2MKNA

Structural characterization of interactions between the double-stranded rna-binding zinc finger protein jaz and dsrna
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
44
structure length
44
Chain Sequence
IDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQETKLKLMARYGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein/rna
molecule keywords Zinc finger protein 346
publication title Structural Characterization of Interactions between the Double-Stranded RNA-Binding Zinc Finger Protein JAZ and Nucleic Acids.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2014-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12874 zf-met Zinc-finger of C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2mknA00
2ADRA 2EJ4A 2EM6A 2EMWA 4R2SA 3EPJA 2ELYA 3EPKA 2YTIA 3UK3C 4IJDA 2EMGA 1ZR9A 2EN7A 1KJKA 2EOEA 2EORA 2ENAA 1JK2A 3MHSC 2CT1A 1BBOA 2DLQA 2YTEA 2DRPA 2WBTA 2YTQA 2EPAA 2ENCA 2EMXA 1B69A 2RSIA 2MKNA 2CTDA 2EMFA 2EMZA 2EN4A 2EQ0A 2PRTA 2EPCA 2YU8A 2EOSA 2GHFA 2EN2A 2EE8A 2EMIA 2E72A 3EPLA 2LVHA 4R2CA 2EMCA 3VHTB 2DLKA 1A1HA 5KL7A 1X3CA 2YTJA 1Z1BA 1JK1A 2EQ3A 2YRMA 1X5WA 2EL6A 1MEYC 2HGHA 1UN6B 2YRKA 2EOZA 1G2FC 2LV2A 1A1LA 2EMYA 2EPXA 2YRHA 4R2EA 2VRDA 3MHHC 2EMBA 2EOMA 1X6HA 2LT7A 1TF6A 1YUJA 2EOQA 2EMLA 2YTFA 2EN6A 1YSAC 5KL4A 1A1FA 2MDGA 2YTDA 1WJPA 2EMAA 2EM2A 2EM5A 2EM3A 2DGCA 4R2PA 2WBUA 3EPHA 2EOXA 1RMDA 2BB8A 2EQ1A 1DGCA 2YTPA 2EMHA 2EM8A 2EN3A 1X6EA 2EL5A 4M9VC 2EPZA 4GZNC 4WSGA 2ENHA 1ZU1A 2MKDA 2JP9A 1A1JA 4R2DA 1TF3A 4FK5C 4R2RA 2EPRA 2NABA 1P47A 4X9JA 2WCC3 1ZAAC 4R2QA 2EN1A 2EM9A 2YTOA 5KL5A 2EP3A 2M9AA 2EOJA 1A1KA 5KL6A 1LLMC 4F6NA 2EM4A 2A25A 2D9HA 2EOIA 2LCEA 2YTNA 2EOFA 4IS1C 2YSOA 2J7JA 1AAYA 1A1GA 1TN9A 1YUIA 2EPUA 2YU5A 2CSHA 5KL3A 4F6MA 2I13A 2EOYA 5KL2A 2EM0A 2WBSA 1F2IG 4R2AA 1X6FA 2EMKA 3M99B 2YSPA 2R1FA 2DMIA 4F2JC 2EN8A 1A1IA 1BB8A 2EL4A 2EOOA 2EPPA 1G2DC 2JPAA 2GLIA 2YTGA 2EM7A 1NCSA 2EOHA 2RPCA 2ELZA 1UBDC 2LO3A
chains in the Genus database with same CATH superfamily
