2MKNA

Structural characterization of interactions between the double-stranded rna-binding zinc finger protein jaz and dsrna
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
44
structure length
44
Chain Sequence
IDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQETKLKLMARYGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Zinc finger protein 346
publication title Structural Characterization of Interactions between the Double-Stranded RNA-Binding Zinc Finger Protein JAZ and Nucleic Acids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 14
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2014-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12874 zf-met Zinc-finger of C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2mknA00
2YTJA 2I13A 2YSPA 2EP3A 2EMLA 2EMCA 2EL4A 2EOQA 5KL7A 3M99B 2EOYA 1DGCA 2YRKA 2YTPA 2WCC3 2MKDA 1AAYA 2EMAA 2EN8A 3EPLA 2YTFA 4F6MA 1G2DC 1TF6A 1KJKA 2YTQA 3EPKA 2EE8A 2NABA 2EM6A 4F2JC 2RSIA 4R2CA 4R2SA 2EPCA 2YSOA 1A1GA 2EM3A 1JK2A 5KL5A 1G2FC 1F2IG 2BB8A 2YTNA 2EOMA 2EOJA 1A1HA 2ENCA 2EMGA 2EMIA 2EM8A 2ENHA 5KL3A 1BBOA 2D9HA 2YRHA 1TN9A 2LVHA 2CTDA 2EM7A 1B69A 4IJDA 4R2DA 2JPAA 2RPCA 2EN7A 2YTOA 2EQ0A 1ZR9A 2EQ1A 2EM2A 2PRTA 2LV2A 2EPXA 3EPHA 1RMDA 5KL2A 4R2AA 1X3CA 1YUIA 2JP9A 2EOFA 2YTDA 4GZNC 2YU5A 1WJPA 2EQ3A 2LO3A 2EPRA 2EPAA 3MHSC 2EN4A 1A1LA 2YTGA 2WBTA 2DLKA 1X6FA 3MHHC 2EMXA 2EL5A 2LCEA 1A1IA 2EM9A 1X6HA 4X9JA 4F6NA 1YSAC 2DRPA 4FK5C 2CSHA 2CT1A 2EMBA 2WBSA 1LLMC 2J7JA 2EM5A 2YRMA 2VRDA 2DMIA 2EPPA 1Z1BA 2EOIA 4R2QA 2A25A 2EMKA 2ELYA 1X6EA 2ADRA 2ELZA 2EN2A 2EOXA 1YUJA 1TF3A 2EM0A 2EOHA 2EN3A 2DLQA 2EMZA 2M9AA 4IS1C 2WBUA 4R2EA 2EORA 1UBDC 2GLIA 2EMYA 2E72A 2EMHA 1P47A 2EMWA 2EPZA 2GHFA 1A1JA 2MKNA 2EMFA 2EOZA 1JK1A 4M9VC 2YTEA 4R2PA 1X5WA 1A1FA 2EPUA 3UK3C 2EN1A 2ENAA 2LT7A 2DGCA 3EPJA 2EOEA 2YU8A 2EOOA 2EM4A 5KL4A 1UN6B 2YTIA 2MDGA 1ZU1A 3VHTB 2EJ4A 1ZAAC 5KL6A 1A1KA 1MEYC 2EOSA 1NCSA 2EL6A 2EN6A 2HGHA 1BB8A 4R2RA 4WSGA 2R1FA
