1ZR9A

Solution structure of a human c2h2-type zinc finger protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
67
structure length
67
Chain Sequence
DPNAEFDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 593
publication title The solution structure of ZNF593 from Homo sapiens reveals a zinc finger in a predominantly unstructured protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 16
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1zr9A00
1B69A 4GZNC 2EOSA 2EMAA 2EPPA 2EN7A 2CSHA 2EN4A 2YRHA 3MHHC 2WBSA 2LCEA 2EOFA 1UBDC 2DGCA 2YRMA 3EPKA 1A1FA 2EN2A 4R2CA 1YUJA 2DLKA 4R2RA 2EMLA 2WCC3 1A1IA 2EPUA 2D9HA 2EN3A 2EQ1A 2EM0A 5KL2A 1X3CA 1WJPA 5KL4A 5KL6A 3EPLA 4F2JC 3EPHA 3MHSC 2HGHA 2WBUA 2EQ3A 2LT7A 2EPAA 1ZU1A 2YTOA 4R2AA 2YSPA 2YTGA 1TN9A 1A1JA 1X5WA 2EM6A 2E72A 2YU5A 2I13A 2RSIA 1P47A 2LV2A 2EOYA 4WSGA 1JK1A 2EMCA 1AAYA 1NCSA 2EMWA 2EOHA 2R1FA 2EQ0A 2EP3A 2VRDA 4R2PA 1BBOA 2EMIA 1RMDA 2YTJA 2ELYA 2EN6A 2EM5A 1TF6A 2EMGA 2YRKA 2YTQA 1X6HA 2ADRA 2EL5A 2EN1A 5KL5A 1BB8A 2LO3A 2EOEA 2EOOA 2EOMA 1A1HA 2ENAA 2ENCA 2YTEA 4R2QA 2EE8A 2YSOA 2GLIA 1Z1BA 2J7JA 2EM7A 2EMYA 2EOZA 1TF3A 2YTDA 2EM9A 2YTIA 1MEYC 2MKNA 2CTDA 1YUIA 2YTPA 2EOQA 2EPXA 4R2SA 2MKDA 2EPCA 2EORA 2EM8A 2LVHA 4IS1C 4F6MA 3EPJA 1JK2A 1DGCA 2DLQA 1A1LA 2BB8A 2EPRA 1ZR9A 2EMZA 2EJ4A 3UK3C 1G2FC 2CT1A 2EL6A 2EMKA 2EM2A 2RPCA 1X6EA 2YTNA 2MDGA 2M9AA 1LLMC 2EOIA 2JP9A 1UN6B 2EOJA 4FK5C 2DMIA 2EM4A 3M99B 1F2IG 1A1GA 2EMFA 2EN8A 2JPAA 2EMXA 4M9VC 2YU8A 1A1KA 2ELZA 4IJDA 2WBTA 1ZAAC 2EOXA 2GHFA 1G2DC 1YSAC 4X9JA 2NABA 2PRTA 3VHTB 2DRPA 2EL4A 2A25A 2YTFA 1KJKA 2EM3A 1X6FA 4R2DA 2EMHA 2ENHA 5KL7A 4F6NA 5KL3A 4R2EA 2EPZA 2EMBA
chains in the Genus database with same CATH superfamily
