2MKNA

Structural characterization of interactions between the double-stranded rna-binding zinc finger protein jaz and dsrna
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
44
structure length
44
Chain Sequence
IDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQETKLKLMARYGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Characterization of Interactions between the Double-Stranded RNA-Binding Zinc Finger Protein JAZ and Nucleic Acids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
molecule keywords Zinc finger protein 346
total genus 14
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2014-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12874 zf-met Zinc-finger of C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2mknA00
2ELZA 2YTEA 2EMCA 2EN1A 2BB8A 2EMGA 2E72A 1RMDA 4F6NA 5KL6A 1MEYC 2YRKA 2EM2A 2EOOA 2EQ3A 4FK5C 1JK1A 2YRMA 2EMWA 4R2RA 2DGCA 2EMFA 2EM9A 2YTGA 3MHHC 1ZR9A 2EORA 3EPKA 2LV2A 2EMXA 2VRDA 4R2PA 2EOZA 5KL5A 1ZU1A 2EMIA 4R2DA 1DGCA 1G2FC 4R2AA 2EN3A 2NABA 2RSIA 1P47A 2ENCA 2EMKA 2LCEA 1YUIA 2EPCA 2DMIA 2JPAA 1JK2A 1UN6B 2LO3A 1TF3A 1B69A 2EM8A 5KL4A 3EPLA 2WBUA 1A1GA 1AAYA 2EN2A 2EJ4A 2LVHA 2YSPA 1X3CA 2YRHA 2EOJA 2EN6A 2YU5A 2GLIA 2MDGA 2EE8A 2RPCA 1YSAC 2EMZA 2EM7A 2EN4A 2EPRA 4R2CA 3UK3C 4IS1C 2DLKA 4IJDA 1TN9A 2CT1A 2MKNA 2EMBA 2WBTA 2ELYA 2EOXA 2EM0A 1F2IG 2EOHA 3EPJA 2CSHA 2GHFA 2EM6A 2YTDA 2HGHA 2D9HA 2EL5A 2ENHA 2EMLA 2YTPA 4R2QA 2EMAA 4R2SA 2EM4A 2JP9A 4GZNC 2EM5A 2EL6A 2J7JA 4F2JC 1KJKA 2DRPA 2EOMA 1G2DC 5KL3A 1LLMC 1ZAAC 2EOSA 4WSGA 2WBSA 1A1JA 2EQ0A 2LT7A 2YU8A 1X6EA 2YTQA 4M9VC 2MKDA 2EQ1A 2PRTA 2DLQA 1X5WA 2EPXA 2EPUA 1WJPA 5KL7A 2YTOA 1NCSA 2ENAA 1A1LA 2EN8A 1YUJA 2EPZA 3EPHA 2A25A 2EMHA 2EPAA 3M99B 5KL2A 1Z1BA 2EN7A 3MHSC 1A1FA 2EPPA 1BBOA 2EOFA 2R1FA 4F6MA 2EOYA 1A1IA 1X6HA 2ADRA 2EL4A 1X6FA 2EMYA 1A1HA 2YSOA 2EM3A 2EOEA 4R2EA 2EOQA 2WCC3 4X9JA 2YTFA 2EOIA 2I13A 1UBDC 3VHTB 1TF6A 1A1KA 2YTIA 2M9AA 1BB8A 2YTNA 2YTJA 2CTDA 2EP3A
