2MDRA

Solution structure of the third double-stranded rna-binding domain (dsrbd3) of human adenosine-deaminase adar1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
94
structure length
94
Chain Sequence
b'MMPNKVRKIGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQEAADAALRVLIGENEKAER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Double-stranded RNA-specific adenosine deaminase
publication title A bimodular nuclear localization signal assembled via an extended double-stranded RNA-binding domain acts as an RNA-sensing signal for transportin 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 26
structure length 94
sequence length 94
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2mdrA00
1N32E 2B3TB 4X64E 1WHNA 4JI8E 4DV6E 4JI4E 1RQ0A 4AQYE 2E5LE 4JI5E 4OOGC 1X49A 1X47A 4JYAE 2L2NA 2L2KB 3C4TA 2N3GA 4B3SE 4LFAE 1QU6A 2L3CA 3ADJA 3T1HE 4YHHE 4LF7E 3VYXA 1J26A 2IHR1 5BR8E 3T1YE 1T4LB 4JI0E 2LTSA 1X48A 2N3HA 1WHQA 4DR3E 2RS7A 2UXDE 4DV5E 4LF8E 1PKPA 1XNRE 4GKKE 4DV2E 2LUPB 1N34E 4DR5E 1IBLE 4DR6E 4DR7E 4DR1E 1XNQE 4LFBE 1XMOE 1N36E 4DKKA 4JI1E 2EZ6A 2YT4A 2UUAE 4X65E 4LF4E 2KHXA 1DI2A 4LFCE 1FKAE 4DUYE 4M2ZA 2MDRA 4NXME 1N33E 4LF9E 1RC7A 4GKJE 4K0KE 2DMYA 1O0WA 2JVAA 4X62E 4DV1E 4JI3E 1IBME 2ZM6E 4B3RE 4NXNE 4M30A 1YYOA 2B7TA 1YYKA 2F4VE 2VQFE 2UU9E 1GQEA 2LTRA 3P1XA 3ADLA 2JY9A 3ADIA 2L2MA 2L3JA 1J5EE 1T4NA 4DR2E 4LF5E 5LMNE 3HTXA 1T4OA 2VQEE 4LF6E 3C4BA 5CFFE 2L33A 2LRSA 2HHHE 1STUA 2RS6A 4DV0E 1EKZA 4WFTA 2UUCE 2B7VA 1UILA 2RSMA 2NUGA 1FJGE 2RTXA 4JV5E 1YZ9A 4WYQB 4DV3E 1IBKE 3J7Yp 3OTOE 2DIXA 2LJHA 2UXBE 2CPNA 4B3TE 4JI6E 1HR0E 4DR4E 1HNXE 1HNWE 3ADGA 2NA2A 4DV4E 2DB2A 4X8WA 2LUQA 3LLHA 3VYYA 2UUBE 5LMUE 4KHPE 2NUEA 1ZBTA 1YYWA 2LBSB 1HNZE 4B3ME 1I94E 1UHZA 4DUZE 4X66E 2NUFA 4YY3E 1XMQE 2UXCE 4JI7E 4OX9E 5IWAE 4DV7E 4JI2E
chains in the Genus database with same CATH superfamily
