2MDRA

Solution structure of the third double-stranded rna-binding domain (dsrbd3) of human adenosine-deaminase adar1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
94
structure length
94
Chain Sequence
MMPNKVRKIGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQEAADAALRVLIGENEKAER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Double-stranded RNA-specific adenosine deaminase
publication title A bimodular nuclear localization signal assembled via an extended double-stranded RNA-binding domain acts as an RNA-sensing signal for transportin 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 26
structure length 94
sequence length 94
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2mdrA00
2UXBE 1O0WA 4LF4E 4DR2E 2L3CA 1RQ0A 4DR1E 4X64E 1GQEA 4B3TE 2LTSA 1J5EE 4M2ZA 3ADIA 4DUYE 1XNRE 4GKKE 4K0KE 4JI2E 4B3RE 2L2NA 4LF5E 4NXME 4DR4E 1DI2A 1UHZA 2RS7A 2E5LE 3VYXA 1HNWE 4DV0E 3OTOE 2CPNA 1X48A 2L2KB 2LJHA 2LUQA 4B3ME 3HTXA 4JI3E 2LUPB 4X65E 2RSMA 4JV5E 1N36E 2NUFA 5BR8E 4LFBE 4JI7E 1T4LB 3T1HE 1T4NA 1YZ9A 1J26A 5LMUE 4LF6E 3T1YE 5CFFE 4M30A 1XMQE 2UUBE 2DB2A 1FJGE 2NUEA 2B3TB 2LBSB 4LF9E 2KHXA 4JYAE 4WYQB 4JI6E 1YYWA 1PKPA 1FKAE 4B3SE 2LRSA 1WHQA 4DR6E 2RS6A 3ADGA 4X66E 2JY9A 2HHHE 2EZ6A 2RTXA 1I94E 3VYYA 4AQYE 4JI1E 2VQEE 1IBKE 2VQFE 4JI5E 1STUA 4OOGC 1N32E 4DUZE 2DIXA 4DR5E 4DV2E 3ADJA 2B7TA 4X62E 3ADLA 4DV7E 1N34E 4LFAE 1IBLE 2JVAA 1T4OA 2L3JA 2ZM6E 4DV4E 4LFCE 2UUCE 1UILA 4KHPE 2UUAE 1X49A 1ZBTA 1HNZE 2L33A 2UXDE 4DV1E 1EKZA 2NUGA 1HNXE 1N33E 4NXNE 2NA2A 1YYOA 3C4BA 2UU9E 2DMYA 4YHHE 4JI4E 4LF7E 4DR3E 1HR0E 4DV5E 1IBME 5LMNE 1XNQE 2L2MA 2MDRA 4DV6E 4X8WA 2YT4A 4WFTA 2N3GA 4GKJE 5IWAE 2F4VE 3P1XA 1YYKA 3LLHA 1QU6A 4DV3E 1WHNA 2IHR1 2N3HA 1RC7A 4DKKA 1XMOE 4JI0E 3J7Yp 1X47A 2LTRA 4LF8E 2B7VA 4YY3E 4DR7E 2UXCE 3C4TA 4JI8E 4OX9E
chains in the Genus database with same CATH superfamily
