1ZR9A

Solution structure of a human c2h2-type zinc finger protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
67
structure length
67
Chain Sequence
b'DPNAEFDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 593
publication title The solution structure of ZNF593 from Homo sapiens reveals a zinc finger in a predominantly unstructured protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 16
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1zr9A00
4R2CA 4R2QA 2E72A 4F6MA 2EN3A 2YTEA 2ELZA 2YTPA 2EOYA 2RPCA 2EMIA 2MKNA 2YRMA 4FK5C 1TN9A 5KL7A 1YUJA 2EPUA 2JPAA 2EOFA 5KL2A 2EPCA 2MKDA 2YU5A 2EMHA 1YSAC 4M9VC 2YU8A 2DGCA 3EPHA 2EMBA 1ZAAC 2EN8A 2WBUA 1A1IA 2EOXA 1X5WA 2YTOA 1X6FA 2EMZA 2EORA 4F6NA 2EMWA 4X9JA 2YTQA 1ZU1A 2CSHA 2EOHA 1TF3A 2EQ1A 2EL4A 1A1LA 2JP9A 1RMDA 1UN6B 1BB8A 2VRDA 2MDGA 2EN4A 2BB8A 5KL4A 1DGCA 1NCSA 2EE8A 2EOQA 2EMCA 4R2PA 1A1KA 2YRHA 2R1FA 1A1JA 2ENCA 2HGHA 1JK1A 2EM0A 1JK2A 2EMGA 2LO3A 3EPLA 4IJDA 2LCEA 2ENAA 2EM7A 2EM4A 2YTJA 2EJ4A 2ADRA 4R2SA 1YUIA 1A1HA 1AAYA 2M9AA 2EOZA 1A1GA 2YTNA 2YSOA 2EN6A 2ELYA 2PRTA 2DLQA 2EMXA 1P47A 4WSGA 2EMLA 3M99B 3EPKA 3UK3C 1MEYC 3MHHC 2YTIA 2EPXA 2YTFA 2EL6A 2WBSA 2WBTA 2EOOA 2D9HA 2EPAA 4R2AA 2EN7A 1LLMC 2LVHA 2YRKA 3MHSC 2LV2A 2EQ0A 2WCC3 4R2DA 2EM9A 1X6EA 4R2RA 1G2FC 2NABA 2YTGA 2GHFA 2EQ3A 2EM5A 2EM8A 2EMYA 4R2EA 2EPZA 1BBOA 2YTDA 1F2IG 2ENHA 1ZR9A 2RSIA 2DMIA 1UBDC 1X6HA 2CTDA 2EN1A 2EPPA 2EOSA 2EN2A 2EOIA 2EP3A 1TF6A 2EMFA 2DLKA 2A25A 5KL5A 1KJKA 1A1FA 4GZNC 2EM6A 2J7JA 1B69A 2EM3A 2DRPA 4F2JC 2EL5A 2I13A 2YSPA 2EMAA 1X3CA 3VHTB 2GLIA 1G2DC 2EOMA 2EM2A 1WJPA 2EOEA 2EOJA 5KL3A 5KL6A 2LT7A 1Z1BA 2CT1A 2EPRA 2EMKA 3EPJA 4IS1C
chains in the Genus database with same CATH superfamily