chains in the Genus database with same CATH superfamily
2L33A 2UUCE 2BB8A 3BGHA 4O5GA 1HNXE 4Q35B 1XMOE 3L00A 3BIDA 1EH7A 5A69A 3HQ1A 3MHHC 2YTGA 5FLXC 2YT4A 3EPKA 3THOB 2EMXA 2VRDA 4R2PA 2DSYA 5LL6R 1ZU1A 2EMIA 1DGCA 4AQYE 2EN3A 2NABA 2RSIA 4F9CB 2ODRD 2LCEA 2NUFA 3ADGA 2VF1A 4LFBE 4LU9A 3HPSA 3EPLA 1FJGE 2EN2A 2EJ4A 2RQLA 1T4NA 2EN6A 2MDGA 1N32E 2RPCA 2DIXA 4DV0E 5A6KA 1TN9A 1YSAC 2MKNA 2YWQA 4JI4E 2EOXA 2L2MA 1YYWA 2EOHA 3H09A 2LE2A 2B3TB 2EM6A 4P78A 2HGHA 4WX9A 2EL5A 2R76A 2YTPA 1YYKA 2EMAA 4LFAE 2V87A 1N34E 4DR2E 1L4SA 1IBLE 1G2DC 2EPOA 1LLMC 1DI2A 4JI8E 1J5EE 2WBSA 2WZOA 2Q8UA 2HHHE 1T39A 2YU8A 2YTQA 3K6QA 2PRTA 2DLQA 2EPKX 2ENAA 1A1LA 2ODRC 3HTXA 1EH8A 2EMHA 2N8XA 5KL2A 2EOFA 1X48A 4JI0E 2ADRA 4GKJE 5A6JA 2LTSA 2DMYA 1A1HA 4NXME 4DV3E 4NZVA 1EKZA 4BS9A 2WCC3 1RC7A 2I13A 1HR0E 1PJQA 1A1KA 5CFFE 1HNWE 4DV2E 4X66E 5LMNE 5ADZA 2CTDA 2KHXA 2EP3A 5LMUE 4BHBA 2YTEA 2BBGA 2EN1A 2L2KB 1AH5A 2EMGA 2MC5A 4MLQA 4B3SE 4F6NA 1MEYC 5BR8E 2YRKA 1YPNA 1MGTA 4I8OA 2JWOA 4X8WA 1X47A 2EQ3A 4FK5C 4R8OA 3J7AG 3FIGA 1JK1A 2YRMA 2DGCA 4JI6E 4F9BB 2EM9A 5IXMB 2JR1A 4BBYA 1T38A 2F4VE 4DR5E 2LV2A 5KL5A 1SFEA 3C6KA 2V83A 2ENCA 3ECRA 3T1HE 5AASA 4DR4E 2MDRA 4TUIA 4ZYHA 2LTRA 1A1GA 2K4VA 2LVHA 2NUGA 3IWDA 2VE7C 2EM7A 3UK3C 2LJHA 2EWLA 4X62E 2E5LE 3KWRA 2EM0A 2L2NA 4L8NA 4OOGC 2ZM6E 2NA2A 1F2IG 3EPJA 4TUGA 3J80C 2D9HA 2V86A 3AUZA 2ENHA 3OTOE 4R2QA 3P1XA 2EPNA 4R03A 1HNZE 2EM4A 2JP9A 3HPZA 5IV8B 2EM5A 2EL6A 2J7JA 4YY3E 2JOXA 2DRPA 3F6HA 2FGGA 4WSGA 1ZBQA 2EZ6A 4DV6E 4NXNE 2B7VA 3J81C 4LF8E 3BF2A 5AE2A 3ZOQB 2V88A 1X5WA 4KWYA 2VQEE 2EPUA 1N3GA 1WJPA 2YPNA 5A6BA 2FTXB 4WXCA 3DJWA 4WPYA 5A2QC 4DR1E 1UHZA 3MSWA 1YUJA 4LF5E 3DF6A 2A25A 2EPAA 2RSMA 2LRSA 2GPIA 4KHPE 2EN7A 2EPPA 2R1FA 2M7QA 4DR3E 4F6MA 2EOYA 1A1IA 4BHCA 3IWCA 4HEIA 1X6FA 2EMYA 2HJJA 2RS6A 2EM3A 2DB2A 3ADIA 2YTFA 3IWBA 4ZYGA 2LUPB 4LF9E 2YTJA 1GZ6A 2LJUA 4O24A 4LTYA 1QU6A 3LLHA 2F8BA 2UUBE 2UU9E 4BC9A 1J26A 2N3GA 4DV1E 1UILA 2EOOA 4Q28A 4P7DA 2JYAA 4R2RA 2EMFA 4JI3E 4NHRA 4R2DA 3VK6A 1N33E 1G2FC 4M30A 