2MDRA

Solution structure of the third double-stranded rna-binding domain (dsrbd3) of human adenosine-deaminase adar1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
94
structure length
94
Chain Sequence
MMPNKVRKIGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQEAADAALRVLIGENEKAER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A bimodular nuclear localization signal assembled via an extended double-stranded RNA-binding domain acts as an RNA-sensing signal for transportin 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Double-stranded RNA-specific adenosine deaminase
total genus 26
structure length 94
sequence length 94
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2mdrA00
2LUQA 4B3TE 1QU6A 3VYYA 2JVAA 4DR5E 4WYQB 4JI5E 2E5LE 4DKKA 4DR4E 4GKJE 2F4VE 4AQYE 1N32E 2DB2A 2N3HA 3J7Yp 2MDRA 2NUGA 4LF9E 2UXBE 1ZBTA 4B3ME 1HR0E 3ADLA 2JY9A 1XNQE 1UILA 1J26A 1DI2A 4LF7E 4YY3E 2RSMA 1HNXE 4JYAE 1PKPA 4X66E 4B3SE 2NUFA 4JI7E 4DV5E 2LTSA 1RC7A 4JI4E 4LFCE 1J5EE 1IBME 2RTXA 4JI1E 4LFBE 2IHR1 2RS7A 4DV7E 5IWAE 3OTOE 1XMQE 4DV4E 2B7VA 1T4LB 1YYWA 2LJHA 2YT4A 4X62E 1FJGE 1HNZE 4WFTA 1O0WA 2B3TB 4JI0E 4LF8E 4DR7E 2L3JA 5LMUE 2N3GA 4DR1E 4DV2E 1T4OA 2DIXA 4X64E 4OX9E 2L2MA 4LF6E 2CPNA 1N33E 1XNRE 4LF4E 3VYXA 2HHHE 3LLHA 4NXNE 1HNWE 4DV1E 4OOGC 2UXDE 4DUYE 1I94E 2VQEE 1YYOA 2LUPB 4X8WA 2VQFE 4DR6E 1STUA 4DV0E 3C4TA 4NXME 2EZ6A 1WHNA 1WHQA 5LMNE 1IBKE 3HTXA 3ADGA 2UUBE 4JI2E 2L2KB 4DUZE 1T4NA 2L33A 2LTRA 4M2ZA 4DV6E 2L3CA 2ZM6E 2L2NA 4B3RE 2LRSA 1X48A 1XMOE 1X47A 1FKAE 4YHHE 1YZ9A 4K0KE 2NUEA 2UU9E 2RS6A 3ADJA 4LFAE 3ADIA 5BR8E 2NA2A 4JI3E 4X65E 4LF5E 1IBLE 4JV5E 1UHZA 2UXCE 2KHXA 2LBSB 1X49A 4JI8E 4DV3E 2DMYA 3T1YE 4DR2E 3C4BA 4KHPE 2B7TA 4JI6E 3P1XA 5CFFE 1N36E 4M30A 2UUAE 1GQEA 4GKKE 1YYKA 2UUCE 1RQ0A 1N34E 3T1HE 4DR3E 1EKZA
chains in the Genus database with same CATH superfamily
