3C6MA

Crystal structure of human spermine synthase in complex with spermine and 5-methylthioadenosine
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
361
structure length
336
Chain Sequence
SRHSTLDFMLGDGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYDSILNKVEERMKELSVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermine synthase
publication title Crystal structure of human spermine synthase: implications of substrate binding and catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 104
structure length 336
sequence length 361
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.22: Spermine synthase.
pdb deposition date 2008-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
A PF17950 SpmSyn_N S-adenosylmethionine decarboxylase N -terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 3c6mA02
3.30.160.110 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Siroheme synthase; domain 2 3c6mA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3c6mA03
2PWYA 5U4XA 3B3GA 3PVCA 3M6UA 4C4AA 2LD4A 1KPHA 1UWVA 3NDJA 1N7IA 1NKVA 1X19A 2QM3A 3S68A 3UWPA 2UYQA 4FZVA 3FTFA 2R3SA 3EVGA 4RVDA 3HNRA 3KU1A 4C06A 1NW5A 1QAMA 1WS6A 4AZSA 2PXAA 3R0QA 2C7OA 4YUVA 4YUWA 3OU2A 2PXCA 4OBXA 3LKDA 3KPYA 3UJ7A 2QRVA 3BKXA 3CJRA 1XTPA 3CC8A 4OA5A 2VS1A 4Y2HA 5FHRA 5FQOA 5LQUA 2G8NA 1G8AA 2FRXA 1VIDA 4AX8A 1G55A 3O7WA 3EVCA 5EMMA 4PINA 1VP3A 2IDKA 2OB1A 3EGIA 3ME5A 1PJTA 2Z6QA 2ZW9A 4LECA 5CVVA 4POOA 3SGLA 1QYRA 2ZBRA 4YMGA 1YZHA 2FCAA 2WK1A 3DULA 3LBYA 3A4TA 3P71T 3KQPA 2AN5A 3FUUA 3O31A 5K0GA 3LKZA 3RIEA 1X1CA 2ERCA 1X1BA 2AVNA 3G5LA 3TKAA 4MIKA 4QQNA 4EMSA 3ID6C 4GF5A 4DM3A 5F2OA 3KQOA 1PJZA 2OKCA 4WVLA 4EKGA 1WXWA 1RI5A 3DXZA 1ZKDA 4JXJA 3UBTA 1KPGA 5DM0A 5KQSA 5FWAA 3UJBA 5MHTA 1QAQA 4LWOA 3UJ6A 2XYVA 3ELUA 3EPPA 1RJFA 4AZVA 4UOEA 3KR1A 3CVOA 1ORHA 3P97A 3A25A 4U7TB 2B3TA 1FBNA 5LQAA 2PT6A 4MTLA 1JG1A 2CWWA 3FZGA 2YVLA 3REOA 4P7FA 1YZ3A 3LECA 3TKYA 3V97A 1NBHA 1VE3A 3NJRA 3CJTA 1L1EA 1KPIA 2ZIEA 3P9IA 4ER0A 4YUZA 1KHHA 2QYOA 2ZBQA 1XXLA 3G89A 4PIMA 5EGSA 4RTPA 3BZBA 4DCGA 3IHTA 4IWNA 5LQRA 3PTAA 2IH5A 3MGGA 3PB3A 1NW6A 1XCJA 3G5TA 3GJYA 4QPPA 2BH2A 2Y1WA 1AF7A 1R8YA 1ZGAA 3FRIA 2QRVB 2P3OA 3GRRA 4KIGA 3LSTA 5EKXA 1FJXA 3FPJA 3SMQA 2IH4A 1EIZA 2AS0A 2GAFA 1M6EX 2AOUA 5DM2A 5JR3A 5C0OE 2O0LA 2PGXA 3BUSA 5DX0A 3HCCA 5ICFA 1BOOA 5K8VA 2I9KA 2OO3A 4OX9Y 3UJDA 3I5UA 4QPNA 3OE4A 4QDJA 2PX2A 1EAMA 3R9XB 4PNEA 3GXOA 5FA5A 1EQAA 1RI4A 1T43A 3HCDA 4ISCA 5DSTA 5EZQA 3GWZA 3JWIA 4RTRA 3UA4A 4KWCA 4BP3A 4DMGA 3KPVA 4CWAA 4RTJA 5LSAA 1XCLA 3VSEA 2I7CA 2F8LA 4PCLA 3BWBA 3EVAA 5DM4A 3TMAA 3PFHA 4IKPA 2IBTA 4RV9A 5HIIA 3I9FA 5K0BA 1X1AA 2NXJA 3IV6A 5LQKA 1NV8A 5E8RA 5EQJB 4E2ZA 4OBWA 4ZTBA 1FP1D 3FYDA 3LDFA 3OZTA 3PT9A 4RTKA 3OPNA 1P1BA 1P91A 4PYIA 5G02A 2OBFA 3G2OA 1FPQA 1U2ZA 1R6AA 2JHAA 4O29A 2G1PA 2NP6A 1PRYA 1ZG3A 2P8JA 1P1CA 4R8RA 2PKWA 4RYLA 3P2EA 5T64A 2JH8A 3FUVA 5GOZA 5DXAA 1L3BA 3DMHA 4PWYA 4DCMA 3VC2A 4RTLA 3ER9A 4OQEA 2O07A 5KQRA 2UYOA 3I53A 3IYLW 2GPYA 4A6EA 1WY7A 3KPWA 1RI3A 2IP2A 1TPYA 3HVJA 4BLVA 5K0JA 2AOUB 2PBFA 1WZNA 3GNLA 3LBFA 5FULA 2NXNA 3B3JA 3R3HA 5HEKA 2BR5A 4FS8A 3SR4A 3THRA 4BY9E 2FK7A 2BR4A 5DT2A 4V0RA 2OXTA 1TW2A 3T7SA 4ER5A 5EMLA 3BXOA 3G2MA 5C1IA 3TQSA 5IH3A 3Q7EA 3X0DA 4X60A 2AZTA 3EGVA 2G71A 3FPHA 4M7RA 5E1OA 3KR9A 4NECA 5EKUA 4E32A 5GM1A 2UYHA 4QTUB 2UYCA 5CCBA 1IXKA 1NW7A 5CVDA 2ZZNA 1JG4A 4DA4A 2FYTA 2XYQA 3NVKI 5EIFA 5ICEA 3P9NA 5DTMA 4C05A 3AXSA 4KRGA 1L3CA 2ADMA 2GLUA 3PX2A 1JQ3A 4EKIA 4PYJA 5CVEA 2IH2A 4C08A 1JSZA 2IDJA 3MHTA 2ZLBA 4FSDA 4FP9A 3ELWA 4YV1A 2O57A 1NW3A 1MHTA 2HTEA 5BW5A 2NYUA 3OZRA 1R18A 4LWPA 3DUWA 4OQDA 2B2CA 2ZBPA 5CIYA 3EEOA 2PSSA 3SSOA 1X1DA 2VZ9A 5DX1A 3FTCA 5BW4A 3HP7A 3OFKA 3DXXA 3GO4A 1DUSA 4P7GA 1SQGA 4QTTB 3OZSA 4P58A 5CM2Z 3SVZA 2PT9A 5EHGA 4ER3A 1AV6A 3KR0A 3A7EA 3NWBA 2ZULA 4FR0A 2YXEA 4PYMA 5ICGA 2Z6AA 2OPBA 1QAOA 2P7IA 2ZZMA 1R74A 3T7TA 5B1SA 4ER6A 1YB2A 2WA2A 2ONZA 2BM9A 1RJGA 1R8XA 4OA8A 3E7PA 2ZCJA 3ERCA 5JUWA 2ZVJA 3M4XA 3BT7A 1XDUA 3DMFA 2P40A 2P35A 5EPEA 5GWXA 3DR5A 2R6ZA 5KVAA 5P8WA 4YMHA 3BGDA 3NTVA 4E2YA 2OYRA 3AXTA 3R24A 1NBIA 3PLAE 2DPMA 2G72A 1DL5A 1SUIA 1V39A 3DLCA 3OE5A 5HOQA 1ZQ9A 4RTMA 4V0QA 4R05A 2C7RA 4GOLD 5EZSA 5C9ZA 3FPEA 2FK8A 4U7PB 1DCTA 2E5WA 3BKWA 3ELDA 5K0NA 4CKEA 5H02A 1HMYA 4AZTA 1R00A 4PYOA 2C7QA 4BLUA 1AQIA 4GC5A 3HCAA 3M6VA 4QVKA 1KXZA 2N47A 4HRAA 1RJDA 3KQMA 4E70A 4KW7A 2P3LA 3VC1A 4X1OA 1VL5A 2B25A 1RJEA 1FP2A 5T67A 2EG5A 3RODA 1KYWA 2YXDA 3HVKA 3LHDA 1N7JA 5DTQA 3G8BA 2PV0A 3GRZA 2YUIA 