1HR0E 4WPYA 1IBKE 2DGCA 3OTOE 3EPKA 2JXPA 1A1FA 2LUQA 1YUJA 2WCC3 1A1IA 4KWYA 1N32E 3EPLA 3EPHA 4X8WA 4DR1E 1ZU1A 4R2AA 2B7VA 1BBGA 2YTGA 1A1JA 3KZYA 3J80C 2EM6A 2YT4A 2IHR1 1WHNA 1P47A 5IT9C 2LV2A 1GTKA 4BC9A 1AAYA 2EOHA 1SFEA 3C6KA 2B7TA 1T4OA 4B3SE 2EM5A 5F3WA 2RQLA 2YTQA 1QU6A 3BGHA 2JYAA 2L8TA 5LLQA 4ZYGA 1DQ3A 5A6AA 5KL5A 4WXDA 2GLIA 2YTEA 3EQ1A 1Z1BA 2EOZA 2M1SA 3HPZA 4DV0E 2LTRA 2N3HA 4DUZE 3VK6A 2EOQA 2EPXA 2MKDA 1X48A 3RMPA 1XMQE 1YFHA 4IS1C 4JYAE 1YYWA 4ZYHA 5LL6R 1A1LA 4DV7E 1IBME 2BB8A 4O5GA 1ZR9A 4JI7E 4BMJA 5AE1A 3UK3C 1G2FC 5A6JA 4F9AB 2EM2A 2RPCA 4J8ZA 2LTSA 2EOIA 2DMIA 3M99B 1F2IG 2EMXA 3ZOQB 4YHHE 4M9VC 1A1KA 2NUFA 2WBTA 4WYQB 1UILA 1QNTA 2L2MA 2EOXA 2GHFA 1YSAC 1L4SA 2R76A 2YTFA 1KJKA 2JY9A 2EM3A 2Q8UA 2L92A 3THOB 2N3GA 2YZTA 2EWLA 1FKAE 2EPZA 1BBOA 1T38A 1B69A 2VF1A 4GZNC 2I9IA 2EN7A 2CSHA 2EN4A 3MHHC 1UBDC 2L33A 4DV3E 1IQSA 2E1MA 2YPNA 3ADIA 4WX9A 2M7QA 4DR2E 4NXME 2EN3A 1X3CA 4BS9A 2B9DA 2N8XA 5KL6A 4F2JC 4JV5E 3MHSC 4BHCA 2HGHA 3OMLA 2WBUA 2EQ3A 4BHBA 2YSPA 4WFTA 4TUGA 2JOBA 4DV1E 4MLVA 2NA2A 3TQMA 2E72A 2YU5A 2I13A 2WZOA 1RC7A 4MLQA 2L2KB 2EOYA 4LF6E 4WSGA 3HQ1A 1PJTA 2F4VE 4LFBE 1NCSA 2R1FA 2V86A 2EP3A 5A6KA 4ZYDA 2LJHA 4P78A 5A69A 2V89A 4B3RE 2HC5A 4DR4E 2B3TB 2VQEE 1RMDA 3HTXA 4I8OA 2NUEA 3JAMC 1IQOA 1STUA 1X6HA 1PKPA 5LMUE 2EL5A 2V83A 2LO3A 1T4LB 2EOEA 4N4RB 1PJQA 1SR9A 4WSPA 4R2QA 4DV6E 2YSOA 2UUAE 2UXDE 5IV8B 1TF3A 2YTDA 5ADZA 4DV2E 3QG5C 4RH8A 4DKKA 1MEYC 4R2SA 2KONA 2EORA 2KHXA 2LVHA 1DI2A 5TSEA 3VYYA 3ECRA 4L8NA 3IWCA 3ADGA 4P7DA 1JK2A 1DGCA 2CT1A 2EL6A 3KWRA 3L00A 1J5EE 3LMLA 2YTNA 5CFFE 4JI2E 4X65E 4FK5C 2EM4A 2UUCE 4O24A 2YU8A 4GKJE 2LBSB 1N36E 4X64E 1G2DC 3F6HA 4JI8E 4HEIA 4M2ZA 2PRTA 5A6BD 2ZM6E 2EL4A 3J7AG 2A25A 1GQEA 1X6FA 2EMHA 2ENHA 4F6NA 4JI0E 4R2EA 2EMBA 2RS7A 1XNQE 5AE3A 2EPPA 4NXNE 5BR8E 4DV4E 2FGGA 4F54A 1WXRA 5AC4A 4LU9A 1EH7A 2DB2A 4DV5E 5FLXC 4R2CA 1XMOE 2LUPB 4R2RA 2EPUA 4M0VA 4KZSA 2L3CA 2EQ1A 2EM0A 4L5NC 1HNWE 4JI6E 1YPNA 2HHHE 1N34E 2H36X 2EPAA 1N3GA 2YTOA 4LF4E 1TN9A 2K4VA 2L6MA 1X5WA 1MGTA 2RSIA 4LFAE 1J26A 2RS6A 4OOGC 2EPNA 2EMCA 1JK1A 5DNYA 2ODRD 3P1XA 4NZVA 3H09A 4X62E 2E5LE 5A2QC 2BBGA 4Q28A 3AV0A 2EN6A 2UXBE 1TF6A 3J7Yp 2YRKA 3C6MA 2LRSA 2MDRA 