2MDRA

Solution structure of the third double-stranded rna-binding domain (dsrbd3) of human adenosine-deaminase adar1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
94
structure length
94
Chain Sequence
MMPNKVRKIGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQEAADAALRVLIGENEKAER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Double-stranded RNA-specific adenosine deaminase
publication title A bimodular nuclear localization signal assembled via an extended double-stranded RNA-binding domain acts as an RNA-sensing signal for transportin 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 26
structure length 94
sequence length 94
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2mdrA00
4GKKE 2L2MA 2HHHE 2UU9E 4NXME 2NUEA 5IWAE 4JV5E 3J7Yp 1I94E 4DV6E 1FKAE 2RS7A 4DUZE 1WHQA 1DI2A 2MDRA 1YZ9A 4DR7E 2LTRA 2LRSA 1IBLE 4LFCE 4M2ZA 1UHZA 2KHXA 2RS6A 4DR5E 1IBME 4DUYE 3T1HE 1PKPA 4LFAE 2RSMA 4DKKA 4DR1E 2B7VA 4JI1E 1HNWE 2JVAA 1N33E 2LJHA 1X49A 4JI5E 2UXBE 1HNZE 2DIXA 2LUPB 2DMYA 3VYYA 4DR2E 2LBSB 1YYWA 4DR3E 5CFFE 2RTXA 1IBKE 2UXDE 2NA2A 4OX9E 2EZ6A 4X8WA 4DV2E 1T4OA 3ADGA 4GKJE 4OOGC 4DV7E 4LF7E 4B3ME 2LUQA 4KHPE 2L3JA 1FJGE 4X64E 4JI6E 3HTXA 5BR8E 4DV4E 4NXNE 2ZM6E 1X47A 4LF9E 4DR6E 4DV3E 2VQEE 1J5EE 2L2KB 1N32E 4X66E 1EKZA 1GQEA 1QU6A 1ZBTA 2YT4A 3LLHA 4WYQB 2NUGA 1J26A 3ADJA 2N3GA 5LMUE 2B3TB 2IHR1 2CPNA 4JI8E 5LMNE 4AQYE 1YYKA 1XMOE 1STUA 4JI7E 2NUFA 2L3CA 1XMQE 2B7TA 3VYXA 1WHNA 4JI3E 1XNQE 2UXCE 1T4LB 4X62E 2VQFE 2N3HA 4DV5E 4LF4E 2L2NA 4X65E 4B3SE 1XNRE 1N34E 3ADIA 4M30A 2E5LE 2LTSA 4JI4E 1N36E 2JY9A 2L33A 4K0KE 4YHHE 4DR4E 4DV0E 1UILA 4WFTA 3ADLA 4B3RE 3C4BA 1HNXE 1RQ0A 4DV1E 4JI2E 3OTOE 2F4VE 1HR0E 4LFBE 1RC7A 2DB2A 1T4NA 2UUBE 4B3TE 1YYOA 4LF6E 3C4TA 1O0WA 2UUCE 3P1XA 4LF8E 3T1YE 2UUAE 4JYAE 4JI0E 4YY3E 1X48A 4LF5E
chains in the Genus database with same CATH superfamily