3VYYA 2JVAA 1ZU1A 4WYQB 4BHCA 2MDGA 4R2QA 4AQYE 1IQSA 2EQ0A 2UXBE 1ZBTA 2VRDA 3RMPA 1PJSA 2EPCA 2N8XA 1A1IA 4LF7E 2GLIA 5AC4A 2YRMA 1PKPA 2EPXA 4B3SE 2V83A 3EPJA 2JXPA 2EMZA 2Q8UA 2ADRA 2VF1A 3JTZA 3HPSA 2LTSA 2WBTA 4TUIA 1RC7A 2V8QB 1IBME 2RTXA 5AE2A 2EN4A 5KL6A 2EOXA 5IWAE 3KZYA 2EOYA 2HGHA 4WSGA 3J80C 4DV4E 2B7VA 3C6KA 2YRKA 2LJHA 2PRTA 4WXCA 1FJGE 4GEQB 3J7AG 2R1FA 2B9DA 3VHTB 3ZOQB 5LMUE 2N3GA 4N4RB 3BGHA 4J8ZA 2DIXA 1PJTA 4X64E 1A1FA 4LF6E 1NEIA 1DQ3A 4R2PA 1SFEA 2EQ3A 2ENAA 5AASA 2EPLX 3ECRA 1F2IG 2VQEE 2EN3A 4X8WA 1ZR9A 4X9JA 1STUA 2JP9A 1Z1BA 1JK2A 3AV0A 1WHNA 1P47A 1WHQA 1IBKE 3EQ1A 4WXDA 2BB8A 3IWBA 4DUZE 2L33A 2DMIA 4BBYA 4R2DA 4DV6E 1X6EA 2EMFA 3TQMA 2ELZA 2LJUA 2E1MA 4Q35B 4O43A 4BHBA 3EPKA 1X47A 4YHHE 1NCSA 2UU9E 5BR8E 2NA2A 4JV5E 3THOB 2KHXA 4GZNC 2YTPA 4JI8E 2DSYA 3C4BA 1MGTA 4IS1C 2B7TA 3HPZA 2F8BA 2EMBA 2UUAE 1GQEA 2FGGA 4IJDA 4BC7A 5A6AA 4DR3E 2CT1A 2EN7A 2YWQA 4B3TE 3QG5C 1QU6A 4DR5E 4JI5E 5A6BD 4DR4E 1EH7A 3EPLA 1EH8A 2N3HA 3J7Yp 1G2FC 2EMKA 2MKDA 3DJWA 2V88A 5KL3A 5LL6R 4MLQA 1A1KA 4B3ME 3LMLA 1HR0E 2EOOA 2V86A 3C6MA 1UILA 1EH6A 1YUIA 1J26A 1DI2A 2EP3A 1TN9A 2M1SA 4BS9A 2CTDA 2EMIA 3HQ1A 4F9BB 4JI7E 2EOJA 1YUJA 2EM5A 4R2AA 4F54A 4LFCE 1J5EE 2K4VA 2EM4A 1X3CA 2EMGA 4JI1E 4RH8A 1IQOA 3JU0A 3IWCA 1A1JA 3VK6A 1X5WA 4Q28A 2EMAA 2FTXB 4R2EA 2MC6A 2EN2A 1MEYC 2HC5A 1UBDC 4OX9E 2L2MA 3IWDA 4M0VA 2DLQA 2HHHE 1TF3A 3LLHA 4NXNE 2UXDE 2ENHA 2WCC3 4DUYE 1PJQA 1RMDA 1A1HA 4WX9A 2K7IA 5KL5A 2EMYA 2EM9A 2EM0A 3M99B 2LCEA 2EZ6A 2EPAA 3DF6A 4O5GA 1YPNA 3JAMC 2YTIA 3ADGA 1AAYA 2L2KB 2EE8A 3MHHC 4R2CA 4M2ZA 2EL4A 2L3CA 3MHSC 2MC5A 1QNTA 4L5NC 1X6HA 2L92A 4X65E 4JI3E 4LF5E 2M4IA 4M9VC 1UHZA 4P7DA 3KZZA 4ZYDA 2UXCE 1A1LA 1YFHA 5IV8B 4DV3E 2DMYA 2YPNA 3T1YE 1X6FA 4DR2E 3K6QA 2EOEA 2I9IA 2D9HA 2EQ1A 2LT7A 3P1XA 1N36E 2EMWA 2JOBA 4WPYA 4GKKE 2YSPA 2RQLA 4F9AB 1N34E 3ADLA 1GTKA 2JOXA 2LUQA 4R2RA 1JK1A 2DRPA 2EN8A 2DB2A 4LF9E 2YTNA 2YTFA 2EMXA 2HJJA 1WJPA 3MSWA 5IT9C 1XNQE 2NABA 1ZBQA 5F3WA 4P78A 2EPMX 2RSMA 1HNXE 4JYAE 3AUZA 2NUFA 4LTYA 3H09A 2GHFA 5ADZA 4F2JC 1AH5A 3HXLA 5DNYA 3KWRA 2EORA 2EN1A 4JI4E 2WBSA 2YTEA 1L4SA 2EOQA 2IHR1 2RS7A 1T38A 4DV7E 3OTOE 4KWYA 2KOUA 2G7HA 1T4LB 2JWOA 1YYWA 5T6JA 4R8OA 1T39A 4X62E 2DGCA 2EPZA 3EPHA 1O0WA 2EL6A 2EM2A 2B3TB 4JI0E 4LF8E 4NHRA 2H36X 4DR1E 1T4OA 2EMCA 1YSAC 3F6GA 1N33E 1XNRE 4LF4E 2I13A 3J81C 1WRJA 5KL2A 1I94E 2EJ4A 5A6KA 2LUPB 2EPUA 2VQFE 1BBGA 4TUGA 2MKNA 4DR6E 4HEIA 1GZ6A 5A6BA 