chains in the Genus database with same CATH superfamily
2YTJA 2EP3A 2EOQA 3C6MA 5KL7A 4DUZE 2E1MA 2MC5A 2YTPA 2EMAA 2EN8A 5LMUE 2YTFA 1G2DC 1TF6A 4R03A 4F9AB 1KJKA 1XMOE 4LF6E 1IBME 2LE2A 5F3WA 2YSOA 4LTYA 4NXNE 2EM3A 3JAMC 2BB8A 2V83A 2EOMA 2EOJA 5IT9C 2ENCA 2EMGA 2EMIA 2EM8A 2ENHA 3IWDA 5KL3A 1BBOA 4DV1E 4ZYHA 1TN9A 2B9DA 2ODRC 5AASA 5AC4A 2EM7A 3ADGA 3VK6A 4YY3E 4IJDA 4JI4E 4F9CB 4JI0E 2EQ1A 2PRTA 2LV2A 2HC5A 1RMDA 3J81C 2MC6A 2JP9A 4O4KA 2NUEA 4P7DA 2M7QA 1A1LA 4DV2E 1T4NA 3BBGA 2WBTA 4DR1E 2L3CA 1X6FA 1X47A 2EL5A 1A1IA 1J5EE 4L5NC 2LRSA 4X9JA 2UUBE 2UXDE 4TUIA 4FK5C 2CSHA 2CT1A 2WBSA 4DUYE 3DF6A 1FJGE 2FGGA 2J7JA 2DMIA 5ADZA 5TSEA 4M30A 3KZYA 4OOGC 2JYAA 2EOIA 4NZVA 5IV8B 4LFAE 4X64E 2UUCE 2EMKA 2ELYA 2KOUA 1X6EA 2ADRA 2JVAA 2ELZA 4BMJA 2EPKX 2I9IA 1PJQA 1YUJA 4B3ME 2UXBE 2EM0A 4BCAA 4BHCA 2EPMX 1N36E 2RQLA 2RS7A 3QG5C 4ZYGA 2EMHA 2GPIA 1HNWE 2GHFA 4J8ZA 1JK1A 2FTXB 2EPLX 2EPUA 1GQEA 2EN1A 1UHZA 2L3JA 2BBGA 2DGCA 2UUAE 1YYKA 1J26A 1IQOA 2EOOA 2EM4A 1WRJA 2YTIA 3ADIA 1QU6A 2EJ4A 1ZAAC 1MEYC 2EOSA 3LLHA 2B7TA 3LMLA 4WSGA 2YSPA 2EMLA 2EL4A 5CFFE 2VE7C 2LUQA 1AAYA 3ADLA 2NA2A 2EE8A 2EPNA 1UILA 2EM6A 2RSIA 2DB2A 4R2SA 2FV4B 2EPCA 2G7HA 1JK2A 5KL5A 1F2IG 4DV7E 1YYWA 2LVHA 1GZ6A 2DSYA 4BC9A 4BC7A 2JPAA 2RPCA 2EN7A 3ECRA 4JI6E 2YTOA 2EQ0A 2V88A 2V8QB 2RTXA 3FIGA 1KYQA 4R2AA 1DI2A 4X62E 3ADJA 1YUIA 2EOFA 2VF1A 4GZNC 1STUA 1WJPA 2EQ3A 2LTSA 2YWQA 2LUPB 3J80C 2EPAA 3MHSC 4DR3E 4DR7E 4JI5E 2EN4A 2RSMA 2V87A 2EMXA 2WZOA 3IWCA 1QNTA 3AUZA 4DR4E 4JI1E 1WHQA 3H09A 1XNQE 1AH5A 2NUGA 4JI8E 2RS6A 3JTZA 4LF7E 2CPNA 3C6KA 4LFBE 4R8OA 2EN2A 4DMIA 1HR0E 1PJSA 1WHNA 1FKAE 4R2EA 3BIDA 2EORA 2DMYA 4BHBA 4AQYE 4DR2E 2GLIA 2E72A 2EMWA 2MKNA 1EH6A 1RQ0A 2VQFE 1A1JA 1T4OA 3MSWA 4LF8E 2YTEA 1X5WA 3UK3C 4LF9E 3HTXA 3EPJA 3HPZA 4GEQB 5KL4A 4LFCE 2EZ6A 3L00A 1ZU1A 4RH8A 1O0WA 2V86A 4DV3E 1NCSA 2EL6A 2NUFA 4R2RA 4KWYA 3VYYA 4I8OA 2EMCA 2H36X 4F54A 4MLVA 4DV4E 2JOXA 3C4BA 3M99B 1DGCA 2YRKA 3BF2A 2YZTA 1EH8A 2MKDA 1WXRA 1PJTA 3EPLA 5BR8E 4F6MA 3AV0A 2YTQA 5AE2A 4O5GA 