1ZR9A

Solution structure of a human c2h2-type zinc finger protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
67
structure length
67
Chain Sequence
DPNAEFDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 593
publication title The solution structure of ZNF593 from Homo sapiens reveals a zinc finger in a predominantly unstructured protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1zr9A00
3EPLA 2EPUA 2EN7A 5KL3A 2LVHA 1BBOA 5KL2A 4R2CA 2EP3A 2YTNA 2YTJA 4GZNC 1A1JA 1ZR9A 2YRMA 2EMBA 2EOHA 4R2AA 1UBDC 4R2EA 1LLMC 2YTPA 2CSHA 5KL4A 2EOYA 1G2FC 2EM5A 2J7JA 3MHHC 3VHTB 1A1HA 2NABA 1YSAC 2EM8A 2YU5A 2WCC3 2JP9A 1Z1BA 3UK3C 2HGHA 2GHFA 2LCEA 2CTDA 1ZAAC 2EOQA 2ENAA 2YTDA 2EQ0A 2EM3A 2ADRA 2YSPA 2EQ3A 2VRDA 2YTEA 3M99B 2WBUA 3EPHA 1YUIA 1KJKA 2EQ1A 1P47A 2EOEA 2YSOA 4M9VC 5KL6A 2YTIA 4F2JC 4R2SA 2EN4A 2EPCA 2EN8A 4FK5C 2MKNA 1TF6A 2EPPA 2YRKA 1ZU1A 2RPCA 5KL7A 4X9JA 2EMZA 4IJDA 2CT1A 1X6FA 3MHSC 2DMIA 2EM6A 1B69A 3EPKA 2EL6A 2EOSA 4R2PA 1WJPA 2EMIA 2EOJA 2E72A 2MDGA 4F6MA 2YTGA 5KL5A 1MEYC 2DRPA 1BB8A 2MKDA 2EMHA 4F6NA 1X5WA 2D9HA 4R2QA 2EJ4A 2YTQA 2WBTA 2LO3A 1DGCA 2LT7A 2EM0A 2YTOA 2A25A 1A1LA 2EPXA 2EOIA 2JPAA 2EMKA 2DLQA 2EPZA 2EMFA 2YRHA 4WSGA 1JK1A 2PRTA 1X3CA 2EN2A 2EN1A 2EPRA 2DGCA 2YU8A 2DLKA 4R2DA 2EM2A 2EM4A 2ENHA 2I13A 2ELZA 2EMGA 2EN6A 2WBSA 1G2DC 2EOXA 2YTFA 2GLIA 1F2IG 3EPJA 1UN6B 4IS1C 2EN3A 2EMWA 2LV2A 1X6HA 2R1FA 1A1KA 1A1IA 1TF3A 1NCSA 2EM7A 2EE8A 1A1GA 2RSIA 2EMCA 2EOOA 2EPAA 1RMDA 2EM9A 2ELYA 2EORA 2EL4A 2EOMA 1A1FA 1AAYA 1YUJA 2BB8A 1JK2A 1TN9A 1X6EA 2EL5A 2EMAA 2EMXA 2ENCA 4R2RA 2EMLA 2M9AA 2EOFA 2EOZA 2EMYA
chains in the Genus database with same CATH superfamily
