2MDRA

Solution structure of the third double-stranded rna-binding domain (dsrbd3) of human adenosine-deaminase adar1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
94
structure length
94
Chain Sequence
MMPNKVRKIGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQEAADAALRVLIGENEKAER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A bimodular nuclear localization signal assembled via an extended double-stranded RNA-binding domain acts as an RNA-sensing signal for transportin 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Double-stranded RNA-specific adenosine deaminase
total genus 26
structure length 94
sequence length 94
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2mdrA00
4JI5E 3HTXA 4K0KE 2MDRA 4DR6E 4X65E 1IBKE 2L3CA 3T1YE 1X47A 2L2NA 5CFFE 1O0WA 1YYWA 2RTXA 4JI8E 4DV0E 1YYKA 2UXDE 4B3ME 2CPNA 2NUGA 4YY3E 4JI7E 1XMOE 3LLHA 1GQEA 3P1XA 1XMQE 3ADIA 1IBME 4LFAE 1T4NA 1EKZA 4JI6E 4OOGC 4X64E 3C4TA 4JI4E 4JYAE 4NXNE 2EZ6A 1QU6A 4LF7E 4LF8E 2B7VA 2N3GA 5LMUE 4JI1E 4B3TE 1WHQA 4DV6E 1J26A 2NA2A 4DR7E 2RS7A 2LRSA 2F4VE 4X62E 4LF6E 1N33E 3VYXA 2VQFE 2L3JA 2DB2A 1HR0E 1N34E 2NUFA 4M2ZA 1STUA 2KHXA 4AQYE 2YT4A 3ADGA 1YZ9A 2L2MA 4DV4E 1HNWE 4DKKA 1T4OA 4YHHE 1T4LB 2E5LE 2LUPB 1WHNA 2LBSB 2B3TB 4X8WA 2RSMA 4B3RE 4X66E 1XNRE 2NUEA 1XNQE 4B3SE 2ZM6E 4DR4E 1DI2A 3T1HE 2JY9A 1X48A 5IWAE 4LF5E 1FKAE 3ADLA 4LFBE 2LJHA 4DV1E 2DMYA 3VYYA 4DV3E 4GKJE 2DIXA 4LF9E 1N32E 4WYQB 4JI0E 1N36E 4DR5E 4M30A 1J5EE 2UU9E 1I94E 5LMNE 4LF4E 1UILA 1YYOA 2IHR1 4JI2E 4KHPE 1PKPA 3C4BA 5BR8E 1FJGE 2UUBE 4DUZE 2UXBE 4DV2E 2UXCE 4JV5E 4GKKE 2LUQA 2JVAA 4LFCE 1X49A 1UHZA 4DR3E 4OX9E 4NXME 2LTSA 4DV5E 2L33A 2LTRA 1IBLE 4DV7E 2B7TA 2N3HA 2VQEE 1RC7A 1HNZE 3ADJA 2UUAE 4DUYE 2HHHE 4WFTA 2L2KB 4JI3E 3OTOE 2RS6A 4DR1E 1HNXE 2UUCE 1ZBTA 4DR2E 1RQ0A 3J7Yp
chains in the Genus database with same CATH superfamily