3AV0A 3P1XA 4DV1E 2YTEA 4LU9A 2YTPA 2EOYA 2RPCA 2MKNA 3J7Yp 4BHBA 4LF4E 1ZBQA 2LBSB 2JPAA 2EOFA 4K0KE 2NUGA 5IWAE 1PDAA 4JI6E 2EPCA 2G7HA 3ZOQB 2DGCA 2EMBA 1ZAAC 2ZM6E 2WBUA 3EQ1A 4LF8E 1YYWA 1ZU1A 4F54A 5AE1A 2V8QB 2EQ1A 1A1LA 1RMDA 4WX9A 1BB8A 4F9AB 2YWQA 5TSEA 1SR9A 2EE8A 4ZYEA 5A6JA 2VQEE 3DF6A 2R1FA 2NUEA 4DUYE 2HGHA 1JK1A 2EM0A 4X66E 4M30A 2V89A 2EZ6A 2VQFE 4JI5E 3ADIA 5LMUE 2EM4A 3J80C 2ADRA 2MDRA 1A1HA 2YTNA 2EN6A 4BCAA 1P47A 4DV3E 2LUQA 3MHHC 4NHRA 2YPNA 4WXCA 2LUPB 2EN7A 2HJJA 2LVHA 3LMLA 1N34E 1HR0E 2EQ0A 1O0WA 2EM9A 3C6KA 3OTOE 1T38A 1BBOA 1I94E 2YTDA 3BF2A 1F2IG 4NXNE 4TUGA 1ZR9A 2RSIA 4WXDA 4WFTA 4BHCA 1X6HA 4DV6E 2EN2A 1XNQE 2EOIA 2EMFA 1KJKA 2ODRC 1A1FA 4GZNC 4BMJA 5A69A 1EH7A 2EM6A 4M0VA 2EM3A 4F2JC 3IWBA 4I8OA 4DUZE 4B3SE 1FJGE 4DR3E 3ECRA 4DV0E 4Q28A 1QU6A 3VHTB 2KONA 2EM2A 2EPMX 2EOJA 2L2MA 2L2NA 4B3RE 5A2QC 1X48A 4O24A 1N33E 2EMKA 4F6NA 3BIDA 1YFHA 3IWCA 4F6MA 2V88A 3FIGA 4GEQB 3DJWA 4P7DA 5AC4A 2F4VE 4DMIA 4B3ME 2JOXA 2VE7C 2L33A 4OX9E 1YSAC 4LF5E 3KWRA 4JI1E 4M9VC 4JI4E 3C4BA 4RH8A 2HHHE 4MLVA 3C4TA 1A1IA 2EOXA 1X5WA 1IBME 2EPLX 4LFBE 4L5NC 4R03A 3OMLA 2EORA 2JXPA 4X9JA 1XMOE 4KHPE 4YY3E 2UUAE 2EOHA 2HC5A 4TUIA 2EL4A 1STUA 1UN6B 1BBGA 2EN4A 2BB8A 2M1SA 5KL4A 4DR7E 1WRJA 2LJUA 1NCSA 1NEIA 1A1JA 3ADLA 2FGGA 1JK2A 2EMGA 5LMNE 2EWLA 4DKKA 2RS6A 1DI2A 4BC9A 2EM7A 5A6BD 4R2SA 1YUIA 4JYAE 2YSOA 1GQEA 2DLQA 2EMLA 2WZOA 3M99B 1MEYC 1IBLE 2EPXA 2EL6A 1PJTA 2EPAA 5LL6R 1XMQE 4ZYHA 3J81C 1N3GA 1EH8A 1X6EA 2NABA 2GHFA 2B3TB 2EMYA 1PJSA 1ZBTA 2JR1A 2V83A 2EPZA 2IHR1 4WSPA 1EH6A 4WPYA 2ENHA 2V87A 4BBYA 2JYAA 1J26A 1AH5A 2EN1A 4R8OA 5KL5A 1MGTA 1IMUA 3VYXA 2J7JA 3VK6A 2MC6A 2NA2A 2B7VA 2YSPA 1G2DC 3QG5C 1HNZE 2L92A 5AC5A 4KZSA 3AUZA 1FKAE 1DQ3A 2R76A 2CT1A 2E1MA 5BR8E 5ADZA 1N32E 1J5EE 4R2QA 2EPNA 2NUFA 4LF7E 2I9IA 2ELZA 3HPZA 3THOB 2EPKX 3VYYA 1TN9A 5FLXC 3BBGA 1RQ0A 2EPUA 3J7AG 4JI8E 5IT9C 4HTGA 2DSYA 2K4VA 2YU8A 3EPHA 3KZYA 2EN8A 3THNA 2GPIA 1X6FA 2L3JA 2LMZA 2EMWA 1SFEA 2YTQA 3RMPA 3IWDA 1X47A 5AE2A 1TF3A 1PKPA 4NZVA 2JP9A 4LF6E 1HNXE 1IQOA 2VRDA 1IBKE 1DGCA 4X8WA 1RC7A 2EOQA 2F8BA 4R2PA 3JAMC 1A1KA 1T4OA 2YRHA 2ENCA 5T6JA 2LO3A 3EPLA 2LCEA 3T1YE 2YTJA 3JU0A 4X64E 2M9AA 1A1GA 2UXDE 4DR2E 