3THNA 4JV5E 4NXME 1NCSA 4RHBB 1I94E 2V85A 5TSEA 2RS7A 2YU5A 1QNTA 1IQSA 1YZ9A 2EMFA 4KWYA 4M2ZA 2L92A 2KHXA 2B9DA 4DR5E 2EMWA 2EOEA 1MGTA 1HNWE 2B7VA 2EOOA 2JVAA 1N33E 1A1IA 4BBYA 2EPCA 4GZNC 3VYYA 4DR2E 5IV8B 2EOZA 2EP3A 5FLXC 2EJ4A 2LBSB 1IMUA 5KL3A 1YYWA 4DR3E 2RTXA 2JR1A 4O5GA 1SFEA 2I13A 1ZAAC 2EZ6A 2L8TA 1T38A 2EQ1A 2EWLA 2EMZA 4NHRA 4DV7E 2JOXA 2D9HA 2LUQA 1FJGE 2E72A 3MSWA 4JI6E 2ZM6E 5A6JA 4LTYA 2EOFA 2H36X 5AC5A 1EKZA 1QU6A 2YT4A 3LLHA 4WYQB 2NUGA 3HQ1A 3JU0A 4R2RA 2IHR1 2CPNA 4AQYE 3J81C 2YSOA 1A1HA 2VE7C 4RH8A 5AE2A 4JI7E 2NUFA 1ZU1A 4MLQA 2EL6A 1Z1BA 3BGHA 2EOIA 2EOHA 2V86A 3THOB 2ODRD 2I9IA 1T4LB 4X62E 2CT1A 2LV2A 2DGCA 3TQMA 4O4KA 4N4RB 2EM5A 2N3HA 3EPHA 1F2IG 1DGCA 2YTFA 2WCC3 2HJJA 2RSIA 2EPXA 2ENHA 4DR4E 4WFTA 3ADLA 4B3RE 2M9AA 5KL5A 2F4VE 1HR0E 5DNYA 1RC7A 3MHSC 5A6BD 2UUBE 4LF6E 2F8BA 4WX9A 4L8NA 4GKKE 2HHHE 2GHFA 2NUEA 4WSPA 5IWAE 2EPZA 1AAYA 3J7Yp 1BB8A 2GPIA 4DUZE 3C6MA 2MDRA 1NEIA 4DR7E 2EMCA 2LRSA 1IBLE 4LFCE 3KZZA 4DUYE 3LMLA 1PKPA 4LFAE 2RSMA 4DR1E 1YPNA 4JI1E 3RMPA 2YZTA 4O24A 1HNZE 2V88A 2LUPB 2DMYA 1TN9A 3IWDA 4WSGA 2LVHA 1X3CA 5CFFE 2EPNA 5F3WA 3J7AG 5AASA 1GTKA 4TUIA 1YFHA 2DRPA 2M1SA 2EOSA 2PRTA 4DV2E 2VF1A 1PJQA 2ADRA 4BCAA 2EOMA 4X64E 3HTXA 5ADZA 2MC6A 2WZOA 2FV4B 4DV3E 1A1JA 2EM7A 3DJWA 3F6GA 2EMIA 2V87A 2YRMA 5IT9C 1EH8A 1BBOA 2EE8A 2ENAA 2LO3A 3ADJA 3JAMC 4NZVA 1JK1A 2N3GA 4WPYA 1KJKA 5LMNE 2EM8A 2EPKX 1T39A 1A1KA 2EN8A 1EH7A 2B7TA 4P78A 4R2SA 1A1LA 2YTNA 4BHCA 1IQOA 2NABA 2JP9A 2G7HA 2DSYA 4F6NA 1SR9A 1XNQE 3HPZA 3C6KA 4M9VC 2EOYA 5A2QC 2JPAA 2MC5A 2EPOA 3EQ1A 2EMYA 3K6QA 4B3SE 1XNRE 4LU9A 4ZYEA 3JTZA 2EN4A 2YTGA 2EM3A 4JI4E 2L33A 2KOUA 3VHTB 1JK2A 2YTJA 2EL5A 2GLIA 1RQ0A 3BBGA 2EPLX 3OTOE 2MKDA 2YTOA 4LFBE 2EM0A 2LCEA 2DB2A 4R2QA 1O0WA 2UUCE 4FK5C 2Q8UA 2R76A 3T1YE 1L4SA 1PJTA 2L2MA 2UU9E 2EM4A 1G2FC 4DV6E 3IWBA 2RPCA 1DI2A 1X5WA 2E1MA 1PDAA 5AE1A 2LTRA 4I8OA 1UHZA 5KL6A 2JWOA 1IBME 1WJPA 3T1HE 4F9CB 3FIGA 4F54A 1X6FA 2EOQA 4R8OA 4JI5E 4HEIA 1BBGA 3ZOQB 2WBUA 2FGGA 2EPAA 2M7QA 2NA2A 2LJUA 2N8XA 5KL2A 4X8WA 4Q35B 4R2DA 5T6JA 3KZYA 3ADGA 1LLMC 4R2PA 2EQ0A 2LMZA 3HXLA 4ZYHA 4KHPE 3HPSA 3AV0A 2EMGA 2K7IA 4WXCA 5BR8E 4NXNE 5A69A 3OMLA 1X47A 2RQLA 1J5EE 2L2KB 2VRDA 3IWCA 1N32E 1EH6A 1X6EA 2EMAA 2EN2A 1GQEA 1ZBTA 1J26A 3BF2A 3J80C 2EPUA 2B3TB 4BMJA 4BC7A 4F2JC 1XMOE 1STUA 1YUJA 2K4VA 2LT7A 1XMQE 3VYXA 1MEYC 4JI3E 3BIDA 5KL4A 2EMLA 4BS9A 2UXCE 1KYQA 2VQFE 4Q28A 2KONA 4DV5E 2V8QB 4R2CA 3M99B 5A6AA 2EQ3A 2MDGA 2ELYA 1GZ6A 3KWRA 4X65E 3VK6A 3ADIA 2R1FA 2E5LE 2LTSA 1N36E 2EL4A 4ZYGA 4YHHE 2V83A 4DV0E 1UILA 1A1FA 2DLQA 1HNXE 2YTQA 4DV1E 4F9AB 5IXMB 4BC9A 1T4NA 1ZBQA 4DMIA 2FTXB 4IS1C 1YYOA 1AH5A 5LLQA 2UUAE 4JYAE 4JI0E 3ECRA 4YY3E 1WRJA 2EMHA 2EPPA 2EM2A 1FKAE 4X9JA 2EMKA 4F9BB 1WHQA 1TF3A 5AC4A 2YRKA 4M0VA 2RS6A 1A1GA 2L6MA 1DQ3A 2EPMX 4DKKA 4ZYDA 2ODRC 2LJHA 1X49A 2UXBE 1B69A 2DIXA 2EN7A 2EM9A 2JXPA 1RMDA 2HGHA 2CSHA 4MLVA 3AUZA 1IBKE 2UXDE 4OX9E 2EN3A 4J8ZA 1N3GA 4KZSA 4P7DA 2M4IA 1TF6A 1T4OA 4GKJE 2YTIA 4OOGC 4IJDA 2JOBA 3L00A 4LF7E 4B3ME 2L3JA 2JYAA 2DMIA 4DV4E 2WBSA 3QG5C 4LF9E 4DR6E 2EN6A 3UK3C 1UN6B 2EOXA 5A6BA 2VQEE 2BB8A 4O43A 2EN1A 4R2AA 4X66E 3MHHC 2ELZA 2YU8A 2YTEA 4TUGA 1YSAC 4GEQB 4BHBA 5KL7A 5LMUE 3DF6A 1PJSA 4JI8E 1YYKA 2EMXA 2A25A 2YSPA 2YTDA 2YPNA 4R2EA 1ZR9A 2L3CA 2YWQA 2EPRA 1WHNA 1UBDC 1P47A 2WBTA 2MKNA 1YUIA 2BBGA 4R03A 1X6HA 2EOJA 2J7JA 4F6MA 3F6HA 4LF4E 2YTPA 2L2NA 3EPKA 5AE3A 1G2DC 1N34E 4WXDA 4M30A 2DLKA 2JY9A 4K0KE 1WXRA 5A6KA 2CTDA 5LL6R 2YRHA 3C4BA 4L5NC 3EPJA 2V89A 4HTGA 4JI2E 2HC5A 2EORA 2EM6A 2ENCA 4B3TE 3H09A 3C4TA 3P1XA 2LE2A 2EMBA 4LF8E 3EPLA 1X48A 4LF5E
chains in the Genus database with same CATH topology
4GKKE 2L2MA 2HHHE 2UU9E 4NXME 4WSPA 5IWAE 2NUEA 4JV5E 3J7Yp 1I94E 4DV6E 2V85A 1FKAE 3IWBA 2RS7A 4F9BB 4DUZE 1WHQA 1DI2A 2E1MA 2MDRA 1YZ9A 5AE1A 4DR7E 2LTRA 2LRSA 1IBLE 4I8OA 4LFCE 4M2ZA 2L92A 1UHZA 2KHXA 2B9DA 2JWOA 2RS6A 2L6MA 4M0VA 4DR5E 1IBME 4DUYE 4F9CB 1DQ3A 3LMLA 3T1HE 1PKPA 3FIGA 4LFAE 2RSMA 4DKKA 4DR1E 2B7VA 4F54A 4JI1E 1HNWE 3RMPA 2JVAA 2ODRC 1N33E 2LJHA 1X49A 2YZTA 4R8OA 4JI5E 1HNZE 2UXBE 2DIXA 2V88A 4BBYA 2LUPB 2DMYA 3ZOQB 3IWDA 3VYYA 4DR2E 5FLXC 2LBSB 1YYWA 4DR3E 2FGGA 5CFFE 5F3WA 2RTXA 3AUZA 1IBKE 2UXDE 2M7QA 2NA2A 4OX9E 3J7AG 5AASA 2JR1A 4J8ZA 4TUIA 2EZ6A 4X8WA 2L8TA 4KZSA 2M1SA 4P7DA 2M4IA 5T6JA 1T4OA 3ADGA 4DV2E 2EWLA 4GKJE 4OOGC 2VF1A 4DV7E 2JOBA 2LMZA 3HXLA 2JOXA 4B3ME 2LUQA 4LF7E 4KHPE 4BCAA 2L3JA 3HPSA 1FJGE 3AV0A 3MSWA 4X64E 4JI6E 3HTXA 5ADZA 5BR8E 2MC6A 4DV4E 4NXNE 3OMLA 2ZM6E 1X47A 2FV4B 2WZOA 4LF9E 4DV3E 4B3TE 4DR6E 4LTYA 3DJWA 2VQEE 1J5EE 3F6GA 2L2KB 2H36X 2V87A 4LF6E 3IWCA 1N32E 