1SR9A 4F54A 2EMWA 3UK3C 1IBKE 2YTIA 4IJDA 4JI7E 1PKPA 3VYXA 5LL6R 4GKJE 2HJJA 1T4LB 4B3TE 4LFBE 1YYOA 2DRPA 5AE2A 2EPAA 2EMZA 2EN4A 3HPZA 1GZ6A 4X8WA 3ADIA 2LJHA 4O5GA 2EE8A 3HQ1A 5F3WA 2E72A 2LVHA 2B7TA 4MLQA 3KZZA 2DB2A 5KL7A 4LU9A 3C6MA 4NXME 1N34E 1UN6B 2YRKA 2LV2A 3J7Yp 2V8QB 2EPXA 3VYYA 4DV6E 1L4SA 2RTXA 4L5NC 1DI2A 5A6KA 2EOQA 1N36E 2EN6A 1A1FA 5IT9C 3THNA 2RSMA 2KOUA 4P7DA 1HNZE 2WBUA 3C6KA 1PDAA 2EOXA 4DR4E 1RMDA 2BB8A 1DGCA 1WRJA 4GEQB 4BHBA 2LTSA 1X6EA 2V86A 4LFCE 2R76A 2L2KB 4B3ME 4DV1E 2NUEA 1PJTA 2ENHA 2YWQA 1A1JA 4TUGA 4JI8E 4LF4E 2L33A 2FTXB 4NZVA 1XNRE 1YYKA 1ZBTA 4X9JA 1XMOE 4RH8A 1RQ0A 2WCC3 2EN1A 2YTOA 5KL5A 2DIXA 2K7IA 1DQ3A 2L92A 2JYAA 2L6MA 2V83A 4ZYHA 2EM4A 2YTNA 4DR1E 4DV7E 4LF9E 2EOFA 4IS1C 2JPAA 1A1GA 5KL3A 2YU5A 2YPNA 4DV2E 3C4TA 2VQFE 3F6GA 1T38A 1GTKA 1YYWA 1EH7A 1X6FA 4O4KA 2EMKA 3M99B 5LMNE 4JI2E 3ADJA 3H09A 2RS7A 2EOOA 2GLIA 4X62E 2RPCA 2N3GA 4BC9A 4O24A 2KONA 3BBGA 2ELYA 2IHR1 4DMIA 3LLHA 1I94E 1HR0E 1JK2A 4DR3E 3AV0A 5IXMB 2DLQA 5DNYA 1IQOA 2YTQA 3OTOE 5FLXC 2DSYA 4BCAA 2EQ0A 2KHXA 3T1YE 3BIDA 2PRTA 2EPCA 1QU6A 2M7QA 5LLQA 2E5LE 3EPLA 2B9DA 4R2CA 2EPMX 4BHCA 3VHTB 1KYQA 1A1HA 1X3CA 3IWCA 2YTJA 2LUPB 2LUQA 2LJUA 1SFEA 1MEYC 4X66E 2EOZA 1XNQE 2YRHA 5CFFE 1MGTA 1TF6A 2ZM6E 3J80C 4BBYA 4LF6E 1WHQA 2EMLA 2RS6A 2FV4B 2V85A 1YSAC 3C4BA 1GQEA 1T39A 1WJPA 4OX9E 1J5EE 4K0KE 2EM3A 4JI0E 4M2ZA 2G7HA 1ZBQA 1UHZA 1X48A 3JAMC 3EPHA 1YZ9A 2YTPA 2EPLX 2EN3A 2L2MA 1ZU1A 2JP9A 4R2DA 3ADLA 4FK5C 4LF7E 2NABA 2L8TA 4L8NA 4N4RB 1P47A 2V89A 1PJSA 3IWBA 1IBLE 4O43A 2DMYA 4F6NA 2D9HA 2LCEA 5A6BA 4DV5E 4F9BB 1YUIA 2V87A 4WYQB 3TQMA 1X49A 5AE3A 1N32E 1FJGE 2JR1A 5AASA 1UILA 3J7AG 4M0VA 2JY9A 2R1FA 3JTZA 2EN8A 1A1IA 2EL4A 3BF2A 2JWOA 4R8OA 5A6AA 2L2NA 4JI1E 2LMZA 1IBME 2ELZA 3F6HA 2ADRA 2EJ4A 2EM6A 1QNTA 3EPJA 1STUA 3DF6A 1ZR9A 3HTXA 5IV8B 2EOEA 2EORA 1BBGA 2ENAA 4P78A 3MHSC 4B3SE 1BBOA 5A69A 1J26A 4R03A 2WBTA 3THOB 2MDRA 2V88A 2RSIA 1AH5A 2HHHE 5T6JA 1O0WA 2ODRD 3IWDA 2WZOA 2JOXA 4KZSA 4LF5E 3KZYA 