3HPSA 4JV5E 2EMXA 4WSGA 2YTIA 2RQLA 2YTFA 3F6GA 2MC5A 3HQ1A 4O43A 2VF1A 2WBSA 4GKKE 2WBTA 2D9HA 2RS7A 4L8NA 4O4KA 4R2AA 1YYKA 2YRKA 3HTXA 4HEIA 2WCC3 4R2DA 4R2RA 1UHZA 4BC7A 2N3GA 2EQ3A 2EM5A 4R2EA 4DV5E 2DMIA 4DV2E 2CTDA 2DB2A 1GTKA 2EPPA 2FV4B 2EOSA 4X65E 2DLKA 3ADJA 5LLQA 1WHNA 4RHBB 1B69A 2DMYA 2YZTA 2CPNA 4N4RB 2I13A 4F9BB 2GLIA 2B9DA 2EOMA 5F3WA 2EOEA 2KHXA 2UU9E 5KL6A 2LT7A 2LE2A 4DV7E 2YT4A 2M4IA 4DR6E 4GKJE 4R2CA 2E72A 2EN3A 2H36X 2N8XA 2L2KB 4BS9A 4WYQB 4AQYE 4ZYGA 3TQMA 1UILA 4OOGC 2EMIA 1WXRA 2YRMA 4FK5C 4NXME 1WHQA 3HXLA 1QNTA 4B3TE 1L4SA 4M2ZA 5KL7A 2JWOA 1YUJA 4P78A 3H09A 4JI7E 1N36E 2RSMA 5KL2A 4JI0E 2RTXA 2MKDA 2YU5A 2EMHA 2LJHA 1KYQA 5A6KA 2FTXB 3C6MA 3L00A 2YTOA 4LFCE 2DIXA 2EMZA 3LLHA 2LRSA 2CSHA 4LTYA 4JI3E 2M7QA 2UXCE 1XNRE 2MDGA 1T39A 3KZZA 3BGHA 4J8ZA 2LTRA 3T1HE 2EMCA 2V85A 1YYOA 5A6BA 4DR4E 4JI2E 3K6QA 4YHHE 5CFFE 4DV4E 4MLQA 2UXBE 4IJDA 2ENAA 5AE3A 2EJ4A 1AAYA 2EOZA 3ADGA 2EPOA 4O5GA 2L6MA 2ELYA 2KOUA 2JVAA 2PRTA 4X62E 3EPKA 3UK3C 2BBGA 2Q8UA 2JOBA 4Q35B 2EOOA 1LLMC 2UUBE 3MHSC 2V86A 2LV2A 1GZ6A 4LFAE 2UUCE 5AASA 2B7TA 2L8TA 1G2FC 2YTGA 2EM8A 1X49A 1YZ9A 1PJQA 5DNYA 4DR1E 4F9CB 5A6AA 4LF9E 1UBDC 5IV8B 4KWYA 2EP3A 1TF6A 4ZYDA 1HNWE 1YPNA 1EKZA 2A25A 2JY9A 2N3HA 5IXMB 2ODRD 2DRPA 2L3CA 2EL5A 3MSWA 2EMAA 1T4NA 3F6HA 1X3CA 2LTSA 2E5LE 1WJPA 4DR5E 5KL3A 2K7IA 3JTZA 1Z1BA 1T4LB 1IQSA 2EPRA 3EPJA 4IS1C
chains in the Genus database with same CATH topology
4R2CA 4R2QA 2E72A 4F6MA 2EN3A 2YTEA 2ELZA 2YTPA 2EOYA 2RPCA 2EMIA 2MKNA 2YRMA 4FK5C 1TN9A 5KL7A 1YUJA 2EPUA 2JPAA 2EOFA 5KL2A 2EPCA 2MKDA 2YU5A 2EMHA 1YSAC 4M9VC 2YU8A 2DGCA 3EPHA 2EMBA 1ZAAC 2EN8A 2WBUA 1A1IA 2EOXA 1X5WA 2YTOA 1X6FA 2EMZA 2EORA 4F6NA 2EMWA 4X9JA 2YTQA 1ZU1A 2CSHA 2EOHA 1TF3A 2EQ1A 2EL4A 1A1LA 2JP9A 1RMDA 1UN6B 1BB8A 2VRDA 2MDGA 2EN4A 2BB8A 5KL4A 1DGCA 1NCSA 2EE8A 2EOQA 2EMCA 4R2PA 1A1KA 2YRHA 2R1FA 1A1JA 2ENCA 2HGHA 1JK1A 2EM0A 1JK2A 2EMGA 2LO3A 3EPLA 4IJDA 2LCEA 2ENAA 2EM7A 2EM4A 2YTJA 2EJ4A 