3JU0A 1X49A 2EMKA 4DR6E 2EPCA 2JPAA 4B3TE 1TF3A 5DNYA 1B69A 2EM8A 3C4TA 2WBUA 3C4BA 1AAYA 4YHHE 2UXCE 4DV5E 1X3CA 2YRHA 2L3JA 1WHQA 2GLIA 2EE8A 4J8ZA 2EMZA 2EN4A 2DLKA 2EMBA 4F54A 2ELYA 1YZ9A 2CSHA 3TQMA 2GHFA 4JI2E 2M4IA 3HXLA 2YTDA 4B3ME 3LMLA 5LLQA 4BCAA 1DQ3A 4JI7E 3ADLA 2NUEA 3RMPA 4F2JC 4LF6E 2EOMA 1ZAAC 5AE3A 1IBME 3EQ1A 4F9AB 2EOSA 1A1JA 2EQ0A 3BBGA 1X6EA 2RTXA 5IT9C 2MKDA 4M9VC 4RHBB 2EPXA 1PJTA 1EH6A 4LF7E 5KL7A 2YTOA 1NCSA 1YYOA 2EN8A 3QG5C 4MLVA 3VYYA 3M99B 4GEQB 4O43A 2V85A 2KONA 1RQ0A 1BBOA 1NEIA 4O4KA 1X6HA 2E1MA 2YSOA 2B7TA 4DV4E 2MC6A 1XNRE 1PKPA 4N4RB 2EOIA 1UBDC 3VHTB 3C6MA 5F3WA 1TF6A 2M9AA 3J7Yp 1PDAA 2YZTA 1SR9A 2ELZA 2JVAA 2EMCA 5TSEA 5AC5A 2LBSB 2IHR1 3JTZA 1WHNA 2G7HA 2E72A 4WSPA 1RMDA 5KL6A 1BBGA 3AV0A 4JV5E 2EM2A 1KYQA 4LFCE 2UXBE 2EMWA 4DR7E 4JYAE 1ZR9A 2EORA 1WRJA 4DV7E 2N3HA 4DKKA 2EOZA 2B9DA 4M0VA 4X64E 1O0WA 2JOBA 4R2AA 1P47A 2UUAE 2M1SA 3OMLA 1YUIA 2K7IA 2DMIA 3T1YE 4DUYE 1JK2A 1UN6B 1XMQE 2LO3A 4KZSA 2CPNA 1I94E 5KL4A 3ADJA 2I9IA 5IWAE 3KZZA 2YSPA 2LMZA 4K0KE 2EOJA 4ZYDA 2YU5A 4JI1E 3F6GA 2L3CA 2EPRA 4R2CA 4IS1C 4IJDA 2CT1A 1ZBTA 1N36E 2WBTA 4JI5E 3VYXA 2VQFE 2EPMX 2EPLX 1XNQE 1IQSA 2HC5A 1YFHA 2H36X 4DUZE 2EMLA 5AC4A 5AE1A 4R2SA 1GQEA 1T4LB 4RH8A 1IBKE 4GKKE 4M2ZA 2LUQA 2V8QB 2L8TA 4GZNC 4ZYEA 1KJKA 1GTKA 5KL3A 4L5NC 2JXPA 2L92A 4WFTA 2LT7A 2L6MA 4WYQB 2EQ1A 1QNTA 1PJSA 4HTGA 2UXDE 4LF4E 2RS7A 4WXDA 1IQOA 2EPZA 3EPHA 5A6BD 4OX9E 3JAMC 1Z1BA 3THNA 1IMUA 3MHSC 1A1FA 2V89A 4BMJA 2KOUA 4B3RE 5A6AA 2EL4A 2FV4B 5T6JA 2JY9A 2EOEA 4R2EA 2EOQA 4X65E 4X9JA 4DMIA 3KZYA 2YTIA 1STUA 1T4OA 1BB8A 2YTNA 1FKAE 4BC7A 1WXRA
chains in the Genus database with same CATH topology
2ELZA 2YTEA 2EMCA 2EN1A 2BB8A 2EMGA 2E72A 1RMDA 4F6NA 5KL6A 1MEYC 2YRKA 2EM2A 2EOOA 2EQ3A 4FK5C 1JK1A 2YRMA 2EMWA 4R2RA 2DGCA 2EMFA 2EM9A 2YTGA 3MHHC 1ZR9A 2EORA 3EPKA 2LV2A 2EMXA 2VRDA 4R2PA 2EOZA 5KL5A 1ZU1A 2EMIA 4R2DA 1DGCA 1G2FC 4R2AA 2EN3A 2NABA 2RSIA 1P47A 2ENCA 2EMKA 2LCEA 1YUIA 2EPCA 2DMIA 2JPAA 1JK2A 1UN6B 2LO3A 1TF3A 