4JI8E 1BB8A 1RQ0A 2E5LE 4JI5E 1A1FA 4R2AA 4OOGC 2EPZA 2EM6A 4ZYEA 1X47A 2VF1A 2L2NA 2YSOA 3EPHA 4B3SE 1MEYC 2L3CA 3ADJA 3T1HE 3ZOQB 1G2FC 2EMGA 3T1YE 1F2IG 2EPOA 3J80C 2LTSA 3DJWA 1JK2A 4Q28A 2RS7A 2YTPA 1A1JA 2UXDE 2EOOA 2M9AA 2NABA 3HPSA 2LUPB 4TUIA 2EL4A 4DR6E 3MHSC 1IQOA 4TUGA 4DKKA 3DF6A 4LF4E 2YTIA 2JP9A 2EOYA 2ELZA 2KHXA 2JPAA 1DQ3A 5TSEA 2EOQA 4M2ZA 2MDRA 2EPMX 1A1LA 2EN6A 2LVHA 4ZYGA 4LF9E 1RC7A 4HEIA 2EOHA 4MLVA 4K0KE 5ADZA 1A1IA 2JVAA 4DV1E 1WRJA 2YZTA 2EL5A 2EPRA 2EOIA 4M0VA 2EJ4A 2ENHA 2YU5A 3KWRA 4DMIA 2EPKX 2YTFA 3KZZA 2L2MA 3H09A 3MHHC 2CT1A 1T4NA 4P78A 4DR2E 1QNTA 4LF6E 4BCAA 2EPLX 2LRSA 1STUA 2ODRD 3F6HA 4DV0E 2R1FA 2MKNA 2EM3A 2B7VA 2E72A 2CTDA 1WJPA 4GZNC 1YZ9A 1IBKE 1ZBQA 3IWBA 2EPUA 2MDGA 2VRDA 2DLKA 1HR0E 2EMKA 4DR4E 4LTYA 2G7HA 1HNXE 1HNWE 5A6BA 4DV4E 4RHBB 2LUQA 5IV8B 4R2RA 4KHPE 1ZBTA 1YYWA 2EORA 2LJUA 2NUFA 2N8XA 1TF3A 2WZOA 4X9JA 4OX9E 5IWAE 2EPCA 2JWOA 3OMLA 4F6NA 3LMLA 1WHNA 4DV6E 3BF2A 1X49A 2LV2A 3HQ1A 4WX9A 2D9HA 2MC5A 5A69A 2EN8A 2FGGA 1J26A 2BBGA 3C6KA 2ODRC 2EPAA 1WHQA 4DR3E 5A6JA 1X6FA 4BS9A 1N34E 3AV0A 2YRHA 1T39A 4JI1E 1G2DC 4R2SA 2EPNA 2EOXA 4X65E 2EM2A 2EP3A 2R76A 2EM8A 1P47A 2E1MA 2A25A 2JR1A 2K7IA 1A1HA 4GKJE 3THOB 1BBGA 2RSIA 2DMYA 2EM7A 1O0WA 1YFHA 4JI3E 2RQLA 1UN6B 1X5WA 4O24A 5A6KA 4P7DA 3MSWA 1PJQA 1YYKA 3F6GA 2F4VE 1BBOA 3P1XA 2L92A 1TF6A 4MLQA 3BGHA 3HTXA 4R2EA 2RPCA 3C4BA 5KL4A 2LT7A 2RS6A 1EKZA 2V88A 4WFTA 2UUCE 1FJGE 1KJKA 2EMHA 2DIXA 2EMAA 5A6BD 2FV4B 2PRTA 3RMPA 2NA2A 2EPPA 5AE3A 4O43A 4F6MA 3J7AG 3C6MA 2EN2A 4Q35B 5A2QC 2EM0A 1I94E 4F9CB 4IJDA 2L6MA 2UXCE 2EPXA 2EOEA 1A1GA 4WSGA 2YTNA 4DV7E 1TN9A 4BC9A 1GTKA 5AASA 3M99B 1GZ6A 2EM9A 2GLIA 4JI4E 1T38A 2EM4A 5AC4A 2EN4A 2FTXB 4F9BB 4JYAE 2L2KB 2EOJA 2GPIA 2BB8A 3L00A 4LF7E 1NEIA 5LLQA 5BR8E 2EMFA 1T4LB 2YSPA 4JI0E 3QG5C 2YRKA 2YTDA 2DSYA 2KONA 4DV5E 3EPKA 4LF8E 4GKKE 4DV2E 2HJJA 2I9IA 2V86A 4DR5E 3TQMA 3JTZA 1IBLE 1XMOE 2YTGA 1DGCA 2EZ6A 5AE1A 3AUZA 2UUAE 5KL5A 5KL2A 1DI2A 1FKAE 4DUYE 2WBUA 4ZYDA 4R03A 1ZAAC 2V87A 5FLXC 2YTQA 3IWCA 5AC5A 2V85A 5F3WA 2B9DA 2ZM6E 4BMJA 2M7QA 2V83A 2EWLA 4ZYHA 2GHFA 1AH5A 2YWQA 2MC6A 4O5GA 1L4SA 2LTRA 2WBTA 3ADIA 2EQ3A 4LU9A 2L3JA 1J5EE 1YSAC 4LF5E 1MGTA 2V89A 5CFFE 2L33A 2HHHE 1PJSA 4HTGA 4GEQB 2ENAA 1UBDC 1UILA 2LMZA 1NCSA 2RSMA 5AE2A 2NUGA 2RTXA 1Z1BA 2VE7C 4R8OA 4WYQB 3J7Yp 2DLQA 2UXBE 1YUJA 4B3TE 4JI6E 2I13A 2M1SA 2ENCA 4IS1C 2DGCA 1X6EA 2JOXA 1RMDA 1PDAA 2DB2A 4X8WA 1WXRA 2UUBE 