2EN2A 4WX9A 2EMIA 2YT4A 2NA2A 2EMCA 1WXRA 2DLKA 4B3RE 1JK1A 1X5WA 4WXCA 3QG5C 2HGHA 2L3JA 4R2EA 2VRDA 3MHHC 2M4IA 2LT7A 3HXLA 3ECRA 3AUZA 3KWRA 1HNXE 5KL4A 4F9CB 2YTDA 2EMAA 2LBSB 2Q8UA 4KWYA 2DGCA 3L00A 3J81C 4R2PA 2VE7C 1XMQE 2LE2A 4DV4E 4LTYA 5A2QC 4F9AB 4GZNC 1YFHA 2K4VA 2LRSA 4X64E 2N8XA 2EPKX 4YY3E 1EH8A 1TF3A 5ADZA 1PJQA 2EM9A 4DR5E 2VF1A 2M9AA 2L3CA 5LMUE 2EOJA 1A1KA 1EH6A 1LLMC 4HEIA 1AAYA 2YSOA 2LTRA 2I13A 4F6MA 2EOYA 4RHBB 4BMJA 5IWAE 4R2AA 2JOBA 2NUFA 2DMIA 4WXDA 4DV3E 4F2JC 3JU0A 4JI3E 2ODRC 2EPPA 1G2DC 4JV5E 4JI4E 3BGHA 4J8ZA 2YTGA 2EM7A 3FIGA 2CPNA 1Z1BA 2F8BA 2LO3A 5BR8E 4R2SA 5A6BD 3EPKA 2EMGA 2UXBE 4WPYA 2EN7A 4DR2E 5AC5A 1KJKA 5AE1A 2JXPA 2CT1A 2YTEA 1IMUA 2RQLA 4MLVA 4Q28A 2ENCA 2EMXA 1B69A 2MKNA 5TSEA 2CTDA 2EMFA 3ZOQB 2YU8A 4JYAE 2EOSA 2M1SA 2GHFA 4LFAE 4AQYE 4ZYEA 2UXCE 3T1HE 3DJWA 2NUGA 1N33E 4Q35B 4DKKA 2EQ3A 2YRMA 2EL6A 2GPIA 2JVAA 2MC5A 2H36X 2UXDE 4TUIA 1G2FC 1A1LA 2EMYA 4WSPA 3P1XA 2EPOA 2EMBA 1X47A 2EOMA 1X6HA 1YUJA 3ADGA 4DV0E 4X65E 2YTFA 2N3HA 4YHHE 2MDGA 3EQ1A 2EM2A 1N3GA 2EM5A 1NEIA 3HPSA 3K6QA 2UUBE 4BS9A 1T4OA 4DUYE 2UU9E 1YPNA 2B3TB 2EQ1A 2F4VE 2EMHA 2EM8A 2B7VA 2EL5A 2EPZA 1T4NA 4M9VC 2EWLA 4WSGA 2BBGA 4JI6E 1FKAE 3OMLA 4M30A 4WFTA 2MKDA 2UUCE 4HTGA 4ZYGA 5AC4A 4I8OA 2I9IA 2YZTA 2HC5A 4LF8E 4R2RA 2EPRA 2VQEE 2MC6A 4KHPE 1RC7A 1HNWE 2EPNA 1ZAAC 4R2QA 4DR6E 4OOGC 2EP3A 3VK6A 5KL6A 1IQSA 2A25A 2EOIA 2J7JA 3RMPA 1TN9A 4NXNE 2EPUA 2CSHA 2E1MA 4NHRA 4ZYDA 2FGGA 3LMLA 2UUAE 2EZ6A 4DR7E 5KL2A 4GKKE 2EM0A 2WBSA 1F2IG 1WHNA 4DUZE 2YSPA 3MSWA 5A6JA 1BB8A 4JI5E 4BC7A 1NCSA 2EOHA 1UBDC 1EKZA
chains in the Genus database with same CATH topology
2ADRA 2EJ4A 2EM6A 2EMWA 4R2SA 3EPJA 2ELYA 3EPKA 2YTIA 3UK3C 4IJDA 2EMGA 1ZR9A 2EN7A 1KJKA 2EOEA 2EORA 2ENAA 1JK2A 3MHSC 2CT1A 1BBOA 2DLQA 2YTEA 2DRPA 2WBTA 2YTQA 2EPAA 2ENCA 2EMXA 1B69A 2RSIA 2MKNA 2CTDA 2EMFA 2EMZA 2EN4A 2EQ0A 2PRTA 2EPCA 2YU8A 2EOSA 2GHFA 2EN2A 2EE8A 2EMIA 2E72A 3EPLA 2LVHA 4R2CA 2EMCA 3VHTB 2DLKA 1A1HA 5KL7A 1X3CA 2YTJA 1Z1BA 