3OMLA 4WXDA 5LMNE 1PDAA 4Q28A 1ZBQA 2YTNA 1N34E 4DKKA 1YPNA 2D9HA 2YRHA 2E5LE 4BBYA 1N33E 2CTDA 5A6BA 2LTRA 3F6GA 3F6HA 4O43A 1ZR9A 5A6JA 2B7VA 5AC5A 1EKZA 1EH7A 4GKJE 3C4TA 3RMPA 1IMUA 2L2NA 2DLKA 3K6QA 2LCEA 2EM9A 2JY9A 1YYOA 4LU9A 3KZZA 2ODRD 4L8NA 4Q35B 4DV0E 4DV6E 2N3HA 1RC7A 2VRDA 2EPPA 1NEIA 1Z1BA 2L2KB 4R2QA 1YFHA 4JI2E 3KWRA 2A25A 2L92A 5A2QC 1PKPA 4GKKE 2EOXA 4K0KE 4HTGA 4YHHE 2EOHA 2EN3A 2DLQA 3T1YE 4IS1C 3HQ1A 2N8XA 2WBUA 1UBDC 2VQEE 4RHBB 2EMYA 1X49A 2EMFA 2EOZA 4DV5E 1HNXE 1HNZE 4OX9E 4KZSA 4KHPE 1N3GA 2KONA 4WYQB 4M2ZA 2M4IA 2Q8UA 3THOB 2LT7A 4JI3E 1IBLE 2B3TB 2EOEA 1X48A 4DR6E 2DIXA 2L8TA 1UN6B 3VHTB 3EQ1A 5A6BD 5IWAE 2LJUA 4WFTA 5KL6A 2K7IA 2EN6A 3ZOQB 4B3TE 4LF5E 4B3SE 3JU0A 2R1FA 2I13A 2JWOA 4X8WA 1XNRE 4X65E 5FLXC 2EOYA 2WCC3 3THNA 3HPSA 4BS9A 2M1SA 1GTKA 1ZBTA 3P1XA 1MGTA 4WPYA 3J7AG 3EPKA 2NABA 1T39A 1DQ3A 4F2JC 2N3GA 2LMZA 4R2CA 1A1GA 1G2FC 2V89A 4B3RE 1SR9A 5LLQA 1A1HA 1L4SA 5A69A 4JYAE 1I94E 1B69A 4R2DA 5AE1A 2EM2A 2EPXA 3EPHA 2IHR1 5KL2A 1X3CA 2YTDA 2LJHA 2YU5A 4P78A 2LO3A 2EPRA 4JV5E 3HXLA 3IWBA 2ZM6E 1T4LB 2YTGA 4JI7E 4LF4E 3DJWA 5AE3A 4ZYEA 4ZYDA 3MHHC 3BGHA 4DR5E 1N32E 4N4RB 1X6HA 4F6NA 1YSAC 2DRPA 3OTOE 1LLMC 2EMBA 2MDRA 1SFEA 2EWLA 2LBSB 2EM5A 2YRMA 5T6JA 2HJJA 5A6AA 4NHRA 4WX9A 2EPOA 3T1HE 5LL6R 2F8BA 2K4VA 1BBGA 2KHXA 2R76A 2JOBA 3TQMA 2L6MA 2JR1A 1TF3A 2L33A 1IBKE 1XMQE 2UU9E 2EMZA 2M9AA 2YPNA 4WXCA 5DNYA 1P47A 2F4VE 2EPZA 4M9VC 2L2MA 1IQSA 4M0VA 4NXME 4R2PA 2V85A 1A1FA 4F9BB 2ENAA 5A6KA 2YT4A 4WSPA 2YU8A 4X66E 1T38A 3J7Yp 2MDGA 5IXMB 2JXPA 4O24A 3VYXA 2UXCE 1A1KA 4HEIA 2HHHE 2HGHA 4TUGA 1BB8A 4MLQA 1YZ9A
chains in the Genus database with same CATH topology
2YTJA 2I13A 2YSPA 2EP3A 2EMLA 2EMCA 2EL4A 2EOQA 5KL7A 3M99B 2EOYA 1DGCA 2YRKA 2YTPA 2WCC3 2MKDA 1AAYA 2EMAA 2EN8A 3EPLA 2YTFA 4F6MA 1G2DC 1TF6A 1KJKA 2YTQA 3EPKA 2EE8A 2NABA 2EM6A 4F2JC 2RSIA 4R2CA 4R2SA 2EPCA 2YSOA 1A1GA 2EM3A 1JK2A 5KL5A 1G2FC 1F2IG 2BB8A 2YTNA 2EOMA 2EOJA 1A1HA 2ENCA 2EMGA 2EMIA 2EM8A 2ENHA 5KL3A 1BBOA 2D9HA 