2UXCE 2DIXA 2MC6A 2EOMA 5T6JA 2ODRC 2UUBE 4LF7E 1I94E 2EMYA 1EH6A 3F6GA 1YZ9A 1O0WA 2YTIA 1YYOA 3HPSA 1RQ0A 4BC7A 2MKNA 2CTDA 1YUIA 3FIGA 2GPIA 4JI4E 2LE2A 3J81C 1IBLE 4BBYA 1EH8A 4F6MA 4ZYEA 2EZ6A 2DLQA 3KZZA 2EPRA 2EJ4A 2MC5A 2EMKA 5AASA 4DR7E 3MSWA 1X6EA 2MDGA 2M9AA 1LLMC 2L2NA 2VQFE 1EKZA 1ZBTA 1PJSA 1X49A 2EN8A 2FV4B 1IMUA 4F9CB 4IJDA 1UHZA 2KOUA 3T1YE 1X47A 4X9JA 2JVAA 2RSMA 1GZ6A 2V87A 5IXMB 5AC5A 4GKKE 4YY3E 4BCAA 4R2DA 2JOXA 2V8QB 5KL7A 4LTYA 4DR5E 3ADLA 5KL3A 4B3TE 4B3ME 2EOSA 2EMAA 3C4TA 2YWQA 3T1HE 2YRHA 2EPMX 4OX9E 2WBSA 2LCEA 2EOFA 2M4IA 4WXCA 2YRMA 2L3JA 1ZBQA 2EN2A 4HTGA 4KHPE 1XNRE 2JWOA 2F8BA 2DLKA 2EMLA 4TUIA 1FJGE 5A6BA 4O4KA 2D9HA 4LF8E 1HNXE 5KL2A 1WJPA 5KL4A 4NHRA 4R03A 2LT7A 3BF2A 3VYXA 2EPOA 1WHQA 3DF6A 1PDAA 2V85A 3C4BA 2V88A 4Q35B 4DR3E 2EMWA 3JTZA 2EQ0A 2VRDA 4R2PA 2EMIA 3HXLA 3K6QA 4R8OA 2YTJA 2ELYA 2K7IA 2EMGA 3ADJA 2RTXA 4LFCE 2EPKX 2ADRA 4DMIA 1HNZE 2EN1A 1BB8A 2EOOA 2JR1A 1A1HA 2ENAA 2ENCA 2EE8A 2J7JA 2EM7A 2UU9E 1T4NA 4RHBB 2LMZA 2EM9A 3AUZA 2EPLX 3BIDA 4GEQB 2YTPA 3LLHA 2EPCA 1N33E 2EM8A 1YYKA 4DUYE 2LJUA 4AQYE 3BBGA 4O43A 3EPJA 2CPNA 5LMNE 1NEIA 1T39A 2EMZA 3DJWA 2VE7C 2DSYA 2G7HA 5IWAE 4LF5E 4LF9E 2FTXB 2JP9A 1UN6B 2EOJA 4JI5E 4F9BB 1A1GA 2JPAA 2EMFA 2ELZA 4X66E 1ZAAC 2HJJA 3JU0A 2NABA 3VHTB 2DRPA 4M30A 4DR6E 1AH5A 3IWDA 1KYQA 2NUGA 5AE2A 3THNA 4JI1E 4JI3E 1WRJA 3IWBA 2DMYA 4K0KE
chains in the Genus database with same CATH topology
1B69A 4GZNC 2EOSA 2EMAA 2EPPA 2EN7A 2CSHA 2EN4A 2YRHA 3MHHC 2WBSA 2LCEA 2EOFA 1UBDC 2DGCA 2YRMA 3EPKA 1A1FA 2EN2A 4R2CA 1YUJA 2DLKA 4R2RA 2EMLA 2WCC3 1A1IA 2EPUA 2D9HA 2EN3A 2EQ1A 2EM0A 5KL2A 1X3CA 1WJPA 5KL4A 5KL6A 3EPLA 4F2JC 3EPHA 3MHSC 2HGHA 2WBUA 2EQ3A 2LT7A 2EPAA 1ZU1A 2YTOA 4R2AA 2YSPA 2YTGA 1TN9A 1A1JA 1X5WA 2EM6A 2E72A 2YU5A 2I13A 2RSIA 1P47A 2LV2A 2EOYA 4WSGA 1JK1A 2EMCA 1AAYA 1NCSA 2EMWA 2EOHA 2R1FA 2EQ0A 2EP3A 2VRDA 4R2PA 1BBOA 2EMIA 1RMDA 2YTJA 2ELYA 2EN6A 2EM5A 1TF6A 2EMGA 2YRKA 2YTQA 1X6HA 2ADRA 