6E 2WBSA 2EPXA 1N34E 3DF6A 4X9JA 2EOQA 3T1HE 2YTFA 4R2EA 2EPAA 2YZTA 4F2JC 2B9DA 2ELZA 2J7JA 2E1MA 4GZNC 3UK3C 2ZM6E 2DGCA 4DV2E 4YHHE 4NZVA 1A1LA 5AE1A 4R2QA 4DV3E 2N3GA 1A1JA 2EM9A 1LLMC 1RQ0A 1DGCA 3QG5C 4WYQB 1RMDA 1KJKA 4BC7A 2NUFA 2DLKA 2EPMX 4RHBB 3J81C 3IWBA 2LE2A 4LFBE 1G2DC 3TQMA 4JI1E 1IBME 4LF9E 1DQ3A 2EN4A 2I9IA 2EE8A 1ZR9A 1T39A 4HEIA 4NXME 1XMOE 3MHSC 2LT7A 4MLVA 2EOXA 1UILA 2RSIA 4BS9A 2DIXA 4L5NC 2V89A 1YYWA 2RS7A 2HC5A 1IQOA 1UHZA 5AASA 3HPZA 3ADGA 2KONA 2YTGA 4GKKE 2LJHA 1B69A 4GKJE 2MC5A 5T6JA 2CSHA 2EMWA 1YUIA 2N8XA 3M99B 4R8OA 2IHR1 4KZSA 2L2KB 4OX9E 2A25A 2RTXA 1Z1BA 4R2DA 1TF3A 4WSGA 4WFTA 4NXNE 3DJWA 1N32E 1X49A 3THOB 2DMYA 3P1XA 2NA2A 1QNTA 1RC7A 4FK5C 4R2SA 3HTXA 2ODRC 2L2MA 2EMHA 1AAYA 3EPLA 2ODRD 2EOMA 4B3TE 1JK2A 3LMLA 2GHFA 2EOSA 2EPCA 2ENCA 3KZYA 2V87A 1T38A 4DUZE 5LMUE 3OTOE 2WZOA 3JU0A 4JI5E 1X6HA 2D9HA 2VE7C 4DV4E 2LTSA 1WRJA 4LF7E 3BIDA 1YSAC 5IWAE 1UBDC 2LRSA 2ENHA 2EMLA 5A6BA 2EM3A 2EPZA 2MDRA 2HJJA 1FKAE 4JI3E 1TF6A 2EORA 1XNRE 1J26A 1F2IG 2F8BA 2KHXA 5AC5A 2EOZA 4F9AB 4WXDA 5AC4A 4OOGC 1MGTA 4DMIA 2YPNA 2EOYA 3HPSA 1EKZA 4IS1C 3K6QA 2GPIA 1IBKE 3IWCA 2YU5A 4L8NA 5ADZA 1PJQA 1ZU1A 1YYKA 1JK1A 2YTOA 2JOBA 1FJGE 1G2FC 2JOXA 5AE3A 4F6NA 2Q8UA 4DR3E 2CTDA 1T4NA 2UUCE 3F6GA 4WX9A 1N3GA 3EPJA 4KHPE 5KL7A 3T1YE 2JPAA
chains in the Genus database with same CATH topology
4JI1E 4JI0E 5FLXC 4DV5E 1IBME 1ZBTA 2L6MA 4LF9E 2JR1A 2L33A 2VF1A 3JTZA 2UUAE 1DQ3A 4LFCE 5A2QC 5LMNE 4KHPE 4M0VA 2LUPB 4NXME 1XMOE 1PKPA 4JI4E 1WHQA 4J8ZA 4F9BB 1GQEA 1UILA 4BS9A 2DIXA 4L5NC 2V89A 2UU9E 1YYWA 1T4OA 2RS7A 4DR6E 1UHZA 3ADJA 3C4TA 5AASA 2VQFE 1XNQE 2FGGA 3HPZA 4DV6E 3ADGA 3ADLA 2KONA 4X65E 4B3RE 4DR4E 4F54A 1IBLE 4LF8E 3C4BA 4GKKE 4LU9A 5LL6R 2LJHA 2B3TB 4DR7E 4GKJE 4JI8E 2MC5A 3VYXA 3J7Yp 4GEQB 3HXLA 5T6JA 4DKKA 4DV7E 4B3ME 2N3HA 4M30A 1T4LB 1YZ9A 4R8OA 3AV0A 1HNXE 2JWOA 4X66E 2KOUA 2M4IA 2YT4A 2NUGA 2F4VE 2JY9A 