2YRHA 1TN9A 2LVHA 2CTDA 2EM7A 1B69A 4IJDA 4R2DA 2JPAA 2RPCA 2EN7A 2YTOA 2EQ0A 1ZR9A 2EQ1A 2EM2A 2PRTA 2LV2A 2EPXA 3EPHA 1RMDA 5KL2A 4R2AA 1X3CA 1YUIA 2JP9A 2EOFA 2YTDA 4GZNC 2YU5A 1WJPA 2EQ3A 2LO3A 2EPRA 2EPAA 3MHSC 2EN4A 1A1LA 2YTGA 2WBTA 2DLKA 1X6FA 3MHHC 2EMXA 2EL5A 2LCEA 1A1IA 2EM9A 1X6HA 4X9JA 4F6NA 1YSAC 2DRPA 4FK5C 2CSHA 2CT1A 2EMBA 2WBSA 1LLMC 2J7JA 2EM5A 2YRMA 2VRDA 2DMIA 2EPPA 1Z1BA 2EOIA 4R2QA 2A25A 2EMKA 2ELYA 1X6EA 2ADRA 2ELZA 2EN2A 2EOXA 1YUJA 1TF3A 2EM0A 2EOHA 2EN3A 2DLQA 2EMZA 2M9AA 4IS1C 2WBUA 4R2EA 2EORA 1UBDC 2GLIA 2EMYA 2E72A 2EMHA 1P47A 2EMWA 2EPZA 2GHFA 1A1JA 2MKNA 2EMFA 2EOZA 1JK1A 4M9VC 2YTEA 4R2PA 1X5WA 1A1FA 2EPUA 3UK3C 2EN1A 2ENAA 2LT7A 2DGCA 3EPJA 2EOEA 2YU8A 2EOOA 2EM4A 5KL4A 1UN6B 2YTIA 2MDGA 1ZU1A 3VHTB 2EJ4A 1ZAAC 5KL6A 1A1KA 1MEYC 2EOSA 1NCSA 2EL6A 2EN6A 2HGHA 1BB8A 4R2RA 4WSGA 2R1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTJ A;  2I13 A;  2YSP A;  2EP3 A;  2EML A;  2EMC A;  2EL4 A;  2EOQ A;  5KL7 A;  3M99 B;  2EOY A;  1DGC A;  2YRK A;  2YTP A;  2WCC 3;  2MKD A;  1AAY A;  2EMA A;  2EN8 A;  3EPL A;  2YTF A;  4F6M A;  1G2D C;  1TF6 A;  1KJK A;  2YTQ A;  3EPK A;  2EE8 A;  2NAB A;  2EM6 A;  4F2J C;  2RSI A;  4R2C A;  4R2S A;  2EPC A;  2YSO A;  1A1G A;  2EM3 A;  1JK2 A;  5KL5 A;  1G2F C;  1F2I G;  2BB8 A;  2YTN A;  2EOM A;  2EOJ A;  1A1H A;  2ENC A;  2EMG A;  2EMI A;  2EM8 A;  2ENH A;  5KL3 A;  1BBO A;  2D9H A;  2YRH A;  1TN9 A;  2LVH A;  2CTD A;  2EM7 A;  1B69 A;  4IJD A;  4R2D A;  2JPA A;  2RPC A;  2EN7 A;  2YTO A;  2EQ0 A;  1ZR9 A;  2EQ1 A;  2EM2 A;  2PRT A;  2LV2 A;  2EPX A;  3EPH A;  1RMD A;  5KL2 A;  4R2A A;  1X3C A;  1YUI A;  2JP9 A;  2EOF A;  2YTD A;  4GZN C;  2YU5 A;  1WJP A;  2EQ3 A;  2LO3 A;  2EPR A;  2EPA A;  3MHS C;  2EN4 A;  1A1L A;  2YTG A;  2WBT A;  2DLK A;  1X6F A;  3MHH C;  2EMX A;  2EL5 A;  2LCE A;  1A1I A;  2EM9 A;  1X6H A;  4X9J A;  4F6N A;  1YSA C;  2DRP A;  4FK5 C;  2CSH A;  2CT1 A;  2EMB A;  2WBS A;  1LLM C;  2J7J A;  2EM5 A;  2YRM A;  2VRD A;  2DMI A;  