1ZR9A

Solution structure of a human c2h2-type zinc finger protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
67
structure length
67
Chain Sequence
DPNAEFDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 593
publication title The solution structure of ZNF593 from Homo sapiens reveals a zinc finger in a predominantly unstructured protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 16
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1zr9A00
1P47A 1UN6B 5KL2A 2EPUA 4WSGA 4R2SA 4R2DA 2EPPA 2ENHA 2EOMA 1A1KA 1UBDC 1Z1BA 2EOEA 2EOZA 2CSHA 2ADRA 2MDGA 2YU8A 4F2JC 2I13A 2EOHA 1A1IA 2YTIA 4X9JA 2EMXA 2YRKA 3UK3C 2EN4A 1WJPA 5KL5A 2WBTA 1RMDA 5KL7A 2EOJA 2LVHA 2LCEA 2E72A 4GZNC 2EOXA 4IS1C 2EM3A 1YUIA 2EM5A 1MEYC 2EM4A 2EMFA 2BB8A 2EQ3A 1A1JA 2EORA 2EPXA 2JP9A 1AAYA 2EL5A 2EM8A 2RSIA 2EOFA 2YRHA 2EPCA 2GLIA 2EE8A 2DGCA 1X6HA 2DLKA 2J7JA 2EMIA 2EN8A 1TN9A 1BB8A 3MHSC 2EN7A 2LV2A 2LO3A 4R2AA 3EPKA 4R2CA 3MHHC 2PRTA 2EQ1A 2YTNA 2NABA 1X6FA 2WBSA 4R2PA 2YTQA 1X6EA 2EOSA 2LT7A 1JK2A 2YTEA 1DGCA 2EOQA 2EQ0A 2YTFA 2EPAA 3EPJA 1TF6A 1A1HA 4FK5C 4R2RA 2A25A 2YTPA 2EM0A 2EMAA 3M99B 2YRMA 4M9VC 2EM9A 2YSOA 2JPAA 2ELZA 2ELYA 2EM6A 5KL6A 1A1FA 2EJ4A 2EN3A 2YSPA 2EMCA 2EOOA 2EMZA 2EN2A 5KL3A 1B69A 2WBUA 4F6MA 1BBOA 4R2QA 2DMIA 1ZU1A 2EMGA 2GHFA 2YTGA 4IJDA 1YSAC 1G2DC 2EOIA 4F6NA 2EMLA 5KL4A 2CT1A 1YUJA 2EMHA 2EN6A 2MKNA 1A1LA 2DLQA 1X3CA 1A1GA 2VRDA 2EMBA 2M9AA 1TF3A 4R2EA 2EM2A 2EMKA 3EPLA 1X5WA 1ZR9A 2EMYA 2YTOA 2ENCA 2ENAA 1JK1A 2CTDA 2EPZA 2R1FA 2DRPA 2EM7A 2YTJA 1F2IG 2EMWA 2EOYA 1G2FC 2EPRA 2HGHA 3VHTB 3EPHA 1KJKA 2WCC3 1ZAAC 1NCSA 2EL6A 2MKDA 2EL4A 1LLMC 2YU5A 2RPCA 2YTDA 2EP3A 2D9HA 2EN1A
chains in the Genus database with same CATH superfamily