2NUEA 2EMIA 2M4IA 4N4RB 3K6QA 1ZR9A 2EN7A 2LBSB 1HNZE 4B3ME 2H36X 2Q8UA 1UHZA 4DUZE 3FIGA 3HPZA 2HC5A 4J8ZA 3IWDA 1AAYA 4KWYA 4JI2E 1ZU1A 2KOUA 2EOSA 4O4KA 4WXDA 1N32E 2B3TB 2YPNA 4X64E 2EMCA 1IQSA 5KL3A 4F9AB 1PJTA 4AQYE 3EQ1A 1EH7A 2EMWA 2YU8A 1X6HA 2HGHA 3C4TA 2N3GA 4LFAE 1QU6A 5DNYA 2EN3A 4YHHE 3VYXA 4F54A 2IHR1 2YRMA 1X48A 2N3HA 4L8NA 5T6JA 4NZVA 1EH6A 1PKPA 1XNRE 4BHBA 4DR7E 4DR1E 1XNQE 4LFBE 1N36E 2YT4A 2YTJA 2JOBA 5IT9C 1JK1A 4R2CA 2LE2A 4LFCE 2WBSA 3UK3C 5IXMB 3THNA 2EN1A 1YUIA 3BIDA 4WXCA 3EPLA 1LLMC 3HXLA 4NXME 1N33E 2J7JA 2L8TA 4WSPA 4BHCA 2V8QB 2YTOA 4M9VC 4R2PA 2DRPA 5KL6A 3KZYA 4X62E 3JAMC 1SR9A 3ECRA 1IBME 2EMYA 4NXNE 4B3RE 1YPNA 4M30A 3J81C 1YYOA 4WPYA 1B69A 2EQ1A 2B7TA 2EL6A 2JYAA 4BC7A 3VK6A 2VQFE 1SFEA 2JXPA 2LCEA 1GQEA 2UU9E 3ADLA 2JY9A 1EH8A 2WCC3 4R2DA 2EOZA 2EMLA 5LMNE 2ELYA 2DMIA 4RH8A 1T4OA 2VQEE 1A1KA 2EM5A 4F2JC 2EMBA 4R2QA 4BBYA 4KZSA 3BBGA 1IMUA 2EMZA 2K4VA 4JV5E 2CSHA 4DV3E 3OTOE 2LJHA 2CPNA 2LO3A 4NHRA 4L5NC 3ADGA 3LLHA 5LL6R 2F8BA 3VYYA 3JU0A 5LMUE 2EE8A 3EPJA 2YTEA 2EQ0A 2EOFA 4FK5C 4X66E 1KYQA 1X3CA 4YY3E 4I8OA 1XMQE 4JI7E 5KL7A 2MKDA 3VHTB 1N3GA 5A6AA 2EMXA 2EOMA 2ADRA
chains in the Genus database with same CATH topology
5AASA 1N32E 3OMLA 1GZ6A 2B3TB 3LMLA 4X64E 1WHNA 4JI8E 4DV6E 4JI4E 4F9AB 1RQ0A 4AQYE 2E5LE 4JI5E 4OOGC 2FTXB 4F9BB 1X49A 1X47A 4JYAE 3HQ1A 2VF1A 2L2NA 2L2KB 3C4TA 2N3GA 1YZ9A 4B3SE 2MC5A 4LFAE 1QU6A 5DNYA 2L3CA 2FGGA 3ADJA 3T1HE 4YHHE 4LF7E 3VYXA 3ZOQB 1J26A 4F54A 2IHR1 5BR8E 3T1YE 1T4LB 4JI0E 3J80C 2LTSA 3DJWA 2ODRC 1X48A 2N3HA 1WHQA 2DSYA 4L8NA 4Q28A 2RS7A 2KONA 5T6JA 4BS9A 4DV5E 4DR3E 1PKPA 4LF8E 1XNRE 4GKKE 4DV2E 3HPSA 2LUPB 2V86A 4TUIA 4DR5E 1N34E 1IBLE 3AV0A 3JTZA 4DR6E 4DR7E 4DR1E 1XNQE 4LFBE 4TUGA 1XMOE 4DKKA 1N36E 4JI1E 2EZ6A 2YT4A 3DF6A 2JOBA 5AE1A 3AUZA 4X65E 5IT9C 2UUAE 4LF4E 2LE2A 2KHXA 1DI2A 4LFCE 1DQ3A 1FKAE 4DUYE 4M2ZA 2E1MA 2MDRA 3HXLA 4NXME 2JR1A 2L8TA 4R03A 4WSPA 1N33E 2V87A 5FLXC 2V8QB 4LF9E 3IWCA 1RC7A 4GKJE 2V85A 5F3WA 4K0KE 2B9DA 5ADZA 2DMYA 1O0WA 2JVAA 4X62E 3JAMC 1SR9A 4DV1E 4JI3E 1IBME 2ZM6E 4B3RE 4NXNE 2YZTA 4BMJA 4M30A 4P7DA 2M7QA 3J81C 1YYOA 3MSWA 4WPYA 2V83A 2EWLA 2B7TA 