1YFHA 4LF8E 1X48A 4AQYE 4R2CA 4DR4E 3MSWA 1J5EE 4LFCE 2EMBA 4NZVA 1WHNA 5CFFE 1XMOE 1FKAE 2DSYA 1LLMC 1AH5A 5LLQA 1NEIA 2EOYA 5A69A 5IT9C 1G2FC 4B3SE 4WXCA 2LE2A 3MHHC 4NXNE 1FJGE 3ADGA 2YU5A 3HPZA 1QU6A 3UK3C 2L33A 2LCEA 2CTDA 1ZAAC 2EOQA 2ENAA 2EPOA 2EM3A 3C6KA 3IWCA 2NUFA 2EPKX 2ODRC 2UXDE 2YTEA 3HQ1A 1KJKA 1PDAA 1YUIA 5ADZA 4YY3E 2YSOA 4M9VC 2YTIA 2N3HA 1QNTA 2EN8A 4FK5C 3THNA 2MKNA 4JI0E 2EPPA 2RS6A 2YRKA 3EQ1A 1SFEA 2CT1A 2YPNA 4DKKA 2MC6A 2DMIA 4JI1E 3EPKA 3ADIA 2EMIA 4DV5E 1XNQE 2EOJA 2E72A 1WRJA 2MDGA 2RS7A 4M30A 2R76A 1J26A 4JI6E 2MKDA 4WXDA 2RSMA 2EMHA 1X5WA 2D9HA 2EJ4A 3HPSA 1GQEA 4GEQB 4X65E 4DR7E 2EPXA 2L6MA 1IBKE 2L2KB 4DV6E 4WFTA 2UUBE 2EPZA 2JR1A 2LBSB 2V89A 1X3CA 2YT4A 4O4KA 3LLHA 2WZOA 4GKJE 2GPIA 1UILA 4R2DA 3BIDA 4JI2E 3C6MA 2I13A 1IMUA 2EN6A 1X47A 2I9IA 1G2DC 5A6BA 4MLVA 2GLIA 1F2IG 5T6JA 3J7AG 4R8OA 1A1KA 3P1XA 5IXMB 5A2QC 2EPAA 2N8XA 3DF6A 4BHBA 2EM9A 3BF2A 2KHXA 1YUJA 2BB8A 1HNWE 1PJSA 3T1HE 4DUYE 2L3JA 2EOFA 4LFBE 1WHQA 3TQMA 1T4OA 4WX9A 4JYAE 2EP3A 2YRMA 4Q28A 2LTRA 2EOHA 5TSEA 1WXRA 5AE1A 3J81C 1T4NA 2YTPA 2CSHA 5LMNE 5KL4A 4HEIA 3IWBA 1A1HA 3VK6A 2NABA 2JP9A 3KWRA 2YWQA 4KWYA 2HGHA 2V85A 4MLQA 4JI8E 2JOXA 4F9BB 5AC5A 2DIXA 2YSPA 2VRDA 3M99B 4DV3E 2HHHE 1P47A 5KL6A 4X64E 2NUGA 4R03A 1YYWA 4X9JA 2RPCA 4IJDA 4BCAA 1I94E 4R2PA 1WJPA 1DI2A 2V8QB 4J8ZA 4BC9A 4F6MA 2YTGA 1BB8A 4ZYHA 1UHZA 1IBME 3ECRA 4LTYA 4O24A 2LO3A 2RTXA 1DGCA 1N33E 4M2ZA 2VQEE 2EOIA 2BBGA 2EWLA 4DV0E 4P78A 1JK1A 4F54A 2PRTA 2EN2A 2DGCA 4N4RB 2M1SA 3F6HA 5LL6R 2YU8A 2L2MA 1YYKA 2ENHA 2LTSA 2CPNA 2ELZA 2YTFA 4BS9A 3EPJA 4IS1C 2EN3A 2EMWA 4JV5E 2K7IA 2JWOA 2UU9E 4HTGA 2EM7A 2F4VE 3RMPA 4NXME 2EOOA 2UUCE 2ELYA 4DV2E 2EOMA 3J80C 2EPNA 1AAYA 1STUA 3ADLA 1TN9A 2RQLA 1X6EA 2EPLX 2EL5A 2EMAA 3QG5C 5A6BD 2V88A 2JVAA 2M9AA 2EOZA 4LF5E 2EN7A 1BBOA 2EPMX 5KL2A 4YHHE 2YTNA 4GZNC 2UXBE 2DB2A 5IWAE 4LU9A 4O43A 4LF4E 4JI5E 4KHPE 1YYOA 1SR9A 4DR1E 4WPYA 4DV1E 2B9DA 2EM5A 2J7JA 1YSAC 2EM8A 4BMJA 2WCC3 1Z1BA 2VF1A 1T39A 1PKPA 5A6JA 3KZYA 2WBUA 3EPHA 1RQ0A 2FTXB 2EOEA 2IHR1 2EN4A 2EPCA 3AV0A 1IBLE 4DR2E 1GZ6A 1MGTA 1RC7A 5AE2A 3C4BA 1ZU1A 5KL7A 3IWDA 4TUGA 2EMZA 3MHSC 2MC5A 4DR5E 3BGHA 5AC4A 1XMQE 2EOSA 1HNXE 1T4LB 2DRPA 5KL5A 1N32E 4R2QA 4F9CB 2YTQA 3ADJA 2ODRD 4BHCA 4DMIA 