4JI5E 2EQ3A 2EN4A 2ELYA 2EOIA 4GEQB 5KL3A 2G7HA 2MC5A 5KL6A 2LE2A 3IWCA 2KONA 2L2NA 4BCAA 1F2IG 2RTXA 4HTGA 2EM7A 5A6KA 1ZBQA 2YTJA 2CPNA 2CT1A 4B3ME 2NUGA 4YY3E 4JI7E 3LLHA 2H36X 1IBME 1EKZA 4JI6E 4OOGC 2DRPA 4JYAE 3HPSA 1WRJA 4R2DA 1QU6A 4LF8E 2LJUA 5LMUE 1BBOA 4DV6E 1J26A 3KZZA 4HEIA 4BC7A 3HXLA 1UN6B 1A1KA 1N3GA 2L92A 2DB2A 4N4RB 2KHXA 4M0VA 3KZYA 4RHBB 1IMUA 3IWBA 2HC5A 4J8ZA 2FGGA 1WHNA 2EJ4A 3J81C 3J7AG 4BS9A 1TF6A 5F3WA 2NUEA 2YRKA 2EM3A 2EN8A 4DR4E 4LF5E 3QG5C 4DMIA 2D9HA 2J7JA 2PRTA 2K7IA 2LJHA 2WZOA 2V87A 5AC4A 2DMYA 2EMCA 4DV1E 2ODRC 2YRHA 3OMLA 4GKJE 4WSGA 1IQOA 2DIXA 2HGHA 2MDGA 3AUZA 2ENAA 3JAMC 1EH6A 4M30A 2ADRA 1UILA 1EH7A 5KL2A 5KL7A 3C4BA 1UBDC 5A6AA 2GPIA 4DUZE 2UXCE 2DLQA 4L5NC 2EL5A 2LUQA 2K4VA 2DMIA 2V85A 2YTQA 3KWRA 4NXME 4R2AA 1LLMC 2E1MA 3EPHA 2LTRA 2EPUA 4X9JA 2EPLX 4WFTA 1AH5A 5AASA 2MKDA 2V8QB 1RQ0A 2EMBA 2ODRD 2EOZA 2JOXA 4WXCA 4Q28A 2EMKA 2MDRA 2WBSA 2MC6A 4WX9A 4DR6E 4MLQA 4RH8A 1JK2A 3T1YE 2EM2A 4R2CA 4ZYHA 1KYQA 2V89A 3BIDA 5AE3A 4JI8E 2VF1A 2UXDE 2YRMA 1XMOE 2EM0A 1ZAAC 1X6FA 2EN6A 3IWDA 3P1XA 5AC5A 4F6NA 3ADIA 2EM9A 2JXPA 4L8NA 2EWLA 3EPJA 4O5GA 1X3CA 2EQ1A 2EOJA 2I9IA 3AV0A 4R2SA 4R8OA 2EZ6A 2EOYA 2B7VA 2BBGA 1L4SA 1WHQA 2YTPA 4TUGA 1BBGA 4R03A 1PJSA 2LT7A 2EPRA 2CSHA 2L3JA 1HR0E 4M2ZA 1ZU1A 4AQYE 2YT4A 3ADGA 4DV4E 1NEIA 4F9BB 4YHHE 2M9AA 3THOB 1SFEA 2EPKX 2B3TB 4GZNC 5ADZA 1JK1A 1XNQE 2ZM6E 2JY9A 2YTNA 1G2DC 1FKAE 3ADLA 2YTIA 1MGTA 2L8TA 2YU8A 2LV2A 1WXRA 1X5WA 5IV8B 3JTZA 1A1IA 2B9DA 2EOMA 2V86A 2I13A 3H09A 1N32E 2EORA 1A1HA 2NABA 2YPNA 2GLIA 2JOBA 1I94E 1PJQA 3LMLA 1G2FC 3F6HA 5T6JA 2EM5A 2Q8UA 3F6GA 1FJGE 2R76A 4LTYA 4DV2E 2YU5A 2E72A 2YTGA 3BBGA 5AE2A 2JVAA 4LFCE 4DR3E 2LTSA 2N8XA 3DF6A 1A1GA 4LU9A 2B7TA 2N3HA 3MHHC 2VQEE 2UUAE 4F9AB 2EPOA 4JI3E 4DR1E 2EOQA 1NCSA 3HPZA 2JP9A 1X6EA 1EH8A 2EL4A 4WXDA 4K0KE 4M9VC 3VK6A 2L3CA 1X47A 5CFFE 1O0WA 1T38A 4O4KA 2EOOA 3TQMA 2LMZA 2JPAA 4DV0E 1YYKA 2EN3A 4IJDA 1AAYA 3MSWA 5A6BA 3JU0A 5IXMB 2M4IA 1T4NA 3C4TA 4F2JC 1SR9A 4Q35B 5LL6R 4BBYA 2N3GA 2EQ0A 2EN2A 4F9CB 4KZSA 2NA2A 2DGCA 4DR7E 2RS7A 3C6MA 2F4VE 4O43A 4X62E 2EMAA 1YUIA 2YTDA 4TUIA 1N33E 3VYXA 5A6JA 2NUFA 3HQ1A 1Z1BA 2EMFA 2M7QA 3BF2A 2V83A 1YZ9A 2EN1A 1T4LB 2EM6A 1WJPA 2LUPB 2A25A 4X8WA 2RSMA 1YPNA 1XNRE 2EPXA 2HJJA 4B3SE 2JYAA 4O24A 5IWAE 4R2PA 2EMYA 3M99B 3UK3C 5KL5A 1GZ6A 4LFBE 2RPCA 3ECRA 2EMHA 2YTFA 2EMGA 3VYYA 4DV3E 3K6QA 2EE8A 2EOFA 4WYQB 4JI0E 1N36E 4DR5E 5FLXC 1J5EE 2UU9E 1KJKA 