4JYAE 2IHR1 2B7VA 4KZSA 3OMLA 5BR8E 2L2KB 3RMPA 4LF4E 4OX9E 2RTXA 2UXCE 4R03A 4BC9A 5AE2A 1XMQE 4NXNE 4WFTA 2JVAA 2M7QA 1N36E 3DJWA 4BBYA 1N32E 1X49A 2V86A 3MSWA 1HR0E 1HNWE 2CPNA 4DV0E 4WPYA 2DMYA 3P1XA 2NUEA 4X62E 2NA2A 2DSYA 2L2NA 1RC7A 2VQEE 3IWDA 1ZBQA 2EZ6A 3HTXA 2DB2A 2RS6A 2ODRC 4X64E 2L2MA 1X48A 3J7AG 3J80C 2L8TA 5CFFE 1HNZE 2UXBE 3H09A 4K0KE 2ODRD 1O0WA 1WXRA 4Q28A 4B3TE 4LF5E 3LMLA 3VYYA 2H36X 4LFAE 2FTXB 2V87A 2V85A 4WSPA 4BMJA 4DUZE 1X47A 1WHNA 5LMUE 4B3SE 3OTOE 1I94E 2WZOA 2FV4B 3HQ1A 3JU0A 2VE7C 4DV4E 2B7TA 4JI5E 1DI2A 2LTSA 1J5EE 3ZOQB 5IT9C 4LF7E 5IWAE 2M1SA 4JV5E 2LRSA 2UUBE 4F9CB 4LF6E 2LTRA 1N34E 3DF6A 4DR2E 3T1HE 2MDRA 4P7DA 4DV1E 4I8OA 2V83A 2YZTA 4DR1E 4AQYE 2L92A 1STUA 2G7HA 1FKAE 2B9DA 2HHHE 2K4VA 4DR5E 4JI3E 2L3CA 2V88A 5DNYA 1XNRE 5F3WA 1J26A 4TUIA 2F8BA 2KHXA 2E1MA 3AUZA 4X8WA 4P78A 4F9AB 2ZM6E 1YYOA 2UXDE 4OOGC 4YHHE 4DV2E 4DMIA 4M2ZA 3LLHA 5AE1A 3HPSA 1EKZA 4JI6E 3K6QA 4DUYE 2N3GA 4DV3E 1GZ6A 1IBKE 3IWCA 4L8NA 5ADZA 3JAMC 1SR9A 2L3JA 3KWRA 3VK6A 3F6HA 1RQ0A 2EWLA 2V8QB 4BCAA 1YYKA 2RSMA 4LTYA 2JOBA 3FIGA 4YY3E 1FJGE 4JI2E 2MC6A 2JOXA 5AE3A 2LUQA 4WYQB 4JI7E 4DR3E 4BC7A 2NUFA 2E5LE 3J81C 3ADIA 1T4NA 2UUCE 3IWBA 2LE2A 2LBSB 4LFBE 1QU6A 3F6GA 4TUGA 2LMZA 3T1YE 1N33E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F54 A;  4L8N A; 
#chains in the Genus database with same CATH topology
 5FLX C;  4DV5 E;  5A69 A;  2JR1 A;  3JTZ A;  4LFC E;  1IQS A;  1EH8 A;  2EM2 A;  1X5W A;  1PKP A;  5TSE A;  1WHQ A;  4J8Z A;  2DMI A;  2EPN A;  2NAB A;  4M9V C;  2EMF A;  1T4O A;  2WBU A;  2EQ0 A;  2VRD A;  4B3R E;  4DR4 E;  5IV8 B;  1IBL E;  3C4B A;  2PRT A;  2B3T B;  5A6K A;  3EPH A;  4DR7 E;  2YU8 A;  5KL6 A;  2RPC A;  4DV7 E;  2EMB A;  3AV0 A;  4ZYH A;  2JWO A;  2YSO A;  2KOU A;  4O43 A;  4WXC A;  2NUG A;  1GTK A;  5BR8 E;  3OML A;  3RMP A;  4KWY A;  2UXC E;  2GLI A;  2JVA A;  2YTJ A;  5IXM B;  1N36 E;  1HR0 E;  