1JK1A 2EQ3A 2YRMA 1X5WA 2EL6A 1MEYC 2HGHA 1UN6B 2YRKA 2EOZA 1G2FC 2LV2A 1A1LA 2EMYA 2EPXA 2YRHA 4R2EA 2VRDA 3MHHC 2EMBA 2EOMA 1X6HA 2LT7A 1TF6A 1YUJA 2EOQA 2EMLA 2YTFA 2EN6A 1YSAC 5KL4A 1A1FA 2MDGA 2YTDA 1WJPA 2EMAA 2EM2A 2EM5A 2EM3A 2DGCA 4R2PA 2WBUA 3EPHA 2EOXA 1RMDA 2BB8A 2EQ1A 1DGCA 2YTPA 2EMHA 2EM8A 2EN3A 1X6EA 2EL5A 4M9VC 2EPZA 4GZNC 4WSGA 2ENHA 1ZU1A 2MKDA 2JP9A 1A1JA 4R2DA 1TF3A 4FK5C 4R2RA 2EPRA 2NABA 1P47A 4X9JA 2WCC3 1ZAAC 4R2QA 2EN1A 2EM9A 2YTOA 5KL5A 2EP3A 2M9AA 2EOJA 1A1KA 5KL6A 1LLMC 4F6NA 2EM4A 2A25A 2D9HA 2EOIA 2LCEA 2YTNA 2EOFA 4IS1C 2YSOA 2J7JA 1AAYA 1A1GA 1TN9A 1YUIA 2EPUA 2YU5A 2CSHA 5KL3A 4F6MA 2I13A 2EOYA 5KL2A 2EM0A 2WBSA 1F2IG 4R2AA 1X6FA 2EMKA 3M99B 2YSPA 2R1FA 2DMIA 4F2JC 2EN8A 1A1IA 1BB8A 2EL4A 2EOOA 2EPPA 1G2DC 2JPAA 2GLIA 2YTGA 2EM7A 1NCSA 2EOHA 2RPCA 2ELZA 1UBDC 2LO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ADR A;  2EJ4 A;  2EM6 A;  2EMW A;  4R2S A;  3EPJ A;  2ELY A;  3EPK A;  2YTI A;  3UK3 C;  4IJD A;  2EMG A;  1ZR9 A;  2EN7 A;  1KJK A;  2EOE A;  2EOR A;  2ENA A;  1JK2 A;  3MHS C;  2CT1 A;  1BBO A;  2DLQ A;  2YTE A;  2DRP A;  2WBT A;  2YTQ A;  2EPA A;  2ENC A;  2EMX A;  1B69 A;  2RSI A;  2MKN A;  2CTD A;  2EMF A;  2EMZ A;  2EN4 A;  2EQ0 A;  2PRT A;  2EPC A;  2YU8 A;  2EOS A;  2GHF A;  2EN2 A;  2EE8 A;  2EMI A;  2E72 A;  3EPL A;  2LVH A;  4R2C A;  2EMC A;  3VHT B;  2DLK A;  1A1H A;  5KL7 A;  1X3C A;  2YTJ A;  1Z1B A;  1JK1 A;  2EQ3 A;  2YRM A;  1X5W A;  2EL6 A;  1MEY C;  2HGH A;  1UN6 B;  2YRK A;  2EOZ A;  1G2F C;  2LV2 A;  1A1L A;  2EMY A;  2EPX A;  2YRH A;  4R2E A;  2VRD A;  3MHH C;  2EMB A;  2EOM A;  1X6H A;  2LT7 A;  1TF6 A;  1YUJ A;  2EOQ A;  2EML A;  2YTF A;  2EN6 A;  1YSA C;  5KL4 A;  1A1F A;  2MDG A;  2YTD A;  1WJP A;  2EMA A;  2EM2 A;  2EM5 A;  2EM3 A;  2DGC A;  4R2P A;  2WBU A;  3EPH A;  2EOX A;  1RMD A;  2BB8 A;  2EQ1 A;  1DGC A;  2YTP A;  2EMH A;  2EM8 A;  2EN3 A;  1X6E A;  2EL5 A;  4M9V C;  2EPZ A;  4GZN C;  4WSG A;  2ENH A;  1ZU1 A;  2MKD A;  2JP9 A;  1A1J