4M36A 5FHQA 4F84A 1IM8A 5BXYA 3GCZA 3BWMA 5ERGB 2Q41A 4GOOD 2V74B 1VPTA 4HG2A 1Q0TA 5DWQA 3LL7A 5K0LA 4RTQA 2EFJA 3P2IA 2JHCA 4CKBA 4RTNA 4HSGA 3G8AA 2NXCA 4RTSA 4AUKA 3KHKA 1P39A 3ER8A 5CUQA 5E8JA 1JQDA 2AR0A 2I6GA 3SXJA 1SUSA 3KQYA 2P3QA 4E30A 1JR4A 1O54A 2AVDA 1I1NA 2FHPA 4PONA 4F85A 4RSRA 2EJTA 1VP9A 5E9JA 1VBFA 5FWDA 3TFWA 3EVFA 2BZGA 3P9CA 3E05A 4RX1A 1YFJA 3BWCA 3R6TA 2WA1A 3FYCA 3O4FA 4YUYA 2JJQA 3HM2A 3M70A 3PFGA 4HGYA 3DTNA 4PGHA 4EVIA 1M6YA 1QZZA 2PLWA 2OB2A 5K01A 2AOTA 5LQCA 3RW9A 1BHJA 3KQVA 4CTKA 1H1DA 3HVIA 5BP7A 1N2XA 4GEKA 2EX4A 5FQNA 5FUBA 2FPOA 2IPXA 2PX5A 2B78A 2AOXA 5DM1A 4HGZA 3T0IA 4CTJA 4YUXA 3LDUA 4PIPA 4BLWA 2I62A 3KQWA 5K03A 10MHA 4DZRA 2ZSUA 4Y30A 3B89A 2VDWA 3PS9A 5K05A 5CVUA 5D1HA 3TLJA 2IIPA 2ZWAA 1ORIA 3P9KA 1RI1A 1MJFA 2O06A 1G6Q1 2AN3A 2OZVA 3SM3A 1KIAA 3MERA 4KVZA 3JWHA 3I64A 4CKCA 3HVHA 4P7KA 4XCXA 1G8SA 4EK9A 5EOVA 5HIKA 4FSXA 2GH1A 4QQKA 2YTZA 4QVGA 1L3IA 2PX8A 5LR6A 3EGEA 1XJ5A 1VQ1A 1BC5A 3OU6A 5F2KA 3OU7A 5DRYA 1O9GA 5EG5A 1SKMA 2PWPA 1IY9A 3EVZA 3OCJA 5E9QA 2C7PA 5GIOE 4ER7A 3KQQA 5FCDA 5K0EA 2P1DA 3CJQA 2ZIGA 1JSXA 2A14A 5E2AA 4H0NA 4R8SA 3TM4A 3FUXA 2ZWVA 3M6WA 4GOMD 3UA3A 5LQNA 4WXHA 2OY0A 4X63A 8MHTA 4RVGA 2KW5A 4PYQA 5DXJA 3H2BA 3HCFA 3SX0A 2P41A 2Y1XA 2EJUA 4GOND 5FADA 4DF3A 2HV9A 5E1DA 3C6KA 1O9HA 4GUAA 2AOTB 3EVEA 3TRKA 4PYLA 2K4MA 2Z6UA 3C0KA 3F4KA 3EVDA 3LX6A 4PYKA 1Z3CA 3MB5A 3MAGA 3FTDA 3MCTA 4HTFA 4FT4A 3AJDA 5K0CA 5CCXA 4LG1A 3AWIA 2CL5A 2JG3A 2PJDA 2QE6A 3GIWA 4BP1A 2HWKA 3FPFA 3LCCA 2DULA 3L8DA 3Q87B 4B17A 4E2XA 2P7HA 4X61A 3A27A 5HIMA 4YV2A 3LPMA 3QOWA 3AY0A 1INLA 1EJ0A 3NW9A 1VLMA 5E1BA 4EQZA 1G60A 4ATNA 3LCVB 3I58A 3OFJA 1EJ6A 3MTIA 4KDCA 1D2CA 5EMKA 3BGIA 2JHPA 3KKZA 3P8ZA 3UJCA 5DSXA 2YR0A 2GB4A 1Y8CA 3UZUA 3UJ8A 2ORED 5IKMA 1NT2A 3FPGA 3WSTA 4MQ4A 4MWZA 3E23A 2PX4A 2PXXA 1NW8A 5EEGA 4KIFA 2CMHA 2XVMA 3VYWA 1HNNA 2H00A 5F2NA 5CD1A 2UZ4A 3HA3A 4AZWA 3UJ9A 2O05A 2AOVA 1JTFA 3CBGA 7MHTA 2IBSA 2VDUE 1M0EA 2HR1A 3HA7A 4Z2YA 1B42A 2QY6A 3CGGA 1KR5A 3GRUA 3HA5A 5DLYA 3GRVA 3ORHA 3HEMA 3GRYA 1F38A 2HMYB 2V7EA 5LQJA 3GU3A 5M5BA 3KPJA 4K6MA 4X41A 1JG2A 3G2QA 3DXYA 1JTEA 4XUDA 1SQFA 4YV0A 4XUCA 3PX3A 3DOUA 1ZHFA 1XVAA 2ESRA 1EG2A 4FT2A 1QANA 2NP7A 3BGVA 4PYNA 3EMDA 3DH0A 3DMGA 3HCEA 4HH4A 4HTFB 1XDZA 4IV8A 4RTOA 5GM2A 5DX8A 4L7VA 4PGGA 5GP1A 5GIPE 4DKJA 4R6XA 1NE2A 1KP9A 2ZZKA 3LGAA 1WXXA 3KQSA 3G7UA 3P2KA 1I4WA 4M37A 3IEIA 3QV2A 5ICCA 3B7PA 4E33A 2GA9A 4PCAA 1TW3A 4RVFA 3CKKA 4E2WA 4E31A 3SSMA 1JG3A 5E1MA 3BWYA 1D2GA 3A26A 4QDKA 3TPZA 1PJQA 3CCFA 2ZFUA 4GQBA 5DPMA 3ANXA 2NXEA 4M38A 5K09A 5EC8A 1AQJA 3V8VA 2YXLA 1NV9A 3A7DA 5K0FA 4C07A 2IGTA 5EMJA 3K6RA 4FGZA 1WG8A 5FA8A 5HILA 4DQ0A 5EIWA 1KYZA 5T6BA 3FTEA 1I9GA 2CMGA 4CXMA 1ZGJA 3LDGA 2PVCA 5FTWA 1Q0SA 1JQEA 4C03A 5HFJA 3JWGA 1G38A 2HNKA 3LCUA 1YF3A 4R6WA 3NVMB 4F86A 1YFLA 2PY6A 2YQZA 3GGDA 4C04A 1KYQA 1RI2A 4A6DA 5E2BA 3SSNA 3EMBA 3TOSA 1BKYA 3NDIA 3FRHA 3QOXA 2BR3A 3D2LA 5GINE 2GS9A 5EHIA 2ZTHA 3MCZA 2YX1A 3HTXA 9MHTA 2VDVE 3C3YA 3EEYA 2AOWA 3FUTA 1F3LA 3B3FA 3KPUA 4IV0A 3ELYA 3DLIA 5D1NA 5KS2A 4GC9A 5DRTA 2H11A 4GBED 4XUEA 3DP7A 4RVHA 3UFBA 2XVAA 1UFKA 3KQTA 1SG9A 1SVUA 4G56A 5DTRA 3TM5A 1XDSA 3FUWA 3G88A 3MQ2A 1YUBA 2AN4A 3G2PA 5HIJA 3JWJA 2NNWB 3UJAA 3NMUF 4MHTA 3C6MA 1PJSA 5HZMA 3HCBA 2XYRA 3C3PA 3KR2A 2G70A 3M6XA 3B5IA 5EVJA 1OR8A 2XBMA 2B9EA 3E8SA 4KDRA 3THSA 3K0BA 3M33A 5KYGA 2H1RA 2ZIFA 4RWZA 4HC4A 3MTEA 3U81A 2IFTA 5EEHA 2ONYA 2VP3A 1UIRA 2BM8A 1L9KA 4P7JA 5E9WA 1D2HA 3GDHA 3EVBA 5CVJA 2JH9A 3T7RA 3NWEA 3TR6A 2CKDA
chains in the Genus database with same CATH superfamily
4C4AA 1GQEA 4FGKA 2FUCA 2CJXA 4HQLA 2WMOB 2WRZA 1NLMA 3G2KA 4I9GA 1I0LA 4LMAA 2QM3A 1U7DA 2W6MA 1CUXA 4CETA 1GDHA 2C7OA 4LV5B 1KYYA 4YUWA 5AVVA 4EY3A 5AVOA 1JFSA 3MT7A 1D6JA 4C2AA 5C8VA 2BKEA 3FWNA 2FZEA 2BBTA 4AW9A 5CCEA 4X65B 2VK1A 5ALXA 2CUTA 1E1KA 1IG0A 4CYMA 2HRCA 3GJ7A 1C0PA 5IK2A 2GGSA 4BO5A 1Y0BA 3G0OA 2L6MA 1QCDA 1LWOA 1TUEA 4LECA 4POOA 4F46A 1QQ6A 5HJ7A 4W5OA 2WK1A 1A8SA 3KDPA 3DULA 2SICE 4KFTA 2IOFA 4MQFA 1PFUA 3CO5A 5UKDA 1ZRMA 3O31A 1YR9A 3VR5A 2PKQP 2V45A 4X1YB 4ZMSA 3H0EA 4J0JA 4OHRA 4RVCA 4EKNB 3UGQA 1UFRA 2MTBA 1A9QA 1T2UA 2Z9BA 5CIWA 1F0NA 3Q3JB 1COWD 1JQBA 4MRSA 3KQOA 1GPWB 2FP4A 1RI5A 4CI9A 2ES4A 3P96A 2D8AA 2EQ1A 2PLAA 4I9UA 1KJQA 4PS0A 3GELA 1VKRA 3OEHA 3TQQA 2EKBA 4RBNA 4CUZA 4KCGA 2ZTUA 2ASVA 1AAYA 2B3TA 3H2JA 3QX8A 4JYAE 5I01A 4J3JA 4W5QA 5A5GA 4W1SA 1YRBA 5B1EA 2RHOA 3O91A 4JC0A 3V97A 1Z22A 4LPKA 3RK0A 5JJ5A 1PVVA 1JWAB 1OV6A 5KHAA 4YCAA 3AWDA 4ER0A 3BWXA 4IDCA 2W2QA 