2EL5A 2EN1A 5KL5A 1BB8A 2LO3A 2EOEA 2EOOA 2EOMA 1A1HA 2ENAA 2ENCA 2YTEA 4R2QA 2EE8A 2YSOA 2GLIA 1Z1BA 2J7JA 2EM7A 2EMYA 2EOZA 1TF3A 2YTDA 2EM9A 2YTIA 1MEYC 2MKNA 2CTDA 1YUIA 2YTPA 2EOQA 2EPXA 4R2SA 2MKDA 2EPCA 2EORA 2EM8A 2LVHA 4IS1C 4F6MA 3EPJA 1JK2A 1DGCA 2DLQA 1A1LA 2BB8A 2EPRA 1ZR9A 2EMZA 2EJ4A 3UK3C 1G2FC 2CT1A 2EL6A 2EMKA 2EM2A 2RPCA 1X6EA 2YTNA 2MDGA 2M9AA 1LLMC 2EOIA 2JP9A 1UN6B 2EOJA 4FK5C 2DMIA 2EM4A 3M99B 1F2IG 1A1GA 2EMFA 2EN8A 2JPAA 2EMXA 4M9VC 2YU8A 1A1KA 2ELZA 4IJDA 2WBTA 1ZAAC 2EOXA 2GHFA 1G2DC 1YSAC 4X9JA 2NABA 2PRTA 3VHTB 2DRPA 2EL4A 2A25A 2YTFA 1KJKA 2EM3A 1X6FA 4R2DA 2EMHA 2ENHA 5KL7A 4F6NA 5KL3A 4R2EA 2EPZA 2EMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B69 A;  4GZN C;  2EOS A;  2EMA A;  2EPP A;  2EN7 A;  2CSH A;  2EN4 A;  2YRH A;  3MHH C;  2WBS A;  2LCE A;  2EOF A;  1UBD C;  2DGC A;  2YRM A;  3EPK A;  1A1F A;  2EN2 A;  4R2C A;  1YUJ A;  2DLK A;  4R2R A;  2EML A;  2WCC 3;  1A1I A;  2EPU A;  2D9H A;  2EN3 A;  2EQ1 A;  2EM0 A;  5KL2 A;  1X3C A;  1WJP A;  5KL4 A;  5KL6 A;  3EPL A;  4F2J C;  3EPH A;  3MHS C;  2HGH A;  2WBU A;  2EQ3 A;  2LT7 A;  2EPA A;  1ZU1 A;  2YTO A;  4R2A A;  2YSP A;  2YTG A;  1TN9 A;  1A1J A;  1X5W A;  2EM6 A;  2E72 A;  2YU5 A;  2I13 A;  2RSI A;  1P47 A;  2LV2 A;  2EOY A;  4WSG A;  1JK1 A;  2EMC A;  1AAY A;  1NCS A;  2EMW A;  2EOH A;  2R1F A;  2EQ0 A;  2EP3 A;  2VRD A;  4R2P A;  1BBO A;  2EMI A;  1RMD A;  2YTJ A;  2ELY A;  2EN6 A;  2EM5 A;  1TF6 A;  2EMG A;  2YRK A;  2YTQ A;  1X6H A;  2ADR A;  2EL5 A;  2EN1 A;  5KL5 A;  1BB8 A;  2LO3 A;  2EOE A;  2EOO A;  2EOM A;  1A1H A;  2ENA A;  2ENC A;  2YTE A;  4R2Q A;  2EE8 A;  2YSO A;  2GLI A;  1Z1B A;  2J7J A;  2EM7 A;  2EMY A;  2EOZ A;  1TF3 A;  2YTD A;  2EM9 A;  2YTI A;  1MEY C;  2MKN A;  2CTD A;  1YUI A;  2YTP A;  2EOQ A;  2EPX A;  4R2S A;  2MKD A;  2EPC A;  2EOR A;  2EM8 A;  2LVH A;  4IS1 C;  4F6M A;  3EPJ A;  1JK2 A;  1DGC A;  2DLQ A;  1A1L A;  2BB8 A;  2EPR A;  1ZR9 A;  2EMZ A;  