A;  4R2D A;  1TF3 A;  4FK5 C;  4R2R A;  2EPR A;  2NAB A;  1P47 A;  4X9J A;  2WCC 3;  1ZAA C;  4R2Q A;  2EN1 A;  2EM9 A;  2YTO A;  5KL5 A;  2EP3 A;  2M9A A;  2EOJ A;  1A1K A;  5KL6 A;  1LLM C;  4F6N A;  2EM4 A;  2A25 A;  2D9H A;  2EOI A;  2LCE A;  2YTN A;  2EOF A;  4IS1 C;  2YSO A;  2J7J A;  1AAY A;  1A1G A;  1TN9 A;  1YUI A;  2EPU A;  2YU5 A;  2CSH A;  5KL3 A;  4F6M A;  2I13 A;  2EOY A;  5KL2 A;  2EM0 A;  2WBS A;  1F2I G;  4R2A A;  1X6F A;  2EMK A;  3M99 B;  2YSP A;  2R1F A;  2DMI A;  4F2J C;  2EN8 A;  1A1I A;  1BB8 A;  2EL4 A;  2EOO A;  2EPP A;  1G2D C;  2JPA A;  2GLI A;  2YTG A;  2EM7 A;  1NCS A;  2EOH A;  2RPC A;  2ELZ A;  1UBD C;  2LO3 A; 
#chains in the Genus database with same CATH topology
 1SR9 A;  4F54 A;  2EMW A;  3UK3 C;  1IBK E;  2YTI A;  4IJD A;  4JI7 E;  1PKP A;  3VYX A;  5LL6 R;  4GKJ E;  2HJJ A;  1T4L B;  4B3T E;  4LFB E;  1YYO A;  2DRP A;  5AE2 A;  2EPA A;  2EMZ A;  2EN4 A;  3HPZ A;  1GZ6 A;  4X8W A;  3ADI A;  2LJH A;  4O5G A;  2EE8 A;  3HQ1 A;  5F3W A;  2E72 A;  2LVH A;  2B7T A;  4MLQ A;  3KZZ A;  2DB2 A;  5KL7 A;  4LU9 A;  3C6M A;  4NXM E;  1N34 E;  1UN6 B;  2YRK A;  2LV2 A;  3J7Y p;  2V8Q B;  2EPX A;  3VYY A;  4DV6 E;  1L4S A;  2RTX A;  4L5N C;  1DI2 A;  5A6K A;  2EOQ A;  1N36 E;  2EN6 A;  1A1F A;  5IT9 C;  3THN A;  2RSM A;  2KOU A;  4P7D A;  1HNZ E;  2WBU A;  3C6K A;  1PDA A;  2EOX A;  4DR4 E;  1RMD A;  2BB8 A;  1DGC A;  1WRJ A;  4GEQ B;  4BHB A;  2LTS A;  1X6E A;  2V86 A;  4LFC E;  2R76 A;  2L2K B;  4B3M E;  4DV1 E;  2NUE A;  1PJT A;  2ENH A;  2YWQ A;  1A1J A;  4TUG A;  4JI8 E;  4LF4 E;  2L33 A;  2FTX B;  4NZV A;  1XNR E;  1YYK A;  1ZBT A;  4X9J A;  1XMO E;  4RH8 A;  1RQ0 A;  2WCC 3;  2EN1 A;  2YTO A;  5KL5 A;  2DIX A;  2K7I A;  1DQ3 A;  2L92 A;  2JYA A;  2L6M A;  2V83 A;  4ZYH A;  2EM4 A;  2YTN A;  4DR1 E;  4DV7 E;  4LF9 E;  2EOF A;  4IS1 C;  2JPA A;  1A1G A;  5KL3 A;  2YU5 A;  2YPN A;  4DV2 E;  3C4T A;  2VQF E;  3F6G A;  1T38 A;  1GTK A;  1YYW A;  1EH7 A;  1X6F A;  4O4K A;  2EMK A;  