2CSHA 2A25A 2YRHA 2YSOA 4L8NA 2ELYA 2EMHA 2ENCA 2UUBE 1T4NA 3FIGA 2ODRD 2ZM6E 5A2QC 4F6MA 1X48A 2LO3A 2LMZA 2EM7A 4LFAE 5LLQA 3THNA 2LVHA 1IBLE 2WZOA 1ZAAC 2EMLA 4BMJA 4R2SA 2EOHA 2YZTA 2YU5A 4KHPE 1PDAA 4JI6E 1B69A 2YTOA 5CFFE 4M30A 1UN6B 2UUCE 1KJKA 1RQ0A 2E72A 2FV4B 2BBGA 2EM6A 3L00A 2EOMA 4NZVA 4ZYHA 2JPAA 2EPNA 4R03A 2E5LE 4DKKA 4GKJE 5AC5A 2F4VE 1N32E 2MDRA 2NUGA 2EPRA 4WSPA 5AE3A 1SR9A 3BF2A 1DGCA 2JY9A 3F6HA 2VE7C 4F9CB 4YY3E 4O24A 4X66E 1A1GA 1G2DC 4O4KA 2EL5A 2RPCA 4DV5E 1LLMC 1KYQA 2EOFA 1TF6A 2V87A 5KL7A 2EOIA 4MLVA 4LFBE 2ODRC 5AE1A 2JYAA 5FLXC 4LU9A 5A69A 1XMQE 2YT4A 2EPKX 1HNZE 4WFTA 4BCAA 2YTGA 2EPOA 2L3JA 4DR7E 4DV2E 2WBUA 2YTQA 2EM3A 2CPNA 3VYXA 2YTDA 2LV2A 1HNWE 1N3GA 2EOZA 4DV1E 4OOGC 2LE2A 4ZYEA 3BBGA 5TSEA 4ZYGA 3OMLA 1YYOA 2YTJA 2EN6A 4KZSA 2M7QA 4RHBB 4F6NA 2JR1A 2M9AA 2L6MA 4DV0E 3C4TA 4NXME 5LMNE 2KONA 2EWLA 3HTXA 2EM8A 4JI2E 2DLKA 2LTRA 2L8TA 2GPIA 1BBOA 2L2NA 4B3RE 2LRSA 1WXRA 2RSIA 1XMOE 1FKAE 1YZ9A 4K0KE 2NUEA 2RS6A 3ADJA 5A6JA 3BIDA 3ADIA 3UK3C 4FK5C 2V85A 5IXMB 4HTGA 4I8OA 2LBSB 1X49A 1IMUA 2J7JA 2V89A 4DMIA 2R76A 1BB8A 1YYKA 2YU8A 4BC9A 2EOSA 5KL4A 2EPPA 3T1HE 1EKZA
chains in the Genus database with same CATH topology
2JOXA 2LUQA 4B3TE 1QU6A 3VYYA 2JVAA 4DR5E 4R03A 4WYQB 2E5LE 4DKKA 4JI5E 4DR4E 4GKJE 2F4VE 4AQYE 1N32E 2DB2A 2N3HA 3J7Yp 2MDRA 2NUGA 4LF9E 2UXBE 1ZBTA 3DJWA 2V88A 4WSPA 5LL6R 5AE3A 3RMPA 1SR9A 4B3ME 3LMLA 3MSWA 5IT9C 1HR0E 3ADLA 2JY9A 2V86A 1XNQE 1UILA 1J26A 3F6HA 1ZBQA 5F3WA 2VE7C 4P78A 4F9CB 4LF7E 4YY3E 1DI2A 2RSMA 2M1SA 1HNXE 1PKPA 4BS9A 4X66E 2V83A 3AUZA 4B3SE 2NUFA 4JYAE 4LTYA 3H09A 3HQ1A 5ADZA 4F9BB 2VF1A 4JI7E 3HXLA 3JTZA 5DNYA 3HPSA 4DV5E 2LTSA 3KWRA 4TUIA 4F54A 1RC7A 4JI4E 1J5EE 2V87A 2K4VA 2V8QB 4LFCE 1IBME 2RTXA 5AE2A 4JI1E 4LFBE 2ODRC 5AE1A 2IHR1 3JU0A 2RS7A 3IWCA 5FLXC 4DV7E 5IWAE 4LU9A 3VK6A 3OTOE 2KOUA 3J80C 4Q28A 1XMQE 4DV4E 2FTXB 2B7VA 2G7HA 2JWOA 2MC6A 1T4LB 1YYWA 2LJHA 2YT4A 4R8OA 5T6JA 4X62E 1FJGE 1HNZE 4WFTA 1O0WA 4BCAA 2B3TB 4GEQB 4JI0E 4LF8E 3J7AG 2B9DA 3ZOQB 2L3JA 4DR7E 2H36X 2N3GA 5LMUE 4DV2E 1T4OA 4DR1E 4J8ZA 2DIXA 4X64E 4OX9E 2L2MA 3F6GA 2CPNA 3IWDA 4LF6E 1N33E 1XNRE 4M0VA 4LF4E 