2UXBE 4L5NC 1X6HA 1BBOA 5FLXC 2EN6A 1GQEA 4B3TE 2LTSA 2EPCA 1KYQA 2EM8A 4DMIA 1JK1A 4GKKE 4K0KE 3HXLA 3RMPA 2EQ0A 2EM4A 4NXME 2M9AA 1X6FA 5KL5A 4ZYEA 3VYXA 3K6QA 3MHSC 1X48A 2LJHA 2YTFA 2K7IA 3J81C 3VHTB 4JI3E 2YTJA 1WJPA 4WPYA 2BBGA 3KWRA 2JXPA 5LMUE 2DRPA 4M30A 5A6BA 4IJDA 2JR1A 2WBUA 2KHXA 2ENCA 3ECRA 2I9IA 2DSYA 5AASA 2ADRA 2LCEA 1I94E 1P47A 5ADZA 4Q35B 4AQYE 2EMFA 2KONA 2DIXA 2EOMA 4DR5E 3BGHA 1DQ3A 2B7TA 2GPIA 2V87A 2PRTA 2E1MA 2JVAA 4J8ZA 2EMZA 3M99B 5F3WA 4DV4E 1Z1BA 2L8TA 1X49A 4NZVA 4RHBB 2HJJA 3THNA 2EMCA 2V85A 4DV1E 2LMZA 3UK3C 4NXNE 1MGTA 1ZR9A 2K4VA 1YYOA 4R2PA 2DGCA 4LF7E 4DR3E 1HR0E 4P7DA 1ZU1A 1TN9A 2YSOA 3H09A 4R2EA 1IQOA 5AC5A 4DV6E 4TUGA 1AH5A 3HPSA 2EE8A 2N3GA 2EPNA 1TF6A 1SR9A 2V86A 1PJQA 2EPRA 5TSEA 4DV3E 4BC7A 5T6JA 2YU5A 2V83A 1X47A 1X5WA 4R2RA 1GZ6A 2B7VA 2LO3A 3EPLA 4YY3E 2YU8A 2YSPA 1EH8A 2YRHA 3JTZA 2EMLA 4WXCA 2EN4A 3BIDA 2M4IA 1RQ0A 4DR1E 2KOUA 5A6AA 4L8NA 2YPNA 5AE3A 1J5EE 4ZYHA 2EN1A 2JP9A 1NEIA 2EPZA 2Q8UA 2LT7A 2EMGA 4R2QA 4JI2E 4B3RE 2L2NA 4LF5E 2MKNA 4DR4E 2EQ3A 2RPCA 2YTQA 2CPNA 2VE7C 1LLMC 4Q28A 2ODRC 3BBGA 1QNTA 1YSAC 2RSMA 5DNYA 4FK5C 2NUFA 2WBTA 3JU0A 3T1HE 1A1KA 4KZSA 3KZYA 2HC5A 5CFFE 3T1YE 2EOEA 1UN6B 2HGHA 3EPKA 4JYAE 3MHHC 5A2QC 2L92A 2WBSA 2EOFA 2G7HA 2VRDA 1X6EA 5A6JA 2EPOA 2D9HA 2CTDA 2ELZA 2EPLX 3F6GA 3VYYA 2JPAA 3IWDA 2GHFA 2EN2A 1IBKE 4R03A 4OOGC 2MC6A 1T39A 2EMYA 2EWLA 4DV2E 3ADJA 2CSHA 2YRMA 2MKDA 2JYAA 2EJ4A 4X62E 4F9CB 1UBDC 1NCSA 1PDAA 4WXDA 5KL3A 4LFCE 3EPHA 4KHPE 2UUAE 4P78A 2LJUA 2LV2A 2R76A 4F54A 1HNZE 2YTPA 2UXDE 2V89A 1EKZA 2NUGA 2EOIA 2UU9E 2YTNA 3OMLA 2B9DA 2EM6A 2RQLA 2YTIA 4BMJA 2EMKA 4O43A 4R2CA 3HQ1A 4DV5E 1IBME 1EH6A 3TQMA 2EMIA 1T38A 2EN3A 4ZYDA 4O5GA 4BHBA 1IMUA 2EORA 1WHNA 2N3HA 3IWCA 2VF1A 1XMOE 3J7Yp 4N4RB 2JOXA 2YTGA 1YUJA 2UXCE 3C4TA 2R1FA 2LRSA 1O0WA 4DR2E 2L3CA 3AV0A 2H36X 3C6MA 4M2ZA 4R2AA 1B69A 4DUYE 1KJKA 1A1JA 2I13A 1F2IG 2ELYA 3ZOQB 5KL6A 1DI2A 2EMBA 2RS7A 2E5LE 1HNWE 2EL6A 4DV0E 1JK2A 2NABA 1TF3A 3HTXA 2FTXB 4R8OA 2LUPB 4JV5E 2N8XA 4WSPA 4LFBE 4BCAA 1T4LB 1YZ9A 1J26A 2EM2A 4TUIA 2UUBE 5AE1A 2DB2A 1FJGE 2EN8A 1IQSA 4LF9E 2ODRD 3J7AG 2DLKA 1ZAAC 4WYQB 4JI6E 1YYWA 2CT1A 1PKPA 2EL4A 1FKAE 5IXMB 5A6KA 3ADGA 4X66E 2HHHE 2RTXA 4F9AB 3AUZA 4JI1E 3FIGA 4JI5E 2VQFE 4DUZE 4GZNC 2EM0A 4NHRA 3ADLA 2EOOA 3THOB 2M1SA 4LFAE 4R2DA 2EM5A 1T4OA 1YFHA 5LL6R 1UILA 2UUCE 2EPPA 1A1FA 1ZBQA 5KL2A 1PJTA 5A6BD 2JWOA 2LE2A 2L33A 2YZTA 4RH8A 1X3CA 1EH7A 3HPZA 