2ADRA 4R2SA 1YUIA 1A1HA 1AAYA 2M9AA 2EOZA 1A1GA 2YTNA 2YSOA 2EN6A 2ELYA 2PRTA 2DLQA 2EMXA 1P47A 4WSGA 2EMLA 3M99B 3EPKA 3UK3C 1MEYC 3MHHC 2YTIA 2EPXA 2YTFA 2EL6A 2WBSA 2WBTA 2EOOA 2D9HA 2EPAA 4R2AA 2EN7A 1LLMC 2LVHA 2YRKA 3MHSC 2LV2A 2EQ0A 2WCC3 4R2DA 2EM9A 1X6EA 4R2RA 1G2FC 2NABA 2YTGA 2GHFA 2EQ3A 2EM5A 2EM8A 2EMYA 4R2EA 2EPZA 1BBOA 2YTDA 1F2IG 2ENHA 1ZR9A 2RSIA 2DMIA 1UBDC 1X6HA 2CTDA 2EN1A 2EPPA 2EOSA 2EN2A 2EOIA 2EP3A 1TF6A 2EMFA 2DLKA 2A25A 5KL5A 1KJKA 1A1FA 4GZNC 2EM6A 2J7JA 1B69A 2EM3A 2DRPA 4F2JC 2EL5A 2I13A 2YSPA 2EMAA 1X3CA 3VHTB 2GLIA 1G2DC 2EOMA 2EM2A 1WJPA 2EOEA 2EOJA 5KL3A 5KL6A 2LT7A 1Z1BA 2CT1A 2EPRA 2EMKA 3EPJA 4IS1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2C A;  4R2Q A;  2E72 A;  4F6M A;  2EN3 A;  2YTE A;  2ELZ A;  2YTP A;  2EOY A;  2RPC A;  2EMI A;  2MKN A;  2YRM A;  4FK5 C;  1TN9 A;  5KL7 A;  1YUJ A;  2EPU A;  2JPA A;  2EOF A;  5KL2 A;  2EPC A;  2MKD A;  2YU5 A;  2EMH A;  1YSA C;  4M9V C;  2YU8 A;  2DGC A;  3EPH A;  2EMB A;  1ZAA C;  2EN8 A;  2WBU A;  1A1I A;  2EOX A;  1X5W A;  2YTO A;  1X6F A;  2EMZ A;  2EOR A;  4F6N A;  2EMW A;  4X9J A;  2YTQ A;  1ZU1 A;  2CSH A;  2EOH A;  1TF3 A;  2EQ1 A;  2EL4 A;  1A1L A;  2JP9 A;  1RMD A;  1UN6 B;  1BB8 A;  2VRD A;  2MDG A;  2EN4 A;  2BB8 A;  5KL4 A;  1DGC A;  1NCS A;  2EE8 A;  2EOQ A;  2EMC A;  4R2P A;  1A1K A;  2YRH A;  2R1F A;  1A1J A;  2ENC A;  2HGH A;  1JK1 A;  2EM0 A;  1JK2 A;  2EMG A;  2LO3 A;  3EPL A;  4IJD A;  2LCE A;  2ENA A;  2EM7 A;  2EM4 A;  2YTJ A;  2EJ4 A;  2ADR A;  4R2S A;  1YUI A;  1A1H A;  1AAY A;  2M9A A;  2EOZ A;  1A1G A;  2YTN A;  2YSO A;  2EN6 A;  2ELY A;  2PRT A;  2DLQ A;  2EMX A;  1P47 A;  4WSG A;  2EML A;  3M99 B;  3EPK A;  3UK3 C;  1MEY C;  3MHH C;  2YTI A;  2EPX A;  2YTF A;  2EL6 A;  2WBS A;  2WBT A;  2EOO A;  2D9H A;  2EPA A;  4R2A A;  2EN7 A;  1LLM C;  2LVH A;  2YRK A;  3MHS C;  2LV2 A;  2EQ0 A;  2WCC 3;  4R2D A;  2EM9 A;  1X6E A;  4R2R A;  1G2F C;  2NAB A;  2YTG A;  2GHF A;  