4L5NC 2FV4B 2WBTA 2LUPB 1KYQA 2MDRA 2JOBA 2DMYA 2M4IA 5IV8B 3L00A 2JPAA 4DV4E 4WYQB 3BBGA 2EMKA 3H09A 4RHBB 2EMFA 3DJWA 2B7VA 1GTKA 4ZYEA 5BR8E 2UXCE 4LF9E 2EN1A 1EH7A 2EPRA 5A6KA 2Q8UA 2EM4A 2FGGA 2B3TB 4Q35B 1X49A 2V87A 4X62E 2LV2A 2R1FA 4GKKE 1L4SA 3AUZA 3F6GA 1A1IA 1TF3A 2HC5A 4X66E 1EKZA 1DQ3A 2RSIA 2NUEA 4LF7E 3C4TA 4RH8A 2EL4A 1A1FA 1JK2A 5DNYA 4B3RE 1ZBQA 2G7HA 4K0KE 2UUAE 2ENCA 4I8OA 2L8TA 2VE7C 1T38A 2EMLA 4M0VA 4B3TE 3EPLA 2EPUA 5KL3A 2LVHA 4LFAE 2E5LE 1YZ9A 2LJHA 4DR3E 2YTJA 1A1JA 2LRSA 1N36E 1ZR9A 2B7TA 5FLXC 3HTXA 3LMLA 3KZZA 2L2NA 4BBYA 4R2AA 1N34E 4R2EA 1UBDC 3JU0A 2L3CA 4ZYGA 1IQSA 3VHTB 1ZBTA 3OMLA 2M7QA 2E1MA 2GHFA 3JAMC 4O5GA 4L8NA 4ZYDA 2YTDA 2EQ0A 2KOUA 2ADRA 1O0WA 2EQ3A 2H36X 1HR0E 2EQ1A 4F2JC 4R2SA 1IQOA 2JY9A 4JI4E 1TF6A 4TUIA 1X6FA 2EM6A 1B69A 2LJUA 2EL6A 4JI3E 3FIGA 2HJJA 1MEYC 4X8WA 4F6NA 2N3GA 5LMUE 1EH6A 1HNZE 5AASA 3OTOE 2LT7A 2EM0A 2YTOA 2V83A 2A25A 2LMZA 4LF6E 4NHRA 3J7Yp 2DLQA 2YRHA 4WSGA 4F9AB 2JXPA 3HXLA 4JI7E 1XNRE 4KZSA 4DR6E 1BBGA 2YZTA 2V86A 4BC7A 1PJTA 4P7DA 5A6AA 2DLKA 2EM2A 2EMGA 2WBSA 1EH8A 2VQFE 2EOXA 1UN6B 4B3ME 2K4VA 4OX9E 5F3WA 2ZM6E 1X6HA 2L92A 3JTZA 2KONA 1NCSA 2NA2A 3VYYA 2EE8A 3THOB 3K6QA 1A1GA 2EMCA 1RMDA 2EORA 3T1YE 1PJQA 5AE3A 1YPNA 4DV7E 2EZ6A 1N3GA 2LUQA 2F8BA 4WSPA 2JYAA 3ZOQB 2EMXA 4OOGC 4R2RA 1A1LA 4DUZE 2EMYA 3VYXA
chains in the Genus database with same CATH topology
3EPLA 2EPUA 2EN7A 5KL3A 2LVHA 1BBOA 5KL2A 4R2CA 2EP3A 2YTNA 2YTJA 4GZNC 1A1JA 1ZR9A 2YRMA 2EMBA 2EOHA 4R2AA 1UBDC 4R2EA 1LLMC 2YTPA 2CSHA 5KL4A 2EOYA 1G2FC 2EM5A 2J7JA 3MHHC 3VHTB 1A1HA 2NABA 1YSAC 2EM8A 2YU5A 2WCC3 2JP9A 1Z1BA 3UK3C 2HGHA 2GHFA 2LCEA 2CTDA 1ZAAC 2EOQA 2ENAA 2YTDA 2EQ0A 2EM3A 2ADRA 2YSPA 2EQ3A 2VRDA 2YTEA 3M99B 2WBUA 3EPHA 1YUIA 1KJKA 2EQ1A 1P47A 2EOEA 2YSOA 4M9VC 5KL6A 2YTIA 4F2JC 4R2SA 2EN4A 2EPCA 2EN8A 4FK5C 2MKNA 1TF6A 2EPPA 2YRKA 1ZU1A 2RPCA 5KL7A 4X9JA 2EMZA 4IJDA 2CT1A 1X6FA 3MHSC 2DMIA 2EM6A 1B69A 3EPKA 2EL6A 2EOSA 4R2PA 