5IT9C 4X66E 1EKZA 1GQEA 1QU6A 1ZBTA 2YT4A 3LLHA 4WYQB 2NUGA 3J80C 1J26A 3JAMC 3ADJA 3HQ1A 4TUGA 3JU0A 4GEQB 2N3GA 5LMUE 2B3TB 4BMJA 2IHR1 3DF6A 2CPNA 4WPYA 4JI8E 5LMNE 4BC7A 3J81C 4AQYE 1YYKA 1XMOE 2VE7C 1STUA 5AE2A 4JI7E 2NUFA 2K4VA 2L3CA 1XMQE 2B7TA 3VYXA 1WHNA 4P78A 4JI3E 2G7HA 2DSYA 4R03A 4BS9A 1SR9A 1XNQE 2V86A 3HPZA 2UXCE 2ODRD 1T4LB 4X62E 2VQFE 4Q28A 5A2QC 2KONA 3F6HA 2N3HA 2MC5A 4DV5E 4LF4E 2V8QB 2L2NA 5AE3A 3K6QA 1GZ6A 3KWRA 4X65E 4B3SE 1XNRE 4LU9A 3VK6A 1N34E 3ADIA 3JTZA 4M30A 2E5LE 2LTSA 4JI4E 1N36E 2JY9A 2L33A 4K0KE 2KOUA 1WXRA 4YHHE 2V83A 4DR4E 4DV0E 1UILA 4WFTA 3ADLA 4B3RE 5LL6R 3C4BA 4L5NC 1HNXE 1RQ0A 2V89A 4DV1E 4JI2E 4F9AB 3OTOE 2F4VE 1HR0E 4LFBE 5DNYA 1RC7A 4BC9A 2DB2A 1T4NA 1ZBQA 2UUBE 3H09A 4DMIA 2FTXB 3C4TA 1O0WA 1YYOA 2UUCE 3P1XA 2LE2A 4LF8E 3T1YE 2F8BA 2UUAE 4L8NA 4JYAE 4JI0E 4YY3E 1X48A 4LF5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKK E;  2L2M A;  2HHH E;  2UU9 E;  4NXM E;  2NUE A;  5IWA E;  4JV5 E;  3J7Y p;  1I94 E;  4DV6 E;  1FKA E;  2RS7 A;  4DUZ E;  1WHQ A;  1DI2 A;  2MDR A;  1YZ9 A;  4DR7 E;  2LTR A;  2LRS A;  1IBL E;  4LFC E;  4M2Z A;  1UHZ A;  2KHX A;  2RS6 A;  4DR5 E;  1IBM E;  4DUY E;  3T1H E;  1PKP A;  4LFA E;  2RSM A;  4DKK A;  4DR1 E;  2B7V A;  4JI1 E;  1HNW E;  2JVA A;  1N33 E;  2LJH A;  1X49 A;  4JI5 E;  2UXB E;  1HNZ E;  2DIX A;  2LUP B;  2DMY A;  3VYY A;  4DR2 E;  2LBS B;  1YYW A;  4DR3 E;  5CFF E;  2RTX A;  1IBK E;  2UXD E;  2NA2 A;  4OX9 E;  2EZ6 A;  4X8W A;  4DV2 E;  1T4O A;  3ADG A;  4GKJ E;  4OOG C;  4DV7 E;  4LF7 E;  4B3M E;  2LUQ A;  4KHP E;  2L3J A;  1FJG E;  4X64 E;  4JI6 E;  3HTX A;  5BR8 E;  4DV4 E;  4NXN E;  2ZM6 E;  1X47 A;  4LF9 E;  4DR6 E;  4DV3 E;  2VQE E;  1J5E E;  2L2K B;  1N32 E;  4X66 E;  1EKZ A;  1GQE A;  1QU6 A;  1ZBT A;  2YT4 A;  3LLH A;  4WYQ B;  2NUG A;  1J26 A;  3ADJ A;  2N3G A;  5LMU E;  2B3T B;  2IHR 1;  2CPN A;  4JI8 E;  5LMN E;  4AQY E;  1YYK A;  1XMO E;  1STU A;  4JI7 E;  2NUF A;  2L3C A;  1XMQ E;  2B7T A;  3VYX A;  1WHN A;  4JI3 E;  1XNQ E;  2UXC E;  1T4L B;  4X62 E;  2VQF E;  2N3H A;  4DV5 E;  4LF4 E;  2L2N A;  4X65 E;  4B3S E;  1XNR E;  1N34 E;  3ADI A;  4M30 A;  2E5L E;  