2EQ3 A;  2EM5 A;  2EM8 A;  2EMY A;  4R2E A;  2EPZ A;  1BBO A;  2YTD A;  1F2I G;  2ENH A;  1ZR9 A;  2RSI A;  2DMI A;  1UBD C;  1X6H A;  2CTD A;  2EN1 A;  2EPP A;  2EOS A;  2EN2 A;  2EOI A;  2EP3 A;  1TF6 A;  2EMF A;  2DLK A;  2A25 A;  5KL5 A;  1KJK A;  1A1F A;  4GZN C;  2EM6 A;  2J7J A;  1B69 A;  2EM3 A;  2DRP A;  4F2J C;  2EL5 A;  2I13 A;  2YSP A;  2EMA A;  1X3C A;  3VHT B;  2GLI A;  1G2D C;  2EOM A;  2EM2 A;  1WJP A;  2EOE A;  2EOJ A;  5KL3 A;  5KL6 A;  2LT7 A;  1Z1B A;  2CT1 A;  2EPR A;  2EMK A;  3EPJ A;  4IS1 C; 
#chains in the Genus database with same CATH topology
 3AV0 A;  3P1X A;  4DV1 E;  2YTE A;  4LU9 A;  2YTP A;  2EOY A;  2RPC A;  2MKN A;  3J7Y p;  4BHB A;  4LF4 E;  1ZBQ A;  2LBS B;  2JPA A;  2EOF A;  4K0K E;  2NUG A;  5IWA E;  1PDA A;  4JI6 E;  2EPC A;  2G7H A;  3ZOQ B;  2DGC A;  2EMB A;  1ZAA C;  2ZM6 E;  2WBU A;  3EQ1 A;  4LF8 E;  1YYW A;  1ZU1 A;  4F54 A;  5AE1 A;  2V8Q B;  2EQ1 A;  1A1L A;  1RMD A;  4WX9 A;  1BB8 A;  4F9A B;  2YWQ A;  5TSE A;  1SR9 A;  2EE8 A;  4ZYE A;  5A6J A;  2VQE E;  3DF6 A;  2R1F A;  2NUE A;  4DUY E;  2HGH A;  1JK1 A;  2EM0 A;  4X66 E;  4M30 A;  2V89 A;  2EZ6 A;  2VQF E;  4JI5 E;  3ADI A;  5LMU E;  2EM4 A;  3J80 C;  2ADR A;  2MDR A;  1A1H A;  2YTN A;  2EN6 A;  4BCA A;  1P47 A;  4DV3 E;  2LUQ A;  3MHH C;  4NHR A;  2YPN A;  4WXC A;  2LUP B;  2EN7 A;  2HJJ A;  2LVH A;  3LML A;  1N34 E;  1HR0 E;  2EQ0 A;  1O0W A;  2EM9 A;  3C6K A;  3OTO E;  1T38 A;  1BBO A;  1I94 E;  2YTD A;  3BF2 A;  1F2I G;  4NXN E;  4TUG A;  1ZR9 A;  2RSI A;  4WXD A;  4WFT A;  4BHC A;  1X6H A;  4DV6 E;  2EN2 A;  1XNQ E;  2EOI A;  2EMF A;  1KJK A;  2ODR C;  1A1F A;  4GZN C;  4BMJ A;  5A69 A;  1EH7 A;  2EM6 A;  4M0V A;  2EM3 A;  4F2J C;  3IWB A;  4I8O A;  4DUZ E;  4B3S E;  1FJG E;  4DR3 E;  3ECR A;  4DV0 E;  4Q28 A;  1QU6 A;  3VHT B;  2KON A;  2EM2 A;  2EPM X;  2EOJ A;  2L2M A;  2L2N A;  4B3R E;  5A2Q C;  1X48 A;  4O24 A;  1N33 E;  2EMK A;  4F6N A;  3BID A;  1YFH A;  3IWC A;  