1WJPA 2EMIA 2EOJA 2E72A 2MDGA 4F6MA 2YTGA 5KL5A 1MEYC 2DRPA 1BB8A 2MKDA 2EMHA 4F6NA 1X5WA 2D9HA 4R2QA 2EJ4A 2YTQA 2WBTA 2LO3A 1DGCA 2LT7A 2EM0A 2YTOA 2A25A 1A1LA 2EPXA 2EOIA 2JPAA 2EMKA 2DLQA 2EPZA 2EMFA 2YRHA 4WSGA 1JK1A 2PRTA 1X3CA 2EN2A 2EN1A 2EPRA 2DGCA 2YU8A 2DLKA 4R2DA 2EM2A 2EM4A 2ENHA 2I13A 2ELZA 2EMGA 2EN6A 2WBSA 1G2DC 2EOXA 2YTFA 2GLIA 1F2IG 3EPJA 1UN6B 4IS1C 2EN3A 2EMWA 2LV2A 1X6HA 2R1FA 1A1KA 1A1IA 1TF3A 1NCSA 2EM7A 2EE8A 1A1GA 2RSIA 2EMCA 2EOOA 2EPAA 1RMDA 2EM9A 2ELYA 2EORA 2EL4A 2EOMA 1A1FA 1AAYA 1YUJA 2BB8A 1JK2A 1TN9A 1X6EA 2EL5A 2EMAA 2EMXA 2ENCA 4R2RA 2EMLA 2M9AA 2EOFA 2EOZA 2EMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EPL A;  2EPU A;  2EN7 A;  5KL3 A;  2LVH A;  1BBO A;  5KL2 A;  4R2C A;  2EP3 A;  2YTN A;  2YTJ A;  4GZN C;  1A1J A;  1ZR9 A;  2YRM A;  2EMB A;  2EOH A;  4R2A A;  1UBD C;  4R2E A;  1LLM C;  2YTP A;  2CSH A;  5KL4 A;  2EOY A;  1G2F C;  2EM5 A;  2J7J A;  3MHH C;  3VHT B;  1A1H A;  2NAB A;  1YSA C;  2EM8 A;  2YU5 A;  2WCC 3;  2JP9 A;  1Z1B A;  3UK3 C;  2HGH A;  2GHF A;  2LCE A;  2CTD A;  1ZAA C;  2EOQ A;  2ENA A;  2YTD A;  2EQ0 A;  2EM3 A;  2ADR A;  2YSP A;  2EQ3 A;  2VRD A;  2YTE A;  3M99 B;  2WBU A;  3EPH A;  1YUI A;  1KJK A;  2EQ1 A;  1P47 A;  2EOE A;  2YSO A;  4M9V C;  5KL6 A;  2YTI A;  4F2J C;  4R2S A;  2EN4 A;  2EPC A;  2EN8 A;  4FK5 C;  2MKN A;  1TF6 A;  2EPP A;  2YRK A;  1ZU1 A;  2RPC A;  5KL7 A;  4X9J A;  2EMZ A;  4IJD A;  2CT1 A;  1X6F A;  3MHS C;  2DMI A;  2EM6 A;  1B69 A;  3EPK A;  2EL6 A;  2EOS A;  4R2P A;  1WJP A;  2EMI A;  2EOJ A;  2E72 A;  2MDG A;  4F6M A;  2YTG A;  5KL5 A;  1MEY C;  2DRP A;  1BB8 A;  2MKD A;  2EMH A;  4F6N A;  1X5W A;  2D9H A;  4R2Q A;  2EJ4 A;  2YTQ A;  2WBT A;  2LO3 A;  1DGC A;  2LT7 A;  2EM0 A;  2YTO A;  2A25 A;  1A1L A;  2EPX A;  2EOI A;  2JPA A;  2EMK A;  2DLQ A;  2EPZ A;  2EMF A;  2YRH A;  4WSG A;  1JK1 A;  2PRT A;  1X3C A;  2EN2 A;  2EN1 A;  2EPR A;  2DGC A;  2YU8 A;  2DLK A;  4R2D A;  2EM2 