1QKJA 1OHHA 2C9CA 3HB7A 4IWNA 2DB3A 3CNQS 2XRYA 3M6IA 5IC6A 4IJVA 1RFLA 1C30A 2AI2A 5EKXA 3LXUX 1ISFA 3IAEA 1SBNE 1SUFA 2PEZA 2GAFA 3C7TA 3LTNC 4MS1B 1H3FA 2DG2A 2F62A 1WF3A 4C9BA 1R0SA 1GGFA 2H5JA 2QAGB 4TTPA 3N5CA 1O89A 1ZM2A 3I5UA 3AYZB 3NHBA 3UCFA 1BKDR 4ZAFA 4HNHA 5BN1A 2H1VA 3MJHA 4YLEA 1RYMA 3L1JA 3ZOKA 3CE9A 3BILA 3IEUA 4M1YA 2HYDA 3HCDA 4EGSA 1WKVA 1VFNA 2EFGA 3JWIA 1H5UA 3WRXA 1D09A 3VYYA 2CFSA 1SXJE 5REQA 3IV7A 3KKOA 4KR6A 3O93A 1W7AA 1O5IA 3ANSA 1RHJA 1B0PA 3A9CA 4L0QA 5SZIA 3WK6A 3FGPA 4EO4A 3ORQA 1U8AA 2OCDA 3GFVA 3IHLA 4YQYA 3MXOA 3IDZA 3O5AA 3SP1A 2IXBA 3T5BA 2HXGA 4ONEA 5HIIA 2LDBA 3QU4A 5K0BA 3U7HB 1FU8A 1NKTA 1Y8QB 3DF7A 1N0IA 4ALKA 2NXJA 3VHTB 2NYAA 3A1DA 4IJKA 4A0QA 2P77A 3MF4A 5IJ9B 2IIQA 1E0DA 2H57A 4R8VA 4R9SA 3WICA 3WJAA 4XVUA 3FYDA 4ENRA 1XG5A 1XLUA 1WABA 2CT1A 1LJ8A 1V48A 1ODKA 3AESA 3EIEA 2EERA 1FPQA 3CR7A 1R6AA 3EH1A 3FXAA 4TL8A 1K5HA 1NHGA 5IM4F 4GKBA 4D6XA 2VJQA 5IS2A 1Q74A 3DV0B 3TSAA 4BB0A 2R44A 3G8DA 4PWYA 3VC2A 4EUEA 1WZ2A 4P5PA 3R3XA 5EUMA 1ZBDA 1XNQB 4ZREA 3HJAA 1WETA 3E22A 1YA8A 3W5AA 2I91A 1ACJA 2RG1A 3HC7A 2IS6A 3BSFA 4P0PB 4U1RA 4G84A 3PCRB 2Q0XA 3KPWA 1RWBA 2ZRMA 1YH3A 2XQGA 4EG4A 1J2EA 2E7ZA 1T38A 1WZNA 4ZVKA 2HCJB 2AN9A 2OFXA 4GZNC 1I33A 3LBFA 2NXNA 2V6GA 4I8IA 2W4QA 4DC0A 3TIVA 1QYIA 2I3AA 5JY6A 3R6WA 1TA0A 4PVDA 4Y6OA 2CUKA 4YMUA 2NUEA 1JYFA 4YDHB 1F7UA 2GTIA 3N2EA 4UATA 4U2BA 2ZCVA 1CUIA 1NVEA 1VL2A 3FBWA 5EY5B 2MMCA 1H65A 1TPZA 3DCNA 3FFXA 4PC3A 4QTUB 3ZLTA 2HHHB 4J1NA 4Q9DA 4IBOA 2FYTA 1GQ2A 4XWTA 5F5XA 1ZEMA 2YMQA 2H48A 4DR3E 4HS4A 4K3VA 4M4SA 1KVUA 5T57A 3ZBQA 1L3CA 4QPCA 5TPWA 3FM9A 1EM6A 1THTA 1TKBA 5LA6A 1W96A 3ZGOA 2ET6A 1Y3CE 4MV7A 1BCRB 1JLLA 1JLKA 4ZV7A 5BSTA 3LC2O 1MHTA 2ZJ8A 2JLZA 4LKOA 5LYJB 2ORIA 1D8TA 3DUWA 4ZT7A 5IYZB 1XDBA 3EH2A 3NPAA 4EYOA 4G1UC 4OYYA 4WH0A 3W34A 4W5NA 2EWLA 4M9CA 1I4LD 2CEKA 4LF4E 3KAPA 4PSDA 2ST1A 4P58A 4Q00A 5HBGA 4BEBA 4AKIA 4XD7A 1U04A 3N9IA 3P9ZA 2W6JA 1YYOA 4ZHQB 2CFRA 1THGA 2B34A 2Y6UA 1QPBA 4MVJG 2FFBA 1RQ7A 1M6NA 2WWHA 3KFLA 4TTRA 3DMPA 3ZG6A 4CNBA 4E13A 3OD5A 5KJ1A 1K2VN 2XB6A 1O96B 4D3XA 1JFFB 1R8XA 2IY9A 2VAPA 4OA8A 5JQGF 5KDOA 3HI6A 3IKLA 1HEUA 1DKRA 5EPEA 4CODB 4N0DA 4IO0A 4R51A 3PNLA 1N2JA 4DWJA 3C74A 3NMUF 4YTEA 2B7LA 2OYRA 4AMVA 1ID8A 3HKEB 3TXXA 4ZVPA 3SS9X 1H6AA 5EJMA 4IIJA 4B4KA 2HSEA 3BTOA 5DNYB 4Q1BA 4WFJA 2FPMA 1ATZA 3RRJA 1UOOA 1YI1A 1YU9A 3ETDA 4BNIA 1X6EA 2EDAA 2PU7A 2HO5A 3L05A 4AZTA 3V1NA 1QRSA 1S2LA 2I55A 1E1MA 3ENVA 2DQSA 3K0AA 3FAKA 1CZNA 3AQIA 4F04A 2YZGA 4AN1A 2L2KB 1PWXA 1Z4KA 1NR5A 3O8QB 4J7XA 4R4JA 4RZ3A 1UIMA 1JAYA 3JQQA 5U4QA 3KLOA 4DLYA 1G1MA 2IZ1A 3IMEA 3JQPA 5FH9A 3HFSA 1NCSA 4Y2PA 5D5PA 3ZWXA 2EM4A 5JPDA 2VCHA 2YUIA 5EP2A 1RQPA 3GJ6A 2Z1DA 3E5MA 3CG0A 3STTA 3WDSA 4ABYA 1B41A 4EHJA 1U3UA 5A5FA 3ER6A 3OUTA 4NBWA 4F3NA 4HG2A 5A1TA 2VZEA 1RWQA 5D8DA 2OHIA 3M3PA 1GA4A 3HR7A 3AB8A 4BV3A 5M2QA 4RTQA 2XZDA 2AG5A 2VUTA 3H87A 3MHSC 2VSXA 4RY8A 1HZZA 3P4UA 2HQOA 1JQAA 3UHJA 5A5DA 5KTPA 1B1AA 3HUUA 4UUBA 3U4QB 4TLDA 3RS7A 1DC5A 4J03A 1UC4B 3KFVA 2O1XA 3WLRA 4DYDA 2DYKA 2NU6B 2X7XA 3KQYA 1LC0A 3QG5C 2VDMB 3U0VA 5IN4A 2G80A 1EDDA 4OUDB 4YBZA 1BS2A 2H7YA 1A77A 3IR7A 1JDNA 2NO6A 3OOSA 4DV1E 3BM5A 2ZQ5A 4QTZA 5KZMB 4YUYA 3ECCA 3A4YA 3HN7A 3M70A 4PNEA 5LD2B 2I99A 3KJHA 3K9FC 1IY2A 5DGTA 3DZGA 5EE1A 3A9SA 3NJ8A 4DAOA 4FZ3A 1D8AA 2AOTA 2RDMA 1CR2A 3QSGA 2YTFA 4ANFA 2JNWA 4KK3A 4G23A 2GHIA 3OE1A 1DAGA 4OHBA 3Q3VA 3WDLA 2WM9B 1S8FA 3KYBA 1Z3IX 2EFEB 3A9RA 3E9EA 1YZUA 1XCOA 3TDMA 4EUFA 1QMGA 1L7DA 1CJCA 2CW5A 3L77A 4UHJA 2PGOA 1SC9A 2V7PA 4Y30A 4GRAA 3R7DA 4L51A 4TUYF 3QKRA 1TVKB 3AONB 1ORIA 2YWXA 1RTTA 5ALJA 1AZWA 5CXUA 3TFOA 4LXYA 3SM3A 1N2CA 4PXYA 3DZKA 4CKCA 1UKBA 3VKGA 3EQZA 3QUSA 3KAKA 2XE4A 2PO5A 2GAIA 2VUIB 3Q7RA 1ST2A 1UANA 4GE3A 1CY2A 4U6NA 4QVGA 5HFAA 3RHTA 3TX6A 4DDKA 1WO8A 2WJGA 3B7GA 2I4IA 4FVTA 5DRYA 4CFZA 2BEJA 5G4KA 2VWHA 3TLGB 1ISHA 4D57A 3D43A 1N3LA 3QSYA 3F67A 3K6SB 1IWPB 1S1CA 1TEXA 3PDHA 4HXYA 3PSHA 1JEYB 5DNVA 5I9TA 5KWSA 1UM8A 3CJQA 3LBHA 5AVJA 1KK1A 2VYCA 1G291 2C54A 2ZYUX 3I04A 1PFYA 2GN0A 4FWBA 3V1YA 2I2CA 2I3DA 1BD3A 4A8JA 3V34A 3IUEA 1IQ0A 5JOQA 5INTA 2CK3D 2CMKA 2H8KA 3BIWA 2OY0A 4AP6A 5JLJA 2B9VA 5K3OA 3LUDA 1QF7A 4U39A 4O4JB 4GIBA 1NRIA 4E0BA 1Z6GA 4Z54A 3NV7A 3HRIA 2EJUA 4DF3A 1SPXA 3P4YA 2WFAA 5C7IO 3ZQUA 3L9XA 3EVEA 1VE6A 4RKRA 2D5CA 3C15C 3EVDA 3KZKA 4NOLA 1FKAE 4ID9A 4O4IA 3MCTA 4G2NA 5CCXA 3R7SA 4CG1A 1NF9A 3GVCA 5KOJB 3IJ5A 4CEIB 4QGBA 1Q0ZA 2WJ6A 1FFHA 3PZRA 5FBZA 2M1ZA 4F4UA 3KEOA 4NENB 4DWVA 3E7WA 1B4DA 1T2VA 3JW8A 5IKPA 4OJKA 3UAGA 