3M99 B;  5LMN E;  4JI2 E;  3ADJ A;  3H09 A;  2RS7 A;  2EOO A;  2GLI A;  4X62 E;  2RPC A;  2N3G A;  4BC9 A;  4O24 A;  2KON A;  3BBG A;  2ELY A;  2IHR 1;  4DMI A;  3LLH A;  1I94 E;  1HR0 E;  1JK2 A;  4DR3 E;  3AV0 A;  5IXM B;  2DLQ A;  5DNY A;  1IQO A;  2YTQ A;  3OTO E;  5FLX C;  2DSY A;  4BCA A;  2EQ0 A;  2KHX A;  3T1Y E;  3BID A;  2PRT A;  2EPC A;  1QU6 A;  2M7Q A;  5LLQ A;  2E5L E;  3EPL A;  2B9D A;  4R2C A;  2EPM X;  4BHC A;  3VHT B;  1KYQ A;  1A1H A;  1X3C A;  3IWC A;  2YTJ A;  2LUP B;  2LUQ A;  2LJU A;  1SFE A;  1MEY C;  4X66 E;  2EOZ A;  1XNQ E;  2YRH A;  5CFF E;  1MGT A;  1TF6 A;  2ZM6 E;  3J80 C;  4BBY A;  4LF6 E;  1WHQ A;  2EML A;  2RS6 A;  2FV4 B;  2V85 A;  1YSA C;  3C4B A;  1GQE A;  1T39 A;  1WJP A;  4OX9 E;  1J5E E;  4K0K E;  2EM3 A;  4JI0 E;  4M2Z A;  2G7H A;  1ZBQ A;  1UHZ A;  1X48 A;  3JAM C;  3EPH A;  1YZ9 A;  2YTP A;  2EPL X;  2EN3 A;  2L2M A;  1ZU1 A;  2JP9 A;  4R2D A;  3ADL A;  4FK5 C;  4LF7 E;  2NAB A;  2L8T A;  4L8N A;  4N4R B;  1P47 A;  2V89 A;  1PJS A;  3IWB A;  1IBL E;  4O43 A;  2DMY A;  4F6N A;  2D9H A;  2LCE A;  5A6B A;  4DV5 E;  4F9B B;  1YUI A;  2V87 A;  4WYQ B;  3TQM A;  1X49 A;  5AE3 A;  1N32 E;  1FJG E;  2JR1 A;  5AAS A;  1UIL A;  3J7A G;  4M0V A;  2JY9 A;  2R1F A;  3JTZ A;  2EN8 A;  1A1I A;  2EL4 A;  3BF2 A;  2JWO A;  4R8O A;  5A6A A;  2L2N A;  4JI1 E;  2LMZ A;  1IBM E;  2ELZ A;  3F6H A;  2ADR A;  2EJ4 A;  2EM6 A;  1QNT A;  3EPJ A;  1STU A;  3DF6 A;  1ZR9 A;  3HTX A;  5IV8 B;  2EOE A;  2EOR A;  1BBG A;  2ENA A;  4P78 A;  3MHS C;  4B3S E;  1BBO A;  5A69 A;  1J26 A;  4R03 A;  2WBT A;  3THO B;  2MDR A;  2V88 A;  2RSI A;  1AH5 A;  2HHH E;  5T6J A;  1O0W A;  2ODR D;  3IWD A;  2WZO A;  2JOX A;  4KZS A;  4LF5 E;  3KZY A;  2EN2 A;  4WX9 A;  2EMI A;  2YT4 A;  2NA2 A;  2EMC A;  1WXR A;  2DLK A;  4B3R E;  1JK1 A;  1X5W A;  4WXC A;  3QG5 C;  2HGH A;  2L3J A;  4R2E A;  2VRD A;  3MHH C;  2M4I A;  2LT7 A;  3HXL A;  3ECR A;  3AUZ A;  3KWR A;  1HNX E;  5KL4 A;  4F9C B;  2YTD A;  2EMA A;  2LBS B;  