2EPMX 1A1LA 2M1SA 2YWQA 5LMNE 4LF4E 2IHR1 2EM4A 5A69A 4I8OA 5BR8E 2UUBE 1RMDA 2DSYA 1GTKA 2VE7C 4JV5E 4GKKE 2RSIA 3DJWA 2EPPA 2LO3A 1X49A 1UHZA 2RQLA 1P47A 2JWOA 4BHBA 2WBTA 2L33A 2CTDA 1IBLE 2EOXA 4DV7E 4F6MA 1A1JA 1RC7A 2EMZA 2EOHA 4NHRA 4F54A 3VHTB 2F8BA 2L2KB 4R2QA 1ZR9A 1DQ3A 2EMIA 2EP3A 4BC9A 3HTXA 2EPNA 1YUJA 1X6HA 4P7DA 4X65E 3J80C 5DNYA 1IBKE 3THNA 2EL6A 1YYWA 5TSEA 1TF3A 4KWYA 2EPCA 1GQEA 5IT9C 1XMQE 1QNTA 4LFAE 3RMPA 2YSOA 4WSPA 4X64E 3L00A 4IS1C 4JI4E 4FK5C 3MHSC 1T39A 4NXNE 4LF7E 4ZYDA 1DGCA 2FV4B 1B69A 4ZYEA 2EOEA 4JI1E 4B3TE 2WBUA 2KOUA 2EM8A 2BB8A 4BMJA 5AE1A 2LRSA 2EPAA 2YTOA 4LF6E 2L6MA 2R1FA 2VQFE 1N34E 3EPKA 1STUA 3C6KA 2MKNA 2L2MA 5A2QC 1HNWE 2YZTA 4DKKA 1T4OA 3ZOQB 2V88A 2E5LE 5KL4A 2LBSB 1YFHA 4B3RE 4X66E 1BB8A 3EQ1A 3EPLA 2GHFA 1DI2A 3T1HE 4NZVA 2LVHA 1MEYC 1X48A 5LLQA 1TN9A 3FIGA 4ZYGA 2EMLA 4P78A 4LF9E 2ELZA 2EMXA 4WPYA 4R2RA 2YSPA 2FTXB 5A6BD 2ENCA 1YSAC 2LCEA 2EN7A 4R2EA 2DLKA 2VRDA 1YYOA 4JI2E 1IQSA 4KHPE 1PKPA 1A1FA 2YTEA 4MLVA 2EOSA 2EPZA 2UXBE 2JR1A 4OX9E 4BHCA 2WCC3 3BGHA 4DV5E 1HNZE 3ADJA 4DUYE 2HHHE 1PJTA 2EMWA 3OTOE 2RS6A 1HNXE 2UUCE 2ENHA 1ZBTA 4DR2E 1PDAA 3J7Yp
chains in the Genus database with same CATH topology
2JOXA 4JI5E 3HTXA 4K0KE 4Q28A 4GEQB 2MDRA 2G7HA 2MC5A 2MC6A 4P7DA 3VK6A 4DR6E 2LE2A 4X65E 3J80C 5DNYA 1IBKE 3IWCA 2L3CA 3T1YE 2KONA 1X47A 2L2NA 5CFFE 1O0WA 4BCAA 1YYWA 2V89A 2RTXA 5AE3A 2LMZA 4JI8E 2VF1A 4DV0E 1YYKA 2UXDE 1ZBQA 4B3ME 2CPNA 2NUGA 4YY3E 4JI7E 1XMOE 3MSWA 3LLHA 3JU0A 1GQEA 3IWDA 3P1XA 2H36X 5IT9C 1XMQE 3ADIA 1IBME 2M4IA 3RMPA 4LFAE 4L8NA 1T4NA 2EWLA 1EKZA 4JI6E 4WSPA 4OOGC 3C4TA 4X64E 4JI4E 3HPSA 3AV0A 4JYAE 4NXNE 1SR9A 4R8OA 2EZ6A 1QU6A 4LF7E 4LF8E 2FV4B 5LL6R 4BBYA 2B7VA 2N3GA 5LMUE 4JI1E 4B3TE 1WHQA 4F9CB 4DV6E 1J26A 4KZSA 2NA2A 4TUGA 4R03A 2KOUA 4BC7A 3HXLA 2RS7A 4DR7E 5AE1A 4BMJA 2LRSA 2F4VE 4X62E 4LF6E 2L6MA 4TUIA 1N33E 3VYXA 2VQFE 2L92A 2DB2A 2L3JA 1N34E 1HR0E 3HQ1A 1STUA 2NUFA 2KHXA 4M0VA 4AQYE 4M2ZA 2YT4A 2M7QA 3ADGA 1YZ9A 2V83A 2L2MA 1HNWE 3IWBA 5A2QC 4DV4E 2YZTA 4DKKA 1T4OA 4J8ZA 3ZOQB 4F9BB 2V88A 4YHHE 1T4LB 2E5LE 2FGGA 2LUPB 1WHNA 3J81C 3J7AG 2LBSB 2B3TB 4X8WA 2RSMA 4B3RE 4X66E 4BS9A 