2EPP A;  1Z1B A;  2EOI A;  4R2Q A;  2A25 A;  2EMK A;  2ELY A;  1X6E A;  2ADR A;  2ELZ A;  2EN2 A;  2EOX A;  1YUJ A;  1TF3 A;  2EM0 A;  2EOH A;  2EN3 A;  2DLQ A;  2EMZ A;  2M9A A;  4IS1 C;  2WBU A;  4R2E A;  2EOR A;  1UBD C;  2GLI A;  2EMY A;  2E72 A;  2EMH A;  1P47 A;  2EMW A;  2EPZ A;  2GHF A;  1A1J A;  2MKN A;  2EMF A;  2EOZ A;  1JK1 A;  4M9V C;  2YTE A;  4R2P A;  1X5W A;  1A1F A;  2EPU A;  3UK3 C;  2EN1 A;  2ENA A;  2LT7 A;  2DGC A;  3EPJ A;  2EOE A;  2YU8 A;  2EOO A;  2EM4 A;  5KL4 A;  1UN6 B;  2YTI A;  2MDG A;  1ZU1 A;  3VHT B;  2EJ4 A;  1ZAA C;  5KL6 A;  1A1K A;  1MEY C;  2EOS A;  1NCS A;  2EL6 A;  2EN6 A;  2HGH A;  1BB8 A;  4R2R A;  4WSG A;  2R1F A; 
#chains in the Genus database with same CATH topology
 2YTJ A;  2EP3 A;  2EOQ A;  3C6M A;  5KL7 A;  4DUZ E;  2E1M A;  2MC5 A;  2YTP A;  2EMA A;  2EN8 A;  5LMU E;  2YTF A;  1G2D C;  1TF6 A;  4R03 A;  4F9A B;  1KJK A;  1XMO E;  4LF6 E;  1IBM E;  2LE2 A;  5F3W A;  2YSO A;  4LTY A;  4NXN E;  2EM3 A;  3JAM C;  2BB8 A;  2V83 A;  2EOM A;  2EOJ A;  5IT9 C;  2ENC A;  2EMG A;  2EMI A;  2EM8 A;  2ENH A;  3IWD A;  5KL3 A;  1BBO A;  4DV1 E;  4ZYH A;  1TN9 A;  2B9D A;  2ODR C;  5AAS A;  5AC4 A;  2EM7 A;  3ADG A;  3VK6 A;  4YY3 E;  4IJD A;  4JI4 E;  4F9C B;  4JI0 E;  2EQ1 A;  2PRT A;  2LV2 A;  2HC5 A;  1RMD A;  3J81 C;  2MC6 A;  2JP9 A;  4O4K A;  2NUE A;  4P7D A;  2M7Q A;  1A1L A;  4DV2 E;  1T4N A;  3BBG A;  2WBT A;  4DR1 E;  2L3C A;  1X6F A;  1X47 A;  2EL5 A;  1A1I A;  1J5E E;  4L5N C;  2LRS A;  4X9J A;  2UUB E;  2UXD E;  4TUI A;  4FK5 C;  2CSH A;  2CT1 A;  2WBS A;  4DUY E;  3DF6 A;  1FJG E;  2FGG A;  2J7J A;  2DMI A;  5ADZ A;  5TSE A;  4M30 A;  3KZY A;  4OOG C;  2JYA A;  2EOI A;  4NZV A;  5IV8 B;  4LFA E;  4X64 E;  2UUC E;  2EMK A;  2ELY A;  2KOU A;  1X6E A;  2ADR A;  2JVA A;  2ELZ A;  4BMJ A;  2EPK X;  2I9I A;  1PJQ A;  1YUJ A;  4B3M E;  2UXB E;  2EM0 A;  4BCA A;  4BHC A;  2EPM X;  1N36 E;  2RQL A;  2RS7 A;  3QG5 C;  4ZYG A;  2EMH A;  2GPI A;  1HNW E;  2GHF A;  4J8Z A;  