2EJ4 A;  3UK3 C;  1G2F C;  2CT1 A;  2EL6 A;  2EMK A;  2EM2 A;  2RPC A;  1X6E A;  2YTN A;  2MDG A;  2M9A A;  1LLM C;  2EOI A;  2JP9 A;  1UN6 B;  2EOJ A;  4FK5 C;  2DMI A;  2EM4 A;  3M99 B;  1F2I G;  1A1G A;  2EMF A;  2EN8 A;  2JPA A;  2EMX A;  4M9V C;  2YU8 A;  1A1K A;  2ELZ A;  4IJD A;  2WBT A;  1ZAA C;  2EOX A;  2GHF A;  1G2D C;  1YSA C;  4X9J A;  2NAB A;  2PRT A;  3VHT B;  2DRP A;  2EL4 A;  2A25 A;  2YTF A;  1KJK A;  2EM3 A;  1X6F A;  4R2D A;  2EMH A;  2ENH A;  5KL7 A;  4F6N A;  5KL3 A;  4R2E A;  2EPZ A;  2EMB A; 
#chains in the Genus database with same CATH topology
 1HR0 E;  4WPY A;  1IBK E;  2DGC A;  3OTO E;  3EPK A;  2JXP A;  1A1F A;  2LUQ A;  1YUJ A;  2WCC 3;  1A1I A;  4KWY A;  1N32 E;  3EPL A;  3EPH A;  4X8W A;  4DR1 E;  1ZU1 A;  4R2A A;  2B7V A;  1BBG A;  2YTG A;  1A1J A;  3KZY A;  3J80 C;  2EM6 A;  2YT4 A;  2IHR 1;  1WHN A;  1P47 A;  5IT9 C;  2LV2 A;  1GTK A;  4BC9 A;  1AAY A;  2EOH A;  1SFE A;  3C6K A;  2B7T A;  1T4O A;  4B3S E;  2EM5 A;  5F3W A;  2RQL A;  2YTQ A;  1QU6 A;  3BGH A;  2JYA A;  2L8T A;  5LLQ A;  4ZYG A;  1DQ3 A;  5A6A A;  5KL5 A;  4WXD A;  2GLI A;  2YTE A;  3EQ1 A;  1Z1B A;  2EOZ A;  2M1S A;  3HPZ A;  4DV0 E;  2LTR A;  2N3H A;  4DUZ E;  3VK6 A;  2EOQ A;  2EPX A;  2MKD A;  1X48 A;  3RMP A;  1XMQ E;  1YFH A;  4IS1 C;  4JYA E;  1YYW A;  4ZYH A;  5LL6 R;  1A1L A;  4DV7 E;  1IBM E;  2BB8 A;  4O5G A;  1ZR9 A;  4JI7 E;  4BMJ A;  5AE1 A;  3UK3 C;  1G2F C;  5A6J A;  4F9A B;  2EM2 A;  2RPC A;  4J8Z A;  2LTS A;  2EOI A;  2DMI A;  3M99 B;  1F2I G;  2EMX A;  3ZOQ B;  4YHH E;  4M9V C;  1A1K A;  2NUF A;  2WBT A;  4WYQ B;  1UIL A;  1QNT A;  2L2M A;  2EOX A;  2GHF A;  1YSA C;  1L4S A;  2R76 A;  2YTF A;  1KJK A;  2JY9 A;  2EM3 A;  2Q8U A;  2L92 A;  3THO B;  2N3G A;  2YZT A;  2EWL A;  1FKA E;  2EPZ A;  1BBO A;  1T38 A;  1B69 A;  2VF1 A;  4GZN C;  2I9I A;  2EN7 A;  2CSH A;  2EN4 A;  3MHH C;  1UBD C;  2L33 A;  4DV3 E;  1IQS A;  2E1M A;  2YPN A;  3ADI A;  4WX9 A;  2M7Q A;  4DR2 