1YYKA 4BC7A 4M0VA 3F6GA 3VK6A 2F4VE 2VQFE 2MC6A 2UU9E 1GQEA 2LTRA 3KWRA 3P1XA 2JY9A 4DMIA 3ADIA 3ADLA 2L92A 2L2MA 4LU9A 3H09A 2L3JA 1J5EE 1T4NA 4P78A 4DR2E 5LMNE 4LF5E 3HTXA 1T4OA 2VQEE 4LF6E 3C4BA 2V89A 4BCAA 2L33A 2LRSA 5CFFE 1STUA 2ODRD 3F6HA 2RS6A 4DV0E 4BBYA 2HHHE 4KZSA 1EKZA 2V88A 4WFTA 2UUCE 2B7VA 4GEQB 1UILA 2LMZA 2RSMA 5AE2A 2K4VA 2NUGA 1FJGE 2RTXA 4JV5E 2VE7C 4R8OA 1ZBQA 4WYQB 3J7Yp 3OTOE 2DIXA 2LJHA 4DV3E 1IBKE 3IWBA 2UXBE 2CPNA 4B3TE 4JI6E 1HR0E 2FV4B 2M1SA 4DR4E 2UXDE 4LTYA 2G7HA 1HNXE 1HNWE 2JOXA 4L5NC 3ADGA 3RMPA 2NA2A 4DV4E 2DB2A 4X8WA 2LUQA 3LLHA 5LL6R 2F8BA 5AE3A 1WXRA 3JU0A 5LMUE 3VYYA 2UUBE 3J7AG 2NUEA 4KHPE 1ZBTA 2M4IA 1YYWA 3K6QA 2LBSB 1HNZE 4B3ME 2H36X 5A2QC 1I94E 1UHZA 4DUZE 4F9CB 3FIGA 4X66E 2NUFA 4YY3E 4I8OA 3HPZA 1XMQE 2L6MA 4J8ZA 2UXCE 2WZOA 4JI7E 3IWDA 4OX9E 5IWAE 4DV7E 4JI2E 4BC9A 2KOUA 2JWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N32 E;  2B3T B;  4X64 E;  1WHN A;  4JI8 E;  4DV6 E;  4JI4 E;  1RQ0 A;  4AQY E;  2E5L E;  4JI5 E;  4OOG C;  1X49 A;  1X47 A;  4JYA E;  2L2N A;  2L2K B;  3C4T A;  2N3G A;  4B3S E;  4LFA E;  1QU6 A;  2L3C A;  3ADJ A;  3T1H E;  4YHH E;  4LF7 E;  3VYX A;  1J26 A;  2IHR 1;  5BR8 E;  3T1Y E;  1T4L B;  4JI0 E;  2LTS A;  1X48 A;  2N3H A;  1WHQ A;  4DR3 E;  2RS7 A;  2UXD E;  4DV5 E;  4LF8 E;  1PKP A;  1XNR E;  4GKK E;  4DV2 E;  2LUP B;  1N34 E;  4DR5 E;  1IBL E;  4DR6 E;  4DR7 E;  4DR1 E;  1XNQ E;  4LFB E;  1XMO E;  1N36 E;  4DKK A;  4JI1 E;  2EZ6 A;  2YT4 A;  2UUA E;  4X65 E;  4LF4 E;  2KHX A;  1DI2 A;  4LFC E;  1FKA E;  4DUY E;  4M2Z A;  2MDR A;  4NXM E;  1N33 E;  4LF9 E;  1RC7 A;  4GKJ E;  4K0K E;  2DMY A;  1O0W A;  2JVA A;  4X62 E;  4DV1 E;  4JI3 E;  1IBM E;  2ZM6 E;  4B3R E;  4NXN E;  4M30 A;  1YYO A;  2B7T A;  1YYK A;  2F4V E;  2VQF E;  2UU9 E;  1GQE A;  2LTR A;  3P1X A;  3ADL A;  2JY9 A;  3ADI A;  2L2M A;  2L3J A;  1J5E E;  1T4N A;  4DR2 E;  4LF5 E;  5LMN E;  3HTX A;  1T4O A;  2VQE E;  4LF6 E;  3C4B A;  5CFF E;  2L33 A;  2LRS A;  2HHH E;  1STU A;  2RS6 A;  4DV0 E;  1EKZ A;  4WFT A;  2UUC E;  2B7V A;  1UIL A;  2RSM A;  2NUG A;  1FJG E;  2RTX A;  4JV5 E;  1YZ9 A;  4WYQ B;  4DV3 E;  1IBK E;  3J7Y