1JK1 A;  2FTX B;  2EPL X;  2EPU A;  1GQE A;  2EN1 A;  1UHZ A;  2L3J A;  2BBG A;  2DGC A;  2UUA E;  1YYK A;  1J26 A;  1IQO A;  2EOO A;  2EM4 A;  1WRJ A;  2YTI A;  3ADI A;  1QU6 A;  2EJ4 A;  1ZAA C;  1MEY C;  2EOS A;  3LLH A;  2B7T A;  3LML A;  4WSG A;  2YSP A;  2EML A;  2EL4 A;  5CFF E;  2VE7 C;  2LUQ A;  1AAY A;  3ADL A;  2NA2 A;  2EE8 A;  2EPN A;  1UIL A;  2EM6 A;  2RSI A;  2DB2 A;  4R2S A;  2FV4 B;  2EPC A;  2G7H A;  1JK2 A;  5KL5 A;  1F2I G;  4DV7 E;  1YYW A;  2LVH A;  1GZ6 A;  2DSY A;  4BC9 A;  4BC7 A;  2JPA A;  2RPC A;  2EN7 A;  3ECR A;  4JI6 E;  2YTO A;  2EQ0 A;  2V88 A;  2V8Q B;  2RTX A;  3FIG A;  1KYQ A;  4R2A A;  1DI2 A;  4X62 E;  3ADJ A;  1YUI A;  2EOF A;  2VF1 A;  4GZN C;  1STU A;  1WJP A;  2EQ3 A;  2LTS A;  2YWQ A;  2LUP B;  3J80 C;  2EPA A;  3MHS C;  4DR3 E;  4DR7 E;  4JI5 E;  2EN4 A;  2RSM A;  2V87 A;  2EMX A;  2WZO A;  3IWC A;  1QNT A;  3AUZ A;  4DR4 E;  4JI1 E;  1WHQ A;  3H09 A;  1XNQ E;  1AH5 A;  2NUG A;  4JI8 E;  2RS6 A;  3JTZ A;  4LF7 E;  2CPN A;  3C6K A;  4LFB E;  4R8O A;  2EN2 A;  4DMI A;  1HR0 E;  1PJS A;  1WHN A;  1FKA E;  4R2E A;  3BID A;  2EOR A;  2DMY A;  4BHB A;  4AQY E;  4DR2 E;  2GLI A;  2E72 A;  2EMW A;  2MKN A;  1EH6 A;  1RQ0 A;  2VQF E;  1A1J A;  1T4O A;  3MSW A;  4LF8 E;  2YTE A;  1X5W A;  3UK3 C;  4LF9 E;  3HTX A;  3EPJ A;  3HPZ A;  4GEQ B;  5KL4 A;  4LFC E;  2EZ6 A;  3L00 A;  1ZU1 A;  4RH8 A;  1O0W A;  2V86 A;  4DV3 E;  1NCS A;  2EL6 A;  2NUF A;  4R2R A;  4KWY A;  3VYY A;  4I8O A;  2EMC A;  2H36 X;  4F54 A;  4MLV A;  4DV4 E;  2JOX A;  3C4B A;  3M99 B;  1DGC A;  2YRK A;  3BF2 A;  2YZT A;  1EH8 A;  2MKD A;  1WXR A;  1PJT A;  3EPL A;  5BR8 E;  4F6M A;  3AV0 A;  2YTQ A;  5AE2 A;  4O5G A;  3OML A;  4WXD A;  5LMN E;  1PDA A;  4Q28 A;  1ZBQ A;  2YTN A;  1N34 E;  4DKK A;  1YPN A;  2D9H A;  2YRH A;  2E5L E;  4BBY A;  1N33 E;  2CTD A;  5A6B A;  2LTR A;  3F6G A;  3F6H A;  4O43 A;  1ZR9 A;  5A6J A;  2B7V A;  5AC5 A;  1EKZ A;  1EH7 A;  4GKJ E;  3C4T A;  3RMP A;  1IMU A;  2L2N A;  2DLK A;  