E;  4NXM E;  2EN3 A;  1X3C A;  4BS9 A;  2B9D A;  2N8X A;  5KL6 A;  4F2J C;  4JV5 E;  3MHS C;  4BHC A;  2HGH A;  3OML A;  2WBU A;  2EQ3 A;  4BHB A;  2YSP A;  4WFT A;  4TUG A;  2JOB A;  4DV1 E;  4MLV A;  2NA2 A;  3TQM A;  2E72 A;  2YU5 A;  2I13 A;  2WZO A;  1RC7 A;  4MLQ A;  2L2K B;  2EOY A;  4LF6 E;  4WSG A;  3HQ1 A;  1PJT A;  2F4V E;  4LFB E;  1NCS A;  2R1F A;  2V86 A;  2EP3 A;  5A6K A;  4ZYD A;  2LJH A;  4P78 A;  5A69 A;  2V89 A;  4B3R E;  2HC5 A;  4DR4 E;  2B3T B;  2VQE E;  1RMD A;  3HTX A;  4I8O A;  2NUE A;  3JAM C;  1IQO A;  1STU A;  1X6H A;  1PKP A;  5LMU E;  2EL5 A;  2V83 A;  2LO3 A;  1T4L B;  2EOE A;  4N4R B;  1PJQ A;  1SR9 A;  4WSP A;  4R2Q A;  4DV6 E;  2YSO A;  2UUA E;  2UXD E;  5IV8 B;  1TF3 A;  2YTD A;  5ADZ A;  4DV2 E;  3QG5 C;  4RH8 A;  4DKK A;  1MEY C;  4R2S A;  2KON A;  2EOR A;  2KHX A;  2LVH A;  1DI2 A;  5TSE A;  3VYY A;  3ECR A;  4L8N A;  3IWC A;  3ADG A;  4P7D A;  1JK2 A;  1DGC A;  2CT1 A;  2EL6 A;  3KWR A;  3L00 A;  1J5E E;  3LML A;  2YTN A;  5CFF E;  4JI2 E;  4X65 E;  4FK5 C;  2EM4 A;  2UUC E;  4O24 A;  2YU8 A;  4GKJ E;  2LBS B;  1N36 E;  4X64 E;  1G2D C;  3F6H A;  4JI8 E;  4HEI A;  4M2Z A;  2PRT A;  5A6B D;  2ZM6 E;  2EL4 A;  3J7A G;  2A25 A;  1GQE A;  1X6F A;  2EMH A;  2ENH A;  4F6N A;  4JI0 E;  4R2E A;  2EMB A;  2RS7 A;  1XNQ E;  5AE3 A;  2EPP A;  4NXN E;  5BR8 E;  4DV4 E;  2FGG A;  4F54 A;  1WXR A;  5AC4 A;  4LU9 A;  1EH7 A;  2DB2 A;  4DV5 E;  5FLX C;  4R2C A;  1XMO E;  2LUP B;  4R2R A;  2EPU A;  4M0V A;  4KZS A;  2L3C A;  2EQ1 A;  2EM0 A;  4L5N C;  1HNW E;  4JI6 E;  1YPN A;  2HHH E;  1N34 E;  2H36 X;  2EPA A;  1N3G A;  2YTO A;  4LF4 E;  1TN9 A;  2K4V A;  2L6M A;  1X5W A;  1MGT A;  2RSI A;  4LFA E;  1J26 A;  2RS6 A;  4OOG C;  2EPN A;  2EMC A;  1JK1 A;  5DNY A;  2ODR D;  3P1X A;  4NZV A;  3H09 A;  4X62 E;  2E5L E;  5A2Q C;  2BBG A;  4Q28 A;  3AV0 A;  2EN6 A;  2UXB E;  1TF6 A;  3J7Y p;  2YRK A;  3C6M A;  2LRS A;  2MDR A;  2UXC E;  2DIX A;  2MC6 A;  2EOM