2LTS A;  4JI4 E;  1N36 E;  2JY9 A;  2L33 A;  4K0K E;  4YHH E;  4DR4 E;  4DV0 E;  1UIL A;  4WFT A;  3ADL A;  4B3R E;  3C4B A;  1HNX E;  1RQ0 A;  4DV1 E;  4JI2 E;  3OTO E;  2F4V E;  1HR0 E;  4LFB E;  1RC7 A;  2DB2 A;  1T4N A;  2UUB E;  4B3T E;  1YYO A;  4LF6 E;  3C4T A;  1O0W A;  2UUC E;  3P1X A;  4LF8 E;  3T1Y E;  2UUA E;  4JYA E;  4JI0 E;  4YY3 E;  1X48 A;  4LF5 E; 
#chains in the Genus database with same CATH topology
 3THN A;  4JV5 E;  4NXM E;  1NCS A;  4RHB B;  1I94 E;  2V85 A;  5TSE A;  2RS7 A;  2YU5 A;  1QNT A;  1IQS A;  1YZ9 A;  2EMF A;  4KWY A;  4M2Z A;  2L92 A;  2KHX A;  2B9D A;  4DR5 E;  2EMW A;  2EOE A;  1MGT A;  1HNW E;  2B7V A;  2EOO A;  2JVA A;  1N33 E;  1A1I A;  4BBY A;  2EPC A;  4GZN C;  3VYY A;  4DR2 E;  5IV8 B;  2EOZ A;  2EP3 A;  5FLX C;  2EJ4 A;  2LBS B;  1IMU A;  5KL3 A;  1YYW A;  4DR3 E;  2RTX A;  2JR1 A;  4O5G A;  1SFE A;  2I13 A;  1ZAA C;  2EZ6 A;  2L8T A;  1T38 A;  2EQ1 A;  2EWL A;  2EMZ A;  4NHR A;  4DV7 E;  2JOX A;  2D9H A;  2LUQ A;  1FJG E;  2E72 A;  3MSW A;  4JI6 E;  2ZM6 E;  5A6J A;  4LTY A;  2EOF A;  2H36 X;  5AC5 A;  1EKZ A;  1QU6 A;  2YT4 A;  3LLH A;  4WYQ B;  2NUG A;  3HQ1 A;  3JU0 A;  4R2R A;  2IHR 1;  2CPN A;  4AQY E;  3J81 C;  2YSO A;  1A1H A;  2VE7 C;  4RH8 A;  5AE2 A;  4JI7 E;  2NUF A;  1ZU1 A;  4MLQ A;  2EL6 A;  1Z1B A;  3BGH A;  2EOI A;  2EOH A;  2V86 A;  3THO B;  2ODR D;  2I9I A;  1T4L B;  4X62 E;  2CT1 A;  2LV2 A;  2DGC A;  3TQM A;  4O4K A;  4N4R B;  2EM5 A;  2N3H A;  3EPH A;  1F2I G;  1DGC A;  2YTF A;  2WCC 3;  2HJJ A;  2RSI A;  2EPX A;  2ENH A;  4DR4 E;  4WFT A;  3ADL A;  4B3R E;  2M9A A;  5KL5 A;  2F4V E;  1HR0 E;  5DNY A;  1RC7 A;  3MHS C;  5A6B D;  2UUB E;  4LF6 E;  2F8B A;  4WX9 A;  4L8N A;  4GKK E;  2HHH E;  2GHF A;  2NUE A;  4WSP A;  5IWA E;  2EPZ A;  1AAY A;  3J7Y p;  1BB8 A;  2GPI A;  4DUZ E;  3C6M A;  2MDR A;  1NEI A;  4DR7 E;  2EMC A;  2LRS A;  1IBL E;  4LFC E;  3KZZ A;  4DUY E;  3LML A;  1PKP A;  4LFA E;  2RSM A;  4DR1 E;  1YPN A;  4JI1 E;  3RMP A;  2YZT A;  4O24 A;  1HNZ E;  2V88 A;  2LUP B;  2DMY A;  1TN9 A;  3IWD A;  4WSG A;  2LVH A;  1X3C A;  5CFF E;  2EPN A;  5F3W A;  3J7A G;  5AAS A;  1GTK A;  