1E8NA 4RVUA 1G60A 1JHZA 3DOJA 3MTIA 5EMKA 4Z1MD 4BEJA 4F97A 5LKRA 3NU1A 1WW3A 2P5UA 3RTAA 4D81A 2X0RA 3JD1A 1BBOA 1OYOA 4IDAA 5LN1A 2C04A 5DKFA 1R4NB 2R8PA 3E23A 5KSWB 2PXXA 5EUCA 4KWHA 3AIKA 3LIIA 2HIAA 4DR2E 3MG9A 4FOSA 1Q95A 4FI3F 5HM8A 2FPKA 2W2LA 2DU8A 1XTVA 3HUTA 3RYTC 4F9FA 4LI3X 4B6SA 4DA8A 2FPSA 5JWOA 1KARA 1XX6A 2WHQA 4M9XA 4MI1A 2FMTA 2HR1A 3SYRA 1HGXA 1IN6A 4JBHA 1V1MB 3DPSA 1WTCA 3OCVA 3ZV5A 3DB1A 4MVJD 4MAAA 1XFDA 2JLQA 4WNAB 2JBHA 4JB3A 5ALEA 1YSAC 3ZV4A 5FOUA 2Y2UA 1EA7A 3LH5A 3FTNA 3DUFA 4E4RA 1WAMA 3HCEA 3QV1A 1KJNA 2J6CA 1W2GA 3D81A 2OENG 4L73A 3AV0A 3DE2X 5E0OA 4R6XA 2CN1A 3NKLA 5F76A 1M66A 5BWCA 1L7OA 2ZZKA 3T3EA 4MQUA 3RFUA 3LX8A 4YJDA 3PR2B 3IEIA 2VF1A 1CBUA 4PFJA 4UAGA 3UFXA 3ZCVA 1BWPA 3L41A 1R6UA 3LXMA 1JG3A 2BFEA 3PI7A 3IKJA 4MIYA 3N76A 3PXEA 1OLXA 1NR7A 1V3VA 1ZI9A 5AXAA 4AYTA 3K0SA 2GF9A 1FRVA 1U3CA 4GQBA 1ZI8A 1VCOA 1LKZA 4GBJA 3ETNA 1X77A 3PPYA 4PXAA 1OFVA 4XGQA 4PXSA 5LC1A 2ZPAA 5TIIA 3UAYA 1XT6A 3MOGA 2ID9A 2ZTLA 5HILA 1XO1A 3FHOA 1R8SA 3J7AG 3OT1A 2UVDA 4PHHA 3W6UA 2FWNA 3M9LA 3ZJYA 4BMYA 3U09A 3C6BA 2C4NA 1J25A 1FFBA 3PLRA 3WGQA 4Z9YA 1B6RA 5L4NA 2EBUA 1EVYA 1PTJC 2GSWA 2ECFA 3AR8A 3PXDA 5DDIP 3G5AA 3L4KA 1T3SA 3ZJ4A 1Z33A 3IEVA 4KO2S 5YASA 3U6BA 2A59A 3K8YA 4FK8A 4LZOA 5B36A 3PA8A 3ZQJA 4ICIA 4DRXB 3FRHA 3ZZTA 3CM0A 1HDRA 3TO5A 2DECA 1QWOA 4HZIA 1EQ2A 4HAUA 1JJVA 2GS9A 2YVQA 3K09A 4L28A 4F4HA 4FKZA 2BUAA 4LYGA 4QNNA 5CB4B 4RULA 1EFDN 1LSSA 1QPGA 1TVMA 2C7BA 2DFDA 2Z3VA 3GRPA 2IEIA 1FQKA 2A2ZA 2C84A 4TQAA 1HEIA 3TMKA 3ELYA 4IFTA 4GEQB 4JI7E 2CB9A 4KYVA 1J2UA 4L5YA 5DRTA 1UBUS 1VC2A 5D3MA 3HR4A 4BMSA 1NBEA 1P4JA 2ONKA 5DTRA 4DLTA 4W63A 1D04A 1U5AA 1RQXA 5KNBD 3AF4A 1FMCA 1R15A 2LCIA 3UJAA 4NBLA 1RAGA 4MHTA 5LIRA 4UUMA 1TO2E 1Y7LA 3IA7A 4I5EA 4GFDA 2Z8XA 4OGFA 5ARCA 4NMHA 3WAGA 3WJ7A 2ON6A 1RWXA 1Z73A 1CUWA 2QRZA 1VPWA 2XBMA 3AIOA 2D5BA 2OP1A 2QYSA 1LEHA 1MX5A 1FX1A 3PEUA 1PNQA 1K8YB 3QX9A 3AVWA 3AFNA 1NL3A 4GPD1 1P4HA 1NBMA 4HC4A 1MD9A 4HYTA 5H68A 4DGSA 3L04A 2Q5FA 3A3NA 2R1TA 2E4ZA 1C3VA 1H1LB 3HEAA 5AOBA 1VDMA 1EFPB 5EEHA 3QBJA 2G7HA 1W0JD 4G85A 2DGCA 4QA9A 3T3PB 5CVJA 1X3LA 1WU8A 2XGMA 1J0DA 5EZ6B 4D43A 5F1KA 3SYNA 4MV9A 1MX9A 3ROKA 4HWTA 1A76A 1OB2A 2P90A 2I2DA 2ROQA 1EG7A 4QFDA 1L5ZA 3HLYA 3SYMA 1PX0A 2W0MA 4H7HA 2WF6A 3I28A 3BJMA 3RIHA 3B6KA 2EJVA 3OU2A 3WJ2A 3L6RA 2VN8A 4XR9A 3I9JA 2ZJFA 1ZN2A 1K4MA 2YFQA 3CNEA 4H18A 1G2IA 3TRDA 4ALNA 2J9FB 1TCAA 1IN4A 4G5XA 4BZZA 3G0BA 4O2BF 3TFQA 2DRIA 1ISRA 2O2XA 5CK4A 5BVGB 3ROMA 4MKIA 3NC1C 4OOFA 2H3HA 5JSKA 4HQ0A 5MGBA 3GY0A 1IY0A 1X1SA 1Z47A 3C3EA 3A4TA 2Q4TA 1DAPA 3MJFA 3AM5A 4NFYA 1T8WA 4IOLA 2IUFA 3Q12A 1YJ5A 4JU8A 4XI9A 2ERCA 3VZPA 1XMXA 2IZ7A 1W1WA 1EFAA 3DJWA 4QQNA 5TB5A 4YJ2A 1KI7A 3ZH2A 4DM3A 5C8YF 2C61A 5B2ZA 3PUIA 4YMTA 4Y7CA 3ETLA 4ZJZA 4B3DA 4WVLA 5I9NA 4AKGA 2Q8UA 3AEQB 2C2HA 1W30A 3VZCA 1IUPA 2BKVA 4V1CB 4EA7A 2BWJA 2RHBA 3SQDA 2XE6A 3IOMA 3SC2B 2WPDD 1SQSA 3C3WA 4JBGA 1HE8B 4B32A 4CE6A 4D8UA 2ZAOA 4EFDA 2AN1A 3TWOA 5IZCC 3V4PB 1XUOA 1IBCA 1BIFA 1ODCA 1KH3A 3VAZA 1XVIA 1HE4A 1G4HA 4P7FA 3GD7A 3WKAA 3X1MA 4I2VA 4IMRA 4CG2A 5EIHA 5KOHB 1BVRA 3JZAA 4RF3A 2PFGA 2D1YA 4C88A 2O8EB 1KU0A 4HHEA 1DC4A 2R48A 1QRUA 4J07A 3ZCXA 3H42B 2CSUA 3MGGA 3PB3A 3SIXA 3HU1A 1Z6QA 1N0HA 3H2ZA 1DBIA 1T9DA 2HDOA 3DBRB 4HB4A 1YQTA 1ZGAA 2IYPA 2EX1A 2KM1A 4B80A 3BAZA 1MJ5A 4IHJB 2WKSA 3SVLA 3LLVA 4GKAA 3NC0C 2X1HA 2B5WA 3WLFA 1KFKB 4O25A 5C0OE 1U6IA 2A7XA 2H1OA 5ALGA 5DX0A 3WLAA 1BOOA 3GCDA 2OO3A 2VSFA 4MW5A 3EOZA 4B3BA 1Z5PA 4QDJA 4ZDJA 3FCUB 4MRMB 1AO3A 2A0FA 2E48A 2YNMA 1CDDA 1L4HA 1KH2A 2AFHA 2HMWA 2YOGA 4HWKA 4S1NA 4TMKA 3DOOA 1R50A 3D3KA 4L3OA 2QN7A 5KKCA 1KJKA 1XP8A 4CWAA 3F1KA 5CLIA 5FNVB 1H3EA 1ESEA 1GT91 3AH8A 1L5KA 3QVGB 1RKBA 2B8JA 4JX9A 4N54A 1K4YA 1UT8A 4Z7JA 2OFFA 2HA3A 4EHHA 2J3IA 2PKQO 2R7AA 1DBWA 2RBEA 1IG3A 1NVGA 1U8YA 3KL4A 4OXIA 9LDBA 4MUEA 1ZH6A 5AKEA 5FYDA 3IJRA 2L33A 2VT6A 3KAJA 1NQVA 3EXHB 2XUIA 3D31A 3Q88A 3AUSA 4JB0A 4CEJB 1MT3A 1Q44A 2CD7A 2I7TA 3PC7A 2VF8A 2MDTA 5CH8A 4GL2A 4N0PA 5DZSA 2WJYA 4RF4A 3RJZA 3S7ZA 3Q6MA 5ALOA 4CQJA 3TECE 1SBTA 2XMZA 1SD1A 2J3EA 2LDXA 3M3HA 3P2EA 4Q9LA 1QOZA 5JAQA 2D1RA 2ZJ6A 3DMHA 5AW1A 1SULA 3RO7A 3FVRA 3FIJA 1JJFA 1QO7A 4BOYA 1WEHA 2XRFA 3IYLW 4GI2A 4TV9A 1G64A 3N59A 4S0XA 2BP7A 2QTVA 2Y1CA 1TPYA 2EJWA 4KFUA 1SK9A 2EZUA 3UC5A 3AW9A 4DBVO 3PGA1 1FMJA 2ZTVA 4J75A 4MKFA 4F1KA 1I3NA 2LKDA 3EZGA 5THQA 3IESA 3GFSA 4BMZA 5TLSA 1O08A 1TTQB 3HUEA 3BOSA 3G2MA 2WD7A 3FZNA 2ZRQA 3K5PA 3TD9A 1G20E 2G5PA 4FZRA 4YC7A 1DAEA 2R4QA 3PHJA 3PNPA 1Y4DE 1A9XB 2QL7A 3A28A 