A;  2EM4 A;  2ENH A;  2I13 A;  2ELZ A;  2EMG A;  2EN6 A;  2WBS A;  1G2D C;  2EOX A;  2YTF A;  2GLI A;  1F2I G;  3EPJ A;  1UN6 B;  4IS1 C;  2EN3 A;  2EMW A;  2LV2 A;  1X6H A;  2R1F A;  1A1K A;  1A1I A;  1TF3 A;  1NCS A;  2EM7 A;  2EE8 A;  1A1G A;  2RSI A;  2EMC A;  2EOO A;  2EPA A;  1RMD A;  2EM9 A;  2ELY A;  2EOR A;  2EL4 A;  2EOM A;  1A1F A;  1AAY A;  1YUJ A;  2BB8 A;  1JK2 A;  1TN9 A;  1X6E A;  2EL5 A;  2EMA A;  2EMX A;  2ENC A;  4R2R A;  2EML A;  2M9A A;  2EOF A;  2EOZ A;  2EMY A; 
#chains in the Genus database with same CATH topology
 1YFH A;  4LF8 E;  1X48 A;  4AQY E;  4R2C A;  4DR4 E;  3MSW A;  1J5E E;  4LFC E;  2EMB A;  4NZV A;  1WHN A;  5CFF E;  1XMO E;  1FKA E;  2DSY A;  1LLM C;  1AH5 A;  5LLQ A;  1NEI A;  2EOY A;  5A69 A;  5IT9 C;  1G2F C;  4B3S E;  4WXC A;  2LE2 A;  3MHH C;  4NXN E;  1FJG E;  3ADG A;  2YU5 A;  3HPZ A;  1QU6 A;  3UK3 C;  2L33 A;  2LCE A;  2CTD A;  1ZAA C;  2EOQ A;  2ENA A;  2EPO A;  2EM3 A;  3C6K A;  3IWC A;  2NUF A;  2EPK X;  2ODR C;  2UXD E;  2YTE A;  3HQ1 A;  1KJK A;  1PDA A;  1YUI A;  5ADZ A;  4YY3 E;  2YSO A;  4M9V C;  2YTI A;  2N3H A;  1QNT A;  2EN8 A;  4FK5 C;  3THN A;  2MKN A;  4JI0 E;  2EPP A;  2RS6 A;  2YRK A;  3EQ1 A;  1SFE A;  2CT1 A;  2YPN A;  4DKK A;  2MC6 A;  2DMI A;  4JI1 E;  3EPK A;  3ADI A;  2EMI A;  4DV5 E;  1XNQ E;  2EOJ A;  2E72 A;  1WRJ A;  2MDG A;  2RS7 A;  4M30 A;  2R76 A;  1J26 A;  4JI6 E;  2MKD A;  4WXD A;  2RSM A;  2EMH A;  1X5W A;  2D9H A;  2EJ4 A;  3HPS A;  1GQE A;  4GEQ B;  4X65 E;  4DR7 E;  2EPX A;  2L6M A;  1IBK E;  2L2K B;  4DV6 E;  4WFT A;  2UUB E;  2EPZ A;  2JR1 A;  2LBS B;  2V89 A;  1X3C A;  2YT4 A;  4O4K A;  3LLH A;  2WZO A;  4GKJ E;  2GPI A;  1UIL A;  4R2D A;  3BID A;  4JI2 E;  3C6M A;  2I13 A;  1IMU A;  2EN6 A;  1X47 A;  2I9I A;  1G2D C;  5A6B A;  4MLV A;  2GLI A;  1F2I G;  5T6J A;  3J7A G;  4R8O A;  1A1K A;  3P1X A;  5IXM B;  5A2Q C;  2EPA A;  2N8X A;  3DF6 A;  4BHB A;  2EM9 A;  3BF2 A;  2KHX A;  1YUJ A;  2BB8 A;  1HNW E;  1PJS A;  3T1H E;  4DUY E;  2L3J A;  2EOF A;  4LFB E;  1WHQ A;  3TQM A;  1T4O A;  4WX9 A;  4JYA E;  2EP3 A;  2YRM A;  4Q28 A;  2LTR A;  2EOH A;  5TSE A;  1WXR A;  5AE1 A;  3J81 C;  1T4N A;  2YTP A;  2CSH A;  5LMN E;  5KL4 A;  4HEI A;  3IWB A;  1A1H A;  3VK6 A;  2NAB A;  2JP9 A;  3KWR A;  2YWQ A;  4KWY A;  2HGH A;  2V85 A;  4MLQ A;  4JI8 E;  2JOX A;  4F9B B;  5AC5 A;  2DIX A;  2YSP A;  2VRD A;  3M99 B;  4DV3 E;  2HHH E;  1P47 A;  5KL6 A;  4X64 E;  2NUG A;  4R03 A;  1YYW A;  4X9J A;  2RPC A;  4IJD A;  4BCA A;  1I94 E;  4R2P A;  1WJP A;  1DI2 A;  2V8Q B;  4J8Z A;  4BC9 A;  4F6M A;  2YTG A;  1BB8 A;  4ZYH A;  1UHZ A;  1IBM E;  3ECR A;  4LTY A;  4O24 A;  2LO3 A;  2RTX A;  1DGC A;  1N33 E;  4M2Z A;  2VQE E;  2EOI A;  2BBG A;  2EWL A;  4DV0 E;  4P78 A;  1JK1 A;  4F54 A;  2PRT A;  2EN2 A;  2DGC A;  4N4R B;  2M1S A;  3F6H A;  5LL6 R;  2YU8 A;  2L2M A;  1YYK A;  2ENH A;  2LTS A;  2CPN A;  2ELZ A;  2YTF A;  4BS9 A;  3EPJ A;  4IS1 C;  2EN3 A;  2EMW A;  4JV5 E;  2K7I A;  2JWO A;  2UU9 E;  4HTG A;  2EM7 A;  2F4V E;  3RMP A;  4NXM E;  2EOO A;  2UUC E;  2ELY A;  4DV2 E;  2EOM A;  3J80 C;  2EPN A;  1AAY A;  1STU A;  3ADL A;  1TN9 A;  2RQL A;  1X6E A;  2EPL X;  2EL5 A;  2EMA A;  3QG5 C;  5A6B D;  2V88 A;  2JVA A;  2M9A A;  2EOZ A;  4LF5 E;  2EN7 A;  1BBO A;  2EPM X;  5KL2 A;  4YHH E;  2YTN A;  4GZN C;  2UXB E;  2DB2 A;  5IWA E;  4LU9 A;  4O43 A;  4LF4 E;  4JI5 E;  4KHP E;  1YYO A;  1SR9 A;  4DR1 E;  4WPY A;  4DV1 E;  2B9D A;  2EM5 A;  2J7J A;  1YSA C;  2EM8 A;  4BMJ A;  2WCC 3;  1Z1B A;  2VF1 A;  1T39 A;  1PKP A;  5A6J A;  3KZY A;  2WBU A;  3EPH A;  1RQ0 A;  2FTX B;  2EOE A;  2IHR 1;  2EN4 A;  2EPC A;  3AV0 A;  1IBL E;  4DR2 E;  1GZ6 A;  1MGT A;  1RC7 A;  5AE2 A;  3C4B A;  1ZU1 A;  5KL7 A;  3IWD A;  4TUG A;  2EMZ A;  3MHS C;  2MC5 A;  4DR5 E;  3BGH A;  5AC4 A;  1XMQ E;  2EOS A;  1HNX E;  1T4L B;  2DRP A;  5KL5 A;  1N32 E;  4R2Q A;  4F9C B;  2YTQ A;  3ADJ A;  2ODR D;  