4ZYDA 3F6HA 2EPUA 3F6GA 3JAMC 4F2JC 1PJSA 4K0KE 3ADGA 2LRSA 2ZM6E 2VQEE 1A1IA 3KZZA 4R8OA 3H09A 1N36E 3ADJA 5AC4A 1BBGA 2EN4A 5KL7A 4WXDA 3VYXA 2EOXA 2B7TA 3L00A 3HXLA 2FGGA 4Q28A 3AV0A 5A2QC 2EM4A 4JI2E 2BB8A 5IT9C 3AUZA 2LMZA 1WRJA 1GZ6A 2V88A 2KHXA 3C6KA 2DGCA 1X6HA 2DLKA 2YZTA 4BCAA 1BB8A 3ZOQB 1EKZA 2K7IA 3ADIA 4B3RE 4R2AA 4DR5E 4O24A 4R2CA 1PKPA 4HTGA 1HNXE 1EH7A 1X6FA 1KYQA 5LMUE 1X6EA 2LT7A 4GEQB 3BGHA 2VQFE 2EPAA 2E1MA 3IWDA 1WHQA 1ZBQA 2EM0A 4M9VC 4X66E 1X47A 2UXDE 1PJQA 2ELYA 5KL6A 2LTSA 4I8OA 2EJ4A 2EN3A 5ADZA 2YSPA 2B7VA 4B3ME 2ODRC 2EOOA 4LF5E 4P7DA 5KL3A 4L5NC 3T1HE 2EMGA 5A6AA 4JI8E 2JYAA 4N4RB 1G2DC 2EOIA 5KL4A 1XMOE 1YUJA 2MKNA 4RHBB 1YZ9A 2DLQA 1L4SA 3KZYA 3DF6A 4JI1E 1QU6A 1EH8A 2L2NA 1ZR9A 4DV7E 2ENCA 4DR7E 3T1YE 2CTDA 2EPZA 2EMWA 3C4BA 2HGHA 3EPHA 1T4NA 2NUFA 2M7QA 4BHBA 1QNTA 5A69A 4LFCE 1YYWA 5A6KA 2RS6A 2JR1A 1WXRA 4F9BB 4NXNE 3LMLA 1X49A 2HC5A 3THOB 1Z1BA 4JI6E 2EOZA 2CSHA 2ADRA 2MDGA 2YU8A 3P1XA 4JV5E 1T39A 2DIXA 2EOHA 4JI4E 4YY3E 2VE7C 5IV8B 5TSEA 2EMXA 5BR8E 2HJJA 3UK3C 4JI3E 4JI5E 2EPKX 5AE1A 2WBTA 3C4TA 4Q35B 2MC5A 1HR0E 2E72A 3DJWA 4ZYGA 2L6MA 4IS1C 1YPNA 2DSYA 4DUYE 1DQ3A 1MEYC 4BMJA 3BIDA 1HNWE 2EL5A 2EM8A 2RSIA 2EOFA 2YRHA 2EPLX 1YYKA 2GLIA 2EE8A 4KHPE 2DMYA 2JY9A 2EMIA 2EN8A 4WSPA 3HPSA 4GKJE 2EN7A 1IQOA 4LU9A 1EH6A 3KWRA 4WYQB 2B3TB 3MHHC 1J5EE 4DV5E 4JI7E 1N3GA 3J81C 2V89A 1PDAA 2YTEA 2EQ0A 2HHHE 1A1HA 2L3JA 4FK5C 3M99B 2YRMA 4M30A 2F4VE 3THNA 2ELZA 4BBYA 4MLVA 2JWOA 4HEIA 2EN2A 3HTXA 3IWBA 1BBOA 4R2QA 3MSWA 1AH5A 1ZU1A 4J8ZA 4NXME 1IBKE 2EMLA 2B9DA 3BF2A 2EN6A 2LJUA 1XNQE 4ZYEA 2JVAA 1T38A 1A1GA 2UUBE 2M9AA 1TF3A 2EPMX 2KONA 4R2EA 2EMKA 2L92A 2IHR1 1X5WA 2H36X 2I9IA 1I94E 5A6BA 2YTJA 2EOYA 1PJTA 3VHTB 3OTOE 2WCC3 1ZAAC 3JU0A 2EL4A 2YU5A 1O0WA 2EP3A 2D9HA 3K6QA 3HPZA 2YT4A 2EMAA 1P47A 3OMLA 1UN6B 1RQ0A 2N3HA 4WSGA 2EPNA 2V8QB 4DMIA 5AE3A 2ENHA 1UBDC 2N8XA 2EOEA 2I13A 4OOGC 2K4VA 4WXCA 2RTXA 1SFEA 4F9AB 2YTIA 3J80C 4X9JA 2YRKA 2WZOA 5KL5A 2RQLA 2CPNA 2LVHA 5LL6R 4GZNC 3J7Yp 2EM3A 1YUIA 1UILA 2EM5A 2E5LE 1NEIA 2FV4B 4YHHE 2M1SA 2EMFA 2EORA 2JP9A 1AAYA 3EQ1A 4AQYE 2EPCA 3BBGA 5AC5A 2J7JA 2JXPA 1TN9A 5A6BD 3JTZA 2GPIA 2PRTA 2LE2A 2NABA 2WBSA 4DV2E 2RSMA 1YYOA 2YTQA 1JK2A 