4IIEA 3AR4A 1IXKA 4WOKA 2OLKA 4KMRA 1N9ZA 3B1WA 3URMA 2A88A 4G0OA 1A1IA 1HY3A 3DBHB 4BIIA 4IZ6A 4IX1A 3LA6A 1DCMA 2XGGA 1BN6A 3AIIA 4EKIA 4PYJA 1B8VA 1N3GA 1AQ6A 2W70A 4RANA 1T9GS 4V24A 1Z6AA 3B9BA 3NEJA 1T15A 3ELWA 1WHQA 1J9ZA 1NW3A 5KX5A 3QHAA 4RFVA 1DAHA 4UNQA 1VMIA 2A67A 3T1TA 2A5YB 4S12A 4Q4DA 2VQDA 4QYIB 5JH7B 4DR6B 4BPRA 2RI1A 1GAWA 2FEAA 3A32A 3TRJA 1Q16A 1KJ9A 1XLVA 1H8EA 1KZ1A 4KZPA 3G23A 4TS4A 4WKNA 5EHGA 2IS4A 1PDAA 2I65A 4BZXA 2O5EA 4Q12A 1VRVA 4BRUA 1WQ4A 1I9CA 2FQQA 2L19A 3DNPA 4ZZ2A 2Q1XA 4PQRA 3AVVA 4RADA 4YA6A 4E4TA 2AFIE 4ZI7F 1BXGA 3F6YA 5KJEA 4AL4A 3D7MA 5B1SA 3NJ4A 4M6WA 2HSJA 3QXHA 1YR3A 1IJFA 2W7TA 2QV0A 1RNLA 3QBVA 4HB3A 1YBAA 2HL6A 4OI4A 5JW6A 5JUWA 1BKSB 1UBLS 1FTYA 1I2BA 2HHHE 1MC8A 4B71A 4M0CA 3T54A 3VC3A 5DASA 3BQ9A 4C4RA 1NPTO 3HACA 4F11A 4Q7LA 3NT4A 1IUNA 2HFKA 3OI7A 4IDEA 1GLGA 4J0CA 3CIFA 4XDYA 3ZXIA 4QKQA 1H2HA 4R31A 4BLUA 3WGYA 4DB4A 4KH0A 1MVNA 4NV3A 2YRWA 5AUPB 5ILQA 4BV8A 3ZHVA 4Q21A 4QWWA 4JL6A 3BL6A 4Y6QA 2GHQA 3NBMA 5ALYA 4NK5A 3T3MB 4LX8A 3T1VA 3DHEA 3ESQA 3ABSB 5I7AA 4ETMA 1T8RA 3SQXA 3MILA 1CQZA 2B4RO 2EG5A 2Q3EA 5T67A 3SBOA 5CX4A 5LP1A 1D3AA 1THZA 1CV2A 2XQJA 3G8BA 3EZFA 3NO4A 3OY2A 5E7JA 1IQUA 5E4YA 1AB5A 1HYQA 4B9EA 1I94B 1HSOA 2P68A 3HP1A 5FI1B 1Y6QA 1X0VA 3L1HA 2QHXA 2VATA 2EBWA 1WXDA 5KDLA 5BR8B 2O4UX 5AASA 1UDRA 1IZZA 4H1HA 4IR7A 4LXQA 1QFZA 1R7RA 2BDEA 4BX2A 2QL6A 1DLIA 4MQFB 1KDVA 5JTTA 1AGYA 4YXFA 4RTSA 4R2DA 3Q7TA 4RJLA 1RXWA 2H7XA 3AF3A 3GR6A 4JYBA 2W43A 4BKUA 4EJSB 5DYIA 3E6AA 1H2ZA 3GCXA 5A2GA 3AVPA 3BB1A 3BIOA 2BE7A 3AO0B 1N9KA 3PPXA 1SVSA 3A1UA 3H5LA 4RNCA 3R0IA 1T1IA 3L0IB 4HDKA 5P21A 3CSUA 3P9CA 2IYVA 4D8XA 5E7IA 3K9QO 2ZR0A 3EDMA 1GAEO 3HB5X 2CWDA 3A3YA 3IUYA 1RP7A 3GYBA 2V89A 1U2EA 4HGYA 3DZJA 4NOKA 1RLIA 2WNHA 2QT0A 4OMUA 4Y2JA 3DKPA 2QRPA 1DAFA 3F7TA 4YAJA 5JANA 5LZ4A 4AY6A 1NVFA 4DFDA 4KR3A 1DJQA 1SXGA 1YVPA 3FSGA 1XDWA 2IHTA 2JA1A 3OJ0A 4DLLA 4ZCTA 1XRPA 4GEKA 5FPTA 2O1EA 5FUBA 4IUBS 1GG5A 1ZDMA 3BDVA 3JQGB 4ND3A 5HKLA 3RTCA 1JV2B 4HK4A 5DM1A 2CFOA 5I7UA 4MYTA 3LDUA 3GLFE 1DOAA 1IMJA 3PTLA 4FILA 2BELA 3CVUA 4C14A 5HW0A 5FEMA 2D7DA 3MHPA 2B1IA 2W37A 1RVV1 5EJ7A 1L4BA 3AEKB 1EB9A 2WVGA 1AMUA 2O06A 3H83A 3QF7A 4K9KA 3FR8A 2NA2A 3JWHA 1HLGA 1URPA 4G4SP 4A8PA 3COJA 1NMSA 4KWYA 4P7KA 4P78A 5CB4A 3THNA 2WMYA 2WFMA 4HPWA 2OBBA 2PZMA 1IU9A 3FPKA 4HDRB 2QG4A 2YTZA 2X19A 2PT7A 4PC7A 4S3MA 4HB2A 5C1OA 5A1JA 5LR6A 3ACDA 1HC7A 1KO1A 1NMZA 3EGEA 4K9SA 1T1SA 3OU6A 5F2KA 2CV1A 4MW1A 4BFXA 1NWCA 3CKYA 2CFCA 3NZEA 2J3DA 5MFPA 4EZIA 1EK0A 1Z7BA 1X9HA 1QH1A 2PZBA 3IOYA 4FYKA 5FPYA 4YR7A 5HKOA 1H2EA 1TYZA 2YYAA 2ZIXB 4DUZB 2DXIA 4I5GA 3K16A 2CZGA 3D0OA 3NHZA 2I4TA 3O73A 3VO2A 1BW9B 1VA4A 1H2YA 3RG2A 1V26A 4H3VA 1QX4A 5JU6A 3MTGA 4JSYA 1AA9A 4K87A 1FXUA 1NAHA 3E8MA 1BRTA 4S1OA 3GQBB 1T5HX 5AJHA 5T4EA 3S70A 5DXJA 1XZEA 4TM7A 4Z1OA 2QBYA 4MYUA 1VPVA 1YE5A 4PO3X 1I2ZA 2QRMA 3GJ0A 4QNRA 3HDQA 2DBYA 1A9TA 2OBLA 2Q1TA 1MU0A 1CR4A 4BIMA 1HQCA 3FI0A 4TMFA 2A0KA 4RKYA 1DZIA 2GPIA 5JO9A 3KB8A 3IAUA 4FT4A 2IXTA 2GM5A 3CMCO 1X0XA 2JG3A 1SIWA 1FLDA 2UZ0A 2KQUA 4IDHA 1FYXA 3T1HE 2DR0A 4B4UA 5H3HA 3RVSA 1KAGA 1V11B 4HTGA 5TRTA 3RANA 2QMOA 2J67A 3LP8A 1JR6A 1Z0KA 2HIGA 1I30A 4FNGA 1INLA 2CE2X 5JYCA 2Y1KA 2VLBA 2I2AA 3LCVB 3CPJB 1I2DA 1P6XA 1NI3A 1V7PC 3N0RA 4NESA 4MKZA 4MINA 2YR0A 1PSZA 2X6QA 1R9JA 1ES9A 4YRCA 3ZXUB 4ARSA 1X6HA 3H0KA 5K3BA 2JWOA 1ZGBA 2WP0A 3I8XA 3MLAA 4WKBA 4N5NA 3KT6A 4GZ5A 2O3JA 4KPEC 4QOIA 3HWWA 2QRHA 3QG5A 4EHKA 2WT9A 1QH8A 1RZVA 4RGBA 2EPAA 5AOVA 4JLSA 3WRYC 1B0UA 4P38A 4LJAA 1Q0HA 1EIWA 2LVBA 4INZA 4OJTA 1A1FA 3HA3A 4B0OA 5LWQA 4B46A 5JFTA 2XD4A 1UODA 3PNVA 2QG6A 4BFCA 2R7NA 3LPDA 2C5LA 3PU6A 4H6XA 3FDZA 5H9WA 3MW8A 3V2GA 2HWXA 1DQPA 2VF7A 4BDSA 5BMVB 2OAEA 2O2YA 3A9VA 3PX3A 1IPHA 4OREX 3K32A 3WGIA 3CLKA 3U16A 3DM9B 2ZM6B 3SLGA 1DJPA 2YV2A 1C8VB 3DFMA 1QV6A 2ZJ2A 3UO8B 4RTOA 2VHZA 2QD5A 3GLSA 3MNFA 3UEOA 3IPAA 4P1ZA 2ZUSA 4BP9A 3V33A 4DARA 2QR3A 5T4HA 1TK2A 1FTWA 4AJ4A 3SHWA 4Q0MA 3NWJA 1JFVA 2E3JA 3AUJB 3IQZA 2GA9A 3KSMA 2CLLB 2X5NA 5K4GA 4I5FA 3SM9A 5E1MA 1D2GA 2XUOA 1LPAB 2Q7OE 1P9RA 1X13A 3PUKA 5H0IA 3S3TA 2EEZA 2NZ8A 3U40A 1NJGA 2X3FA 3IR5A 4QRHA 4COKA 4K8OA 1F8XA 3U7QB 4WKGA 4A1OA 5BMOA 1BDHA 2ZS8A 1SVOA 2B0JA 3AEZA 4JSRA 5M29A 3K5WA 1LPNA 2PMKA 2JFGA 1EFCA 4G1CA 3WV4A 4MDYA 1Y1PA 1G8JA 1FYFA 4OQFA 4BKMA 1I9GA 4UM9D 3SICE 3BFPA 3GFGA 4UCXA 4MUXA 4NFHA 2BAGA 4MUNA 5ABPA 2D0OB 1WV0A 1W87A 1ZN7A 2HIHA 2R87A 1WCIA 1EK2A 4UASA 3SEQA 2EZTA 5EE5B 1S2IA 3BIDA 3TQMA 3GK3A 2O2CA 3IPYA 3MFYA 3QENA 5ESRA 3KJEA 3VU9B 3GVHA 1RXUA 