4F6M A;  2V88 A;  3FIG A;  4GEQ B;  3DJW A;  4P7D A;  5AC4 A;  2F4V E;  4DMI A;  4B3M E;  2JOX A;  2VE7 C;  2L33 A;  4OX9 E;  1YSA C;  4LF5 E;  3KWR A;  4JI1 E;  4M9V C;  4JI4 E;  3C4B A;  4RH8 A;  2HHH E;  4MLV A;  3C4T A;  1A1I A;  2EOX A;  1X5W A;  1IBM E;  2EPL X;  4LFB E;  4L5N C;  4R03 A;  3OML A;  2EOR A;  2JXP A;  4X9J A;  1XMO E;  4KHP E;  4YY3 E;  2UUA E;  2EOH A;  2HC5 A;  4TUI A;  2EL4 A;  1STU A;  1UN6 B;  1BBG A;  2EN4 A;  2BB8 A;  2M1S A;  5KL4 A;  4DR7 E;  1WRJ A;  2LJU A;  1NCS A;  1NEI A;  1A1J A;  3ADL A;  2FGG A;  1JK2 A;  2EMG A;  5LMN E;  2EWL A;  4DKK A;  2RS6 A;  1DI2 A;  4BC9 A;  2EM7 A;  5A6B D;  4R2S A;  1YUI A;  4JYA E;  2YSO A;  1GQE A;  2DLQ A;  2EML A;  2WZO A;  3M99 B;  1MEY C;  1IBL E;  2EPX A;  2EL6 A;  1PJT A;  2EPA A;  5LL6 R;  1XMQ E;  4ZYH A;  3J81 C;  1N3G A;  1EH8 A;  1X6E A;  2NAB A;  2GHF A;  2B3T B;  2EMY A;  1PJS A;  1ZBT A;  2JR1 A;  2V83 A;  2EPZ A;  2IHR 1;  4WSP A;  1EH6 A;  4WPY A;  2ENH A;  2V87 A;  4BBY A;  2JYA A;  1J26 A;  1AH5 A;  2EN1 A;  4R8O A;  5KL5 A;  1MGT A;  1IMU A;  3VYX A;  2J7J A;  3VK6 A;  2MC6 A;  2NA2 A;  2B7V A;  2YSP A;  1G2D C;  3QG5 C;  1HNZ E;  2L92 A;  5AC5 A;  4KZS A;  3AUZ A;  1FKA E;  1DQ3 A;  2R76 A;  2CT1 A;  2E1M A;  5BR8 E;  5ADZ A;  1N32 E;  1J5E E;  4R2Q A;  2EPN A;  2NUF A;  4LF7 E;  2I9I A;  2ELZ A;  3HPZ A;  3THO B;  2EPK X;  3VYY A;  1TN9 A;  5FLX C;  3BBG A;  1RQ0 A;  2EPU A;  3J7A G;  4JI8 E;  5IT9 C;  4HTG A;  2DSY A;  2K4V A;  2YU8 A;  3EPH A;  3KZY A;  2EN8 A;  3THN A;  2GPI A;  1X6F A;  2L3J A;  2LMZ A;  2EMW A;  1SFE A;  2YTQ A;  3RMP A;  3IWD A;  1X47 A;  5AE2 A;  1TF3 A;  1PKP A;  4NZV A;  2JP9 A;  4LF6 E;  1HNX E;  1IQO A;  2VRD A;  1IBK E;  1DGC A;  4X8W A;  1RC7 A;  2EOQ A;  2F8B A;  4R2P A;  3JAM C;  1A1K A;  1T4O A;  2YRH A;  2ENC A;  5T6J A;  2LO3 A;  3EPL A;  2LCE A;  3T1Y E;  2YTJ A;  3JU0 A;  4X64 E;  2M9A A;  1A1G A;  2UXD E;  4DR2 E;  3HPS A;  4JV5 E;  2EMX A;  4WSG A;  2YTI