2Q8U A;  4KWY A;  2DGC A;  3L00 A;  3J81 C;  4R2P A;  2VE7 C;  1XMQ E;  2LE2 A;  4DV4 E;  4LTY A;  5A2Q C;  4F9A B;  4GZN C;  1YFH A;  2K4V A;  2LRS A;  4X64 E;  2N8X A;  2EPK X;  4YY3 E;  1EH8 A;  1TF3 A;  5ADZ A;  1PJQ A;  2EM9 A;  4DR5 E;  2VF1 A;  2M9A A;  2L3C A;  5LMU E;  2EOJ A;  1A1K A;  1EH6 A;  1LLM C;  4HEI A;  1AAY A;  2YSO A;  2LTR A;  2I13 A;  4F6M A;  2EOY A;  4RHB B;  4BMJ A;  5IWA E;  4R2A A;  2JOB A;  2NUF A;  2DMI A;  4WXD A;  4DV3 E;  4F2J C;  3JU0 A;  4JI3 E;  2ODR C;  2EPP A;  1G2D C;  4JV5 E;  4JI4 E;  3BGH A;  4J8Z A;  2YTG A;  2EM7 A;  3FIG A;  2CPN A;  1Z1B A;  2F8B A;  2LO3 A;  5BR8 E;  4R2S A;  5A6B D;  3EPK A;  2EMG A;  2UXB E;  4WPY A;  2EN7 A;  4DR2 E;  5AC5 A;  1KJK A;  5AE1 A;  2JXP A;  2CT1 A;  2YTE A;  1IMU A;  2RQL A;  4MLV A;  4Q28 A;  2ENC A;  2EMX A;  1B69 A;  2MKN A;  5TSE A;  2CTD A;  2EMF A;  3ZOQ B;  2YU8 A;  4JYA E;  2EOS A;  2M1S A;  2GHF A;  4LFA E;  4AQY E;  4ZYE A;  2UXC E;  3T1H E;  3DJW A;  2NUG A;  1N33 E;  4Q35 B;  4DKK A;  2EQ3 A;  2YRM A;  2EL6 A;  2GPI A;  2JVA A;  2MC5 A;  2H36 X;  2UXD E;  4TUI A;  1G2F C;  1A1L A;  2EMY A;  4WSP A;  3P1X A;  2EPO A;  2EMB A;  1X47 A;  2EOM A;  1X6H A;  1YUJ A;  3ADG A;  4DV0 E;  4X65 E;  2YTF A;  2N3H A;  4YHH E;  2MDG A;  3EQ1 A;  2EM2 A;  1N3G A;  2EM5 A;  1NEI A;  3HPS A;  3K6Q A;  2UUB E;  4BS9 A;  1T4O A;  4DUY E;  2UU9 E;  1YPN A;  2B3T B;  2EQ1 A;  2F4V E;  2EMH A;  2EM8 A;  2B7V A;  2EL5 A;  2EPZ A;  1T4N A;  4M9V C;  2EWL A;  4WSG A;  2BBG A;  4JI6 E;  1FKA E;  3OML A;  4M30 A;  4WFT A;  2MKD A;  2UUC E;  4HTG A;  4ZYG A;  5AC4 A;  4I8O A;  2I9I A;  2YZT A;  2HC5 A;  4LF8 E;  4R2R A;  2EPR A;  2VQE E;  2MC6 A;  4KHP E;  1RC7 A;  1HNW E;  2EPN A;  1ZAA C;  4R2Q A;  4DR6 E;  4OOG C;  2EP3 A;  3VK6 A;  5KL6 A;  1IQS A;  2A25 A;  2EOI A;  2J7J A;  3RMP A;  1TN9 A;  4NXN E;  2EPU A;  2CSH A;  2E1M A;  4NHR A;  4ZYD A;  2FGG A;  3LML A;  2UUA E;  2EZ6 A;  4DR7 E;  5KL2 A;  4GKK E;  2EM0 A;  2WBS A;  1F2I G;  1WHN A;  4DUZ E;  2YSP A;  3MSW A;  5A6J A;  1BB8 A;  4JI5 E;  4BC7 A;  1NCS A;  2EOH A;  1UBD C;  1EKZ A; 