2EMHA 3EQ1A 3VK6A 1N33E 1HNXE 2NA2A 3C4BA 2DMYA 1A1GA 2DLQA 2EPUA 2EP3A 4LU9A 3C6KA 5LMNE 2L2MA 4KWYA 2GLIA 4WFTA 2JOBA 2EOSA 3DF6A 3JAMC 4M9VC 1YYKA 3LMLA 2IHR1 1YUIA 1RC7A 4DKKA 2EOHA 2LTRA 4M0VA 4LF8E 4BS9A 5IT9C 5IV8B 4DR7E 2LVHA 2EMWA 4JI8E 2V8QB 4OX9E 2FV4B 4LF4E 2EPAA 1SFEA 3EPJA 4X64E 3ADIA 2A25A 2ENHA 2MDGA 4F6MA 1XNRE 2EMXA 4O24A 3MSWA 2EMAA 1UHZA 2YRKA 1G2DC 2MC5A 3OTOE 1PJSA 2L2KB 2LUQA 4HTGA 4B3ME 2EQ1A 2EL5A 4X65E 3KZZA 1N36E 2J7JA 5BR8E 4WX9A 1N3GA 2EPMX 4HEIA 3F6HA 4JI7E 3J80C 1T4NA 1G2FC 1L4SA 4LF6E 1XMQE 4BHCA 5KL4A 2NUEA 4ZYGA 2B3TB 2LBSB 4GEQB 5AC4A 3BF2A 4MLVA 2YWQA 4B3SE 1WHQA 4DR6E 2RS6A 4X9JA 2JY9A 2EZ6A 2EM9A 2WZOA 4IS1C 2VQEE 4F2JC 2EPKX 1N32E 1STUA 2DMIA 2EOYA 1MEYC 2YTDA 2ENAA 4DV7E 1N34E 1IBLE 3L00A 2RSIA 4LTYA 2BB8A 2E72A 1WXRA 3QG5C 4BC9A 2EN7A 2L3JA 2ZM6E 3DJWA 2WCC3 2YTOA 1ZBTA 4MLQA 5A69A 2F8BA 4I8OA 1RMDA 2EOZA 4YHHE 4JI4E 2EOQA 1GTKA 2YTEA 4WSGA 4BBYA 3IWBA 2V88A 4R2SA 4F6NA 1YPNA 1A1HA 1XNQE 2MDRA 2L6MA 1AAYA 2EOJA 1WRJA 4X8WA 2YT4A 1DGCA 4GKJE 5IWAE 2F4VE 4F9BB 1A1IA 2EM3A 4O4KA 3P1XA 5KL7A 1BBGA 3LLHA 1QU6A 1BB8A 2EOXA 5AE2A 2M7QA 4JI0E 2EM7A 2FGGA 2EPXA 5LLQA 1A1LA
chains in the Genus database with same CATH topology
2UXBE 2FV4B 4L5NC 1O0WA 4LF4E 2M4IA 4DR2E 2L3CA 1RQ0A 5FLXC 3AV0A 2KOUA 4DR1E 2H36X 4X64E 1GQEA 4L8NA 2LTSA 5AE3A 1J5EE 4B3TE 4M2ZA 3ADIA 4DMIA 4DUYE 1XNRE 4GKKE 4K0KE 3HXLA 4JI2E 3RMPA 4B3RE 2L2NA 4LF5E 3MSWA 3ZOQB 4NXME 4DR4E 1DI2A 1UHZA 2MC5A 2RS7A 2E5LE 3VYXA 3K6QA 4DV0E 3OTOE 2CPNA 1HNWE 2VE7C 1X48A 2L2KB 2LJHA 2LUQA 4Q28A 4B3ME 3J81C 3HTXA 2ODRC 2FTXB 4R8OA 4JI3E 2LUPB 2RSMA 4X65E 4WSPA 5DNYA 4JV5E 1N36E 2NUFA 5BR8E 3JU0A 4LFBE 4BCAA 4JI7E 3F6HA 1T4LB 3T1HE 3J80C 4WPYA 3KWRA 4KZSA 1T4NA 1YZ9A 1J26A 5LMUE 4LF6E 3T1YE 5CFFE 4M30A 4TUIA 1XMQE 5AE1A 2UUBE 2DB2A 1FJGE 2NUEA 2B3TB 2JR1A 2LBSB 4LF9E 2ODRD 2KHXA 3JTZA 3J7AG 4JYAE 4GEQB 2DSYA 4WYQB 4JI6E 1YYWA 1PKPA 1FKAE 5AASA 4B3SE 5A2QC 2L92A 1WHQA 4DR6E 2G7HA 2RS6A 3ADGA 4X66E 2JY9A 2HHHE 2EZ6A 2RTXA 1I94E 2WZOA 3F6GA 3VYYA 3IWDA 5ADZA 4F9AB 3AUZA 4AQYE 4JI1E 3FIGA 2VQEE 1IBKE 2VQFE 4JI5E 1STUA 4R03A 4OOGC 4DUZE 2KONA 2DIXA 2MC6A 4DR5E 2EWLA 1DQ3A 4DV2E 