p;  3OTO E;  2DIX A;  2LJH A;  2UXB E;  2CPN A;  4B3T E;  4JI6 E;  1HR0 E;  4DR4 E;  1HNX E;  1HNW E;  3ADG A;  2NA2 A;  4DV4 E;  2DB2 A;  4X8W A;  2LUQ A;  3LLH A;  3VYY A;  2UUB E;  5LMU E;  4KHP E;  2NUE A;  1ZBT A;  1YYW A;  2LBS B;  1HNZ E;  4B3M E;  1I94 E;  1UHZ A;  4DUZ E;  4X66 E;  2NUF A;  4YY3 E;  1XMQ E;  2UXC E;  4JI7 E;  4OX9 E;  5IWA E;  4DV7 E;  4JI2 E; 
#chains in the Genus database with same CATH topology
 4JI8 E;  1BB8 A;  1RQ0 A;  2E5L E;  4JI5 E;  1A1F A;  4R2A A;  4OOG C;  2EPZ A;  2EM6 A;  4ZYE A;  1X47 A;  2VF1 A;  2L2N A;  2YSO A;  3EPH A;  4B3S E;  1MEY C;  2L3C A;  3ADJ A;  3T1H E;  3ZOQ B;  1G2F C;  2EMG A;  3T1Y E;  1F2I G;  2EPO A;  3J80 C;  2LTS A;  3DJW A;  1JK2 A;  4Q28 A;  2RS7 A;  2YTP A;  1A1J A;  2UXD E;  2EOO A;  2M9A A;  2NAB A;  3HPS A;  2LUP B;  4TUI A;  2EL4 A;  4DR6 E;  3MHS C;  1IQO A;  4TUG A;  4DKK A;  3DF6 A;  4LF4 E;  2YTI A;  2JP9 A;  2EOY A;  2ELZ A;  2KHX A;  2JPA A;  1DQ3 A;  5TSE A;  2EOQ A;  4M2Z A;  2MDR A;  2EPM X;  1A1L A;  2EN6 A;  2LVH A;  4ZYG A;  4LF9 E;  1RC7 A;  4HEI A;  2EOH A;  4MLV A;  4K0K E;  5ADZ A;  1A1I A;  2JVA A;  4DV1 E;  1WRJ A;  2YZT A;  2EL5 A;  2EPR A;  2EOI A;  4M0V A;  2EJ4 A;  2ENH A;  2YU5 A;  3KWR A;  4DMI A;  2EPK X;  2YTF A;  3KZZ A;  2L2M A;  3H09 A;  3MHH C;  2CT1 A;  1T4N A;  4P78 A;  4DR2 E;  1QNT A;  4LF6 E;  4BCA A;  2EPL X;  2LRS A;  1STU A;  2ODR D;  3F6H A;  4DV0 E;  2R1F A;  2MKN A;  2EM3 A;  2B7V A;  2E72 A;  2CTD A;  1WJP A;  4GZN C;  1YZ9 A;  1IBK E;  1ZBQ A;  3IWB A;  2EPU A;  2MDG A;  2VRD A;  2DLK A;  1HR0 E;  2EMK A;  4DR4 E;  4LTY A;  2G7H A;  1HNX E;  1HNW E;  5A6B A;  4DV4 E;  4RHB B;  2LUQ A;  5IV8 B;  4R2R A;  4KHP E;  1ZBT A;  1YYW A;  2EOR A;  2LJU A;  2NUF A;  2N8X A;  1TF3 A;  2WZO A;  4X9J A;  4OX9 E;  5IWA E;  2EPC A;  2JWO A;  3OML A;  4F6N A;  3LML A;  1WHN A;  4DV6 E;  3BF2 A;  1X49 A;  2LV2 A;  3HQ1 A;  4WX9 A;  2D9H A;  2MC5 A;  5A69 A;  2EN8 A;  2FGG A;  1J26 A;  2BBG A;  3C6K A;  2ODR C;  2EPA A;  1WHQ A;  4DR3 E;  5A6J A;  1X6F A;  4BS9 A;  1N34 E;  3AV0 A;  2YRH A;  1T39 A;  4JI1 E;  1G2D C;  4R2S A;  2EPN A;  2EOX A;  4X65 E;  2EM2 A;  