A;  2RQL A;  2YTF A;  3F6G A;  2MC5 A;  3HQ1 A;  4O43 A;  2VF1 A;  2WBS A;  4GKK E;  2WBT A;  2D9H A;  2RS7 A;  4L8N A;  4O4K A;  4R2A A;  1YYK A;  2YRK A;  3HTX A;  4HEI A;  2WCC 3;  4R2D A;  4R2R A;  1UHZ A;  4BC7 A;  2N3G A;  2EQ3 A;  2EM5 A;  4R2E A;  4DV5 E;  2DMI A;  4DV2 E;  2CTD A;  2DB2 A;  1GTK A;  2EPP A;  2FV4 B;  2EOS A;  4X65 E;  2DLK A;  3ADJ A;  5LLQ A;  1WHN A;  4RHB B;  1B69 A;  2DMY A;  2YZT A;  2CPN A;  4N4R B;  2I13 A;  4F9B B;  2GLI A;  2B9D A;  2EOM A;  5F3W A;  2EOE A;  2KHX A;  2UU9 E;  5KL6 A;  2LT7 A;  2LE2 A;  4DV7 E;  2YT4 A;  2M4I A;  4DR6 E;  4GKJ E;  4R2C A;  2E72 A;  2EN3 A;  2H36 X;  2N8X A;  2L2K B;  4BS9 A;  4WYQ B;  4AQY E;  4ZYG A;  3TQM A;  1UIL A;  4OOG C;  2EMI A;  1WXR A;  2YRM A;  4FK5 C;  4NXM E;  1WHQ A;  3HXL A;  1QNT A;  4B3T E;  1L4S A;  4M2Z A;  5KL7 A;  2JWO A;  1YUJ A;  4P78 A;  3H09 A;  4JI7 E;  1N36 E;  2RSM A;  5KL2 A;  4JI0 E;  2RTX A;  2MKD A;  2YU5 A;  2EMH A;  2LJH A;  1KYQ A;  5A6K A;  2FTX B;  3C6M A;  3L00 A;  2YTO A;  4LFC E;  2DIX A;  2EMZ A;  3LLH A;  2LRS A;  2CSH A;  4LTY A;  4JI3 E;  2M7Q A;  2UXC E;  1XNR E;  2MDG A;  1T39 A;  3KZZ A;  3BGH A;  4J8Z A;  2LTR A;  3T1H E;  2EMC A;  2V85 A;  1YYO A;  5A6B A;  4DR4 E;  4JI2 E;  3K6Q A;  4YHH E;  5CFF E;  4DV4 E;  4MLQ A;  2UXB E;  4IJD A;  2ENA A;  5AE3 A;  2EJ4 A;  1AAY A;  2EOZ A;  3ADG A;  2EPO A;  4O5G A;  2L6M A;  2ELY A;  2KOU A;  2JVA A;  2PRT A;  4X62 E;  3EPK A;  3UK3 C;  2BBG A;  2Q8U A;  2JOB A;  4Q35 B;  2EOO A;  1LLM C;  2UUB E;  3MHS C;  2V86 A;  2LV2 A;  1GZ6 A;  4LFA E;  2UUC E;  5AAS A;  2B7T A;  2L8T A;  1G2F C;  2YTG A;  2EM8 A;  1X49 A;  1YZ9 A;  1PJQ A;  5DNY A;  4DR1 E;  4F9C B;  5A6A A;  4LF9 E;  1UBD C;  5IV8 B;  4KWY A;  2EP3 A;  1TF6 A;  4ZYD A;  1HNW E;  1YPN A;  1EKZ A;  2A25 A;  2JY9 A;  2N3H A;  5IXM B;  2ODR D;  2DRP A;  2L3C A;  2EL5 A;  3MSW A;  2EMA A;  1T4N A;  3F6H A;  1X3C A;  2LTS A;  2E5L E;  1WJP A;  4DR5 E;  5KL3 A;  2K7I A;  3JTZ A;  1Z1B A;  1T4L B;  1IQS A;  2EPR A;  3EPJ A;  4IS1 C; 