3ADJA 2B7TA 4X62E 3ADLA 2V87A 4DV7E 2M1SA 1N34E 4F9CB 1IBLE 4LFAE 2E1MA 2JVAA 4LTYA 4J8ZA 1WXRA 1T4OA 4BC9A 5F3WA 2L3JA 2ZM6E 4DV4E 3DJWA 4LFCE 5LL6R 1UILA 2UUCE 2L8TA 4KHPE 2UUAE 1N32E 4P78A 1X49A 1ZBQA 1ZBTA 4F54A 1HNZE 2JWOA 2LE2A 2L33A 2YZTA 2V89A 2V85A 3VK6A 4DV1E 3HPZA 2F8BA 1EKZA 2UXDE 2NUGA 2LMZA 4I8OA 1HNXE 4NXNE 1N33E 2NA2A 2K4VA 3C4BA 1YYOA 2UU9E 3OMLA 2DMYA 2B9DA 4YHHE 4JI4E 4BMJA 4LF7E 4DR3E 4BBYA 3IWBA 1HR0E 2V88A 3HQ1A 4P7DA 4LU9A 4DV5E 1IBME 5LMNE 1XNQE 2L2MA 2MDRA 3H09A 2L6MA 4DV6E 4TUGA 4X8WA 2YT4A 3HPSA 4WFTA 2JOBA 2N3GA 4GKJE 5IWAE 2F4VE 4F9BB 3DF6A 3JAMC 1SR9A 2V86A 3P1XA 1YYKA 3LMLA 3LLHA 1QU6A 4DV3E 4BC7A 5AE2A 1WHNA 2IHR1 2N3HA 5T6JA 3IWCA 1RC7A 2VF1A 4JI8E 2M7QA 4DKKA 1XMOE 3J7Yp 4JI0E 1X47A 2LTRA 2V83A 4M0VA 1GZ6A 2B7VA 2JOXA 4LF8E 2FGGA 4BS9A 4YY3E 5IT9C 4DR7E 2UXCE 3C4TA 2LRSA 2V8QB 4OX9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXB E;  1O0W A;  4LF4 E;  4DR2 E;  2L3C A;  1RQ0 A;  4DR1 E;  4X64 E;  1GQE A;  4B3T E;  2LTS A;  1J5E E;  4M2Z A;  3ADI A;  4DUY E;  1XNR E;  4GKK E;  4K0K E;  4JI2 E;  4B3R E;  2L2N A;  4LF5 E;  4NXM E;  4DR4 E;  1DI2 A;  1UHZ A;  2RS7 A;  2E5L E;  3VYX A;  1HNW E;  4DV0 E;  3OTO E;  2CPN A;  1X48 A;  2L2K B;  2LJH A;  2LUQ A;  4B3M E;  3HTX A;  4JI3 E;  2LUP B;  4X65 E;  2RSM A;  4JV5 E;  1N36 E;  2NUF A;  5BR8 E;  4LFB E;  4JI7 E;  1T4L B;  3T1H E;  1T4N A;  1YZ9 A;  1J26 A;  5LMU E;  4LF6 E;  3T1Y E;  5CFF E;  4M30 A;  1XMQ E;  2UUB E;  2DB2 A;  1FJG E;  2NUE A;  2B3T B;  2LBS B;  4LF9 E;  2KHX A;  4JYA E;  4WYQ B;  4JI6 E;  1YYW A;  1PKP A;  1FKA E;  4B3S E;  2LRS A;  1WHQ A;  4DR6 E;  2RS6 A;  3ADG A;  4X66 E;  2JY9 A;  2HHH E;  2EZ6 A;  2RTX A;  1I94 E;  3VYY A;  4AQY E;  4JI1 E;  2VQE E;  1IBK E;  2VQF E;  4JI5 E;  1STU A;  4OOG C;  1N32 E;  4DUZ E;  2DIX A;  4DR5 E;  4DV2 E;  3ADJ A;  2B7T A;  4X62 E;  3ADL A;  4DV7 E;  1N34 E;  4LFA E;  1IBL E;  2JVA A;  1T4O A;  2L3J A;  2ZM6 E;  4DV4 E;  4LFC E;  2UUC E;  1UIL A;  4KHP E;  2UUA E;  1X49 A;  1ZBT A;  1HNZ E;  2L33 A;  2UXD E;  4DV1 E;  1EKZ A;  2NUG A;  1HNX E;  1N33 E;  4NXN E;  2NA2 A;  1YYO A;  3C4B A;  2UU9 E;  2DMY A;  4YHH E;  