2ZBGA 1YCHA 1J99A 1Z2AA 1GTJ1 2AZDA 2IHUA 2Z58A 1XTUA 3EMBA 3C8DA 2X0DA 1C2TA 4FYWA 4DCTA 3TRIA 1P31A 3IPCA 1TZCA 4DJTA 5LJLA 5A6KA 3I9V1 4IRUB 1EDZA 3UG6A 2DJIA 2HPHA 5IXMB 3H8WA 1QIMA 3EPRA 4YGXB 4C0HA 5MN6A 2Z3ZA 3LLHA 1E59A 1BFKA 1KBOA 4J7CA 1M8PA 4QHYA 3NASA 3TAHA 4D9HA 1F3LA 1KO8A 1VPEA 3KPUA 4OXYA 1R6XA 5EVCA 2OL4A 4QOFA 5AVZA 2GN9A 3VR4D 5J4KA 1YKSA 4XUEA 3W2IA 3MAJA 3OCCA 2ZUFA 1SVUA 3WB0A 4JBNA 3FYUB 4EY6A 3D8UA 3DAPA 2HT6A 4B3RE 3GLQA 1FSGA 4OQNA 3UUGA 2O2GA 3IFSA 3MQ2A 4HUTA 5DBIA 1N4DA 4KXYA 3FWYA 4XH9B 1MABA 4MV5A 4WJKB 1LX6A 3FGZA 4D45A 3VSDA 5DGCA 1J20A 3ZFOA 2Z4TA 4L5IA 1JIKA 3L0OA 4Q7EA 3EBPA 1TZ2A 2HA4A 1NUTA 3FMPB 2G7ZA 1RAFA 2KLHA 3ANNA 4QPZA 3OO0A 1H2WA 4V3CA 5FR1A 3RKSA 1SOVA 1T5SA 3R75A 5DHQA 2EDCA 1LNQA 2Z5LA 1CDOA 2OEPA 4JDPA 4M21A 1COWA 4RWZA 4KLZA 4XWYA 4URVR 2F3TA 1KZHA 4KRXA 3WA7A 4FOPA 1L1RA 4NCJA 2AA3A 1HQDA 3H86A 4NJOA 1SU6A 5C81A 2IODA 1AKMA 1T5DX 3WYEA 1CQPA 5U1PA 4A82A 2Q9UA 3IS3A 3C4TA 2Q3MA 3PD7A 4WLEA 1ZQ1A 2M1SA 2EPMX 3SZMA 1N32B 4F7WA 1N2IA 1Z06A 1W581 2IPMA 1ZVVA 1P33A 4TXLA 2XWQA 3CLHA 5IYZF 3UWPA 1QTQA 1W4AA 4RVDA 1PG2A 1JKIA 1LW7A 5SY4A 1QVAA 1R6BX 4W5JA 2VEDA 4PNZA 4TV8A 1UMCA 3KPYA 1N2CB 3X1YA 5D85A 1GP2A 5FQOA 1XZKA 2OHGA 5A6AA 2OPHA 2CBXA 4C0JA 4QXPA 1G4AE 4CIWA 4M9ZA 3ABZA 4K0KB 4R9RA 4ZHQF 3RI3A 3RWMB 2J4FA 4S35A 3RVKA 2IS1A 1GV1A 4TSKA 5DEOA 5FOXA 3DD5A 1X14A 3ZHZA 3E2PA 2V7GA 2OBMA 1SXPA 4BB5A 4EF4A 1VKJA 2H07A 3BRWD 4YMGA 2ZBRA 4TUGA 3SIPA 2AN5A 5D3QA 2NSHA 4EY4A 1V95A 4B7XA 3C8HA 5KHLB 4XTRA 1YNSA 1ZA1A 4M60A 3A05A 4WJZA 1KU6A 4A36A 3TF5A 1E2BA 4GF5A 4YLGA 2AKEA 2C8KA 3DO5A 2PX0A 4RXTA 1L5LA 1U7TA 8OHMA 4A8JB 1ND5A 2D1TA 2WM8A 3M9XA 5TS2A 1FJGE 4UMEA 1CT9A 1U7UA 2I2BA 1TAGA 3BIXA 2FE1A 3E1KA 2CV0A 3UJBA 5AC4A 1B6SA 2E21A 2GZSA 3OVMA 1QYCA 4BS9A 3FNIA 4LNUB 4LRWA 3QPAA 2H54A 5CFMA 4LAFA 5HHTA 1PTJA 3QHPA 4U7TB 2O3SA 3M4ZA 1VCNA 2E87A 3CVVA 2GZ2A 3L7JA 3M5DA 4DIMA 4WFTA 3OFNA 4U6SA 1Y3AA 5CLQA 2PWBA 5J1TB 1N4AA 4EX6A 3ITKA 3Q5EA 1VFPA 1E64A 1QE0A 1U0JA 1U99A 2CUNA 4XWAA 1XEWY 5BSEA 4LF9B 2VJYA 4RXMA 1L1EA 2N3GA 4LGVA 4FC6A 1UC8A 3CPEA 1ZJWA 1UZNA 2C5FA 2WBSA 2CZCA 5CDTA 1QB7A 5AVUA 2EW8A 2JL1A 2PS9A 3GEEA 3DFFA 3OHSX 4YONB 3UWDA 2NZYA 4IGEA 1EWRA 1U1CA 1U3WA 4K2AA 4EX7A 3GUZA 3AF0A 2JF0A 1QCZA 4GP6A 4GYYA 1YRLA 4TKLA 4ZHSA 4RMHA 2XSZD 4OQZA 1SVNA 3RKUA 3QW4B 3AGQA 1I01A 1UM9A 3VGPA 1S96A 2I71A 1JMYA 2PGDA 5HIAA 5DWVA 2WBUA 3WDKA 1WCXA 5BYJA 1U6JA 2BMEA 5SICE 4AD8A 3T94A 4B3IA 5GGXA 2YMLA 2HJGA 3NTXA 4QPNA 4ZVQA 1A9ZA 3Q9NA 1TQ8A 3T95A 1T8PA 4J4BA 4AWBA 1EQAA 2X9GA 3G17A 2EN2A 5ADVA 3H84A 4KE6A 2DHRA 3LY7A 4HGNA 2GZDA 3H9JA 2RGBA 2G17A 3QX7A 1K7XB 2E2WA 2XMPA 3D8SA 4RACA 3AHFA 1I3CA 2YHBA 3VXKA 4DY6A 2D5IA 5A6BD 3TMYA 5EIXA 4EHDA 1UDWA 1CNMA 1U8CB 2ACWA 4C7MA 3ADBA 2IOQA 2DH5A 3DT9A 1MHPA 4LF7B 3H1EA 1OC2A 4QOGA 4D0RA 3R0VA 3BK7A 3EFOA 4REQA 2DPHA 4AK9A 1O03A 3LP6A 4UPDA 1OKKD 3C8ZA 2R66A 1L5MA 5I51A 5CNKA 1KMQA 3IAXA 1RWMA 3BICA 3KEGA 4HPJB 1YQQA 4G0XA 2PO7A 2IYEA 1M1YB 1XTZA 2NWQA 5LU8A 1JFLA 2QGZA 2QA5A 4XE5A 3WAJA 4MDFA 3D2AA 1JDUA 2QTFA 2JK1A 1QHYA 4E6EA 1NX6A 2BVNA 4YRTA 2EG9A 4DCMA 4JOSA 2FPLA 4MS3A 1NMYA 4X9JA 1S0UA 4ZDWA 3UGKA 4GE0A 5BWOA 1T9GR 3F4BA 3PGXA 3QYPA 2W2XA 2AZ4A 4O1HA 2AMYA 4CL2A 3DEZA 4FHCA 2A92A 4LYHA 4B6OA 2E55A 1DADA 2ZI9A 2ZRLA 4HKTA 1XMSA 5G4LA 1NSYA 3T38A 5KUTA 5CB0A 5BQ3A 1F0PA 3LCJA 4IJMA 4OMFG 2FLKA 4TVKA 1I51A 4UE3S 4CUJA 3OZCA 4O4JF 1RZRD 4BJ6A 3G5MA 3X0DA 4YWJA 1F12A 1R10A 5ALHA 5E1OA 5JJKA 4A4DA 2RHGB 1YIOA 2Q5CA 4S1TA 1L5FA 4LSZA 5CT6A 5IVDA 2NACA 1XZNA 2XQKA 3QMVA 4WMLA 3SKVA 4M0KA 3ZBPA 5ICEA 5IZCA 1C7EA 1JBKA 2G28A 2UXBB 2CDCA 3CT4A 3ST7A 4D5EA 1UPTA 5HYVA 5K8CA 5LU9A 2CVPA 4D6YA 1CY6A 1S8NA 4QEKA 2VUHB 3FKJA 4FP9A 4KNVA 4LPSA 4M46A 4G0ZA 3QFFA 2WYIA 4IS2A 1E6EA 4RHTA 1OVGA 3ESCA 2YIDA 4OQDA 2YTOA 3HBNA 3ZCTA 3IEMA 5FFMA 2W2MA 1DAOA 3H05A 2HMAA 4IF4A 4ID3A 5D3MB 3U9TA 5KL4A 3EZ7A 3L49A 2A84A 3P94A 2IU0A 1YD7A 4KR0A 1Y8RB 1RXYA 3TQHA 2YWFA 3IIEA 3KR0A 5A4JA 3KJGA 1GDDA 1KK2A 2ZULA 5J2UA 1TMOA 1MIOB 3GG2A 4MVYA 2JCVA 3RYIB 1VGRA 3MOIA 1W5FA 1EUCB 1YQ9A 2J7PD 4P8RA 4V2IA 4UTVA 4X3PA 3KOWA 1KSFX 5ESXA 5L4LA 2ONZA 3RT1A 5JI2E 3R6LA 1GU0A 1EZZA 3BT7A 4HDSB 1XDUA 1FLAA 2Z95A 3DE6X 1WP9A 5CHYA 4ROSA 3CZRA 2OQVA 1JKMA 2G8LA 1JE1A 5P8WA 4A16A 4B6EA 4B74A 3ETEA 3VJRA 3F5DA 4XJSA 3R24A 3AUFA 3AUZA 1XAIA 2H4WA 1NG9A 1EFTA 4V0QA 4B5KA 1VYTA 1EAYA 2AXQA 4LHEA 2Z2XA 2Q7DA 3Q8XB 4MHOA 3ZGZA 5LMZA 1WMBA 2GNPA 4L9WA 1XJ0A 2WYUA 1V5FA 1U7XA 1MAUA 1KXZA 5CK5A 3PITA 7MDHA 1WDWB 1WHSB 2VHEA 3S2ZA 5CA1B 4ARIA 