2EP3 A;  2R76 A;  2EM8 A;  1P47 A;  2E1M A;  2A25 A;  2JR1 A;  2K7I A;  1A1H A;  4GKJ E;  3THO B;  1BBG A;  2RSI A;  2DMY A;  2EM7 A;  1O0W A;  1YFH A;  4JI3 E;  2RQL A;  1UN6 B;  1X5W A;  4O24 A;  5A6K A;  4P7D A;  3MSW A;  1PJQ A;  1YYK A;  3F6G A;  2F4V E;  1BBO A;  3P1X A;  2L92 A;  1TF6 A;  4MLQ A;  3BGH A;  3HTX A;  4R2E A;  2RPC A;  3C4B A;  5KL4 A;  2LT7 A;  2RS6 A;  1EKZ A;  2V88 A;  4WFT A;  2UUC E;  1FJG E;  1KJK A;  2EMH A;  2DIX A;  2EMA A;  5A6B D;  2FV4 B;  2PRT A;  3RMP A;  2NA2 A;  2EPP A;  5AE3 A;  4O43 A;  4F6M A;  3J7A G;  3C6M A;  2EN2 A;  4Q35 B;  5A2Q C;  2EM0 A;  1I94 E;  4F9C B;  4IJD A;  2L6M A;  2UXC E;  2EPX A;  2EOE A;  1A1G A;  4WSG A;  2YTN A;  4DV7 E;  1TN9 A;  4BC9 A;  1GTK A;  5AAS A;  3M99 B;  1GZ6 A;  2EM9 A;  2GLI A;  4JI4 E;  1T38 A;  2EM4 A;  5AC4 A;  2EN4 A;  2FTX B;  4F9B B;  4JYA E;  2L2K B;  2EOJ A;  2GPI A;  2BB8 A;  3L00 A;  4LF7 E;  1NEI A;  5LLQ A;  5BR8 E;  2EMF A;  1T4L B;  2YSP A;  4JI0 E;  3QG5 C;  2YRK A;  2YTD A;  2DSY A;  2KON A;  4DV5 E;  3EPK A;  4LF8 E;  4GKK E;  4DV2 E;  2HJJ A;  2I9I A;  2V86 A;  4DR5 E;  3TQM A;  3JTZ A;  1IBL E;  1XMO E;  2YTG A;  1DGC A;  2EZ6 A;  5AE1 A;  3AUZ A;  2UUA E;  5KL5 A;  5KL2 A;  1DI2 A;  1FKA E;  4DUY E;  2WBU A;  4ZYD A;  4R03 A;  1ZAA C;  2V87 A;  5FLX C;  2YTQ A;  3IWC A;  5AC5 A;  2V85 A;  5F3W A;  2B9D A;  2ZM6 E;  4BMJ A;  2M7Q A;  2V83 A;  2EWL A;  4ZYH A;  2GHF A;  1AH5 A;  2YWQ A;  2MC6 A;  4O5G A;  1L4S A;  2LTR A;  2WBT A;  3ADI A;  2EQ3 A;  4LU9 A;  2L3J A;  1J5E E;  1YSA C;  4LF5 E;  1MGT A;  2V89 A;  5CFF E;  2L33 A;  2HHH E;  1PJS A;  4HTG A;  4GEQ B;  2ENA A;  1UBD C;  1UIL A;  2LMZ A;  1NCS A;  2RSM A;  5AE2 A;  2NUG A;  2RTX A;  1Z1B A;  2VE7 C;  4R8O A;  4WYQ B;  3J7Y p;  2DLQ A;  2UXB E;  1YUJ A;  4B3T E;  4JI6 E;  2I13 A;  2M1S A;  2ENC A;  4IS1 C;  2DGC A;  1X6E A;  2JOX A;  1RMD A;  1PDA A;  2DB2 A;  4X8W A;  1WXR A;  2UUB E;  2NUE A;  2EMI A;  2M4I A;  4N4R B;  3K6Q A;  1ZR9 A;  2EN7 A;  2LBS B;  1HNZ E;  4B3M E;  2H36 X;  2Q8U A;  1UHZ A;  4DUZ E;  3FIG A;  3HPZ A;  2HC5 A;  4J8Z A;  3IWD A;  1AAY A;  4KWY A;  4JI2 E;  1ZU1 A;  2KOU A;  2EOS