4JI4 E;  4LF7 E;  4DR3 E;  1HR0 E;  4DV5 E;  1IBM E;  5LMN E;  1XNQ E;  2L2M A;  2MDR A;  4DV6 E;  4X8W A;  2YT4 A;  4WFT A;  2N3G A;  4GKJ E;  5IWA E;  2F4V E;  3P1X A;  1YYK A;  3LLH A;  1QU6 A;  4DV3 E;  1WHN A;  2IHR 1;  2N3H A;  1RC7 A;  4DKK A;  1XMO E;  4JI0 E;  3J7Y p;  1X47 A;  2LTR A;  4LF8 E;  2B7V A;  4YY3 E;  4DR7 E;  2UXC E;  3C4T A;  4JI8 E;  4OX9 E; 
#chains in the Genus database with same CATH topology
 2UXB E;  4L5N C;  1X6H A;  1BBO A;  5FLX C;  2EN6 A;  1GQE A;  4B3T E;  2LTS A;  2EPC A;  1KYQ A;  2EM8 A;  4DMI A;  1JK1 A;  4GKK E;  4K0K E;  3HXL A;  3RMP A;  2EQ0 A;  2EM4 A;  4NXM E;  2M9A A;  1X6F A;  5KL5 A;  4ZYE A;  3VYX A;  3K6Q A;  3MHS C;  1X48 A;  2LJH A;  2YTF A;  2K7I A;  3J81 C;  3VHT B;  4JI3 E;  2YTJ A;  1WJP A;  4WPY A;  2BBG A;  3KWR A;  2JXP A;  5LMU E;  2DRP A;  4M30 A;  5A6B A;  4IJD A;  2JR1 A;  2WBU A;  2KHX A;  2ENC A;  3ECR A;  2I9I A;  2DSY A;  5AAS A;  2ADR A;  2LCE A;  1I94 E;  1P47 A;  5ADZ A;  4Q35 B;  4AQY E;  2EMF A;  2KON A;  2DIX A;  2EOM A;  4DR5 E;  3BGH A;  1DQ3 A;  2B7T A;  2GPI A;  2V87 A;  2PRT A;  2E1M A;  2JVA A;  4J8Z A;  2EMZ A;  3M99 B;  5F3W A;  4DV4 E;  1Z1B A;  2L8T A;  1X49 A;  4NZV A;  4RHB B;  2HJJ A;  3THN A;  2EMC A;  2V85 A;  4DV1 E;  2LMZ A;  3UK3 C;  4NXN E;  1MGT A;  1ZR9 A;  2K4V A;  1YYO A;  4R2P A;  2DGC A;  4LF7 E;  4DR3 E;  1HR0 E;  4P7D A;  1ZU1 A;  1TN9 A;  2YSO A;  3H09 A;  4R2E A;  1IQO A;  5AC5 A;  4DV6 E;  4TUG A;  1AH5 A;  3HPS A;  2EE8 A;  2N3G A;  2EPN A;  1TF6 A;  1SR9 A;  2V86 A;  1PJQ A;  2EPR A;  5TSE A;  4DV3 E;  4BC7 A;  5T6J A;  2YU5 A;  2V83 A;  1X47 A;  1X5W A;  4R2R A;  1GZ6 A;  2B7V A;  2LO3 A;  3EPL A;  4YY3 E;  2YU8 A;  2YSP A;  1EH8 A;  2YRH A;  3JTZ A;  2EML A;  4WXC A;  2EN4 A;  3BID A;  2M4I A;  1RQ0 A;  4DR1 E;  2KOU A;  5A6A A;  4L8N A;  2YPN A;  5AE3 A;  1J5E E;  4ZYH A;  2EN1 A;  2JP9 A;  1NEI A;  2EPZ A;  2Q8U A;  2LT7 A;  2EMG A;  4R2Q A;  4JI2 E;  4B3R E;  2L2N A;  4LF5 E;  2MKN A;  4DR4 E;  2EQ3 A;  2RPC A;  2YTQ A;  2CPN A;  2VE7 C;  1LLM C;  4Q28 A;  2ODR C;  3BBG A;  1QNT A;  1YSA C;  2RSM A;  5DNY A;  4FK5 C;  2NUF A;  2WBT A;  3JU0 A;  