1DGCA 1IBME 2YTFA 4MLQA 1TF6A 3C6MA 4DV3E 4R2RA 1IMUA 4TUGA 2LBSB 2YWQA 1HNZE 2EM9A 2LUPB 2V86A 2JPAA 2EM6A 1A1FA 3J7AG 1IQSA 4B3SE 2EMCA 2Q8UA 5LLQA 5FLXC 2WBUA 4F6MA 4O43A 2BBGA 4WX9A 2GHFA 2YTGA 2VF1A 2L2KB 2LTRA 4JYAE 4IJDA 1YSAC 2L3CA 5IXMB 4F6NA 2M4IA 1FJGE 3TQMA 2CT1A 2EMHA 4BC7A 1A1LA 1STUA 1X3CA 1YFHA 5LMNE 3EPLA 2EMYA 2YTOA 4DR2E 1N34E 4JI0E 1JK1A 2UXBE 2DRPA 2EPOA 2EM7A 1G2FC 4LF8E 1N32E 4X8WA 4GKKE 4KWYA 2G7HA 1KJKA 4OX9E 2EZ6A 4X64E 1T4LB 2YTDA 4ZYHA 2EN1A 2YSOA 4M2ZA 4DR1E 4TUIA 5KL2A 4R2SA 4R2DA 3IWCA 2EPPA 5AE2A 2KOUA 2FTXB 2EOMA 1A1KA 3ADLA 3QG5C 2RS7A 4O4KA 4BC9A 4X62E 1GTKA 4P78A 2LUQA 4LF9E 1WJPA 2NUGA 1RMDA 4DV0E 4DV1E 4L8NA 4WPYA 2EOJA 2LCEA 4F54A 2N3GA 4R03A 3RMPA 3ECRA 4B3TE 1SR9A 2EQ3A 1A1JA 4LF4E 2EPXA 2EWLA 4LFBE 1MGTA 4BHCA 2L8TA 2DB2A 2UXCE 2L33A 1X48A 4DKKA 1ZBTA 3MHSC 2LV2A 5A6JA 2UU9E 2LO3A 3EPKA 1DI2A 2JOBA 2EQ1A 2YTNA 3VK6A 4BS9A 1FKAE 4R2PA 2EOSA 2UUCE 2LJHA 2EOQA 1WHNA 3EPJA 4DV4E 3LLHA 4NZVA 2MDRA 4DV6E 2A25A 2NA2A 2YTPA 2V85A 4DR3E 4KZSA 5IWAE 4NHRA 5CFFE 1J26A 5F3WA 2ODRD 2YPNA 3VYYA 2EMZA 4LTYA 4RH8A 1B69A 5AASA 5DNYA 2DMIA 4O5GA 1N33E 4DR4E 3FIGA 2V83A 1GQEA 4WFTA 2MC6A 1XNRE 2UUAE 2VRDA 4LF7E 2EMBA 4DUZE 2NUEA 2R76A 2EM2A 4F9CB 2ENAA 5T6JA 2R1FA 2V87A 4M0VA 1F2IG 1T4OA 4DR6E 1XMQE 2EPRA 4X65E 2L2MA 3HQ1A 1NCSA 2EL6A 2MKDA 1LLMC 2RPCA 1RC7A 1IBLE 2JOXA 2F8BA 4LFAE 4LF6E 1UHZA
chains in the Genus database with same CATH topology
1P47A 1UN6B 5KL2A 2EPUA 4WSGA 4R2SA 4R2DA 2EPPA 2ENHA 2EOMA 1A1KA 1UBDC 1Z1BA 2EOEA 2EOZA 2CSHA 2ADRA 2MDGA 2YU8A 4F2JC 2I13A 2EOHA 1A1IA 2YTIA 4X9JA 2EMXA 2YRKA 3UK3C 2EN4A 1WJPA 5KL5A 2WBTA 1RMDA 5KL7A 2EOJA 2LVHA 2LCEA 2E72A 4GZNC 2EOXA 4IS1C 2EM3A 1YUIA 2EM5A 1MEYC 2EM4A 2EMFA 2BB8A 2EQ3A 1A1JA 2EORA 2EPXA 2JP9A 1AAYA 2EL5A 2EM8A 2RSIA 2EOFA 2YRHA 2EPCA 2GLIA 2EE8A 2DGCA 1X6HA 2DLKA 2J7JA 2EMIA 2EN8A 1TN9A 1BB8A 3MHSC 2EN7A 2LV2A 2LO3A 4R2AA 3EPKA 4R2CA 3MHHC 2PRTA 2EQ1A 2YTNA 2NABA 1X6FA 2WBSA 4R2PA 2YTQA 