1DQ3A 3VYXA 3J81C 2HHHE 3LLHA 4NXNE 1HNWE 4DV1E 4OOGC 2LE2A 2UXDE 4DUYE 1I94E 3OMLA 5AASA 2VQEE 1YYOA 2LUPB 4X8WA 4KZSA 2VQFE 2M7QA 2JR1A 2L6MA 1STUA 4TUGA 4DR6E 1GZ6A 4DV0E 3C4TA 4NXME 3AV0A 2EZ6A 1WHNA 3DF6A 1WHQA 5LMNE 2KONA 3JAMC 2EWLA 1IBKE 3HTXA 3ADGA 4L8NA 2UUBE 4JI2E 3IWBA 2L2KB 4DUZE 1T4NA 2L33A 3FIGA 2LTRA 2L8TA 2ODRD 4BBYA 4M2ZA 4DV6E 2L3CA 2ZM6E 2L2NA 2E1MA 4B3RE 2MC5A 2LRSA 1WXRA 5A2QC 1X48A 1XMOE 4L5NC 1X47A 1FKAE 2LMZA 4YHHE 1YZ9A 4K0KE 2NUEA 2UU9E 2RS6A 3ADJA 4LFAE 3ADIA 5BR8E 2NA2A 4JI3E 2L92A 4X65E 4LF5E 1IBLE 4JV5E 2M4IA 2WZOA 1UHZA 2V85A 4BMJA 4P7DA 2UXCE 2KHXA 4I8OA 2LBSB 1X49A 2YZTA 4JI8E 4DV3E 2DMYA 3T1YE 4DR2E 2DSYA 3C4BA 4KHPE 2V89A 2B7TA 3HPZA 3K6QA 2F8BA 4DMIA 4JI6E 3P1XA 5CFFE 1N36E 4M30A 2UUAE 1GQEA 2FGGA 2JOBA 4WPYA 4BC7A 2UUCE 1RQ0A 1YYKA 4BC9A 4GKKE 2FV4B 4F9AB 1N34E 3T1HE 4DR3E 1EKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUQ A;  4B3T E;  1QU6 A;  3VYY A;  2JVA A;  4DR5 E;  4WYQ B;  4JI5 E;  2E5L E;  4DKK A;  4DR4 E;  4GKJ E;  2F4V E;  4AQY E;  1N32 E;  2DB2 A;  2N3H A;  3J7Y p;  2MDR A;  2NUG A;  4LF9 E;  2UXB E;  1ZBT A;  4B3M E;  1HR0 E;  3ADL A;  2JY9 A;  1XNQ E;  1UIL A;  1J26 A;  1DI2 A;  4LF7 E;  4YY3 E;  2RSM A;  1HNX E;  4JYA E;  1PKP A;  4X66 E;  4B3S E;  2NUF A;  4JI7 E;  4DV5 E;  2LTS A;  1RC7 A;  4JI4 E;  4LFC E;  1J5E E;  1IBM E;  2RTX A;  4JI1 E;  4LFB E;  2IHR 1;  2RS7 A;  4DV7 E;  5IWA E;  3OTO E;  1XMQ E;  4DV4 E;  2B7V A;  1T4L B;  1YYW A;  2LJH A;  2YT4 A;  4X62 E;  1FJG E;  1HNZ E;  4WFT A;  1O0W A;  2B3T B;  4JI0 E;  4LF8 E;  4DR7 E;  2L3J A;  5LMU E;  2N3G A;  4DR1 E;  4DV2 E;  1T4O A;  2DIX A;  4X64 E;  4OX9 E;  2L2M A;  4LF6 E;  2CPN A;  1N33 E;  1XNR E;  4LF4 E;  3VYX A;  2HHH E;  3LLH A;  4NXN E;  1HNW E;  4DV1 E;  4OOG C;  2UXD E;  4DUY E;  1I94 E;  2VQE E;  1YYO A;  2LUP B;  4X8W A;  2VQF E;  4DR6 E;  1STU A;  4DV0 E;  3C4T A;  4NXM E;  2EZ6 A;  1WHN A;  1WHQ A;  5LMN E;  1IBK E;  3HTX A;  3ADG A;  2UUB E;  4JI2 E;  2L2K B;  4DUZ E;  1T4N A;  2L33 A;  2LTR A;  4M2Z A;  4DV6 E;  2L3C A;  2ZM6 E;  2L2N A;  4B3R E;  2LRS A;  1X48 A;  1XMO E;  1X47 A;  1FKA E;  4YHH E;  1YZ9 A;  4K0K E;  2NUE A;  2UU9 E;  2RS6 A;  3ADJ A;  4LFA E;  3ADI A;  5BR8 E;  2NA2 A;  4JI3 E;  4X65 E;  4LF5 E;  1IBL E;  4JV5 E;  1UHZ A;  2UXC E;  2KHX A;  2LBS B;  1X49 A;  4JI8 E;  4DV3 E;  2DMY A;  3T1Y E;  4DR2 E;  3C4B A;  4KHP E;  2B7T A;  4JI6 E;  3P1X A;  5CFF E;  1N36 E;  4M30 A;  2UUA E;  1GQE A;  4GKK E;  1YYK A;  2UUC E;  1RQ0 A;  1N34 E;  3T1H E;  4DR3 E;  1EKZ A; 
#chains in the Genus database with same CATH topology
 3VYY A;  2JVA A;  1ZU1 A;  4WYQ B;  4BHC A;  2MDG A;  4R2Q A;  4AQY E;  1IQS A;  2EQ0 A;  2UXB E;  1ZBT A;  2VRD A;  3RMP A;  1PJS A;  2EPC A;  2N8X A;  1A1I A;  4LF7 E;  2GLI A;  5AC4 A;  2YRM A;  1PKP A;  2EPX A;  4B3S E;  2V83 A;  3EPJ A;  2JXP A;  2EMZ A;  2Q8U A;  2ADR A;  2VF1 A;  3JTZ A;  3HPS A;  2LTS A;  2WBT A;  4TUI A;  1RC7 A;  2V8Q B;  1IBM E;  2RTX A;  5AE2 A;  2EN4 A;  5KL6 A;  2EOX A;  5IWA E;  3KZY A;  2EOY A;  2HGH A;  4WSG A;  3J80 C;  4DV4 E;  2B7V A;  3C6K A;  2YRK A;  2LJH A;  2PRT A;  4WXC A;  1FJG E;  4GEQ B;  3J7A G;  2R1F A;  2B9D A;  3VHT B;  3ZOQ B;  5LMU E;  2N3G A;  4N4R B;  3BGH A;  4J8Z A;  2DIX A;  1PJT A;  4X64 E;  1A1F A;  4LF6 E;  1NEI A;  1DQ3 A;  4R2P A;  1SFE A;  2EQ3 A;  2ENA A;  5AAS A;  2EPL X;  3ECR A;  1F2I G;  2VQE E;  2EN3 A;  4X8W A;  1ZR9 A;  4X9J A;  1STU A;  2JP9 A;  1Z1B A;  1JK2 A;  3AV0 A;  1WHN A;  1P47 A;  1WHQ A;  1IBK E;  3EQ1 A;  4WXD A;  2BB8 A;  3IWB A;  4DUZ E;  2L33 A;  2DMI A;  4BBY A;  4R2D A;  4DV6 E;  1X6E A;  2EMF A;  3TQM A;  2ELZ A;  2LJU A;  2E1M A;  4Q35 B;  4O43 A;  4BHB A;  3EPK A;  1X47 A;  4YHH E;  1NCS A;  2UU9 E;  5BR8 E;  2NA2 A;  4JV5 E;  3THO B;  2KHX A;  4GZN C;  2YTP A;  4JI8 E;  2DSY A;  3C4B A;  1MGT A;  4IS1 C;  2B7T A;  3HPZ A;  2F8B A;  2EMB A;  2UUA E;  1GQE A;  2FGG A;  4IJD A;  4BC7 A;  5A6A A;  4DR3 E;  2CT1 A;  2EN7 A;  2YWQ A;  4B3T E;  3QG5 C;  1QU6 A;  4DR5 E;  4JI5 E;  5A6B D;  4DR4 E;  1EH7 A;  3EPL A;  1EH8 A;  2N3H A;  3J7Y p;  1G2F C;  2EMK A;  2MKD A;  3DJW A;  2V88 A;  5KL3 A;  5LL6 R;  4MLQ A;  1A1K A;  4B3M E;  3LML A;  1HR0 E;  2EOO A;  2V86 A;  3C6M A;  1UIL A;  1EH6 A;  1YUI A;  1J26 A;  1DI2 A;  2EP3 A;  1TN9 A;  2M1S A;  4BS9 A;  2CTD