3T1H E;  1A1K A;  4KZS A;  3KZY A;  2HC5 A;  5CFF E;  3T1Y E;  2EOE A;  1UN6 B;  2HGH A;  3EPK A;  4JYA E;  3MHH C;  5A2Q C;  2L92 A;  2WBS A;  2EOF A;  2G7H A;  2VRD A;  1X6E A;  5A6J A;  2EPO A;  2D9H A;  2CTD A;  2ELZ A;  2EPL X;  3F6G A;  3VYY A;  2JPA A;  3IWD A;  2GHF A;  2EN2 A;  1IBK E;  4R03 A;  4OOG C;  2MC6 A;  1T39 A;  2EMY A;  2EWL A;  4DV2 E;  3ADJ A;  2CSH A;  2YRM A;  2MKD A;  2JYA A;  2EJ4 A;  4X62 E;  4F9C B;  1UBD C;  1NCS A;  1PDA A;  4WXD A;  5KL3 A;  4LFC E;  3EPH A;  4KHP E;  2UUA E;  4P78 A;  2LJU A;  2LV2 A;  2R76 A;  4F54 A;  1HNZ E;  2YTP A;  2UXD E;  2V89 A;  1EKZ A;  2NUG A;  2EOI A;  2UU9 E;  2YTN A;  3OML A;  2B9D A;  2EM6 A;  2RQL A;  2YTI A;  4BMJ A;  2EMK A;  4O43 A;  4R2C A;  3HQ1 A;  4DV5 E;  1IBM E;  1EH6 A;  3TQM A;  2EMI A;  1T38 A;  2EN3 A;  4ZYD A;  4O5G A;  4BHB A;  1IMU A;  2EOR A;  1WHN A;  2N3H A;  3IWC A;  2VF1 A;  1XMO E;  3J7Y p;  4N4R B;  2JOX A;  2YTG A;  1YUJ A;  2UXC E;  3C4T A;  2R1F A;  2LRS A;  1O0W A;  4DR2 E;  2L3C A;  3AV0 A;  2H36 X;  3C6M A;  4M2Z A;  4R2A A;  1B69 A;  4DUY E;  1KJK A;  1A1J A;  2I13 A;  1F2I G;  2ELY A;  3ZOQ B;  5KL6 A;  1DI2 A;  2EMB A;  2RS7 A;  2E5L E;  1HNW E;  2EL6 A;  4DV0 E;  1JK2 A;  2NAB A;  1TF3 A;  3HTX A;  2FTX B;  4R8O A;  2LUP B;  4JV5 E;  2N8X A;  4WSP A;  4LFB E;  4BCA A;  1T4L B;  1YZ9 A;  1J26 A;  2EM2 A;  4TUI A;  2UUB E;  5AE1 A;  2DB2 A;  1FJG E;  2EN8 A;  1IQS A;  4LF9 E;  2ODR D;  3J7A G;  2DLK A;  1ZAA C;  4WYQ B;  4JI6 E;  1YYW A;  2CT1 A;  1PKP A;  2EL4 A;  1FKA E;  5IXM B;  5A6K A;  3ADG A;  4X66 E;  2HHH E;  2RTX A;  4F9A B;  3AUZ A;  4JI1 E;  3FIG A;  4JI5 E;  2VQF E;  4DUZ E;  4GZN C;  2EM0 A;  4NHR A;  3ADL A;  2EOO A;  3THO B;  2M1S A;  4LFA E;  4R2D A;  2EM5 A;  1T4O A;  1YFH A;  5LL6 R;  1UIL A;  2UUC E;  2EPP A;  1A1F A;  1ZBQ A;  5KL2 A;  1PJT A;  5A6B D;  2JWO A;  2LE2 A;  2L33 A;  2YZT A;  4RH8 A;  1X3C A;  1EH7 A;  3HPZ A;  2EMH A;  3EQ1 A;  3VK6 A;  1N33 E;  1HNX E;  2NA2 A;  3C4B A;  2DMY A;  1A1G A;  2DLQ A;  2EPU A;  2EP3 A;  4LU9 A;  3C6K A;  5LMN E;  2L2M A;  4KWY A;  2GLI A;  4WFT A;  2JOB A;  2EOS A;  3DF6 A;  3JAM C;  4M9V C;  1YYK