1X6EA 2EOSA 2LT7A 1JK2A 2YTEA 1DGCA 2EOQA 2EQ0A 2YTFA 2EPAA 3EPJA 1TF6A 1A1HA 4FK5C 4R2RA 2A25A 2YTPA 2EM0A 2EMAA 3M99B 2YRMA 4M9VC 2EM9A 2YSOA 2JPAA 2ELZA 2ELYA 2EM6A 5KL6A 1A1FA 2EJ4A 2EN3A 2YSPA 2EMCA 2EOOA 2EMZA 2EN2A 5KL3A 1B69A 2WBUA 4F6MA 1BBOA 4R2QA 2DMIA 1ZU1A 2EMGA 2GHFA 2YTGA 4IJDA 1YSAC 1G2DC 2EOIA 4F6NA 2EMLA 5KL4A 2CT1A 1YUJA 2EMHA 2EN6A 2MKNA 1A1LA 2DLQA 1X3CA 1A1GA 2VRDA 2EMBA 2M9AA 1TF3A 4R2EA 2EM2A 2EMKA 3EPLA 1X5WA 1ZR9A 2EMYA 2YTOA 2ENCA 2ENAA 1JK1A 2CTDA 2EPZA 2R1FA 2DRPA 2EM7A 2YTJA 1F2IG 2EMWA 2EOYA 1G2FC 2EPRA 2HGHA 3VHTB 3EPHA 1KJKA 2WCC3 1ZAAC 1NCSA 2EL6A 2MKDA 2EL4A 1LLMC 2YU5A 2RPCA 2YTDA 2EP3A 2D9HA 2EN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P47 A;  1UN6 B;  5KL2 A;  2EPU A;  4WSG A;  4R2S A;  4R2D A;  2EPP A;  2ENH A;  2EOM A;  1A1K A;  1UBD C;  1Z1B A;  2EOE A;  2EOZ A;  2CSH A;  2ADR A;  2MDG A;  2YU8 A;  4F2J C;  2I13 A;  2EOH A;  1A1I A;  2YTI A;  4X9J A;  2EMX A;  2YRK A;  3UK3 C;  2EN4 A;  1WJP A;  5KL5 A;  2WBT A;  1RMD A;  5KL7 A;  2EOJ A;  2LVH A;  2LCE A;  2E72 A;  4GZN C;  2EOX A;  4IS1 C;  2EM3 A;  1YUI A;  2EM5 A;  1MEY C;  2EM4 A;  2EMF A;  2BB8 A;  2EQ3 A;  1A1J A;  2EOR A;  2EPX A;  2JP9 A;  1AAY A;  2EL5 A;  2EM8 A;  2RSI A;  2EOF A;  2YRH A;  2EPC A;  2GLI A;  2EE8 A;  2DGC A;  1X6H A;  2DLK A;  2J7J A;  2EMI A;  2EN8 A;  1TN9 A;  1BB8 A;  3MHS C;  2EN7 A;  2LV2 A;  2LO3 A;  4R2A A;  3EPK A;  4R2C A;  3MHH C;  2PRT A;  2EQ1 A;  2YTN A;  2NAB A;  1X6F A;  2WBS A;  4R2P A;  2YTQ A;  1X6E A;  2EOS A;  2LT7 A;  1JK2 A;  2YTE A;  1DGC A;  2EOQ A;  2EQ0 A;  2YTF A;  2EPA A;  3EPJ A;  1TF6 A;  1A1H A;  4FK5 C;  4R2R A;  2A25 A;  2YTP A;  2EM0 A;  2EMA A;  3M99 B;  2YRM A;  4M9V C;  2EM9 A;  2YSO A;  2JPA A;  2ELZ A;  2ELY A;  2EM6 A;  5KL6 A;  1A1F A;  2EJ4 A;  2EN3 A;  2YSP A;  2EMC A;  2EOO A;  2EMZ A;  2EN2 A;  5KL3 A;  1B69 A;  2WBU A;  4F6M A;  1BBO A;  4R2Q A;  2DMI A;  1ZU1 A;  2EMG A;  2GHF A;  2YTG A;  4IJD A;  1YSA C;  1G2D C;  2EOI A;  4F6N A;  2EML A;  5KL4 A;  2CT1 A;  1YUJ A;  2EMH A;  2EN6 A;  2MKN A;  1A1L A;  2DLQ A;  1X3C A;  1A1G A;  2VRD A;  2EMB A;  2M9A A;  1TF3 A;  4R2E A;  2EM2 A;  2EMK A;  3EPL A;  1X5W A;  1ZR9 A;  2EMY A;  2YTO A;  2ENC A;  2ENA A;  1JK1 A;  2CTD A;  2EPZ A;  2R1F A;  2DRP A;  2EM7 A;  2YTJ A;  1F2I G;  2EMW A;  2EOY A;  1G2F C;  2EPR A;  2HGH A;  3VHT B;  3EPH A;  1KJK A;  2WCC 3;  1ZAA C;  1NCS A;  2EL6 A;  2MKD A;  2EL4 A;  1LLM C;  2YU5 A;  2RPC A;  2YTD A;  2EP3 A;  2D9H A;  2EN1 A; 
#chains in the Genus database with same CATH topology
 4ZYD A;  3F6H A;  2EPU A;  3F6G A;  3JAM C;  4F2J C;  1PJS A;  4K0K E;  3ADG A;  2LRS A;  2ZM6 E;  2VQE E;  1A1I A;  3KZZ A;  4R8O A;  3H09 A;  1N36 E;  3ADJ A;  5AC4 A;  1BBG A;  2EN4 A;  5KL7 A;  4WXD A;  3VYX A;  2EOX A;  2B7T A;  3L00 A;  3HXL A;  2FGG A;  4Q28 A;  3AV0 A;  5A2Q C;  2EM4 A;  4JI2 E;  2BB8 A;  5IT9 C;  3AUZ A;  2LMZ A;  1WRJ A;  1GZ6 A;  2V88 A;  2KHX A;  3C6K A;  2DGC A;  1X6H A;  2DLK A;  2YZT A;  4BCA A;  1BB8 A;  3ZOQ B;  1EKZ A;  2K7I A;  3ADI A;  4B3R E;  4R2A A;  4DR5 E;  4O24 A;  4R2C A;  1PKP A;  4HTG A;  1HNX E;  1EH7 A;  1X6F A;  1KYQ A;  5LMU E;  1X6E A;  2LT7 A;  4GEQ B;  3BGH A;  2VQF E;  2EPA A;  2E1M A;  3IWD A;  1WHQ A;  1ZBQ A;  2EM0 A;  4M9V C;  4X66 E;  1X47 A;  2UXD E;  1PJQ A;  2ELY A;  5KL6 A;  2LTS A;  4I8O A;  2EJ4 A;  2EN3 A;  5ADZ A;  2YSP A;  2B7V A;  4B3M E;  2ODR C;  2EOO A;  4LF5 E;  4P7D A;  5KL3 A;  4L5N C;  3T1H E;  2EMG A;  5A6A A;  4JI8 E;  2JYA A;  4N4R B;  1G2D C;  2EOI A;  5KL4 A;  1XMO E;  1YUJ A;  2MKN A;  4RHB B;  1YZ9 A;  2DLQ A;  1L4S A;  3KZY A;  3DF6 A;  4JI1 E;  1QU6 A;  1EH8 A;  2L2N A;  1ZR9 A;  4DV7 E;  2ENC A;  4DR7 E;  3T1Y E;  2CTD A;  2EPZ A;  2EMW A;  3C4B A;  2HGH A;  3EPH A;  1T4N A;  2NUF A;  2M7Q A;  4BHB A;  1QNT A;  5A69 A;  4LFC E;  1YYW A;  5A6K A;  2RS6 A;  2JR1 A;  1WXR A;  4F9B B;  4NXN E;  3LML A;  1X49 A;  2HC5 A;  3THO B;  1Z1B