#chains in the Genus database with same CATH homology
 4R2C A;  4R2Q A;  2E72 A;  4F6M A;  2EN3 A;  2YTE A;  2ELZ A;  2YTP A;  2EOY A;  2RPC A;  2EMI A;  2MKN A;  2YRM A;  4FK5 C;  1TN9 A;  5KL7 A;  1YUJ A;  2EPU A;  2JPA A;  2EOF A;  5KL2 A;  2EPC A;  2MKD A;  2YU5 A;  2EMH A;  1YSA C;  4M9V C;  2YU8 A;  2DGC A;  3EPH A;  2EMB A;  1ZAA C;  2EN8 A;  2WBU A;  1A1I A;  2EOX A;  1X5W A;  2YTO A;  1X6F A;  2EMZ A;  2EOR A;  4F6N A;  2EMW A;  4X9J A;  2YTQ A;  1ZU1 A;  2CSH A;  2EOH A;  1TF3 A;  2EQ1 A;  2EL4 A;  1A1L A;  2JP9 A;  1RMD A;  1UN6 B;  1BB8 A;  2VRD A;  2MDG A;  2EN4 A;  2BB8 A;  5KL4 A;  1DGC A;  1NCS A;  2EE8 A;  2EOQ A;  2EMC A;  4R2P A;  1A1K A;  2YRH A;  2R1F A;  1A1J A;  2ENC A;  2HGH A;  1JK1 A;  2EM0 A;  1JK2 A;  2EMG A;  2LO3 A;  3EPL A;  4IJD A;  2LCE A;  2ENA A;  2EM7 A;  2EM4 A;  2YTJ A;  2EJ4 A;  2ADR A;  4R2S A;  1YUI A;  1A1H A;  1AAY A;  2M9A A;  2EOZ A;  1A1G A;  2YTN A;  2YSO A;  2EN6 A;  2ELY A;  2PRT A;  2DLQ A;  2EMX A;  1P47 A;  4WSG A;  2EML A;  3M99 B;  3EPK A;  3UK3 C;  1MEY C;  3MHH C;  2YTI A;  2EPX A;  2YTF A;  2EL6 A;  2WBS A;  2WBT A;  2EOO A;  2D9H A;  2EPA A;  4R2A A;  2EN7 A;  1LLM C;  2LVH A;  2YRK A;  3MHS C;  2LV2 A;  2EQ0 A;  2WCC 3;  4R2D A;  2EM9 A;  1X6E A;  4R2R A;  1G2F C;  2NAB A;  2YTG A;  2GHF A;  2EQ3 A;  2EM5 A;  2EM8 A;  2EMY A;  4R2E A;  2EPZ A;  1BBO A;  2YTD A;  1F2I G;  2ENH A;  1ZR9 A;  2RSI A;  2DMI A;  1UBD C;  1X6H A;  2CTD A;  2EN1 A;  2EPP A;  2EOS A;  2EN2 A;  2EOI A;  2EP3 A;  1TF6 A;  2EMF A;  2DLK A;  2A25 A;  5KL5 A;  1KJK A;  1A1F A;  4GZN C;  2EM6 A;  2J7J A;  1B69 A;  2EM3 A;  2DRP A;  4F2J C;  2EL5 A;  2I13 A;  2YSP A;  2EMA A;  1X3C A;  3VHT B;  2GLI A;  1G2D C;  2EOM A;  2EM2 A;  1WJP A;  2EOE A;  2EOJ A;  5KL3 A;  5KL6 A;  2LT7 A;  1Z1B A;  2CT1 A;  2EPR A;  2EMK A;  3EPJ A;  4IS1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...