1B69A 2EM8A 5KL4A 3EPLA 2WBUA 1A1GA 1AAYA 2EN2A 2EJ4A 2LVHA 2YSPA 1X3CA 2YRHA 2EOJA 2EN6A 2YU5A 2GLIA 2MDGA 2EE8A 2RPCA 1YSAC 2EMZA 2EM7A 2EN4A 2EPRA 4R2CA 3UK3C 4IS1C 2DLKA 4IJDA 1TN9A 2CT1A 2MKNA 2EMBA 2WBTA 2ELYA 2EOXA 2EM0A 1F2IG 2EOHA 3EPJA 2CSHA 2GHFA 2EM6A 2YTDA 2HGHA 2D9HA 2EL5A 2ENHA 2EMLA 2YTPA 4R2QA 2EMAA 4R2SA 2EM4A 2JP9A 4GZNC 2EM5A 2EL6A 2J7JA 4F2JC 1KJKA 2DRPA 2EOMA 1G2DC 5KL3A 1LLMC 1ZAAC 2EOSA 4WSGA 2WBSA 1A1JA 2EQ0A 2LT7A 2YU8A 1X6EA 2YTQA 4M9VC 2MKDA 2EQ1A 2PRTA 2DLQA 1X5WA 2EPXA 2EPUA 1WJPA 5KL7A 2YTOA 1NCSA 2ENAA 1A1LA 2EN8A 1YUJA 2EPZA 3EPHA 2A25A 2EMHA 2EPAA 3M99B 5KL2A 1Z1BA 2EN7A 3MHSC 1A1FA 2EPPA 1BBOA 2EOFA 2R1FA 4F6MA 2EOYA 1A1IA 1X6HA 2ADRA 2EL4A 1X6FA 2EMYA 1A1HA 2YSOA 2EM3A 2EOEA 4R2EA 2EOQA 2WCC3 4X9JA 2YTFA 2EOIA 2I13A 1UBDC 3VHTB 1TF6A 1A1KA 2YTIA 2M9AA 1BB8A 2YTNA 2YTJA 2CTDA 2EP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ELZ A;  2YTE A;  2EMC A;  2EN1 A;  2BB8 A;  2EMG A;  2E72 A;  1RMD A;  4F6N A;  5KL6 A;  1MEY C;  2YRK A;  2EM2 A;  2EOO A;  2EQ3 A;  4FK5 C;  1JK1 A;  2YRM A;  2EMW A;  4R2R A;  2DGC A;  2EMF A;  2EM9 A;  2YTG A;  3MHH C;  1ZR9 A;  2EOR A;  3EPK A;  2LV2 A;  2EMX A;  2VRD A;  4R2P A;  2EOZ A;  5KL5 A;  1ZU1 A;  2EMI A;  4R2D A;  1DGC A;  1G2F C;  4R2A A;  2EN3 A;  2NAB A;  2RSI A;  1P47 A;  2ENC A;  2EMK A;  2LCE A;  1YUI A;  2EPC A;  2DMI A;  2JPA A;  1JK2 A;  1UN6 B;  2LO3 A;  1TF3 A;  1B69 A;  2EM8 A;  5KL4 A;  3EPL A;  2WBU A;  1A1G A;  1AAY A;  2EN2 A;  2EJ4 A;  2LVH A;  2YSP A;  1X3C A;  2YRH A;  2EOJ A;  2EN6 A;  2YU5 A;  2GLI A;  2MDG A;  2EE8 A;  2RPC A;  1YSA C;  2EMZ A;  2EM7 A;  2EN4 A;  2EPR A;  4R2C A;  3UK3 C;  4IS1 C;  2DLK A;  4IJD A;  1TN9 A;  2CT1 A;  2MKN A;  2EMB A;  2WBT A;  2ELY A;  2EOX A;  2EM0 A;  1F2I G;  2EOH A;  3EPJ A;  2CSH A;  2GHF A;  2EM6 A;  2YTD A;  2HGH A;  2D9H A;  2EL5 A;  2ENH A;  2EML A;  2YTP A;  4R2Q A;  2EMA A;  4R2S A;  2EM4 A;  2JP9 A;  4GZN C;  2EM5 A;  2EL6 A;  2J7J A;  4F2J C;  1KJK A;  2DRP A;  2EOM