A;  3LML A;  2IHR 1;  1YUI A;  1RC7 A;  4DKK A;  2EOH A;  2LTR A;  4M0V A;  4LF8 E;  4BS9 A;  5IT9 C;  5IV8 B;  4DR7 E;  2LVH A;  2EMW A;  4JI8 E;  2V8Q B;  4OX9 E;  2FV4 B;  4LF4 E;  2EPA A;  1SFE A;  3EPJ A;  4X64 E;  3ADI A;  2A25 A;  2ENH A;  2MDG A;  4F6M A;  1XNR E;  2EMX A;  4O24 A;  3MSW A;  2EMA A;  1UHZ A;  2YRK A;  1G2D C;  2MC5 A;  3OTO E;  1PJS A;  2L2K B;  2LUQ A;  4HTG A;  4B3M E;  2EQ1 A;  2EL5 A;  4X65 E;  3KZZ A;  1N36 E;  2J7J A;  5BR8 E;  4WX9 A;  1N3G A;  2EPM X;  4HEI A;  3F6H A;  4JI7 E;  3J80 C;  1T4N A;  1G2F C;  1L4S A;  4LF6 E;  1XMQ E;  4BHC A;  5KL4 A;  2NUE A;  4ZYG A;  2B3T B;  2LBS B;  4GEQ B;  5AC4 A;  3BF2 A;  4MLV A;  2YWQ A;  4B3S E;  1WHQ A;  4DR6 E;  2RS6 A;  4X9J A;  2JY9 A;  2EZ6 A;  2EM9 A;  2WZO A;  4IS1 C;  2VQE E;  4F2J C;  2EPK X;  1N32 E;  1STU A;  2DMI A;  2EOY A;  1MEY C;  2YTD A;  2ENA A;  4DV7 E;  1N34 E;  1IBL E;  3L00 A;  2RSI A;  4LTY A;  2BB8 A;  2E72 A;  1WXR A;  3QG5 C;  4BC9 A;  2EN7 A;  2L3J A;  2ZM6 E;  3DJW A;  2WCC 3;  2YTO A;  1ZBT A;  4MLQ A;  5A69 A;  2F8B A;  4I8O A;  1RMD A;  2EOZ A;  4YHH E;  4JI4 E;  2EOQ A;  1GTK A;  2YTE A;  4WSG A;  4BBY A;  3IWB A;  2V88 A;  4R2S A;  4F6N A;  1YPN A;  1A1H A;  1XNQ E;  2MDR A;  2L6M A;  1AAY A;  2EOJ A;  1WRJ A;  4X8W A;  2YT4 A;  1DGC A;  4GKJ E;  5IWA E;  2F4V E;  4F9B B;  1A1I A;  2EM3 A;  4O4K A;  3P1X A;  5KL7 A;  1BBG A;  3LLH A;  1QU6 A;  1BB8 A;  2EOX A;  5AE2 A;  2M7Q A;  4JI0 E;  2EM7 A;  2FGG A;  2EPX A;  5LLQ A;  1A1L A; 
#chains in the Genus database with same CATH homology
 2UXB E;  2FV4 B;  4L5N C;  1O0W A;  4LF4 E;  2M4I A;  4DR2 E;  2L3C A;  1RQ0 A;  5FLX C;  3AV0 A;  2KOU A;  4DR1 E;  2H36 X;  4X64 E;  1GQE A;  4L8N A;  2LTS A;  5AE3 A;  1J5E E;  4B3T E;  4M2Z A;  3ADI A;  4DMI A;  4DUY E;  1XNR E;  4GKK E;  4K0K E;  3HXL A;  4JI2 E;  3RMP A;  4B3R E;  2L2N A;  4LF5 E;  3MSW A;  3ZOQ B;  4NXM E;  4DR4 E;  1DI2 A;  1UHZ A;  2MC5 A;  2RS7 A;  2E5L E;  3VYX A;  3K6Q A;  4DV0 E;  3OTO E;  2CPN A;  1HNW E;  2VE7 C;  1X48 A;  2L2K B;  2LJH A;  2LUQ A;  4Q28 A;  4B3M E;  3J81 C;  3HTX A;  2ODR C;  2FTX B;  4R8O A;  4JI3 E;  2LUP B;  2RSM A;  