A;  4O4K A;  4WXD A;  1N32 E;  2B3T B;  2YPN A;  4X64 E;  2EMC A;  1IQS A;  5KL3 A;  4F9A B;  1PJT A;  4AQY E;  3EQ1 A;  1EH7 A;  2EMW A;  2YU8 A;  1X6H A;  2HGH A;  3C4T A;  2N3G A;  4LFA E;  1QU6 A;  5DNY A;  2EN3 A;  4YHH E;  3VYX A;  4F54 A;  2IHR 1;  2YRM A;  1X48 A;  2N3H A;  4L8N A;  5T6J A;  4NZV A;  1EH6 A;  1PKP A;  1XNR E;  4BHB A;  4DR7 E;  4DR1 E;  1XNQ E;  4LFB E;  1N36 E;  2YT4 A;  2YTJ A;  2JOB A;  5IT9 C;  1JK1 A;  4R2C A;  2LE2 A;  4LFC E;  2WBS A;  3UK3 C;  5IXM B;  3THN A;  2EN1 A;  1YUI A;  3BID A;  4WXC A;  3EPL A;  1LLM C;  3HXL A;  4NXM E;  1N33 E;  2J7J A;  2L8T A;  4WSP A;  4BHC A;  2V8Q B;  2YTO A;  4M9V C;  4R2P A;  2DRP A;  5KL6 A;  3KZY A;  4X62 E;  3JAM C;  1SR9 A;  3ECR A;  1IBM E;  2EMY A;  4NXN E;  4B3R E;  1YPN A;  4M30 A;  3J81 C;  1YYO A;  4WPY A;  1B69 A;  2EQ1 A;  2B7T A;  2EL6 A;  2JYA A;  4BC7 A;  3VK6 A;  2VQF E;  1SFE A;  2JXP A;  2LCE A;  1GQE A;  2UU9 E;  3ADL A;  2JY9 A;  1EH8 A;  2WCC 3;  4R2D A;  2EOZ A;  2EML A;  5LMN E;  2ELY A;  2DMI A;  4RH8 A;  1T4O A;  2VQE E;  1A1K A;  2EM5 A;  4F2J C;  2EMB A;  4R2Q A;  4BBY A;  4KZS A;  3BBG A;  1IMU A;  2EMZ A;  2K4V A;  4JV5 E;  2CSH A;  4DV3 E;  3OTO E;  2LJH A;  2CPN A;  2LO3 A;  4NHR A;  4L5N C;  3ADG A;  3LLH A;  5LL6 R;  2F8B A;  3VYY A;  3JU0 A;  5LMU E;  2EE8 A;  3EPJ A;  2YTE A;  2EQ0 A;  2EOF A;  4FK5 C;  4X66 E;  1KYQ A;  1X3C A;  4YY3 E;  4I8O A;  1XMQ E;  4JI7 E;  5KL7 A;  2MKD A;  3VHT B;  1N3G A;  5A6A A;  2EMX A;  2EOM A;  2ADR A; 
#chains in the Genus database with same CATH homology
 5AAS A;  1N32 E;  3OML A;  1GZ6 A;  2B3T B;  3LML A;  4X64 E;  1WHN A;  4JI8 E;  4DV6 E;  4JI4 E;  4F9A B;  1RQ0 A;  4AQY E;  2E5L E;  4JI5 E;  4OOG C;  2FTX B;  4F9B B;  1X49 A;  1X47 A;  4JYA E;  3HQ1 A;  2VF1 A;  2L2N A;  2L2K B;  3C4T A;  2N3G A;  1YZ9 A;  4B3S E;  2MC5 A;  4LFA E;  1QU6 A;  5DNY A;  2L3C A;  2FGG A;  3ADJ A;  3T1H E;  4YHH E;  4LF7 E;  3VYX A;  3ZOQ B;  1J26 A;  4F54 A;  2IHR 1;  5BR8 E;  3T1Y E;  1T4L B;  4JI0 E;  3J80 C;  2LTS A;  3DJW A;  2ODR C;  1X48 A;  2N3H A;  1WHQ A;  2DSY A;  4L8N A;  4Q28 A;  2RS7 A;  2KON A;  5T6J A;  4BS9 A;  4DV5 E;  