3K6Q A;  2LCE A;  2EM9 A;  2JY9 A;  1YYO A;  4LU9 A;  3KZZ A;  2ODR D;  4L8N A;  4Q35 B;  4DV0 E;  4DV6 E;  2N3H A;  1RC7 A;  2VRD A;  2EPP A;  1NEI A;  1Z1B A;  2L2K B;  4R2Q A;  1YFH A;  4JI2 E;  3KWR A;  2A25 A;  2L92 A;  5A2Q C;  1PKP A;  4GKK E;  2EOX A;  4K0K E;  4HTG A;  4YHH E;  2EOH A;  2EN3 A;  2DLQ A;  3T1Y E;  4IS1 C;  3HQ1 A;  2N8X A;  2WBU A;  1UBD C;  2VQE E;  4RHB B;  2EMY A;  1X49 A;  2EMF A;  2EOZ A;  4DV5 E;  1HNX E;  1HNZ E;  4OX9 E;  4KZS A;  4KHP E;  1N3G A;  2KON A;  4WYQ B;  4M2Z A;  2M4I A;  2Q8U A;  3THO B;  2LT7 A;  4JI3 E;  1IBL E;  2B3T B;  2EOE A;  1X48 A;  4DR6 E;  2DIX A;  2L8T A;  1UN6 B;  3VHT B;  3EQ1 A;  5A6B D;  5IWA E;  2LJU A;  4WFT A;  5KL6 A;  2K7I A;  2EN6 A;  3ZOQ B;  4B3T E;  4LF5 E;  4B3S E;  3JU0 A;  2R1F A;  2I13 A;  2JWO A;  4X8W A;  1XNR E;  4X65 E;  5FLX C;  2EOY A;  2WCC 3;  3THN A;  3HPS A;  4BS9 A;  2M1S A;  1GTK A;  1ZBT A;  3P1X A;  1MGT A;  4WPY A;  3J7A G;  3EPK A;  2NAB A;  1T39 A;  1DQ3 A;  4F2J C;  2N3G A;  2LMZ A;  4R2C A;  1A1G A;  1G2F C;  2V89 A;  4B3R E;  1SR9 A;  5LLQ A;  1A1H A;  1L4S A;  5A69 A;  4JYA E;  1I94 E;  1B69 A;  4R2D A;  5AE1 A;  2EM2 A;  2EPX A;  3EPH A;  2IHR 1;  5KL2 A;  1X3C A;  2YTD A;  2LJH A;  2YU5 A;  4P78 A;  2LO3 A;  2EPR A;  4JV5 E;  3HXL A;  3IWB A;  2ZM6 E;  1T4L B;  2YTG A;  4JI7 E;  4LF4 E;  3DJW A;  5AE3 A;  4ZYE A;  4ZYD A;  3MHH C;  3BGH A;  4DR5 E;  1N32 E;  4N4R B;  1X6H A;  4F6N A;  1YSA C;  2DRP A;  3OTO E;  1LLM C;  2EMB A;  2MDR A;  1SFE A;  2EWL A;  2LBS B;  2EM5 A;  2YRM A;  5T6J A;  2HJJ A;  5A6A A;  4NHR A;  4WX9 A;  2EPO A;  3T1H E;  5LL6 R;  2F8B A;  2K4V A;  1BBG A;  2KHX A;  2R76 A;  2JOB A;  3TQM A;  2L6M A;  2JR1 A;  1TF3 A;  2L33 A;  1IBK E;  1XMQ E;  2UU9 E;  2EMZ A;  2M9A A;  2YPN A;  4WXC A;  5DNY A;  1P47 A;  2F4V E;  2EPZ A;  4M9V C;  2L2M A;  1IQS A;  4M0V A;  4NXM E;  4R2P A;  2V85 A;  1A1F A;  4F9B B;  2ENA A;  5A6K A;  2YT4 A;  4WSP A;  2YU8 A;  4X66 E;  1T38 A;  3J7Y p;  2MDG A;  5IXM B;  2JXP A;  4O24 A;  3VYX A;  2UXC E;  1A1K A;  4HEI A;  2HHH E;  2HGH A;  4TUG A;  1BB8 A;  4MLQ A;  1YZ9 A; 