A;  1G2D C;  5KL3 A;  1LLM C;  1ZAA C;  2EOS A;  4WSG A;  2WBS A;  1A1J A;  2EQ0 A;  2LT7 A;  2YU8 A;  1X6E A;  2YTQ A;  4M9V C;  2MKD A;  2EQ1 A;  2PRT A;  2DLQ A;  1X5W A;  2EPX A;  2EPU A;  1WJP A;  5KL7 A;  2YTO A;  1NCS A;  2ENA A;  1A1L A;  2EN8 A;  1YUJ A;  2EPZ A;  3EPH A;  2A25 A;  2EMH A;  2EPA A;  3M99 B;  5KL2 A;  1Z1B A;  2EN7 A;  3MHS C;  1A1F A;  2EPP A;  1BBO A;  2EOF A;  2R1F A;  4F6M A;  2EOY A;  1A1I A;  1X6H A;  2ADR A;  2EL4 A;  1X6F A;  2EMY A;  1A1H A;  2YSO A;  2EM3 A;  2EOE A;  4R2E A;  2EOQ A;  2WCC 3;  4X9J A;  2YTF A;  2EOI A;  2I13 A;  1UBD C;  3VHT B;  1TF6 A;  1A1K A;  2YTI A;  2M9A A;  1BB8 A;  2YTN A;  2YTJ A;  2CTD A;  2EP3 A; 
#chains in the Genus database with same CATH topology
 2L33 A;  2UUC E;  2BB8 A;  3BGH A;  4O5G A;  1HNX E;  4Q35 B;  1XMO E;  3L00 A;  3BID A;  1EH7 A;  5A69 A;  3HQ1 A;  3MHH C;  2YTG A;  5FLX C;  2YT4 A;  3EPK A;  3THO B;  2EMX A;  2VRD A;  4R2P A;  2DSY A;  5LL6 R;  1ZU1 A;  2EMI A;  1DGC A;  4AQY E;  2EN3 A;  2NAB A;  2RSI A;  4F9C B;  2ODR D;  2LCE A;  2NUF A;  3ADG A;  2VF1 A;  4LFB E;  4LU9 A;  3HPS A;  3EPL A;  1FJG E;  2EN2 A;  2EJ4 A;  2RQL A;  1T4N A;  2EN6 A;  2MDG A;  1N32 E;  2RPC A;  2DIX A;  4DV0 E;  5A6K A;  1TN9 A;  1YSA C;  2MKN A;  2YWQ A;  4JI4 E;  2EOX A;  2L2M A;  1YYW A;  2EOH A;  3H09 A;  2LE2 A;  2B3T B;  2EM6 A;  4P78 A;  2HGH A;  4WX9 A;  2EL5 A;  2R76 A;  2YTP A;  1YYK A;  2EMA A;  4LFA E;  2V87 A;  1N34 E;  4DR2 E;  1L4S A;  1IBL E;  1G2D C;  2EPO A;  1LLM C;  1DI2 A;  4JI8 E;  1J5E E;  2WBS A;  2WZO A;  2Q8U A;  2HHH E;  1T39 A;  2YU8 A;  2YTQ A;  3K6Q A;  2PRT A;  2DLQ A;  2EPK X;  2ENA A;  1A1L A;  2ODR C;  3HTX A;  1EH8 A;  2EMH A;  2N8X A;  5KL2 A;  2EOF A;  1X48 A;  4JI0 E;  2ADR A;  4GKJ E;  5A6J A;  2LTS A;  2DMY A;  1A1H A;  4NXM E;  4DV3 E;  4NZV A;  1EKZ A;  4BS9 A;  2WCC 3;  1RC7 A;  2I13 A;  1HR0 E;  1PJQ A;  1A1K A;  5CFF E;  1HNW E;  4DV2 E;  4X66 E;  5LMN E;  5ADZ A;  2CTD A;  2KHX A;  2EP3 A;  5LMU E;  4BHB A;  