A;  5T6J A;  2ODR C;  2UUB E;  4LF7 E;  1I94 E;  2EMY A;  1EH6 A;  3F6G A;  1YZ9 A;  1O0W A;  2YTI A;  1YYO A;  3HPS A;  1RQ0 A;  4BC7 A;  2MKN A;  2CTD A;  1YUI A;  3FIG A;  2GPI A;  4JI4 E;  2LE2 A;  3J81 C;  1IBL E;  4BBY A;  1EH8 A;  4F6M A;  4ZYE A;  2EZ6 A;  2DLQ A;  3KZZ A;  2EPR A;  2EJ4 A;  2MC5 A;  2EMK A;  5AAS A;  4DR7 E;  3MSW A;  1X6E A;  2MDG A;  2M9A A;  1LLM C;  2L2N A;  2VQF E;  1EKZ A;  1ZBT A;  1PJS A;  1X49 A;  2EN8 A;  2FV4 B;  1IMU A;  4F9C B;  4IJD A;  1UHZ A;  2KOU A;  3T1Y E;  1X47 A;  4X9J A;  2JVA A;  2RSM A;  1GZ6 A;  2V87 A;  5IXM B;  5AC5 A;  4GKK E;  4YY3 E;  4BCA A;  4R2D A;  2JOX A;  2V8Q B;  5KL7 A;  4LTY A;  4DR5 E;  3ADL A;  5KL3 A;  4B3T E;  4B3M E;  2EOS A;  2EMA A;  3C4T A;  2YWQ A;  3T1H E;  2YRH A;  2EPM X;  4OX9 E;  2WBS A;  2LCE A;  2EOF A;  2M4I A;  4WXC A;  2YRM A;  2L3J A;  1ZBQ A;  2EN2 A;  4HTG A;  4KHP E;  1XNR E;  2JWO A;  2F8B A;  2DLK A;  2EML A;  4TUI A;  1FJG E;  5A6B A;  4O4K A;  2D9H A;  4LF8 E;  1HNX E;  5KL2 A;  1WJP A;  5KL4 A;  4NHR A;  4R03 A;  2LT7 A;  3BF2 A;  3VYX A;  2EPO A;  1WHQ A;  3DF6 A;  1PDA A;  2V85 A;  3C4B A;  2V88 A;  4Q35 B;  4DR3 E;  2EMW A;  3JTZ A;  2EQ0 A;  2VRD A;  4R2P A;  2EMI A;  3HXL A;  3K6Q A;  4R8O A;  2YTJ A;  2ELY A;  2K7I A;  2EMG A;  3ADJ A;  2RTX A;  4LFC E;  2EPK X;  2ADR A;  4DMI A;  1HNZ E;  2EN1 A;  1BB8 A;  2EOO A;  2JR1 A;  1A1H A;  2ENA A;  2ENC A;  2EE8 A;  2J7J A;  2EM7 A;  2UU9 E;  1T4N A;  4RHB B;  2LMZ A;  2EM9 A;  3AUZ A;  2EPL X;  3BID A;  4GEQ B;  2YTP A;  3LLH A;  2EPC A;  1N33 E;  2EM8 A;  1YYK A;  4DUY E;  2LJU A;  4AQY E;  3BBG A;  4O43 A;  3EPJ A;  2CPN A;  5LMN E;  1NEI A;  1T39 A;  2EMZ A;  3DJW A;  2VE7 C;  2DSY A;  2G7H A;  5IWA E;  4LF5 E;  4LF9 E;  2FTX B;  2JP9 A;  1UN6 B;  2EOJ A;  4JI5 E;  4F9B B;  1A1G A;  2JPA A;  2EMF A;  2ELZ A;  4X66 E;  1ZAA C;  2HJJ A;  3JU0 A;  2NAB A;  3VHT B;  2DRP A;  4M30 A;  4DR6 E;  1AH5 A;  3IWD A;  1KYQ A;  2NUG A;  5AE2 A;  3THN A;  4JI1 E;  4JI3 E;  1WRJ A;  3IWB A;  2DMY A;  4K0K E; 
#chains in the Genus database with same CATH homology
 1B69 A;  4GZN C;  2EOS A;  2EMA A;  2EPP A;  2EN7 A;  2CSH A;  2EN4 A;  2YRH A;  3MHH C;  2WBS A;  2LCE A;  2EOF A;  1UBD C;  2DGC A;  2YRM A;  3EPK A;  1A1F A;  2EN2 A;  4R2C A;  1YUJ A;  2DLK A;  4R2R A;  2EML A;  2WCC 3;  1A1I A;  2EPU A;  2D9H A;  2EN3 A;  2EQ1 A;  2EM0 A;  5KL2 A;  1X3C A;  1WJP A;  5KL4 A;  5KL6 A;  3EPL A;  4F2J C;  3EPH A;  3MHS C;  2HGH A;  2WBU A;  2EQ3 A;  2LT7 A;  2EPA A;  1ZU1 A;  2YTO A;  4R2A A;  2YSP A;  2YTG A;  1TN9 A;  1A1J A;  1X5W A;  2EM6 A;  2E72 A;  2YU5 A;  2I13 A;  2RSI A;  1P47 A;  2LV2 A;  2EOY A;  4WSG A;  1JK1 A;  2EMC A;  1AAY A;  1NCS A;  2EMW A;  2EOH A;  2R1F A;  2EQ0 A;  2EP3 A;  2VRD A;  4R2P A;  1BBO A;  2EMI A;  1RMD A;  2YTJ A;  2ELY A;  2EN6 A;  2EM5 A;  1TF6 A;  2EMG A;  2YRK A;  2YTQ A;  1X6H A;  2ADR A;  2EL5 A;  2EN1 A;  5KL5 A;  1BB8 A;  2LO3 A;  2EOE A;  2EOO A;  2EOM A;  1A1H A;  2ENA A;  2ENC A;  2YTE A;  4R2Q A;  2EE8 A;  2YSO A;  2GLI A;  1Z1B A;  2J7J A;  2EM7 A;  2EMY A;  2EOZ A;  1TF3 A;  2YTD A;  2EM9 A;  2YTI A;  1MEY C;  2MKN A;  2CTD A;  1YUI A;  2YTP A;  2EOQ A;  2EPX A;  4R2S A;  2MKD A;  2EPC A;  2EOR A;  2EM8 A;  2LVH A;  4IS1 C;  4F6M A;  3EPJ A;  1JK2 A;  1DGC A;  2DLQ A;  1A1L A;  2BB8 A;  2EPR A;  1ZR9 A;  2EMZ A;  2EJ4 A;  3UK3 C;  1G2F C;  2CT1 A;  2EL6 A;  2EMK A;  2EM2 A;  2RPC A;  1X6E A;  2YTN A;  2MDG A;  2M9A A;  1LLM C;  2EOI A;  2JP9 A;  1UN6 B;  2EOJ A;  4FK5 C;  2DMI A;  2EM4 A;  3M99 B;  1F2I G;  1A1G A;  2EMF A;  2EN8 A;  2JPA A;  2EMX A;  4M9V C;  2YU8 A;  1A1K A;  2ELZ A;  4IJD A;  2WBT A;  1ZAA C;  2EOX A;  2GHF A;  1G2D C;  1YSA C;  4X9J A;  2NAB A;  2PRT A;  3VHT B;  2DRP A;  2EL4 A;  2A25 A;  2YTF A;  1KJK A;  2EM3 A;  1X6F A;  4R2D A;  2EMH A;  2ENH A;  5KL7 A;  4F6N A;  5KL3 A;  4R2E A;  2EPZ A;  2EMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...