1XNRE 5F3WA 2NUEA 5ADZA 4B3SE 1XNQE 2ZM6E 4DR4E 1DI2A 3T1HE 2JY9A 1X48A 5IWAE 4LF5E 3FIGA 4DMIA 1GZ6A 1FKAE 3ADLA 4LFBE 2L8TA 2LJHA 2V87A 2WZOA 2DMYA 4DV1E 2ODRC 1WXRA 3OMLA 3VYYA 4P78A 3JTZA 4DV3E 2DIXA 3K6QA 4LF9E 4GKJE 2B9DA 2V86A 3H09A 1N32E 3AUZA 4WYQB 4JI0E 1N36E 4WPYA 3JAMC 5FLXC 4M30A 4DR5E 1J5EE 2UU9E 2FTXB 2JOBA 2M1SA 5LMNE 1I94E 3LMLA 4LF4E 1UILA 3F6HA 5T6JA 1YYOA 2IHR1 4JI2E 3F6GA 4KHPE 1PKPA 3C4BA 4I8OA 5BR8E 1FJGE 2UUBE 4DUZE 2DSYA 4LTYA 2UXBE 4DV2E 2UXCE 4L5NC 2VE7C 5AE2A 4JV5E 4GKKE 2LUQA 2JVAA 3DJWA 4LFCE 2JR1A 1X49A 1UHZA 2K4VA 2V85A 2JWOA 3KWRA 4DR3E 4NXME 2LTSA 4OX9E 2E1MA 3DF6A 2L33A 4DV5E 2LTRA 1IBLE 4DV7E 4LU9A 2B7TA 2N3HA 2VQEE 1RC7A 1HNZE 3ADJA 2UUAE 4F54A 4F9AB 4DUYE 2HHHE 2F8BA 4WFTA 2L2KB 4JI3E 1DQ3A 3OTOE 2RS6A 4DR1E 1HNXE 2UUCE 3HPZA 4BC9A 1ZBTA 5AASA 2V8QB 1RQ0A 3J7Yp 4DR2E 2ODRD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 E;  3HTX A;  4K0K E;  2MDR A;  4DR6 E;  4X65 E;  1IBK E;  2L3C A;  3T1Y E;  1X47 A;  2L2N A;  5CFF E;  1O0W A;  1YYW A;  2RTX A;  4JI8 E;  4DV0 E;  1YYK A;  2UXD E;  4B3M E;  2CPN A;  2NUG A;  4YY3 E;  4JI7 E;  1XMO E;  3LLH A;  1GQE A;  3P1X A;  1XMQ E;  3ADI A;  1IBM E;  4LFA E;  1T4N A;  1EKZ A;  4JI6 E;  4OOG C;  4X64 E;  3C4T A;  4JI4 E;  4JYA E;  4NXN E;  2EZ6 A;  1QU6 A;  4LF7 E;  4LF8 E;  2B7V A;  2N3G A;  5LMU E;  4JI1 E;  4B3T E;  1WHQ A;  4DV6 E;  1J26 A;  2NA2 A;  4DR7 E;  2RS7 A;  2LRS A;  2F4V E;  4X62 E;  4LF6 E;  1N33 E;  3VYX A;  2VQF E;  2L3J A;  2DB2 A;  1HR0 E;  1N34 E;  2NUF A;  4M2Z A;  1STU A;  2KHX A;  4AQY E;  2YT4 A;  3ADG A;  1YZ9 A;  2L2M A;  4DV4 E;  1HNW E;  4DKK A;  1T4O A;  4YHH E;  1T4L B;  2E5L E;  2LUP B;  1WHN A;  2LBS B;  2B3T B;  4X8W A;  2RSM A;  4B3R E;  4X66 E;  1XNR E;  2NUE A;  1XNQ E;  4B3S E;  2ZM6 E;  4DR4 E;  1DI2 A;  3T1H E;  2JY9 A;  1X48 A;  5IWA E;  4LF5 E;  1FKA E;  3ADL A;  4LFB E;  2LJH A;  4DV1 E;  2DMY A;  3VYY A;  4DV3 E;  4GKJ E;  2DIX A;  4LF9 E;  1N32 E;  4WYQ B;  4JI0 E;  1N36 E;  4DR5 E;  4M30 A;  1J5E E;  2UU9 E;  1I94 E;  5LMN E;  4LF4 E;  1UIL A;  1YYO A;  2IHR 1;  4JI2 E;  4KHP E;  1PKP A;  3C4B A;  5BR8 E;  1FJG E;  2UUB E;  4DUZ E;  2UXB E;  4DV2 E;  2UXC E;  4JV5 E;  4GKK E;  2LUQ A;  2JVA A;  4LFC E;  1X49 A;  1UHZ A;  4DR3 E;  4OX9 E;  4NXM E;  2LTS A;  4DV5 E;  2L33 A;  2LTR A;  1IBL E;  4DV7 E;  2B7T A;  2N3H A;  2VQE E;  1RC7 A;  1HNZ E;  3ADJ A;  2UUA E;  4DUY E;  2HHH E;  4WFT A;  2L2K B;  4JI3 E;  3OTO E;  2RS6 A;  4DR1 E;  1HNX E;  2UUC E;  1ZBT A;  4DR2 E;  1RQ0 A;  3J7Y p; 
#chains in the Genus database with same CATH topology
 4JI5 E;  2EQ3 A;  2EN4 A;  2ELY A;  2EOI A;  4GEQ B;  5KL3 A;  2G7H A;  2MC5 A;  5KL6 A;  2LE2 A;  3IWC A;  2KON A;  2L2N A;  4BCA A;  1F2I G;  2RTX A;  4HTG A;  2EM7 A;  5A6K A;  1ZBQ A;  2YTJ A;  2CPN A;  2CT1 A;  4B3M E;  2NUG A;  4YY3 E;  4JI7 E;  3LLH A;  2H36 X;  1IBM E;  1EKZ A;  4JI6 E;  4OOG C;  2DRP A;  4JYA E;  3HPS A;  1WRJ A;  4R2D A;  1QU6 A;  4LF8 E;  2LJU A;  5LMU E;  1BBO A;  4DV6 E;  1J26 A;  3KZZ A;  4HEI A;  4BC7 A;  3HXL A;  1UN6 B;  1A1K A;  1N3G A;  2L92 A;  2DB2 A;  4N4R B;  2KHX A;  4M0V A;  3KZY A;  4RHB B;  1IMU A;  3IWB A;  2HC5 A;  4J8Z A;  2FGG A;  1WHN A;  2EJ4 A;  3J81 C;  3J7A G;  4BS9 A;  1TF6 A;  5F3W A;  2NUE A;  2YRK A;  2EM3 A;  2EN8 A;  4DR4 E;  4LF5 E;  3QG5 C;  4DMI A;  2D9H A;  2J7J A;  2PRT A;  2K7I A;  2LJH A;  2WZO A;  2V87 A;  5AC4 A;  2DMY A;  2EMC A;  4DV1 E;  2ODR C;  2YRH A;  3OML A;  4GKJ E;  4WSG A;  1IQO A;  2DIX A;  2HGH A;  2MDG A;  3AUZ A;  2ENA A;  3JAM C;  1EH6 A;  4M30 A;  2ADR A;  1UIL A;  1EH7 A;  5KL2 A;  5KL7 A;  3C4B A;  1UBD C;  5A6A A;  2GPI A;  4DUZ E;  2UXC E;  2DLQ A;  4L5N C;  2EL5 A;  2LUQ A;  2K4V A;  2DMI A;  2V85 A;  2YTQ A;  3KWR A;  4NXM E;  4R2A A;  1LLM C;  2E1M A;  3EPH A;  2LTR A;  2EPU A;  4X9J A;  2EPL X;  4WFT A;  1AH5 A;  5AAS A;  2MKD A;  2V8Q B;  1RQ0 A;  2EMB A;  2ODR D;  2EOZ A;  2JOX A;  4WXC A;  4Q28 A;  2EMK A;  2MDR A;  2WBS A;  2MC6 A;  4WX9 A;  4DR6 E;  4MLQ A;  4RH8 A;  1JK2 A;  3T1Y E;  2EM2 A;  4R2C A;  4ZYH A;  1KYQ A;  2V89 A;  3BID A;  5AE3 A;  4JI8 E;  2VF1 A;  2UXD E;  2YRM A;  1XMO E;  2EM0 A;  1ZAA C;  1X6F A;  2EN6 A;  3IWD A;  3P1X A;  5AC5 A;  4F6N A;  3ADI A;  2EM9 A;  2JXP A;  4L8N A;  2EWL A;  3EPJ A;  4O5G A;  1X3C A;  2EQ1 A;  2EOJ A;  2I9I A;  3AV0 A;  4R2S A;  4R8O A;  2EZ6 A;  2EOY A;  2B7V A;  2BBG A;  1L4S A;  1WHQ A;  2YTP A;  4TUG A;  1BBG A;  4R03 A;  1PJS A;  2LT7 A;  2EPR A;  2CSH A;  2L3J A;  1HR0 E;  4M2Z A;  1ZU1 A;  4AQY E;  2YT4 A;  3ADG A;  4DV4 E;  1NEI A;  4F9B B;  4YHH E;  2M9A A;  3THO B;  1SFE A;  2EPK X;  2B3T B;  4GZN C;  5ADZ A;  1JK1 A;  1XNQ E;  2ZM6 E;  2JY9 A;  2YTN A;  1G2D C;  1FKA E;  3ADL A;  2YTI A;  1MGT A;  2L8T A;  2YU8 A;  2LV2 A;  1WXR A;  1X5W A;  5IV8 B;  3JTZ A;  1A1I A;  2B9D A;  2EOM A;  2V86 A;  2I13 A;  3H09 A;  1N32 E;  2EOR A;  1A1H A;  2NAB A;  2YPN A;  2GLI A;  2JOB A;  1I94 E;  1PJQ A;  3LML A;  1G2F C;  3F6H A;  5T6J A;  2EM5 A;  2Q8U A;  3F6G A;  1FJG E;  2R76 A;  4LTY A;  4DV2 E;  2YU5 A;  2E72 A;  2YTG A;  3BBG A;  5AE2 A;  2JVA A;  4LFC E;  4DR3 E;  2LTS A;  2N8X A;  3DF6 A;  1A1G A;  4LU9 A;  2B7T A;  2N3H A;  3MHH C;  2VQE E;  2UUA E;  4F9A B;  2EPO A;  4JI3 E;  4DR1 E;  2EOQ A;  1NCS A;  3HPZ A;  2JP9 A;  1X6E A;  1EH8 A;  2EL4 A;  4WXD A;  4K0K E;  4M9V C;  3VK6 A;  2L3C A;  1X47 A;  5CFF E;  1O0W A;  1T38 A;  4O4K A;  2EOO A;  3TQM A;  2LMZ A;  2JPA A;  4DV0 E;  1YYK A;  2EN3 A;  4IJD A;  1AAY A;  3MSW A;  5A6B A;  3JU0 A;  5IXM B;  2M4I A;  1T4N A;  3C4T A;  4F2J C;  1SR9 A;  4Q35 B;  5LL6 R;  4BBY A;  2N3G A;  2EQ0 A;  2EN2 A;  4F9C B;  4KZS A;  2NA2 A;  2DGC A;  4DR7 E;  2RS7 A;  3C6M A;  2F4V E;  4O43 A;  4X62 E;  2EMA A;  1YUI A;  2YTD A;  4TUI A;  1N33 E;  3VYX A;  5A6J A;  2NUF A;  3HQ1 A;  1Z1B A;  2EMF A;  2M7Q A;  3BF2 A;  2V83 A;  1YZ9 A;  2EN1 A;  1T4L B;  2EM6 A;  1WJP A;  2LUP B;  2A25 A;  4X8W A;  2RSM A;  1YPN A;  1XNR E;  2EPX A;  2HJJ A;  4B3S E;  2JYA A;  4O24 A;  5IWA E;  4R2P A;  2EMY A;  3M99 B;  3UK3 C;  5KL5 A;  1GZ6 A;  4LFB E;  2RPC A;  3ECR A;  2EMH A;  2YTF A;  2EMG A;  3VYY A;  4DV3 E;  3K6Q A;  2EE8 A;  2EOF A;  4WYQ B;  4JI0 E;  1N36 E;  4DR5 E;  5FLX C;  1J5E E;  2UU9 E;  1KJK A;  2EPM X;  1A1L A;  2M1S A;  2YWQ A;  5LMN E;  4LF4 E;  2IHR 1;  2EM4 A;  5A69 A;  4I8O A;  5BR8 E;  2UUB E;  1RMD A;  2DSY A;  1GTK A;  2VE7 C;  4JV5 E;  4GKK E;  2RSI A;  3DJW A;  2EPP A;  2LO3 A;  1X49 A;  1UHZ A;  