2YTE A;  2BBG A;  2EN1 A;  2L2K B;  1AH5 A;  2EMG A;  2MC5 A;  4MLQ A;  4B3S E;  4F6N A;  1MEY C;  5BR8 E;  2YRK A;  1YPN A;  1MGT A;  4I8O A;  2JWO A;  4X8W A;  1X47 A;  2EQ3 A;  4FK5 C;  4R8O A;  3J7A G;  3FIG A;  1JK1 A;  2YRM A;  2DGC A;  4JI6 E;  4F9B B;  2EM9 A;  5IXM B;  2JR1 A;  4BBY A;  1T38 A;  2F4V E;  4DR5 E;  2LV2 A;  5KL5 A;  1SFE A;  3C6K A;  2V83 A;  2ENC A;  3ECR A;  3T1H E;  5AAS A;  4DR4 E;  2MDR A;  4TUI A;  4ZYH A;  2LTR A;  1A1G A;  2K4V A;  2LVH A;  2NUG A;  3IWD A;  2VE7 C;  2EM7 A;  3UK3 C;  2LJH A;  2EWL A;  4X62 E;  2E5L E;  3KWR A;  2EM0 A;  2L2N A;  4L8N A;  4OOG C;  2ZM6 E;  2NA2 A;  1F2I G;  3EPJ A;  4TUG A;  3J80 C;  2D9H A;  2V86 A;  3AUZ A;  2ENH A;  3OTO E;  4R2Q A;  3P1X A;  2EPN A;  4R03 A;  1HNZ E;  2EM4 A;  2JP9 A;  3HPZ A;  5IV8 B;  2EM5 A;  2EL6 A;  2J7J A;  4YY3 E;  2JOX A;  2DRP A;  3F6H A;  2FGG A;  4WSG A;  1ZBQ A;  2EZ6 A;  4DV6 E;  4NXN E;  2B7V A;  3J81 C;  4LF8 E;  3BF2 A;  5AE2 A;  3ZOQ B;  2V88 A;  1X5W A;  4KWY A;  2VQE E;  2EPU A;  1N3G A;  1WJP A;  2YPN A;  5A6B A;  2FTX B;  4WXC A;  3DJW A;  4WPY A;  5A2Q C;  4DR1 E;  1UHZ A;  3MSW A;  1YUJ A;  4LF5 E;  3DF6 A;  2A25 A;  2EPA A;  2RSM A;  2LRS A;  2GPI A;  4KHP E;  2EN7 A;  2EPP A;  2R1F A;  2M7Q A;  4DR3 E;  4F6M A;  2EOY A;  1A1I A;  4BHC A;  3IWC A;  4HEI A;  1X6F A;  2EMY A;  2HJJ A;  2RS6 A;  2EM3 A;  2DB2 A;  3ADI A;  2YTF A;  3IWB A;  4ZYG A;  2LUP B;  4LF9 E;  2YTJ A;  1GZ6 A;  2LJU A;  4O24 A;  4LTY A;  1QU6 A;  3LLH A;  2F8B A;  2UUB E;  2UU9 E;  4BC9 A;  1J26 A;  2N3G A;  4DV1 E;  1UIL A;  2EOO A;  4Q28 A;  4P7D A;  2JYA A;  4R2R A;  2EMF A;  4JI3 E;  4NHR A;  4R2D A;  3VK6 A;  1N33 E;  1G2F C;  4M30 A;  3JU0 A;  1X49 A;  2EMK A;  4DR6 E;  2EPC A;  2JPA A;  4B3T E;  1TF3 A;  5DNY A;  1B69 A;  2EM8 A;  3C4T A;  2WBU A;  3C4B A;  1AAY A;  4YHH E;  2UXC E;  4DV5 E;  1X3C A;  2YRH A;  2L3J A;  1WHQ A;  2GLI A;  2EE8 A;  4J8Z A;  2EMZ A;  2EN4 A;  2DLK A;  2EMB A;  4F54 A;  2ELY A;  1YZ9 A;  2CSH A;  