3OZDA 1WMDA 4FHGA 4B40A 1M2WA 1I5OA 5K7SA 1MLDA 2BT4A 2C96A 2CB0A 2C9YA 1EPUA 4K7JA 1EGQA 4FU0A 1VLQA 4BZWA 3L7IA 1F20A 3BWMA 3NHRA 4EPXA 3GX1A 3AETA 1AURA 1P1HA 1T24A 3K31A 1P7PA 3MGCA 3NBAA 5EQFA 5C31A 1G4UR 1ZVJA 2OMEA 2R8ZA 2CD9A 5IW8A 3T9BA 4C6TA 1Q2UA 2GLTA 5FKJA 7REQA 1DG1G 2VZLA 3MWDB 4C4SA 3FNHA 1GUZA 1QLWA 3ADOA 3P0HA 4UXIA 5J40A 2F4VB 4B3ME 5ARDA 2OQ2A 4CL3A 2QLBA 3KZZA 5EFOA 3FOWA 4IWYA 1H0RA 3ZGLA 1Z0UA 3LC0A 4KQIA 1T2NA 4MLDA 1X94A 1UINA 2YTEA 2I1QA 2X5XA 4D79A 3DL4A 4OOGC 3L4JA 5JCOC 2BZGA 2R9VA 1YK1A 5ELLA 1HXHA 2ZUDA 5L6LB 2F8SA 4JL5A 1L4LA 2WA1A 3PFGA 1VOTA 4IFBA 3BDAA 5LPNA 3AVQA 4AO7A 1E69A 1PR6A 4H7EA 4WYQB 2F43A 4MR9A 3DF9A 3OM1A 1LWNA 4CUKA 4MROA 3LUJA 4JL8A 4MGZR 4PIVA 4E5KA 5LQCA 2ZSHA 1NUPA 5HJ5A 4CM4B 1JX6A 4LCEA 2EOIA 4UHHA 3TW0A 3ZCPA 4BLSA 3TDKA 4CM8A 2JEOA 4YUXA 1N0WA 3HL0A 5AVQA 3U3RA 4BLWA 4KE8A 3SCZA 1CJKC 1XTQA 2JFNA 1B16A 1AY0A 1P2TA 1ETHA 5K05A 3K53A 1MEOA 2JD2A 3DL2A 4NNJA 4HRYA 3TVDA 1BGVA 4QSHA 2ZI3A 3TIIA 2H0RA 2IQIA 2BFFA 4PAGA 4PX2A 1U1EA 2YOFA 5E6RB 2XI4A 1OLOA 3MTBA 5EP1A 1FSSA 3INYA 1T4NA 4REOA 3ZV3A 2ZRKA 4Z1MA 1XWFA 2OCYC 2WVJA 1TF3A 3DAHA 3IB3A 4JLMA 4E5MA 3ROQA 2B8WA 5FEUA 1T1EA 3Q4GA 1NXOA 3QBDA 5E9QA 3HDHA 3LY9A 4FYPA 4D99A 2J3KA 3VMFA 2GASA 4RYDA 4FYYA 3T15A 1DB3A 2VYFA 3GJ5A 1WDTA 2D2VA 5F3WB 3ORFA 4AI6A 3S5JA 4F3YA 2VHXA 4A10A 1IIBA 2ZWVA 2DLKA 3DE7X 3UA3A 5HJEA 4EGQA 3RSHA 1ZJYA 2O0HA 5B5SA 5LDGA 1EE9A 2KW5A 3OHPA 4L02A 1EM8B 3UCEA 3H2BA 2ISSD 5CPBA 3RJ9A 1QYDA 1T8UA 1SKYE 4AURA 1VLHA 1SWVA 4BLOA 3PDWA 1CLUA 4GYWA 4QFCA 2ZJ3A 5JRZA 2V0GA 3PGLA 2A9RA 3MB5A 3MWFA 5EZYB 1KBQA 2ZI4A 2B21A 1HKHA 3ENNA 4RELA 4LDNA 4AMZA 4C4TA 2B6HA 4BP1A 3BGHA 1HT3A 3FPFA 1A88A 3JYOA 4IXMA 2GPNA 4JBWA 4CF6A 1ZIOA 4WXDA 3N8NA 3OURA 3MJDA 4JLPA 4NULA 4ZAZA 4CKWB 1L4NA 2QL9A 4JJ4A 5TPZD 3RASA 4MA5A 5CDYA 5E1BA 1XAJA 2D0IA 4EFNA 2F1KA 2QMUA 5KWJA 3OEEA 4Y2RA 2ONCA 3BGIA 3BGWA 3IKVA 4HNTA 1NJ5A 2VK8A 4R8KA 5E6SB 1Q77A 4A8TA 1CUAA 1UT5A 1G9SA 4LTDA 1UWCA 1BH2A 4YAKA 1UWLA 1ZCAA 3TQTA 1JNXX 3Q11A 4GZ3A 4RK6A 5CR9A 1VHQA 3OZXA 4AYWA 1TF6A 5AVRA 4MWZA 5F3RA 4LHXA 1USIA 1BGXT 4MLQA 4G4SO 1A8PA 5C8XA 4KLAA 4Z0HO 2D2XA 1AUPA 1QNFA 2GILA 2O05A 4NCKA 4OU4A 1X7XA 3WE7A 4A5SA 1TUBB 3EQ7A 1M0EA 1QB8A 3AUYA 1F4LA 4H4DA 1SXJD 4M1ZA 4Z2YA 2Z2ZA 2BJHA 3SF0A 3ZK8A 1UMDA 2GOYA 1LU9A 1RZ3A 1Z4OA 1PFGA 4IG9A 5AKZA 2C7GA 5JRJA 3HEMA 3LLCA 2HIMA 5HRUA 2V7EA 2WYOA 1TUGA 3THOA 1KFJB 2QR5A 2QX4A 4PM4A 4K6MA 4XUDA 4XUCA 1E96A 1JIVA 1KMCA 2I3ZA 2OC9A 3X1XA 3IQXA 3SE0A 2EM9A 4CLRB 1XVAA 1KWGA 2NYVA 5BWLA 1QANA 3ZK9A 4BJ1A 2W6ID 2ZBDA 4I3HA 1S7CA 1E3WA 4HTFB 3HB4X 2PMFA 3FDFA 2ZYIA 4L7VA 3TTVA 5CA0F 2WT4A 4URYR 2FSUA 1FFCA 4OU5A 3L07A 1Z7GA 4FFLA 3WQHA 3TL2A 2V0NA 3O2NA 3P2KA 1XE3A 3VNAA 1LBTA 3FLBA 4E33A 2Q6KA 3WLOA 5JAIA 5KNBA 4UARA 1XTIA 4Q4CA 2YXNA 2AZXA 1K6EA 1V0JA 4EEXA 1C1XA 2PL5A 1KOLA 3KOYA 2XJ4A 3P26A 4I55F 3SSAA 4JFRA 2GN4A 4RGYA 4CMHA 1MPXA 5EC8A 1KK3A 1TE2A 3A7DA 1UJNA 4LXTA 3MMNA 3A6KA 2P79A 4IO1A 3SOPA 1D0VA 4YRZA 2X8BA 3KHSA 5FNVF 5L3SA 3EYWA 3D59A 4KUGA 1KZ9A 4KBFA 4CXMA 4B3GA 2LUPB 4B81A 3TX2A 5DMHA 1ZD1A 1ZO8A 2EAUA 2OD9A 3A2LA 3H8SA 3GA7A 3JWGA 2HNKA 1U0EA 1A8UA 1L5OA 3WGLA 5TQ2A 1SCDA 1UAGA 3OZBA 1W0JA 4HMQA 4DTCA 3NYRA 1WDLA 4MI6A 4RV5A 1AX9A 2Y99A 3ZIDA 3FNFA 5HQ3A 4TTJA 3CTPA 1I1OA 1NN5A 4KB5A 4MULA 5CW2A 3RFXA 3WNBA 4DC9A 1GU7A 3FWHA 1MKYA 2R7LA 3UW3A 1YBFA 4KOAA 4EYSA 1XU4A 4ENPA 5ALVA 2Q1UA 2H1CA 5AVXA 1ZWLA 1O2DA 2B82A 4HR7A 3MBIA 4BTLA 3AU8A 1DKUA 2XLBA 2BFPA 4AKEA 1ONOA 2HSZA 4MQ6A 1E7RA 2QX7A 4U2EA 1NUHA 5KYXB 3FH0A 3I12A 4ZQGA 4JGBA 4AQ7A 4ALLA 4N7RA 2VLIA 2I3BA 1GSAA 2ZPTX 4XYGA 5BOVA 4E94A 1QP8A 3OUZA 5I4BA 2EMYA 1DIHA 3RH0A 2C31A 5IZ4A 5LZ7A 4ZZ0A 3WGMA 2FX3A 3TRHA 2HEGA 3PF9A 5JAPA 2ZR8A 3WFZA 1J97A 4KUHA 4GOKA 4O59O 3R9KA 4FW8A 2IHBA 4YYEA 4U7GA 2W6CX 2EIHA 4PX3A 4JHLA 1KI4A 3L02A 5AHXA 2ZITA 4PSKA 4RJJA 3H11A 2B8NA 2Q6VA 2XUKA 3BK2A 5AM4A 5DN6D 4NXNE 5G0SA 3WRYA 3QXSA 2Q4RA 2RC5A 1I80A 1X7DA 3AHJA 2CTDA 3GJZA 2ASEA 4NPHA 4M0DA 2I1VB 1L9KA 3WYCA 1IYZA 5DNUA 1UHZA 2EGHA 4N5LA 1QF9A 5IVHA 3TR6A 2WPDA 5I7FA 2BSXA 4G5RA 4PSUA 2DCUA 3PVCA 1TYBE 1ZM3A 2VQ3A 3TW8A 2VYNA 3OQ1A 4YI5A 5JSYA 2PUAA 1AKVA 1AKWA 1IUOA 2BFBB 1JHYA 3GZJA 3S68A 2O8CB 1U1DA 4IHKA 3P1XA 4QBKA 3C24A 2GPSA 2P6NA 3FPAA 2FTKE 4P53A 2NQTA 1LS6A 4DPKA 2JANA 3MC1A 2YY7A 4DIUA 4OA5A 3CC8A 1E6WA 3A4IA 4J49A 1KE1A 3AEUA 4QC2A 1WB9A 3OECA 1TEZA 2IELA 2ZYDA 4TS3A 3O7WA 4OHFA 2PNJA 3G68A 3ZY4A 1PYDA 1X8KA 4RE6A 5BR4A 3V3TA 4MR7B 2ZW9A 1ZEJA 1QKIA 2QUHA 2VFAA 4L6AA 4OBBA 2Z6QA 3USCS 2PR2A 