4BHC A;  4DMI A;  4L5N C;  2FV4 B;  2WBT A;  2LUP B;  1KYQ A;  2MDR A;  2JOB A;  2DMY A;  2M4I A;  5IV8 B;  3L00 A;  2JPA A;  4DV4 E;  4WYQ B;  3BBG A;  2EMK A;  3H09 A;  4RHB B;  2EMF A;  3DJW A;  2B7V A;  1GTK A;  4ZYE A;  5BR8 E;  2UXC E;  4LF9 E;  2EN1 A;  1EH7 A;  2EPR A;  5A6K A;  2Q8U A;  2EM4 A;  2FGG A;  2B3T B;  4Q35 B;  1X49 A;  2V87 A;  4X62 E;  2LV2 A;  2R1F A;  4GKK E;  1L4S A;  3AUZ A;  3F6G A;  1A1I A;  1TF3 A;  2HC5 A;  4X66 E;  1EKZ A;  1DQ3 A;  2RSI A;  2NUE A;  4LF7 E;  3C4T A;  4RH8 A;  2EL4 A;  1A1F A;  1JK2 A;  5DNY A;  4B3R E;  1ZBQ A;  2G7H A;  4K0K E;  2UUA E;  2ENC A;  4I8O A;  2L8T A;  2VE7 C;  1T38 A;  2EML A;  4M0V A;  4B3T E;  3EPL A;  2EPU A;  5KL3 A;  2LVH A;  4LFA E;  2E5L E;  1YZ9 A;  2LJH A;  4DR3 E;  2YTJ A;  1A1J A;  2LRS A;  1N36 E;  1ZR9 A;  2B7T A;  5FLX C;  3HTX A;  3LML A;  3KZZ A;  2L2N A;  4BBY A;  4R2A A;  1N34 E;  4R2E A;  1UBD C;  3JU0 A;  2L3C A;  4ZYG A;  1IQS A;  3VHT B;  1ZBT A;  3OML A;  2M7Q A;  2E1M A;  2GHF A;  3JAM C;  4O5G A;  4L8N A;  4ZYD A;  2YTD A;  2EQ0 A;  2KOU A;  2ADR A;  1O0W A;  2EQ3 A;  2H36 X;  1HR0 E;  2EQ1 A;  4F2J C;  4R2S A;  1IQO A;  2JY9 A;  4JI4 E;  1TF6 A;  4TUI A;  1X6F A;  2EM6 A;  1B69 A;  2LJU A;  2EL6 A;  4JI3 E;  3FIG A;  2HJJ A;  1MEY C;  4X8W A;  4F6N A;  2N3G A;  5LMU E;  1EH6 A;  1HNZ E;  5AAS A;  3OTO E;  2LT7 A;  2EM0 A;  2YTO A;  2V83 A;  2A25 A;  2LMZ A;  4LF6 E;  4NHR A;  3J7Y p;  2DLQ A;  2YRH A;  4WSG A;  4F9A B;  2JXP A;  3HXL A;  4JI7 E;  1XNR E;  4KZS A;  4DR6 E;  1BBG A;  2YZT A;  2V86 A;  4BC7 A;  1PJT A;  4P7D A;  5A6A A;  2DLK A;  2EM2 A;  2EMG A;  2WBS A;  1EH8 A;  2VQF E;  2EOX A;  1UN6 B;  4B3M E;  2K4V A;  4OX9 E;  5F3W A;  2ZM6 E;  1X6H A;  2L92 A;  3JTZ A;  2KON A;  1NCS A;  2NA2 A;  3VYY A;  2EE8 A;  3THO B;  3K6Q A;  1A1G A;  2EMC A;  1RMD A;  2EOR A;  3T1Y E;  1PJQ A;  5AE3 A;  1YPN A;  4DV7 E;  2EZ6 A;  1N3G A;  2LUQ A;  2F8B A;  4WSP A;  2JYA A;  3ZOQ B;  2EMX A;  4OOG C;  4R2R A;  1A1L A;  4DUZ E;  2EMY A;  3VYX A; 