3TQM A;  2GHF A;  4JI2 E;  2M4I A;  3HXL A;  2YTD A;  4B3M E;  3LML A;  5LLQ A;  4BCA A;  1DQ3 A;  4JI7 E;  3ADL A;  2NUE A;  3RMP A;  4F2J C;  4LF6 E;  2EOM A;  1ZAA C;  5AE3 A;  1IBM E;  3EQ1 A;  4F9A B;  2EOS A;  1A1J A;  2EQ0 A;  3BBG A;  1X6E A;  2RTX A;  5IT9 C;  2MKD A;  4M9V C;  4RHB B;  2EPX A;  1PJT A;  1EH6 A;  4LF7 E;  5KL7 A;  2YTO A;  1NCS A;  1YYO A;  2EN8 A;  3QG5 C;  4MLV A;  3VYY A;  3M99 B;  4GEQ B;  4O43 A;  2V85 A;  2KON A;  1RQ0 A;  1BBO A;  1NEI A;  4O4K A;  1X6H A;  2E1M A;  2YSO A;  2B7T A;  4DV4 E;  2MC6 A;  1XNR E;  1PKP A;  4N4R B;  2EOI A;  1UBD C;  3VHT B;  3C6M A;  5F3W A;  1TF6 A;  2M9A A;  3J7Y p;  1PDA A;  2YZT A;  1SR9 A;  2ELZ A;  2JVA A;  2EMC A;  5TSE A;  5AC5 A;  2LBS B;  2IHR 1;  3JTZ A;  1WHN A;  2G7H A;  2E72 A;  4WSP A;  1RMD A;  5KL6 A;  1BBG A;  3AV0 A;  4JV5 E;  2EM2 A;  1KYQ A;  4LFC E;  2UXB E;  2EMW A;  4DR7 E;  4JYA E;  1ZR9 A;  2EOR A;  1WRJ A;  4DV7 E;  2N3H A;  4DKK A;  2EOZ A;  2B9D A;  4M0V A;  4X64 E;  1O0W A;  2JOB A;  4R2A A;  1P47 A;  2UUA E;  2M1S A;  3OML A;  1YUI A;  2K7I A;  2DMI A;  3T1Y E;  4DUY E;  1JK2 A;  1UN6 B;  1XMQ E;  2LO3 A;  4KZS A;  2CPN A;  1I94 E;  5KL4 A;  3ADJ A;  2I9I A;  5IWA E;  3KZZ A;  2YSP A;  2LMZ A;  4K0K E;  2EOJ A;  4ZYD A;  2YU5 A;  4JI1 E;  3F6G A;  2L3C A;  2EPR A;  4R2C A;  4IS1 C;  4IJD A;  2CT1 A;  1ZBT A;  1N36 E;  2WBT A;  4JI5 E;  3VYX A;  2VQF E;  2EPM X;  2EPL X;  1XNQ E;  1IQS A;  2HC5 A;  1YFH A;  2H36 X;  4DUZ E;  2EML A;  5AC4 A;  5AE1 A;  4R2S A;  1GQE A;  1T4L B;  4RH8 A;  1IBK E;  4GKK E;  4M2Z A;  2LUQ A;  2V8Q B;  2L8T A;  4GZN C;  4ZYE A;  1KJK A;  1GTK A;  5KL3 A;  4L5N C;  2JXP A;  2L92 A;  4WFT A;  2LT7 A;  2L6M A;  4WYQ B;  2EQ1 A;  1QNT A;  1PJS A;  4HTG A;  2UXD E;  4LF4 E;  2RS7 A;  4WXD A;  1IQO A;  2EPZ A;  3EPH A;  5A6B D;  4OX9 E;  3JAM C;  1Z1B A;  3THN A;  1IMU A;  3MHS C;  1A1F A;  2V89 A;  4BMJ A;  2KOU A;  4B3R E;  5A6A A;  2EL4 A;  2FV4 B;  5T6J A;  2JY9 A;  2EOE A;  4R2E A;  2EOQ A;  4X65 E;  4X9J A;  4DMI A;  3KZY A;  2YTI A;  1STU A;  1T4O A;  1BB8 A;  2YTN A;  1FKA E;  4BC7 A;  1WXR A; 