#chains in the Genus database with same CATH homology
 2ADR A;  2EJ4 A;  2EM6 A;  2EMW A;  4R2S A;  3EPJ A;  2ELY A;  3EPK A;  2YTI A;  3UK3 C;  4IJD A;  2EMG A;  1ZR9 A;  2EN7 A;  1KJK A;  2EOE A;  2EOR A;  2ENA A;  1JK2 A;  3MHS C;  2CT1 A;  1BBO A;  2DLQ A;  2YTE A;  2DRP A;  2WBT A;  2YTQ A;  2EPA A;  2ENC A;  2EMX A;  1B69 A;  2RSI A;  2MKN A;  2CTD A;  2EMF A;  2EMZ A;  2EN4 A;  2EQ0 A;  2PRT A;  2EPC A;  2YU8 A;  2EOS A;  2GHF A;  2EN2 A;  2EE8 A;  2EMI A;  2E72 A;  3EPL A;  2LVH A;  4R2C A;  2EMC A;  3VHT B;  2DLK A;  1A1H A;  5KL7 A;  1X3C A;  2YTJ A;  1Z1B A;  1JK1 A;  2EQ3 A;  2YRM A;  1X5W A;  2EL6 A;  1MEY C;  2HGH A;  1UN6 B;  2YRK A;  2EOZ A;  1G2F C;  2LV2 A;  1A1L A;  2EMY A;  2EPX A;  2YRH A;  4R2E A;  2VRD A;  3MHH C;  2EMB A;  2EOM A;  1X6H A;  2LT7 A;  1TF6 A;  1YUJ A;  2EOQ A;  2EML A;  2YTF A;  2EN6 A;  1YSA C;  5KL4 A;  1A1F A;  2MDG A;  2YTD A;  1WJP A;  2EMA A;  2EM2 A;  2EM5 A;  2EM3 A;  2DGC A;  4R2P A;  2WBU A;  3EPH A;  2EOX A;  1RMD A;  2BB8 A;  2EQ1 A;  1DGC A;  2YTP A;  2EMH A;  2EM8 A;  2EN3 A;  1X6E A;  2EL5 A;  4M9V C;  2EPZ A;  4GZN C;  4WSG A;  2ENH A;  1ZU1 A;  2MKD A;  2JP9 A;  1A1J A;  4R2D A;  1TF3 A;  4FK5 C;  4R2R A;  2EPR A;  2NAB A;  1P47 A;  4X9J A;  2WCC 3;  1ZAA C;  4R2Q A;  2EN1 A;  2EM9 A;  2YTO A;  5KL5 A;  2EP3 A;  2M9A A;  2EOJ A;  1A1K A;  5KL6 A;  1LLM C;  4F6N A;  2EM4 A;  2A25 A;  2D9H A;  2EOI A;  2LCE A;  2YTN A;  2EOF A;  4IS1 C;  2YSO A;  2J7J A;  1AAY A;  1A1G A;  1TN9 A;  1YUI A;  2EPU A;  2YU5 A;  2CSH A;  5KL3 A;  4F6M A;  2I13 A;  2EOY A;  5KL2 A;  2EM0 A;  2WBS A;  1F2I G;  4R2A A;  1X6F A;  2EMK A;  3M99 B;  2YSP A;  2R1F A;  2DMI A;  4F2J C;  2EN8 A;  1A1I A;  1BB8 A;  2EL4 A;  2EOO A;  2EPP A;  1G2D C;  2JPA A;  2GLI A;  2YTG A;  2EM7 A;  1NCS A;  2EOH A;  2RPC A;  2ELZ A;  1UBD C;  2LO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...