4TUI A;  1YFH A;  2DRP A;  2M1S A;  2EOS A;  2PRT A;  4DV2 E;  2VF1 A;  1PJQ A;  2ADR A;  4BCA A;  2EOM A;  4X64 E;  3HTX A;  5ADZ A;  2MC6 A;  2WZO A;  2FV4 B;  4DV3 E;  1A1J A;  2EM7 A;  3DJW A;  3F6G A;  2EMI A;  2V87 A;  2YRM A;  5IT9 C;  1EH8 A;  1BBO A;  2EE8 A;  2ENA A;  2LO3 A;  3ADJ A;  3JAM C;  4NZV A;  1JK1 A;  2N3G A;  4WPY A;  1KJK A;  5LMN E;  2EM8 A;  2EPK X;  1T39 A;  1A1K A;  2EN8 A;  1EH7 A;  2B7T A;  4P78 A;  4R2S A;  1A1L A;  2YTN A;  4BHC A;  1IQO A;  2NAB A;  2JP9 A;  2G7H A;  2DSY A;  4F6N A;  1SR9 A;  1XNQ E;  3HPZ A;  3C6K A;  4M9V C;  2EOY A;  5A2Q C;  2JPA A;  2MC5 A;  2EPO A;  3EQ1 A;  2EMY A;  3K6Q A;  4B3S E;  1XNR E;  4LU9 A;  4ZYE A;  3JTZ A;  2EN4 A;  2YTG A;  2EM3 A;  4JI4 E;  2L33 A;  2KOU A;  3VHT B;  1JK2 A;  2YTJ A;  2EL5 A;  2GLI A;  1RQ0 A;  3BBG A;  2EPL X;  3OTO E;  2MKD A;  2YTO A;  4LFB E;  2EM0 A;  2LCE A;  2DB2 A;  4R2Q A;  1O0W A;  2UUC E;  4FK5 C;  2Q8U A;  2R76 A;  3T1Y E;  1L4S A;  1PJT A;  2L2M A;  2UU9 E;  2EM4 A;  1G2F C;  4DV6 E;  3IWB A;  2RPC A;  1DI2 A;  1X5W A;  2E1M A;  1PDA A;  5AE1 A;  2LTR A;  4I8O A;  1UHZ A;  5KL6 A;  2JWO A;  1IBM E;  1WJP A;  3T1H E;  4F9C B;  3FIG A;  4F54 A;  1X6F A;  2EOQ A;  4R8O A;  4JI5 E;  4HEI A;  1BBG A;  3ZOQ B;  2WBU A;  2FGG A;  2EPA A;  2M7Q A;  2NA2 A;  2LJU A;  2N8X A;  5KL2 A;  4X8W A;  4Q35 B;  4R2D A;  5T6J A;  3KZY A;  3ADG A;  1LLM C;  4R2P A;  2EQ0 A;  2LMZ A;  3HXL A;  4ZYH A;  4KHP E;  3HPS A;  3AV0 A;  2EMG A;  2K7I A;  4WXC A;  5BR8 E;  4NXN E;  5A69 A;  3OML A;  1X47 A;  2RQL A;  1J5E E;  2L2K B;  2VRD A;  3IWC A;  1N32 E;  1EH6 A;  1X6E A;  2EMA A;  2EN2 A;  1GQE A;  1ZBT A;  1J26 A;  3BF2 A;  3J80 C;  2EPU A;  2B3T B;  4BMJ A;  4BC7 A;  4F2J C;  1XMO E;  1STU A;  1YUJ A;  2K4V A;  2LT7 A;  1XMQ E;  3VYX A;  1MEY C;  4JI3 E;  3BID A;  5KL4 A;  2EML A;  4BS9 A;  2UXC E;  1KYQ A;  2VQF E;  4Q28 A;  2KON A;  4DV5 E;  2V8Q B;  4R2C A;  3M99 B;  5A6A A;  2EQ3 A;  2MDG A;  2ELY A;  1GZ6 A;  3KWR A;  4X65 E;  3VK6 A;  3ADI A;  2R1F A;  2E5L E;  2LTS A;  1N36 E;  2EL4 A;  4ZYG A;  4YHH E;  2V83 A;  4DV0 E;  1UIL A;  1A1F A;  2DLQ A;  1HNX E;  2YTQ A;  4DV1 