#chains in the Genus database with same CATH homology
 3EPL A;  2EPU A;  2EN7 A;  5KL3 A;  2LVH A;  1BBO A;  5KL2 A;  4R2C A;  2EP3 A;  2YTN A;  2YTJ A;  4GZN C;  1A1J A;  1ZR9 A;  2YRM A;  2EMB A;  2EOH A;  4R2A A;  1UBD C;  4R2E A;  1LLM C;  2YTP A;  2CSH A;  5KL4 A;  2EOY A;  1G2F C;  2EM5 A;  2J7J A;  3MHH C;  3VHT B;  1A1H A;  2NAB A;  1YSA C;  2EM8 A;  2YU5 A;  2WCC 3;  2JP9 A;  1Z1B A;  3UK3 C;  2HGH A;  2GHF A;  2LCE A;  2CTD A;  1ZAA C;  2EOQ A;  2ENA A;  2YTD A;  2EQ0 A;  2EM3 A;  2ADR A;  2YSP A;  2EQ3 A;  2VRD A;  2YTE A;  3M99 B;  2WBU A;  3EPH A;  1YUI A;  1KJK A;  2EQ1 A;  1P47 A;  2EOE A;  2YSO A;  4M9V C;  5KL6 A;  2YTI A;  4F2J C;  4R2S A;  2EN4 A;  2EPC A;  2EN8 A;  4FK5 C;  2MKN A;  1TF6 A;  2EPP A;  2YRK A;  1ZU1 A;  2RPC A;  5KL7 A;  4X9J A;  2EMZ A;  4IJD A;  2CT1 A;  1X6F A;  3MHS C;  2DMI A;  2EM6 A;  1B69 A;  3EPK A;  2EL6 A;  2EOS A;  4R2P A;  1WJP A;  2EMI A;  2EOJ A;  2E72 A;  2MDG A;  4F6M A;  2YTG A;  5KL5 A;  1MEY C;  2DRP A;  1BB8 A;  2MKD A;  2EMH A;  4F6N A;  1X5W A;  2D9H A;  4R2Q A;  2EJ4 A;  2YTQ A;  2WBT A;  2LO3 A;  1DGC A;  2LT7 A;  2EM0 A;  2YTO A;  2A25 A;  1A1L A;  2EPX A;  2EOI A;  2JPA A;  2EMK A;  2DLQ A;  2EPZ A;  2EMF A;  2YRH A;  4WSG A;  1JK1 A;  2PRT A;  1X3C A;  2EN2 A;  2EN1 A;  2EPR A;  2DGC A;  2YU8 A;  2DLK A;  4R2D A;  2EM2 A;  2EM4 A;  2ENH A;  2I13 A;  2ELZ A;  2EMG A;  2EN6 A;  2WBS A;  1G2D C;  2EOX A;  2YTF A;  2GLI A;  1F2I G;  3EPJ A;  1UN6 B;  4IS1 C;  2EN3 A;  2EMW A;  2LV2 A;  1X6H A;  2R1F A;  1A1K A;  1A1I A;  1TF3 A;  1NCS A;  2EM7 A;  2EE8 A;  1A1G A;  2RSI A;  2EMC A;  2EOO A;  2EPA A;  1RMD A;  2EM9 A;  2ELY A;  2EOR A;  2EL4 A;  2EOM A;  1A1F A;  1AAY A;  1YUJ A;  2BB8 A;  1JK2 A;  1TN9 A;  1X6E A;  2EL5 A;  2EMA A;  2EMX A;  2ENC A;  4R2R A;  2EML A;  2M9A A;  2EOF A;  2EOZ A;  2EMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...