4DR3 E;  1PKP A;  4LF8 E;  1XNR E;  4GKK E;  4DV2 E;  3HPS A;  2LUP B;  2V86 A;  4TUI A;  4DR5 E;  1N34 E;  1IBL E;  3AV0 A;  3JTZ A;  4DR6 E;  4DR7 E;  4DR1 E;  1XNQ E;  4LFB E;  4TUG A;  1XMO E;  4DKK A;  1N36 E;  4JI1 E;  2EZ6 A;  2YT4 A;  3DF6 A;  2JOB A;  5AE1 A;  3AUZ A;  4X65 E;  5IT9 C;  2UUA E;  4LF4 E;  2LE2 A;  2KHX A;  1DI2 A;  4LFC E;  1DQ3 A;  1FKA E;  4DUY E;  4M2Z A;  2E1M A;  2MDR A;  3HXL A;  4NXM E;  2JR1 A;  2L8T A;  4R03 A;  4WSP A;  1N33 E;  2V87 A;  5FLX C;  2V8Q B;  4LF9 E;  3IWC A;  1RC7 A;  4GKJ E;  2V85 A;  5F3W A;  4K0K E;  2B9D A;  5ADZ A;  2DMY A;  1O0W A;  2JVA A;  4X62 E;  3JAM C;  1SR9 A;  4DV1 E;  4JI3 E;  1IBM E;  2ZM6 E;  4B3R E;  4NXN E;  2YZT A;  4BMJ A;  4M30 A;  4P7D A;  2M7Q A;  3J81 C;  1YYO A;  3MSW A;  4WPY A;  2V83 A;  2EWL A;  2B7T A;  1YYK A;  4BC7 A;  4M0V A;  3F6G A;  3VK6 A;  2F4V E;  2VQF E;  2MC6 A;  2UU9 E;  1GQE A;  2LTR A;  3KWR A;  3P1X A;  2JY9 A;  4DMI A;  3ADI A;  3ADL A;  2L92 A;  2L2M A;  4LU9 A;  3H09 A;  2L3J A;  1J5E E;  1T4N A;  4P78 A;  4DR2 E;  5LMN E;  4LF5 E;  3HTX A;  1T4O A;  2VQE E;  4LF6 E;  3C4B A;  2V89 A;  4BCA A;  2L33 A;  2LRS A;  5CFF E;  1STU A;  2ODR D;  3F6H A;  2RS6 A;  4DV0 E;  4BBY A;  2HHH E;  4KZS A;  1EKZ A;  2V88 A;  4WFT A;  2UUC E;  2B7V A;  4GEQ B;  1UIL A;  2LMZ A;  2RSM A;  5AE2 A;  2K4V A;  2NUG A;  1FJG E;  2RTX A;  4JV5 E;  2VE7 C;  4R8O A;  1ZBQ A;  4WYQ B;  3J7Y p;  3OTO E;  2DIX A;  2LJH A;  4DV3 E;  1IBK E;  3IWB A;  2UXB E;  2CPN A;  4B3T E;  4JI6 E;  1HR0 E;  2FV4 B;  2M1S A;  4DR4 E;  2UXD E;  4LTY A;  2G7H A;  1HNX E;  1HNW E;  2JOX A;  4L5N C;  3ADG A;  3RMP A;  2NA2 A;  4DV4 E;  2DB2 A;  4X8W A;  2LUQ A;  3LLH A;  5LL6 R;  2F8B A;  5AE3 A;  1WXR A;  3JU0 A;  5LMU E;  3VYY A;  2UUB E;  3J7A G;  2NUE A;  4KHP E;  1ZBT A;  2M4I A;  1YYW A;  3K6Q A;  2LBS B;  1HNZ E;  4B3M E;  2H36 X;  5A2Q C;  1I94 E;  1UHZ A;  4DUZ E;  4F9C B;  3FIG A;  4X66 E;  2NUF A;  4YY3 E;  4I8O A;  3HPZ A;  1XMQ E;  2L6M A;  4J8Z A;  2UXC E;  2WZO A;  4JI7 E;  3IWD A;  4OX9 E;  5IWA E;  4DV7 E;  4JI2 E;  4BC9 A;  2KOU A;  2JWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...