A;  2EMI A;  3HQ1 A;  4F9B B;  4JI7 E;  2EOJ A;  1YUJ A;  2EM5 A;  4R2A A;  4F54 A;  4LFC E;  1J5E E;  2K4V A;  2EM4 A;  1X3C A;  2EMG A;  4JI1 E;  4RH8 A;  1IQO A;  3JU0 A;  3IWC A;  1A1J A;  3VK6 A;  1X5W A;  4Q28 A;  2EMA A;  2FTX B;  4R2E A;  2MC6 A;  2EN2 A;  1MEY C;  2HC5 A;  1UBD C;  4OX9 E;  2L2M A;  3IWD A;  4M0V A;  2DLQ A;  2HHH E;  1TF3 A;  3LLH A;  4NXN E;  2UXD E;  2ENH A;  2WCC 3;  4DUY E;  1PJQ A;  1RMD A;  1A1H A;  4WX9 A;  2K7I A;  5KL5 A;  2EMY A;  2EM9 A;  2EM0 A;  3M99 B;  2LCE A;  2EZ6 A;  2EPA A;  3DF6 A;  4O5G A;  1YPN A;  3JAM C;  2YTI A;  3ADG A;  1AAY A;  2L2K B;  2EE8 A;  3MHH C;  4R2C A;  4M2Z A;  2EL4 A;  2L3C A;  3MHS C;  2MC5 A;  1QNT A;  4L5N C;  1X6H A;  2L92 A;  4X65 E;  4JI3 E;  4LF5 E;  2M4I A;  4M9V C;  1UHZ A;  4P7D A;  3KZZ A;  4ZYD A;  2UXC E;  1A1L A;  1YFH A;  5IV8 B;  4DV3 E;  2DMY A;  2YPN A;  3T1Y E;  1X6F A;  4DR2 E;  3K6Q A;  2EOE A;  2I9I A;  2D9H A;  2EQ1 A;  2LT7 A;  3P1X A;  1N36 E;  2EMW A;  2JOB A;  4WPY A;  4GKK E;  2YSP A;  2RQL A;  4F9A B;  1N34 E;  3ADL A;  1GTK A;  2JOX A;  2LUQ A;  4R2R A;  1JK1 A;  2DRP A;  2EN8 A;  2DB2 A;  4LF9 E;  2YTN A;  2YTF A;  2EMX A;  2HJJ A;  1WJP A;  3MSW A;  5IT9 C;  1XNQ E;  2NAB A;  1ZBQ A;  5F3W A;  4P78 A;  2EPM X;  2RSM A;  1HNX E;  4JYA E;  3AUZ A;  2NUF A;  4LTY A;  3H09 A;  2GHF A;  5ADZ A;  4F2J C;  1AH5 A;  3HXL A;  5DNY A;  3KWR A;  2EOR A;  2EN1 A;  4JI4 E;  2WBS A;  2YTE A;  1L4S A;  2EOQ A;  2IHR 1;  2RS7 A;  1T38 A;  4DV7 E;  3OTO E;  4KWY A;  2KOU A;  2G7H A;  1T4L B;  2JWO A;  1YYW A;  5T6J A;  4R8O A;  1T39 A;  4X62 E;  2DGC A;  2EPZ A;  3EPH A;  1O0W A;  2EL6 A;  2EM2 A;  2B3T B;  4JI0 E;  4LF8 E;  4NHR A;  2H36 X;  4DR1 E;  1T4O A;  2EMC A;  1YSA C;  3F6G A;  1N33 E;  1XNR E;  4LF4 E;  2I13 A;  3J81 C;  1WRJ A;  5KL2 A;  1I94 E;  2EJ4 A;  5A6K A;  2LUP B;  2EPU A;  2VQF E;  1BBG A;  4TUG A;  2MKN A;  4DR6 E;  4HEI A;  1GZ6 A;  5A6B A;  2CSH A;  2A25 A;  2YRH A;  2YSO A;  4L8N A;  2ELY A;  2EMH A;  2ENC A;  2UUB E;  1T4N A;  3FIG A;  2ODR D;  2ZM6 E;  5A2Q C;  4F6M A;  1X48 A;  2LO3 A;  2LMZ A;  2EM7 A;  4LFA E;  5LLQ A;  3THN A;  2LVH A;  1IBL E;  