2RQL A;  1P47 A;  2JWO A;  4BHB A;  2WBT A;  2L33 A;  2CTD A;  1IBL E;  2EOX A;  4DV7 E;  4F6M A;  1A1J A;  1RC7 A;  2EMZ A;  2EOH A;  4NHR A;  4F54 A;  3VHT B;  2F8B A;  2L2K B;  4R2Q A;  1ZR9 A;  1DQ3 A;  2EMI A;  2EP3 A;  4BC9 A;  3HTX A;  2EPN A;  1YUJ A;  1X6H A;  4P7D A;  4X65 E;  3J80 C;  5DNY A;  1IBK E;  3THN A;  2EL6 A;  1YYW A;  5TSE A;  1TF3 A;  4KWY A;  2EPC A;  1GQE A;  5IT9 C;  1XMQ E;  1QNT A;  4LFA E;  3RMP A;  2YSO A;  4WSP A;  4X64 E;  3L00 A;  4IS1 C;  4JI4 E;  4FK5 C;  3MHS C;  1T39 A;  4NXN E;  4LF7 E;  4ZYD A;  1DGC A;  2FV4 B;  1B69 A;  4ZYE A;  2EOE A;  4JI1 E;  4B3T E;  2WBU A;  2KOU A;  2EM8 A;  2BB8 A;  4BMJ A;  5AE1 A;  2LRS A;  2EPA A;  2YTO A;  4LF6 E;  2L6M A;  2R1F A;  2VQF E;  1N34 E;  3EPK A;  1STU A;  3C6K A;  2MKN A;  2L2M A;  5A2Q C;  1HNW E;  2YZT A;  4DKK A;  1T4O A;  3ZOQ B;  2V88 A;  2E5L E;  5KL4 A;  2LBS B;  1YFH A;  4B3R E;  4X66 E;  1BB8 A;  3EQ1 A;  3EPL A;  2GHF A;  1DI2 A;  3T1H E;  4NZV A;  2LVH A;  1MEY C;  1X48 A;  5LLQ A;  1TN9 A;  3FIG A;  4ZYG A;  2EML A;  4P78 A;  4LF9 E;  2ELZ A;  2EMX A;  4WPY A;  4R2R A;  2YSP A;  2FTX B;  5A6B D;  2ENC A;  1YSA C;  2LCE A;  2EN7 A;  4R2E A;  2DLK A;  2VRD A;  1YYO A;  4JI2 E;  1IQS A;  4KHP E;  1PKP A;  1A1F A;  2YTE A;  4MLV A;  2EOS A;  2EPZ A;  2UXB E;  2JR1 A;  4OX9 E;  4BHC A;  2WCC 3;  3BGH A;  4DV5 E;  1HNZ E;  3ADJ A;  4DUY E;  2HHH E;  1PJT A;  2EMW A;  3OTO E;  2RS6 A;  1HNX E;  2UUC E;  2ENH A;  1ZBT A;  4DR2 E;  1PDA A;  3J7Y p; 
#chains in the Genus database with same CATH homology
 2JOX A;  4JI5 E;  3HTX A;  4K0K E;  4Q28 A;  4GEQ B;  2MDR A;  2G7H A;  2MC5 A;  2MC6 A;  4P7D A;  3VK6 A;  4DR6 E;  2LE2 A;  4X65 E;  3J80 C;  5DNY A;  1IBK E;  3IWC A;  2L3C A;  3T1Y E;  2KON A;  1X47 A;  2L2N A;  5CFF E;  1O0W A;  4BCA A;  1YYW A;  2V89 A;  2RTX A;  5AE3 A;  2LMZ A;  4JI8 E;  2VF1 A;  4DV0 E;  1YYK A;  2UXD E;  1ZBQ A;  4B3M E;  2CPN A;  2NUG A;  4YY3 E;  4JI7 E;  1XMO E;  3MSW A;  3LLH A;  3JU0 A;  1GQE A;  3IWD A;  3P1X A;  2H36 X;  5IT9 C;  1XMQ E;  3ADI A;  1IBM E;  2M4I A;  3RMP A;  4LFA E;  4L8N A;  1T4N A;  2EWL A;  1EKZ A;  4JI6 E;  4WSP A;  4OOG