#chains in the Genus database with same CATH homology
 2YTJ A;  2I13 A;  2YSP A;  2EP3 A;  2EML A;  2EMC A;  2EL4 A;  2EOQ A;  5KL7 A;  3M99 B;  2EOY A;  1DGC A;  2YRK A;  2YTP A;  2WCC 3;  2MKD A;  1AAY A;  2EMA A;  2EN8 A;  3EPL A;  2YTF A;  4F6M A;  1G2D C;  1TF6 A;  1KJK A;  2YTQ A;  3EPK A;  2EE8 A;  2NAB A;  2EM6 A;  4F2J C;  2RSI A;  4R2C A;  4R2S A;  2EPC A;  2YSO A;  1A1G A;  2EM3 A;  1JK2 A;  5KL5 A;  1G2F C;  1F2I G;  2BB8 A;  2YTN A;  2EOM A;  2EOJ A;  1A1H A;  2ENC A;  2EMG A;  2EMI A;  2EM8 A;  2ENH A;  5KL3 A;  1BBO A;  2D9H A;  2YRH A;  1TN9 A;  2LVH A;  2CTD A;  2EM7 A;  1B69 A;  4IJD A;  4R2D A;  2JPA A;  2RPC A;  2EN7 A;  2YTO A;  2EQ0 A;  1ZR9 A;  2EQ1 A;  2EM2 A;  2PRT A;  2LV2 A;  2EPX A;  3EPH A;  1RMD A;  5KL2 A;  4R2A A;  1X3C A;  1YUI A;  2JP9 A;  2EOF A;  2YTD A;  4GZN C;  2YU5 A;  1WJP A;  2EQ3 A;  2LO3 A;  2EPR A;  2EPA A;  3MHS C;  2EN4 A;  1A1L A;  2YTG A;  2WBT A;  2DLK A;  1X6F A;  3MHH C;  2EMX A;  2EL5 A;  2LCE A;  1A1I A;  2EM9 A;  1X6H A;  4X9J A;  4F6N A;  1YSA C;  2DRP A;  4FK5 C;  2CSH A;  2CT1 A;  2EMB A;  2WBS A;  1LLM C;  2J7J A;  2EM5 A;  2YRM A;  2VRD A;  2DMI A;  2EPP A;  1Z1B A;  2EOI A;  4R2Q A;  2A25 A;  2EMK A;  2ELY A;  1X6E A;  2ADR A;  2ELZ A;  2EN2 A;  2EOX A;  1YUJ A;  1TF3 A;  2EM0 A;  2EOH A;  2EN3 A;  2DLQ A;  2EMZ A;  2M9A A;  4IS1 C;  2WBU A;  4R2E A;  2EOR A;  1UBD C;  2GLI A;  2EMY A;  2E72 A;  2EMH A;  1P47 A;  2EMW A;  2EPZ A;  2GHF A;  1A1J A;  2MKN A;  2EMF A;  2EOZ A;  1JK1 A;  4M9V C;  2YTE A;  4R2P A;  1X5W A;  1A1F A;  2EPU A;  3UK3 C;  2EN1 A;  2ENA A;  2LT7 A;  2DGC A;  3EPJ A;  2EOE A;  2YU8 A;  2EOO A;  2EM4 A;  5KL4 A;  1UN6 B;  2YTI A;  2MDG A;  1ZU1 A;  3VHT B;  2EJ4 A;  1ZAA C;  5KL6 A;  1A1K A;  1MEY C;  2EOS A;  1NCS A;  2EL6 A;  2EN6 A;  2HGH A;  1BB8 A;  4R2R A;  4WSG A;  2R1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...