A;  4JI6 E;  2EOZ A;  2CSH A;  2ADR A;  2MDG A;  2YU8 A;  3P1X A;  4JV5 E;  1T39 A;  2DIX A;  2EOH A;  4JI4 E;  4YY3 E;  2VE7 C;  5IV8 B;  5TSE A;  2EMX A;  5BR8 E;  2HJJ A;  3UK3 C;  4JI3 E;  4JI5 E;  2EPK X;  5AE1 A;  2WBT A;  3C4T A;  4Q35 B;  2MC5 A;  1HR0 E;  2E72 A;  3DJW A;  4ZYG A;  2L6M A;  4IS1 C;  1YPN A;  2DSY A;  4DUY E;  1DQ3 A;  1MEY C;  4BMJ A;  3BID A;  1HNW E;  2EL5 A;  2EM8 A;  2RSI A;  2EOF A;  2YRH A;  2EPL X;  1YYK A;  2GLI A;  2EE8 A;  4KHP E;  2DMY A;  2JY9 A;  2EMI A;  2EN8 A;  4WSP A;  3HPS A;  4GKJ E;  2EN7 A;  1IQO A;  4LU9 A;  1EH6 A;  3KWR A;  4WYQ B;  2B3T B;  3MHH C;  1J5E E;  4DV5 E;  4JI7 E;  1N3G A;  3J81 C;  2V89 A;  1PDA A;  2YTE A;  2EQ0 A;  2HHH E;  1A1H A;  2L3J A;  4FK5 C;  3M99 B;  2YRM A;  4M30 A;  2F4V E;  3THN A;  2ELZ A;  4BBY A;  4MLV A;  2JWO A;  4HEI A;  2EN2 A;  3HTX A;  3IWB A;  1BBO A;  4R2Q A;  3MSW A;  1AH5 A;  1ZU1 A;  4J8Z A;  4NXM E;  1IBK E;  2EML A;  2B9D A;  3BF2 A;  2EN6 A;  2LJU A;  1XNQ E;  4ZYE A;  2JVA A;  1T38 A;  1A1G A;  2UUB E;  2M9A A;  1TF3 A;  2EPM X;  2KON A;  4R2E A;  2EMK A;  2L92 A;  2IHR 1;  1X5W A;  2H36 X;  2I9I A;  1I94 E;  5A6B A;  2YTJ A;  2EOY A;  1PJT A;  3VHT B;  3OTO E;  2WCC 3;  1ZAA C;  3JU0 A;  2EL4 A;  2YU5 A;  1O0W A;  2EP3 A;  2D9H A;  3K6Q A;  3HPZ A;  2YT4 A;  2EMA A;  1P47 A;  3OML A;  1UN6 B;  1RQ0 A;  2N3H A;  4WSG A;  2EPN A;  2V8Q B;  4DMI A;  5AE3 A;  2ENH A;  1UBD C;  2N8X A;  2EOE A;  2I13 A;  4OOG C;  2K4V A;  4WXC A;  2RTX A;  1SFE A;  4F9A B;  2YTI A;  3J80 C;  4X9J A;  2YRK A;  2WZO A;  5KL5 A;  2RQL A;  2CPN A;  2LVH A;  5LL6 R;  4GZN C;  3J7Y p;  2EM3 A;  1YUI A;  1UIL A;  2EM5 A;  2E5L E;  1NEI A;  2FV4 B;  4YHH E;  2M1S A;  2EMF A;  2EOR A;  2JP9 A;  1AAY A;  3EQ1 A;  4AQY E;  2EPC A;  3BBG A;  5AC5 A;  2J7J A;  2JXP A;  1TN9 A;  5A6B D;  3JTZ A;  2GPI A;  2PRT A;  2LE2 A;  2NAB A;  2WBS A;  4DV2 E;  2RSM A;  1YYO A;  2YTQ A;  1JK2 A;  1DGC A;  1IBM E;  2YTF A;  4MLQ A;  1TF6 A;  3C6M A;  4DV3 E;  4R2R A;  1IMU A;  4TUG A;  2LBS B;  2YWQ A;  1HNZ E;  2EM9 A;  2LUP B;  2V86 A;  2JPA A;  2EM6 A;  1A1F A;  3J7A G;  1IQS A;  4B3S E;  2EMC A;  2Q8U A;  5LLQ A;  5FLX C;  2WBU A;  4F6M A;  4O43 A;  2BBG A;  4WX9 A;  2GHF A;  2YTG A;  2VF1 A;  2L2K B;  2LTR A;  4JYA E;  4IJD A;  1YSA C;  2L3C A;  5IXM B;  4F6N A;  2M4I A;  1FJG E;  3TQM A;  2CT1 A;  2EMH A;  4BC7 A;  1A1L A;  1STU A;  1X3C A;  1YFH A;  5LMN E;  3EPL A;  2EMY A;  2YTO A;  4DR2 E;  1N34 E;  4JI0 E;  1JK1 A;  2UXB E;  2DRP A;  2EPO A;  2EM7 A;  1G2F C;  4LF8 E;  1N32 E;  4X8W A;  4GKK E;  4KWY A;  2G7H A;  1KJK A;  4OX9 E;  2EZ6 A;  4X64 E;  1T4L B;  2YTD A;  4ZYH A;  2EN1 A;  2YSO A;  4M2Z A;  4DR1 E;  4TUI A;  5KL2 A;  4R2S A;  4R2D A;  3IWC A;  2EPP A;  5AE2 A;  2KOU A;  2FTX B;  2EOM A;  1A1K A;  3ADL A;  3QG5 C;  2RS7 A;  4O4K A;  4BC9 A;  4X62 E;  1GTK A;  4P78 A;  2LUQ A;  4LF9 E;  1WJP A;  2NUG A;  1RMD A;  4DV0 E;  4DV1 E;  4L8N A;  4WPY A;  2EOJ A;  2LCE A;  4F54 A;  2N3G A;  4R03 A;  3RMP A;  3ECR A;  4B3T E;  1SR9 A;  2EQ3 A;  1A1J A;  4LF4 E;  2EPX A;  2EWL A;  4LFB E;  1MGT A;  4BHC A;  2L8T A;  2DB2 A;  2UXC E;  2L33 A;  1X48 A;  4DKK A;  1ZBT A;  3MHS C;  2LV2 A;  5A6J A;  2UU9 E;  2LO3 A;  3EPK A;  1DI2 A;  2JOB A;  2EQ1 A;  2YTN A;  3VK6 A;  4BS9 A;  1FKA E;  4R2P A;  2EOS A;  2UUC E;  2LJH A;  2EOQ A;  1WHN A;  3EPJ A;  4DV4 E;  3LLH A;  4NZV A;  2MDR A;  4DV6 E;  2A25 A;  2NA2 A;  2YTP A;  2V85 A;  4DR3 E;  4KZS A;  5IWA E;  4NHR A;  5CFF E;  1J26 A;  5F3W A;  2ODR D;  2YPN A;  3VYY A;  2EMZ A;  4LTY A;  4RH8 A;  1B69 A;  5AAS A;  5DNY A;  2DMI A;  4O5G A;  1N33 E;  4DR4 E;  3FIG A;  2V83 A;  1GQE A;  4WFT A;  2MC6 A;  1XNR E;  2UUA E;  2VRD A;  4LF7 E;  2EMB A;  4DUZ E;  2NUE A;  2R76 A;  2EM2 A;  4F9C B;  2ENA A;  5T6J A;  2R1F A;  2V87 A;  4M0V A;  1F2I G;  1T4O A;  4DR6 E;  1XMQ E;  2EPR A;  4X65 E;  2L2M A;  3HQ1 A;  1NCS A;  2EL6 A;  2MKD A;  1LLM C;  2RPC A;  1RC7 A;  1IBL E;  2JOX A;  2F8B A;  4LFA E;  4LF6 E;  1UHZ A; 