2EL6 A;  4WPY A;  4O5G A;  4X62 E;  2E72 A;  2K7I A;  2DB2 A;  1X48 A;  2DLQ A;  1WXR A;  4Q28 A;  4ZYD A;  2H36 X;  2LV2 A;  4LFA E;  4WSP A;  1IMU A;  2FV4 B;  2EN1 A;  2BB8 A;  3ZOQ B;  5IT9 C;  4DR2 E;  4P7D A;  4DV1 E;  4I8O A;  2V83 A;  4DR1 E;  4AQY E;  2L92 A;  2G7H A;  2HHH E;  2K4V A;  4DR5 E;  2L3C A;  2V88 A;  5DNY A;  5F3W A;  3C6M A;  2LVH A;  4X8W A;  2YRH A;  4P78 A;  4M2Z A;  3LLH A;  2EMG A;  5A6A A;  1BBO A;  2YTI A;  4ZYG A;  4DUY E;  4JI6 E;  1GZ6 A;  2EOE A;  2EOJ A;  1SR9 A;  2YTN A;  2L3J A;  3KWR A;  2EMA A;  3F6H A;  2EJ4 A;  2EWL A;  2V8Q B;  4BCA A;  2RSM A;  4LTY A;  3FIG A;  4YY3 E;  3MHH C;  2BBG A;  2EM0 A;  3KZZ A;  1NEI A;  2LO3 A;  4JI7 E;  2E5L E;  3ECR A;  1EH6 A;  2LBS B;  4Q35 B;  2YSP A;  2LMZ A;  5KL3 A;  1N33 E;  4JI0 E;  2L6M A;  2L33 A;  5A2Q C;  4M0V A;  1WJP A;  2ELY A;  2LUP B;  4JI4 E;  2EMX A;  1NCS A;  5A6B D;  2UU9 E;  1UN6 B;  2EQ3 A;  2VQF E;  2DRP A;  1XNQ E;  4DV6 E;  3ADL A;  4O4K A;  1AH5 A;  2EN3 A;  1A1F A;  2JYA A;  3VYX A;  2R76 A;  4GEQ B;  3HXL A;  1X6E A;  2YRM A;  3J7Y p;  2M9A A;  4O24 A;  4R2R A;  1EH7 A;  4M30 A;  1T4L B;  4MLQ A;  5KL2 A;  2MKN A;  4X66 E;  1MEY C;  3THN A;  2F4V E;  2JY9 A;  2B7V A;  2EPO A;  4LF4 E;  1A1I A;  4R03 A;  4BC9 A;  5AE2 A;  1BB8 A;  2RQL A;  4BBY A;  2EOF A;  4NHR A;  2CPN A;  2EMK A;  4N4R B;  4ZYE A;  2DSY A;  2JP9 A;  1SFE A;  2EQ1 A;  1ZBQ A;  2EPR A;  1YFH A;  3J80 C;  2L8T A;  2UXB E;  1HNZ E;  4K0K E;  2LJU A;  2R1F A;  2FTX B;  2MKD A;  2V85 A;  4BMJ A;  4IJD A;  1YUJ A;  1DI2 A;  3C6K A;  2ENA A;  4JV5 E;  4F6M A;  2UUB E;  4F9C B;  2LTR A;  2ADR A;  2EMY A;  2WBT A;  1STU A;  4BHB A;  4TUI A;  3EPK A;  3AUZ A;  2UXD E;  4R2A A;  1YYO A;  3L00 A;  2YRK A;  1KYQ A;  1YPN A;  2YWQ A;  2EM5 A;  2LCE A;  1X3C A;  2YTP A;  2EN7 A;  3JAM C;  2EPP A;  2EN8 A;  2MDG A;  2YTQ A;  5KL4 A;  2EMC A;  4JI2 E;  2MC6 A;  1A1H A;  