C;  3C4T A;  4X64 E;  4JI4 E;  3HPS A;  3AV0 A;  4JYA E;  4NXN E;  1SR9 A;  4R8O A;  2EZ6 A;  1QU6 A;  4LF7 E;  4LF8 E;  2FV4 B;  5LL6 R;  4BBY A;  2B7V A;  2N3G A;  5LMU E;  4JI1 E;  4B3T E;  1WHQ A;  4F9C B;  4DV6 E;  1J26 A;  4KZS A;  2NA2 A;  4TUG A;  4R03 A;  2KOU A;  4BC7 A;  3HXL A;  2RS7 A;  4DR7 E;  5AE1 A;  4BMJ A;  2LRS A;  2F4V E;  4X62 E;  4LF6 E;  2L6M A;  4TUI A;  1N33 E;  3VYX A;  2VQF E;  2L92 A;  2DB2 A;  2L3J A;  1N34 E;  1HR0 E;  3HQ1 A;  1STU A;  2NUF A;  2KHX A;  4M0V A;  4AQY E;  4M2Z A;  2YT4 A;  2M7Q A;  3ADG A;  1YZ9 A;  2V83 A;  2L2M A;  1HNW E;  3IWB A;  5A2Q C;  4DV4 E;  2YZT A;  4DKK A;  1T4O A;  4J8Z A;  3ZOQ B;  4F9B B;  2V88 A;  4YHH E;  1T4L B;  2E5L E;  2FGG A;  2LUP B;  1WHN A;  3J81 C;  3J7A G;  2LBS B;  2B3T B;  4X8W A;  2RSM A;  4B3R E;  4X66 E;  4BS9 A;  1XNR E;  5F3W A;  2NUE A;  5ADZ A;  4B3S E;  1XNQ E;  2ZM6 E;  4DR4 E;  1DI2 A;  3T1H E;  2JY9 A;  1X48 A;  5IWA E;  4LF5 E;  3FIG A;  4DMI A;  1GZ6 A;  1FKA E;  3ADL A;  4LFB E;  2L8T A;  2LJH A;  2V87 A;  2WZO A;  2DMY A;  4DV1 E;  2ODR C;  1WXR A;  3OML A;  3VYY A;  4P78 A;  3JTZ A;  4DV3 E;  2DIX A;  3K6Q A;  4LF9 E;  4GKJ E;  2B9D A;  2V86 A;  3H09 A;  1N32 E;  3AUZ A;  4WYQ B;  4JI0 E;  1N36 E;  4WPY A;  3JAM C;  5FLX C;  4M30 A;  4DR5 E;  1J5E E;  2UU9 E;  2FTX B;  2JOB A;  2M1S A;  5LMN E;  1I94 E;  3LML A;  4LF4 E;  1UIL A;  3F6H A;  5T6J A;  1YYO A;  2IHR 1;  4JI2 E;  3F6G A;  4KHP E;  1PKP A;  3C4B A;  4I8O A;  5BR8 E;  1FJG E;  2UUB E;  4DUZ E;  2DSY A;  4LTY A;  2UXB E;  4DV2 E;  2UXC E;  4L5N C;  2VE7 C;  5AE2 A;  4JV5 E;  4GKK E;  2LUQ A;  2JVA A;  3DJW A;  4LFC E;  2JR1 A;  1X49 A;  1UHZ A;  2K4V A;  2V85 A;  2JWO A;  3KWR A;  4DR3 E;  4NXM E;  2LTS A;  4OX9 E;  2E1M A;  3DF6 A;  2L33 A;  4DV5 E;  2LTR A;  1IBL E;  4DV7 E;  4LU9 A;  2B7T A;  2N3H A;  2VQE E;  1RC7 A;  1HNZ E;  3ADJ A;  2UUA E;  4F54 A;  4F9A B;  4DUY E;  2HHH E;  2F8B A;  4WFT A;  2L2K B;  4JI3 E;  1DQ3 A;  3OTO E;  2RS6 A;  4DR1 E;  1HNX E;  2UUC E;  3HPZ A;  4BC9 A;  1ZBT A;  5AAS A;  2V8Q B;  1RQ0 A;  3J7Y p;  4DR2 E;  2ODR D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...