2WZO A;  1ZAA C;  2EML A;  4BMJ A;  4R2S A;  2EOH A;  2YZT A;  2YU5 A;  4KHP E;  1PDA A;  4JI6 E;  1B69 A;  2YTO A;  5CFF E;  4M30 A;  1UN6 B;  2UUC E;  1KJK A;  1RQ0 A;  2E72 A;  2FV4 B;  2BBG A;  2EM6 A;  3L00 A;  2EOM A;  4NZV A;  4ZYH A;  2JPA A;  2EPN A;  4R03 A;  2E5L E;  4DKK A;  4GKJ E;  5AC5 A;  2F4V E;  1N32 E;  2MDR A;  2NUG A;  2EPR A;  4WSP A;  5AE3 A;  1SR9 A;  3BF2 A;  1DGC A;  2JY9 A;  3F6H A;  2VE7 C;  4F9C B;  4YY3 E;  4O24 A;  4X66 E;  1A1G A;  1G2D C;  4O4K A;  2EL5 A;  2RPC A;  4DV5 E;  1LLM C;  1KYQ A;  2EOF A;  1TF6 A;  2V87 A;  5KL7 A;  2EOI A;  4MLV A;  4LFB E;  2ODR C;  5AE1 A;  2JYA A;  5FLX C;  4LU9 A;  5A69 A;  1XMQ E;  2YT4 A;  2EPK X;  1HNZ E;  4WFT A;  4BCA A;  2YTG A;  2EPO A;  2L3J A;  4DR7 E;  4DV2 E;  2WBU A;  2YTQ A;  2EM3 A;  2CPN A;  3VYX A;  2YTD A;  2LV2 A;  1HNW E;  1N3G A;  2EOZ A;  4DV1 E;  4OOG C;  2LE2 A;  4ZYE A;  3BBG A;  5TSE A;  4ZYG A;  3OML A;  1YYO A;  2YTJ A;  2EN6 A;  4KZS A;  2M7Q A;  4RHB B;  4F6N A;  2JR1 A;  2M9A A;  2L6M A;  4DV0 E;  3C4T A;  4NXM E;  5LMN E;  2KON A;  2EWL A;  3HTX A;  2EM8 A;  4JI2 E;  2DLK A;  2LTR A;  2L8T A;  2GPI A;  1BBO A;  2L2N A;  4B3R E;  2LRS A;  1WXR A;  2RSI A;  1XMO E;  1FKA E;  1YZ9 A;  4K0K E;  2NUE A;  2RS6 A;  3ADJ A;  5A6J A;  3BID A;  3ADI A;  3UK3 C;  4FK5 C;  2V85 A;  5IXM B;  4HTG A;  4I8O A;  2LBS B;  1X49 A;  1IMU A;  2J7J A;  2V89 A;  4DMI A;  2R76 A;  1BB8 A;  1YYK A;  2YU8 A;  4BC9 A;  2EOS A;  5KL4 A;  2EPP A;  3T1H E;  1EKZ A; 
#chains in the Genus database with same CATH homology
 2JOX A;  2LUQ A;  4B3T E;  1QU6 A;  3VYY A;  2JVA A;  4DR5 E;  4R03 A;  4WYQ B;  2E5L E;  4DKK A;  4JI5 E;  4DR4 E;  4GKJ E;  2F4V E;  4AQY E;  1N32 E;  2DB2 A;  2N3H A;  3J7Y p;  2MDR A;  2NUG A;  4LF9 E;  2UXB E;  1ZBT A;  3DJW A;  2V88 A;  4WSP A;  5LL6 R;  5AE3 A;  3RMP A;  1SR9 A;  4B3M E;  3LML A;  3MSW A;  5IT9 C;  1HR0 E;  3ADL A;  2JY9 A;  2V86 A;  1XNQ E;  1UIL A;  1J26 A;  3F6H A;  1ZBQ A;  5F3W A;  2VE7 C;  4P78 A;  4F9C B;  4LF7 E;  4YY3 E;  1DI2 A;  2RSM A;  2M1S A;  1HNX E;  1PKP A;  4BS9 A;  4X66 E;  2V83 A;  3AUZ A;  4B3S E;  2NUF A;  4JYA E;  4LTY A;  