4X65 E;  4WSP A;  5DNY A;  4JV5 E;  1N36 E;  2NUF A;  5BR8 E;  3JU0 A;  4LFB E;  4BCA A;  4JI7 E;  3F6H A;  1T4L B;  3T1H E;  3J80 C;  4WPY A;  3KWR A;  4KZS A;  1T4N A;  1YZ9 A;  1J26 A;  5LMU E;  4LF6 E;  3T1Y E;  5CFF E;  4M30 A;  4TUI A;  1XMQ E;  5AE1 A;  2UUB E;  2DB2 A;  1FJG E;  2NUE A;  2B3T B;  2JR1 A;  2LBS B;  4LF9 E;  2ODR D;  2KHX A;  3JTZ A;  3J7A G;  4JYA E;  4GEQ B;  2DSY A;  4WYQ B;  4JI6 E;  1YYW A;  1PKP A;  1FKA E;  5AAS A;  4B3S E;  5A2Q C;  2L92 A;  1WHQ A;  4DR6 E;  2G7H A;  2RS6 A;  3ADG A;  4X66 E;  2JY9 A;  2HHH E;  2EZ6 A;  2RTX A;  1I94 E;  2WZO A;  3F6G A;  3VYY A;  3IWD A;  5ADZ A;  4F9A B;  3AUZ A;  4AQY E;  4JI1 E;  3FIG A;  2VQE E;  1IBK E;  2VQF E;  4JI5 E;  1STU A;  4R03 A;  4OOG C;  4DUZ E;  2KON A;  2DIX A;  2MC6 A;  4DR5 E;  2EWL A;  1DQ3 A;  4DV2 E;  3ADJ A;  2B7T A;  4X62 E;  3ADL A;  2V87 A;  4DV7 E;  2M1S A;  1N34 E;  4F9C B;  1IBL E;  4LFA E;  2E1M A;  2JVA A;  4LTY A;  4J8Z A;  1WXR A;  1T4O A;  4BC9 A;  5F3W A;  2L3J A;  2ZM6 E;  4DV4 E;  3DJW A;  4LFC E;  5LL6 R;  1UIL A;  2UUC E;  2L8T A;  4KHP E;  2UUA E;  1N32 E;  4P78 A;  1X49 A;  1ZBQ A;  1ZBT A;  4F54 A;  1HNZ E;  2JWO A;  2LE2 A;  2L33 A;  2YZT A;  2V89 A;  2V85 A;  3VK6 A;  4DV1 E;  3HPZ A;  2F8B A;  1EKZ A;  2UXD E;  2NUG A;  2LMZ A;  4I8O A;  1HNX E;  4NXN E;  1N33 E;  2NA2 A;  2K4V A;  3C4B A;  1YYO A;  2UU9 E;  3OML A;  2DMY A;  2B9D A;  4YHH E;  4JI4 E;  4BMJ A;  4LF7 E;  4DR3 E;  4BBY A;  3IWB A;  1HR0 E;  2V88 A;  3HQ1 A;  4P7D A;  4LU9 A;  4DV5 E;  1IBM E;  5LMN E;  1XNQ E;  2L2M A;  2MDR A;  3H09 A;  2L6M A;  4DV6 E;  4TUG A;  4X8W A;  2YT4 A;  3HPS A;  4WFT A;  2JOB A;  2N3G A;  4GKJ E;  5IWA E;  2F4V E;  4F9B B;  3DF6 A;  3JAM C;  1SR9 A;  2V86 A;  3P1X A;  1YYK A;  3LML A;  3LLH A;  1QU6 A;  4DV3 E;  4BC7 A;  5AE2 A;  1WHN A;  2IHR 1;  2N3H A;  5T6J A;  3IWC A;  1RC7 A;  2VF1 A;  4JI8 E;  2M7Q A;  4DKK A;  1XMO E;  3J7Y p;  4JI0 E;  1X47 A;  2LTR A;  2V83 A;  4M0V A;  1GZ6 A;  2B7V A;  2JOX A;  4LF8 E;  2FGG A;  4BS9 A;  4YY3 E;  5IT9 C;  4DR7 E;  2UXC E;  3C4T A;  2LRS A;  2V8Q B;  4OX9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...