#chains in the Genus database with same CATH homology
 1P47 A;  1UN6 B;  5KL2 A;  2EPU A;  4WSG A;  4R2S A;  4R2D A;  2EPP A;  2ENH A;  2EOM A;  1A1K A;  1UBD C;  1Z1B A;  2EOE A;  2EOZ A;  2CSH A;  2ADR A;  2MDG A;  2YU8 A;  4F2J C;  2I13 A;  2EOH A;  1A1I A;  2YTI A;  4X9J A;  2EMX A;  2YRK A;  3UK3 C;  2EN4 A;  1WJP A;  5KL5 A;  2WBT A;  1RMD A;  5KL7 A;  2EOJ A;  2LVH A;  2LCE A;  2E72 A;  4GZN C;  2EOX A;  4IS1 C;  2EM3 A;  1YUI A;  2EM5 A;  1MEY C;  2EM4 A;  2EMF A;  2BB8 A;  2EQ3 A;  1A1J A;  2EOR A;  2EPX A;  2JP9 A;  1AAY A;  2EL5 A;  2EM8 A;  2RSI A;  2EOF A;  2YRH A;  2EPC A;  2GLI A;  2EE8 A;  2DGC A;  1X6H A;  2DLK A;  2J7J A;  2EMI A;  2EN8 A;  1TN9 A;  1BB8 A;  3MHS C;  2EN7 A;  2LV2 A;  2LO3 A;  4R2A A;  3EPK A;  4R2C A;  3MHH C;  2PRT A;  2EQ1 A;  2YTN A;  2NAB A;  1X6F A;  2WBS A;  4R2P A;  2YTQ A;  1X6E A;  2EOS A;  2LT7 A;  1JK2 A;  2YTE A;  1DGC A;  2EOQ A;  2EQ0 A;  2YTF A;  2EPA A;  3EPJ A;  1TF6 A;  1A1H A;  4FK5 C;  4R2R A;  2A25 A;  2YTP A;  2EM0 A;  2EMA A;  3M99 B;  2YRM A;  4M9V C;  2EM9 A;  2YSO A;  2JPA A;  2ELZ A;  2ELY A;  2EM6 A;  5KL6 A;  1A1F A;  2EJ4 A;  2EN3 A;  2YSP A;  2EMC A;  2EOO A;  2EMZ A;  2EN2 A;  5KL3 A;  1B69 A;  2WBU A;  4F6M A;  1BBO A;  4R2Q A;  2DMI A;  1ZU1 A;  2EMG A;  2GHF A;  2YTG A;  4IJD A;  1YSA C;  1G2D C;  2EOI A;  4F6N A;  2EML A;  5KL4 A;  2CT1 A;  1YUJ A;  2EMH A;  2EN6 A;  2MKN A;  1A1L A;  2DLQ A;  1X3C A;  1A1G A;  2VRD A;  2EMB A;  2M9A A;  1TF3 A;  4R2E A;  2EM2 A;  2EMK A;  3EPL A;  1X5W A;  1ZR9 A;  2EMY A;  2YTO A;  2ENC A;  2ENA A;  1JK1 A;  2CTD A;  2EPZ A;  2R1F A;  2DRP A;  2EM7 A;  2YTJ A;  1F2I G;  2EMW A;  2EOY A;  1G2F C;  2EPR A;  2HGH A;  3VHT B;  3EPH A;  1KJK A;  2WCC 3;  1ZAA C;  1NCS A;  2EL6 A;  2MKD A;  2EL4 A;  1LLM C;  2YU5 A;  2RPC A;  2YTD A;  2EP3 A;  2D9H A;  2EN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...