E;  4F9A B;  5IXM B;  4BC9 A;  1T4N A;  1ZBQ A;  4DMI A;  2FTX B;  4IS1 C;  1YYO A;  1AH5 A;  5LLQ A;  2UUA E;  4JYA E;  4JI0 E;  3ECR A;  4YY3 E;  1WRJ A;  2EMH A;  2EPP A;  2EM2 A;  1FKA E;  4X9J A;  2EMK A;  4F9B B;  1WHQ A;  1TF3 A;  5AC4 A;  2YRK A;  4M0V A;  2RS6 A;  1A1G A;  2L6M A;  1DQ3 A;  2EPM X;  4DKK A;  4ZYD A;  2ODR C;  2LJH A;  1X49 A;  2UXB E;  1B69 A;  2DIX A;  2EN7 A;  2EM9 A;  2JXP A;  1RMD A;  2HGH A;  2CSH A;  4MLV A;  3AUZ A;  1IBK E;  2UXD E;  4OX9 E;  2EN3 A;  4J8Z A;  1N3G A;  4KZS A;  4P7D A;  2M4I A;  1TF6 A;  1T4O A;  4GKJ E;  2YTI A;  4OOG C;  4IJD A;  2JOB A;  3L00 A;  4LF7 E;  4B3M E;  2L3J A;  2JYA A;  2DMI A;  4DV4 E;  2WBS A;  3QG5 C;  4LF9 E;  4DR6 E;  2EN6 A;  3UK3 C;  1UN6 B;  2EOX A;  5A6B A;  2VQE E;  2BB8 A;  4O43 A;  2EN1 A;  4R2A A;  4X66 E;  3MHH C;  2ELZ A;  2YU8 A;  2YTE A;  4TUG A;  1YSA C;  4GEQ B;  4BHB A;  5KL7 A;  5LMU E;  3DF6 A;  1PJS A;  4JI8 E;  1YYK A;  2EMX A;  2A25 A;  2YSP A;  2YTD A;  2YPN A;  4R2E A;  1ZR9 A;  2L3C A;  2YWQ A;  2EPR A;  1WHN A;  1UBD C;  1P47 A;  2WBT A;  2MKN A;  1YUI A;  2BBG A;  4R03 A;  1X6H A;  2EOJ A;  2J7J A;  4F6M A;  3F6H A;  4LF4 E;  2YTP A;  2L2N A;  3EPK A;  5AE3 A;  1G2D C;  1N34 E;  4WXD A;  4M30 A;  2DLK A;  2JY9 A;  4K0K E;  1WXR A;  5A6K A;  2CTD A;  5LL6 R;  2YRH A;  3C4B A;  4L5N C;  3EPJ A;  2V89 A;  4HTG A;  4JI2 E;  2HC5 A;  2EOR A;  2EM6 A;  2ENC A;  4B3T E;  3H09 A;  3C4T A;  3P1X A;  2LE2 A;  2EMB A;  4LF8 E;  3EPL A;  1X48 A;  4LF5 E; 
#chains in the Genus database with same CATH homology
 4GKK E;  2L2M A;  2HHH E;  2UU9 E;  4NXM E;  4WSP A;  5IWA E;  2NUE A;  4JV5 E;  3J7Y p;  1I94 E;  4DV6 E;  2V85 A;  1FKA E;  3IWB A;  2RS7 A;  4F9B B;  4DUZ E;  1WHQ A;  1DI2 A;  2E1M A;  2MDR A;  1YZ9 A;  5AE1 A;  4DR7 E;  2LTR A;  2LRS A;  1IBL E;  4I8O A;  4LFC E;  4M2Z A;  2L92 A;  1UHZ A;  2KHX A;  2B9D A;  2JWO A;  2RS6 A;  2L6M A;  4M0V A;  4DR5 E;  1IBM E;  4DUY E;  4F9C B;  1DQ3 A;  3LML A;  3T1H E;  1PKP A;  3FIG A;  4LFA E;  2RSM A;  4DKK A;  4DR1 E;  2B7V A;  4F54 A;  4JI1 E;  1HNW E;  3RMP A;  2JVA A;  2ODR C;  1N33 E;  2LJH A;  1X49 A;  2YZT A;  4R8O A;  