#chains in the Genus database with same CATH homology
 2ELZ A;  2YTE A;  2EMC A;  2EN1 A;  2BB8 A;  2EMG A;  2E72 A;  1RMD A;  4F6N A;  5KL6 A;  1MEY C;  2YRK A;  2EM2 A;  2EOO A;  2EQ3 A;  4FK5 C;  1JK1 A;  2YRM A;  2EMW A;  4R2R A;  2DGC A;  2EMF A;  2EM9 A;  2YTG A;  3MHH C;  1ZR9 A;  2EOR A;  3EPK A;  2LV2 A;  2EMX A;  2VRD A;  4R2P A;  2EOZ A;  5KL5 A;  1ZU1 A;  2EMI A;  4R2D A;  1DGC A;  1G2F C;  4R2A A;  2EN3 A;  2NAB A;  2RSI A;  1P47 A;  2ENC A;  2EMK A;  2LCE A;  1YUI A;  2EPC A;  2DMI A;  2JPA A;  1JK2 A;  1UN6 B;  2LO3 A;  1TF3 A;  1B69 A;  2EM8 A;  5KL4 A;  3EPL A;  2WBU A;  1A1G A;  1AAY A;  2EN2 A;  2EJ4 A;  2LVH A;  2YSP A;  1X3C A;  2YRH A;  2EOJ A;  2EN6 A;  2YU5 A;  2GLI A;  2MDG A;  2EE8 A;  2RPC A;  1YSA C;  2EMZ A;  2EM7 A;  2EN4 A;  2EPR A;  4R2C A;  3UK3 C;  4IS1 C;  2DLK A;  4IJD A;  1TN9 A;  2CT1 A;  2MKN A;  2EMB A;  2WBT A;  2ELY A;  2EOX A;  2EM0 A;  1F2I G;  2EOH A;  3EPJ A;  2CSH A;  2GHF A;  2EM6 A;  2YTD A;  2HGH A;  2D9H A;  2EL5 A;  2ENH A;  2EML A;  2YTP A;  4R2Q A;  2EMA A;  4R2S A;  2EM4 A;  2JP9 A;  4GZN C;  2EM5 A;  2EL6 A;  2J7J A;  4F2J C;  1KJK A;  2DRP A;  2EOM A;  1G2D C;  5KL3 A;  1LLM C;  1ZAA C;  2EOS A;  4WSG A;  2WBS A;  1A1J A;  2EQ0 A;  2LT7 A;  2YU8 A;  1X6E A;  2YTQ A;  4M9V C;  2MKD A;  2EQ1 A;  2PRT A;  2DLQ A;  1X5W A;  2EPX A;  2EPU A;  1WJP A;  5KL7 A;  2YTO A;  1NCS A;  2ENA A;  1A1L A;  2EN8 A;  1YUJ A;  2EPZ A;  3EPH A;  2A25 A;  2EMH A;  2EPA A;  3M99 B;  5KL2 A;  1Z1B A;  2EN7 A;  3MHS C;  1A1F A;  2EPP A;  1BBO A;  2EOF A;  2R1F A;  4F6M A;  2EOY A;  1A1I A;  1X6H A;  2ADR A;  2EL4 A;  1X6F A;  2EMY A;  1A1H A;  2YSO A;  2EM3 A;  2EOE A;  4R2E A;  2EOQ A;  2WCC 3;  4X9J A;  2YTF A;  2EOI A;  2I13 A;  1UBD C;  3VHT B;  1TF6 A;  1A1K A;  2YTI A;  2M9A A;  1BB8 A;  2YTN A;  2YTJ A;  2CTD A;  2EP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...