2WCC 3;  2LUQ A;  5KL5 A;  2EOO A;  2EN6 A;  3ADI A;  2EMZ A;  1QU6 A;  1X6F A;  3BGH A;  2EOH A;  4TUG A;  2EPK X;  1PJT A;  3VK6 A;  4DR6 E;  2YTD A;  2EM4 A;  2EM6 A;  4BHC A;  1ZBT A;  2VF1 A;  2UUA E;  5LMN E;  4R2P A;  2EP3 A;  2EM7 A;  4F9B B;  1GQE A;  4RH8 A;  3ADJ A;  3C4T A;  2FGG A;  1P47 A;  4HTG A;  4X65 E;  4F54 A;  4LF8 E;  2JXP A;  4LU9 A;  5LL6 R;  4JI8 E;  2YTE A;  1BBG A;  3BBG A;  4DKK A;  4B3M E;  2N3H A;  1YZ9 A;  2CT1 A;  1HNX E;  2M4I A;  2YT4 A;  4JYA E;  1ZAA C;  3BF2 A;  1XMQ E;  2EOI A;  2M7Q A;  2V86 A;  3MSW A;  2EN2 A;  1HNW E;  2EMI A;  2EM8 A;  4DV0 E;  2NUE A;  1PDA A;  3VHT B;  5LLQ A;  1PJS A;  2L2N A;  2VQE E;  3IWD A;  4R2C A;  2EZ6 A;  2RS6 A;  2EL5 A;  4X64 E;  3J7A G;  5A6J A;  5CFF E;  3EQ1 A;  3H09 A;  1O0W A;  2I13 A;  4LF5 E;  3VYY A;  2EPU A;  1X47 A;  1WHN A;  4B3S E;  1I94 E;  1TN9 A;  3HQ1 A;  1L4S A;  2EL4 A;  2B7T A;  1A1K A;  1J5E E;  1A1G A;  2M1S A;  2EPL X;  2HGH A;  4LF6 E;  2WBS A;  2EPX A;  1N34 E;  3DF6 A;  4X9J A;  2EOQ A;  3T1H E;  2YTF A;  4R2E A;  2EPA A;  2YZT A;  4F2J C;  2B9D A;  2ELZ A;  2J7J A;  2E1M A;  4GZN C;  3UK3 C;  2ZM6 E;  2DGC A;  4DV2 E;  4YHH E;  4NZV A;  1A1L A;  5AE1 A;  4R2Q A;  4DV3 E;  2N3G A;  1A1J A;  2EM9 A;  1LLM C;  1RQ0 A;  1DGC A;  3QG5 C;  4WYQ B;  1RMD A;  1KJK A;  4BC7 A;  2NUF A;  2DLK A;  2EPM X;  4RHB B;  3J81 C;  3IWB A;  2LE2 A;  4LFB E;  1G2D C;  3TQM A;  4JI1 E;  1IBM E;  4LF9 E;  1DQ3 A;  2EN4 A;  2I9I A;  2EE8 A;  1ZR9 A;  1T39 A;  4HEI A;  4NXM E;  1XMO E;  3MHS C;  2LT7 A;  4MLV A;  2EOX A;  1UIL A;  2RSI A;  4BS9 A;  2DIX A;  4L5N C;  2V89 A;  1YYW A;  2RS7 A;  2HC5 A;  1IQO A;  1UHZ A;  5AAS A;  3HPZ A;  3ADG A;  2KON A;  2YTG A;  4GKK E;  2LJH A;  1B69 A;  4GKJ E;  2MC5 A;  5T6J A;  2CSH A;  2EMW A;  1YUI A;  2N8X A;  3M99 B;  4R8O A;  2IHR 1;  4KZS A;  2L2K B;  4OX9 E;  2A25 A;  2RTX A;  1Z1B A;  4R2D A;  1TF3 A;  4WSG