4JI5 E;  1HNZ E;  2UXB E;  2DIX A;  2V88 A;  4BBY A;  2LUP B;  2DMY A;  3ZOQ B;  3IWD A;  3VYY A;  4DR2 E;  5FLX C;  2LBS B;  1YYW A;  4DR3 E;  2FGG A;  5CFF E;  5F3W A;  2RTX A;  3AUZ A;  1IBK E;  2UXD E;  2M7Q A;  2NA2 A;  4OX9 E;  3J7A G;  5AAS A;  2JR1 A;  4J8Z A;  4TUI A;  2EZ6 A;  4X8W A;  2L8T A;  4KZS A;  2M1S A;  4P7D A;  2M4I A;  5T6J A;  1T4O A;  3ADG A;  4DV2 E;  2EWL A;  4GKJ E;  4OOG C;  2VF1 A;  4DV7 E;  2JOB A;  2LMZ A;  3HXL A;  2JOX A;  4B3M E;  2LUQ A;  4LF7 E;  4KHP E;  4BCA A;  2L3J A;  3HPS A;  1FJG E;  3AV0 A;  3MSW A;  4X64 E;  4JI6 E;  3HTX A;  5ADZ A;  5BR8 E;  2MC6 A;  4DV4 E;  4NXN E;  3OML A;  2ZM6 E;  1X47 A;  2FV4 B;  2WZO A;  4LF9 E;  4DV3 E;  4B3T E;  4DR6 E;  4LTY A;  3DJW A;  2VQE E;  1J5E E;  3F6G A;  2L2K B;  2H36 X;  2V87 A;  4LF6 E;  3IWC A;  1N32 E;  5IT9 C;  4X66 E;  1EKZ A;  1GQE A;  1QU6 A;  1ZBT A;  2YT4 A;  3LLH A;  4WYQ B;  2NUG A;  3J80 C;  1J26 A;  3JAM C;  3ADJ A;  3HQ1 A;  4TUG A;  3JU0 A;  4GEQ B;  2N3G A;  5LMU E;  2B3T B;  4BMJ A;  2IHR 1;  3DF6 A;  2CPN A;  4WPY A;  4JI8 E;  5LMN E;  4BC7 A;  3J81 C;  4AQY E;  1YYK A;  1XMO E;  2VE7 C;  1STU A;  5AE2 A;  4JI7 E;  2NUF A;  2K4V A;  2L3C A;  1XMQ E;  2B7T A;  3VYX A;  1WHN A;  4P78 A;  4JI3 E;  2G7H A;  2DSY A;  4R03 A;  4BS9 A;  1SR9 A;  1XNQ E;  2V86 A;  3HPZ A;  2UXC E;  2ODR D;  1T4L B;  4X62 E;  2VQF E;  4Q28 A;  5A2Q C;  2KON A;  3F6H A;  2N3H A;  2MC5 A;  4DV5 E;  4LF4 E;  2V8Q B;  2L2N A;  5AE3 A;  3K6Q A;  1GZ6 A;  3KWR A;  4X65 E;  4B3S E;  1XNR E;  4LU9 A;  3VK6 A;  1N34 E;  3ADI A;  3JTZ A;  4M30 A;  2E5L E;  2LTS A;  4JI4 E;  1N36 E;  2JY9 A;  2L33 A;  4K0K E;  2KOU A;  1WXR A;  4YHH E;  2V83 A;  4DR4 E;  4DV0 E;  1UIL A;  4WFT A;  3ADL A;  4B3R E;  5LL6 R;  3C4B A;  4L5N C;  1HNX E;  1RQ0 A;  2V89 A;  4DV1 E;  4JI2 E;  4F9A B;  3OTO E;  2F4V E;  1HR0 E;  4LFB E;  5DNY A;  1RC7 A;  4BC9 A;  2DB2 A;  1T4N A;  1ZBQ A;  2UUB E;  3H09 A;  4DMI A;  2FTX B;  3C4T A;  1O0W A;  1YYO A;  2UUC E;  3P1X A;  2LE2 A;  4LF8 E;  3T1Y E;  2F8B A;  2UUA E;  4L8N A;  4JYA E;  4JI0 E;  4YY3 E;  1X48 A;  4LF5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...