3H09 A;  3HQ1 A;  5ADZ A;  4F9B B;  2VF1 A;  4JI7 E;  3HXL A;  3JTZ A;  5DNY A;  3HPS A;  4DV5 E;  2LTS A;  3KWR A;  4TUI A;  4F54 A;  1RC7 A;  4JI4 E;  1J5E E;  2V87 A;  2K4V A;  2V8Q B;  4LFC E;  1IBM E;  2RTX A;  5AE2 A;  4JI1 E;  4LFB E;  2ODR C;  5AE1 A;  2IHR 1;  3JU0 A;  2RS7 A;  3IWC A;  5FLX C;  4DV7 E;  5IWA E;  4LU9 A;  3VK6 A;  3OTO E;  2KOU A;  3J80 C;  4Q28 A;  1XMQ E;  4DV4 E;  2FTX B;  2B7V A;  2G7H A;  2JWO A;  2MC6 A;  1T4L B;  1YYW A;  2LJH A;  2YT4 A;  4R8O A;  5T6J A;  4X62 E;  1FJG E;  1HNZ E;  4WFT A;  1O0W A;  4BCA A;  2B3T B;  4GEQ B;  4JI0 E;  4LF8 E;  3J7A G;  2B9D A;  3ZOQ B;  2L3J A;  4DR7 E;  2H36 X;  2N3G A;  5LMU E;  4DV2 E;  1T4O A;  4DR1 E;  4J8Z A;  2DIX A;  4X64 E;  4OX9 E;  2L2M A;  3F6G A;  2CPN A;  3IWD A;  4LF6 E;  1N33 E;  1XNR E;  4M0V A;  4LF4 E;  1DQ3 A;  3VYX A;  3J81 C;  2HHH E;  3LLH A;  4NXN E;  1HNW E;  4DV1 E;  4OOG C;  2LE2 A;  2UXD E;  4DUY E;  1I94 E;  3OML A;  5AAS A;  2VQE E;  1YYO A;  2LUP B;  4X8W A;  4KZS A;  2VQF E;  2M7Q A;  2JR1 A;  2L6M A;  1STU A;  4TUG A;  4DR6 E;  1GZ6 A;  4DV0 E;  3C4T A;  4NXM E;  3AV0 A;  2EZ6 A;  1WHN A;  3DF6 A;  1WHQ A;  5LMN E;  2KON A;  3JAM C;  2EWL A;  1IBK E;  3HTX A;  3ADG A;  4L8N A;  2UUB E;  4JI2 E;  3IWB A;  2L2K B;  4DUZ E;  1T4N A;  2L33 A;  3FIG A;  2LTR A;  2L8T A;  2ODR D;  4BBY A;  4M2Z A;  4DV6 E;  2L3C A;  2ZM6 E;  2L2N A;  2E1M A;  4B3R E;  2MC5 A;  2LRS A;  1WXR A;  5A2Q C;  1X48 A;  1XMO E;  4L5N C;  1X47 A;  1FKA E;  2LMZ A;  4YHH E;  1YZ9 A;  4K0K E;  2NUE A;  2UU9 E;  2RS6 A;  3ADJ A;  4LFA E;  3ADI A;  5BR8 E;  2NA2 A;  4JI3 E;  2L92 A;  4X65 E;  4LF5 E;  1IBL E;  4JV5 E;  2M4I A;  2WZO A;  1UHZ A;  2V85 A;  4BMJ A;  4P7D A;  2UXC E;  2KHX A;  4I8O A;  2LBS B;  1X49 A;  2YZT A;  4JI8 E;  4DV3 E;  2DMY A;  3T1Y E;  4DR2 E;  2DSY A;  3C4B A;  4KHP E;  2V89 A;  2B7T A;  3HPZ A;  3K6Q A;  2F8B A;  4DMI A;  4JI6 E;  3P1X A;  5CFF E;  1N36 E;  4M30 A;  2UUA E;  1GQE A;  2FGG A;  2JOB A;  4WPY A;  4BC7 A;  2UUC E;  1RQ0 A;  1YYK A;  4BC9 A;  4GKK E;  2FV4 B;  4F9A B;  1N34 E;  3T1H E;  4DR3 E;  1EKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...