A;  4WFT A;  4NXN E;  3DJW A;  1N32 E;  1X49 A;  3THO B;  2DMY A;  3P1X A;  2NA2 A;  1QNT A;  1RC7 A;  4FK5 C;  4R2S A;  3HTX A;  2ODR C;  2L2M A;  2EMH A;  1AAY A;  3EPL A;  2ODR D;  2EOM A;  4B3T E;  1JK2 A;  3LML A;  2GHF A;  2EOS A;  2EPC A;  2ENC A;  3KZY A;  2V87 A;  1T38 A;  4DUZ E;  5LMU E;  3OTO E;  2WZO A;  3JU0 A;  4JI5 E;  1X6H A;  2D9H A;  2VE7 C;  4DV4 E;  2LTS A;  1WRJ A;  4LF7 E;  3BID A;  1YSA C;  5IWA E;  1UBD C;  2LRS A;  2ENH A;  2EML A;  5A6B A;  2EM3 A;  2EPZ A;  2MDR A;  2HJJ A;  1FKA E;  4JI3 E;  1TF6 A;  2EOR A;  1XNR E;  1J26 A;  1F2I G;  2F8B A;  2KHX A;  5AC5 A;  2EOZ A;  4F9A B;  4WXD A;  5AC4 A;  4OOG C;  1MGT A;  4DMI A;  2YPN A;  2EOY A;  3HPS A;  1EKZ A;  4IS1 C;  3K6Q A;  2GPI A;  1IBK E;  3IWC A;  2YU5 A;  4L8N A;  5ADZ A;  1PJQ A;  1ZU1 A;  1YYK A;  1JK1 A;  2YTO A;  2JOB A;  1FJG E;  1G2F C;  2JOX A;  5AE3 A;  4F6N A;  2Q8U A;  4DR3 E;  2CTD A;  1T4N A;  2UUC E;  3F6G A;  4WX9 A;  1N3G A;  3EPJ A;  4KHP E;  5KL7 A;  3T1Y E;  2JPA A; 
#chains in the Genus database with same CATH homology
 4JI1 E;  4JI0 E;  5FLX C;  4DV5 E;  1IBM E;  1ZBT A;  2L6M A;  4LF9 E;  2JR1 A;  2L33 A;  2VF1 A;  3JTZ A;  2UUA E;  1DQ3 A;  4LFC E;  5A2Q C;  5LMN E;  4KHP E;  4M0V A;  2LUP B;  4NXM E;  1XMO E;  1PKP A;  4JI4 E;  1WHQ A;  4J8Z A;  4F9B B;  1GQE A;  1UIL A;  4BS9 A;  2DIX A;  4L5N C;  2V89 A;  2UU9 E;  1YYW A;  1T4O A;  2RS7 A;  4DR6 E;  1UHZ A;  3ADJ A;  3C4T A;  5AAS A;  2VQF E;  1XNQ E;  2FGG A;  3HPZ A;  4DV6 E;  3ADG A;  3ADL A;  2KON A;  4X65 E;  4B3R E;  4DR4 E;  4F54 A;  1IBL E;  4LF8 E;  3C4B A;  4GKK E;  4LU9 A;  5LL6 R;  2LJH A;  2B3T B;  4DR7 E;  4GKJ E;  4JI8 E;  2MC5 A;  3VYX A;  3J7Y p;  4GEQ B;  3HXL A;  5T6J A;  4DKK A;  4DV7 E;  4B3M E;  2N3H A;  4M30 A;  1T4L B;  1YZ9 A;  4R8O A;  3AV0 A;  1HNX E;  2JWO A;  4X66 E;  2KOU A;  2M4I A;  2YT4 A;  2NUG A;  2F4V E;  2JY9 A;  4JYA E;  2IHR 1;  2B7V A;  4KZS A;  3OML A;  5BR8 E;  2L2K B;  3RMP A;  4LF4 E;  4OX9 E;  2RTX A;  2UXC E;  4R03 A;  4BC9 A;  5AE2 A;  1XMQ E;  4NXN E;  4WFT A;  2JVA A;  2M7Q A;  1N36 E;  3DJW A;  4BBY A;  1N32 E;  1X49 A;  2V86 A;  3MSW A;  1HR0 E;  1HNW E;  2CPN A;  4DV0 E;  4WPY A;  2DMY A;  3P1X A;  2NUE A;  4X62 E;  2NA2 A;  2DSY A;  2L2N A;  1RC7 A;  2VQE E;  3IWD A;  1ZBQ A;  2EZ6 A;  3HTX A;  2DB2 A;  2RS6 A;  2ODR C;  4X64 E;  2L2M A;  1X48 A;  3J7A G;  3J80 C;  2L8T A;  5CFF E;  1HNZ E;  2UXB E;  3H09 A;  4K0K E;  2ODR D;  1O0W A;  1WXR A;  4Q28 A;  4B3T E;  4LF5 E;  3LML A;  3VYY A;  2H36 X;  4LFA E;  2FTX B;  2V87 A;  2V85 A;  4WSP A;  4BMJ A;  4DUZ E;  1X47 A;  1WHN A;  5LMU E;  4B3S E;  3OTO E;  1I94 E;  2WZO A;  2FV4 B;  3HQ1 A;  3JU0 A;  2VE7 C;  4DV4 E;  2B7T A;  4JI5 E;  1DI2 A;  2LTS A;  1J5E E;  3ZOQ B;  5IT9 C;  4LF7 E;  5IWA E;  2M1S A;  4JV5 E;  2LRS A;  2UUB E;  4F9C B;  4LF6 E;  2LTR A;  1N34 E;  3DF6 A;  4DR2 E;  3T1H E;  2MDR A;  4P7D A;  4DV1 E;  4I8O A;  2V83 A;  2YZT A;  4DR1 E;  4AQY E;  2L92 A;  1STU A;  2G7H A;  1FKA E;  2B9D A;  2HHH E;  2K4V A;  4DR5 E;  4JI3 E;  2L3C A;  2V88 A;  5DNY A;  1XNR E;  5F3W A;  1J26 A;  4TUI A;  2F8B A;  2KHX A;  2E1M A;  3AUZ A;  4X8W A;  4P78 A;  4F9A B;  2ZM6 E;  1YYO A;  2UXD E;  4OOG C;  4YHH E;  4DV2 E;  4DMI A;  4M2Z A;  3LLH A;  5AE1 A;  3HPS A;  1EKZ A;  4JI6 E;  3K6Q A;  4DUY E;  2N3G A;  4DV3 E;  1GZ6 A;  1IBK E;  3IWC A;  4L8N A;  5ADZ A;  3JAM C;  1SR9 A;  2L3J A;  3KWR A;  3VK6 A;  3F6H A;  1RQ0 A;  2EWL A;  2V8Q B;  4BCA A;  1YYK A;  2RSM A;  4LTY A;  2JOB A;  3FIG A;  4YY3 E;  1FJG E;  4JI2 E;  2MC6 A;  2JOX A;  5AE3 A;  2LUQ A;  4WYQ B;  4JI7 E;  4DR3 E;  4BC7 A;  2NUF A;  2E5L E;  3J81 C;  3ADI A;  1T4N A;  2UUC E;  3IWB A;  2LE2 A;  2LBS B;  4LFB E;  1QU6 A;  3F6G A;  4TUG A;  2LMZ A;  3T1Y E;  1N33 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...