1TU4A 4EHNA 1E4EB 1TX4B 4D8TA 3RIEA 1B93A 4KL8S 3Q3EA 1FDOA 2PRSA 3EGCA 2A9PA 1T4DA 5HG0A 1D4AA 3V8NA 4BEVA 4OAOA 3SR0A 4KO1S 3T4XA 3HVRA 2J7JA 1UK8A 3GEDA 3IDOA 3INRA 2IK8A 4P32A 3ZLBA 4CCYB 2ZVDA 4YI3A 2QD3A 2ZCJA 1XXHB 2AQIA 1XNRB 5JPCA 3EUWA 4OLHA 3DS8A 3PNOA 1EU1A 4UVDA 3S2YA 5C4IA 1RE1A 3CRW1 3DWEX 1LJLA 4YAWA 2D2EA 1J8FA 3G8YA 1GL6A 3HEBA 3MOSA 3W5JA 4A2QA 1L7BA 1Q22A 5IN5A 4EG6A 1ORHA 5J5AA 5KNBH 2ENCA 1KJWA 3DDHA 3TD2A 3PIDA 4XSVA 1FZTA 1P80A 2OD7A 4EGAA 4ZARA 3OWXA 3ZU3A 4KQ2A 4JXXA 3HU3A 4MUAA 3E27A 2RH8A 3R0ZA 1FFWA 1A69A 4LJ5A 1J8VA 1CYDA 2JAOA 1Z5ZA 3CF6R 4LN1A 2UV8A 3SJCA 3ZIUA 2RGNC 1C7FA 1LDEA 1TF7A 2AG1A 2CXTA 2HV8A 2V96A 2X2PA 2ZVPX 4YUZA 1BROA 1KHHA 4UUQA 3UWOA 5H82A 3BZBA 2Y1FA 4DMIA 3OMWA 2JFYA 1HG0A 5K3CA 3KAQA 4HFRA 4S1PA 1BVYF 3QUCA 2VAXA 2Y1WA 1U9ZA 3PHIA 2AMVA 3ESRA 1B3BA 3N2IA 4R9VA 1SIBE 4Q1EA 3O74A 3E4DA 1QZ3A 3OHMA 4KQ6A 2GPTA 2WBTA 4BKRA 4YRSA 3LQFA 3RWOA 2BFCB 2PH1A 1YB6A 1TO6A 3K8ZA 5K8VA 4I6JA 3MJVA 3OLZA 4R1LA 1ZR4A 4UBNA 2DY1A 1VIYA 3Q40A 1Q92A 4U3JB 5B58C 1IMUA 2JAXA 3T5TA 2P65A 2QV7A 3C3JA 4DJJA 1U0BB 3MINB 3WVNA 3JY6A 4L27A 3I1IA 2KHXA 2ZSKA 1JT9A 1TJ4A 5FI3A 2IHJA 4EKYA 2C5SA 3KPVA 4YGYA 4N8SA 2G76A 1H1TA 2Q2VA 4YVFA 3WQQA 4D2IA 3WTBA 3BMQB 4RTJA 4KXUA 3FDZB 4Q39A 3VDMA 3HJGA 2IBTA 2WD8A 2ISQA 4BL5A 3H3XA 2Q5HA 4K0KE 1E9RA 4P5DA 3V6LA 3W8RA 3WL8A 4D1YA 5JXIA 3EGDA 1Y4SA 4Y2UA 1KETA 4FMPA 3GN2A 3SXUB 1B7GO 4HQKA 1Y63A 1OV4A 1VXRA 4C4ZA 4X95A 1T5BA 4LGMA 4MB0A 3LRXA 2R8EA 4ZTBA 1ZMXA 1XLTC 1B69A 1SVKA 2BZ0A 2GA8A 2PPVA 2PVPA 2FZLA 5KKAA 4BQSA 1P91A 1M72A 4MUJA 4DIDA 3KQLA 4C4YA 4JI1B 3MMZA 1T3HA 5DYTA 4CMBA 1BE6A 2C9BA 1P1CA 1UMKA 3GPLA 4GW3A 1JNYA 1AS3A 4HFNA 2XCSB 3QXCA 3SK0A 4AS1A 4YP0A 1WW2A 1JBEA 3V4RA 5ALSA 5JSZB 5GV8A 2OV6A 2PN1A 2XB2A 2HU2A 2GJ4A 4EYKA 2CXOA 1BJRE 1SBQA 4Q1VA 2EOHA 2VNJA 2OESA 3TRFA 2X77A 1IBRA 4FEEA 3GNLA 1QR6A 3I01A 3CUYA 1ZC3A 2I4OA 3RROA 2JXPA 4OHCA 5THKA 1A7JA 1ZESA 1P72A 1ZU1A 3HPQA 4LCBA 3R76A 4FONA 1WXHA 3THXB 1LPSA 3U61B 1AXRA 2F48A 4H7PA 3Q7EA 4HDAA 4ZEMA 3S8EA 4X60A 1N6LA 3FA2A 4ZAYA 1XMQE 3D1VA 2GF0A 1DKQA 3O38A 3CX8A 5EE0A 2ZI5A 3H9BA 4EHFA 3Q2OA 1M8GA 3UJ3X 4YV7A 2NUAA 2ERYA 3IAM6 1SFEA 1WWKA 2AUTA 1PTKA 2YTQA 1PK9A 1ZJZA 1ULZA 2VSQA 1DRUA 1L9XA 3EW7A 2GRUA 4OHUA 4OJMX 5LP6B 4G9GA 1NOJA 4WZBA 4YY3E 3L8ZA 1FA9A 1EP2B 1ODLA 3FRJA 3ASYA 3UMSA 3DWFA 3SOZA 3L6EA 421PA 5TMDA 1T1GA 2BKAA 2QNRA 1ZJ6A 3DCYA 3RFFA 5C5DA 3N8KA 3E9MA 5DSZA 4RQTA 4RHBB 4DLZA 3SF8A 1HNZB 2MIIA 3WK9A 5AJUA 3ZYZA 3DW3X 4IH9A 4RXUA 3IDAA 4WFQA 3SVZA 3ZUGA 1ZVQA 1IQPA 3OZSA 3I61A 4E5SA 3SLKA 3PEVA 4ER3A 3JWPA 1T36B 1NMXA 4RA6A 4XPZA 4ITVA 4GGPA 2IYRA 2SCUA 2FEXA 4D0GA 5FUQA 3WOVA 4ER6A 4Q47A 1IBKB 3B1ZA 4WCFB 1ZD9A 1YUJA 4W82A 1EQUA 3E7PA 3IALA 4RSHA 1NPDA 3ERCA 2XY4A 1R6VA 4YAGA 4RDHA 3NHAA 2AFHE 5AW4A 3TSZA 3DE1X 2XOXA 3O8OB 1UOEA 2DHEA 4EMBA 5MN4A 3THYB 2UUAB 2HLDA 1VL8A 2BBSA 2ANCA 4BHBA 1LQTA 3Q3IA 2PUEA 3FPLA 3DLCA 2BY4A 3OE5A 1ESDA 2G0TA 4BO8A 2PX3A 2BFAA 5LA6F 4P2BA 1XVVA 1V43A 3TLKA 5BMVF 3NOXA 4HWGA 4UTZA 3UWKA 3RSFA 2ELZA 3VO9A 4D4KA 2PAFA 4WXCA 1KERA 4KAAA 5C7LO 4JYPA 1NXWA 4BCBA 3HFGA 2VT2A 2NQ8A 4H1WA 5IBRA 4G26A 1B43A 1K06A 4GPEA 4YMIA 5JD4A 2ZUWA 1XF1A 1UMCB 3LOUA 2AHOA 3C5VA 4YP1A 5ES3A 3IRVA 4M36A 1RYDA 3BSYA 2YZMA 4G97A 5JO0A 1IM8A 3K7EA 4TWAA 4DBLE 3G82C 4YK7A 3MWKA 1V96A 2V74B 4MGEA 2F6RA 2GJAA 5CBPA 5FIUA 1ODIA 1UJ6A 4WZZA 2CJWB 2FR1A 3P2IA 2DLCX 4QGAA 3LZDA 1UFVA 3FN4A 4PZ9A 4U5XA 5J59A 1NG1A 5AOCA 3UMBA 3V8BA 4CMAA 4E30A 1ZK2A 2HZ7A 5HTOA 4PONA 1ZSYA 2UZ3A 3IE0A 4F85A 2FLVA 1LTKA 4RGQA 4IIJF 3LD9A 3E05A 1G2PA 2GRAA 5D7NA 1LPPA 4NV0A 3ITEA 3KSZO 4NBKA 5BPHA 1W85B 4B85A 3BZUA 4XVQA 1F1JA 1OQAA 2CXUA 3EXFA 4G5QA 5DNEA 2O50A 3RRFA 5K8TA 4Q15A 1F6DA 1J90A 1M54A 2QQ0A 2G04A 1V4NA 3NATA 3TSCA 4CTKA 2IYYA 5D01A 4UDYX 1XRQA 1NF3A 4AUNA 2FPOA 2Q1SA 2F8BA 2FCRA 4P0TA 3K1YA 1U8TA 3I3SR 3K0FA 3KQHA 3ICPA 4DZRA 2ZSUA 3RQIA 3DONA 4UUAA 3U2QA 4HEA6 1ZAKA 5ECGC 3IELA 3AY7A 1FS6A 1G6HA 2W6OA 4V1CI 1IY8A 4FN5A 4KVZA 1FY2A 4OL9A 4PZAA 3NX4A 2VC2B 1OA0A 5GPBA 3TIGA 1W1UA 1J7JA 4RH8A 2I2XB 1MB4A 2WJAA 4U0JA 2C07A 3WL4A 4J0FA 3TAXA 3FLMA 1WXQA 3DNMA 3BA6A 1FUIA 1GWNA 3RFTA 4HZGA 2NV0A 2NO1A 1BC5A 1YCDA 4LTYA 2SKCA 3EWIA 3HXQA 5FUXA 4M0VA 3EXEA 3A2MA 4KAFA 1COZA 3QVJA 4K86A 3HU5A 4PFSA 4LV8B 3BORA 1LBSA 4JN6B 3DAOA 2VNIA 1IBMB 2JIMA 1RBQA 2XUFA 1ZN8A 4K9DA 4ZYWA 3JATA 1GN9A 1JSXA 2J4DA 4GDFA 3H4IA 3N70A 3IUSA 4J0DA 1Z4JA 4MK4A 5ITSA 1TQ4A 3M6WA 1VKHA 3V4OA 4DADA 1L7QA 3PXXA 1C29B 2HEIA 1UXKA 4WXHA 1M75A 1GZ6A 1FMTA 2JZOA 2FWJA 5F3DA 3B1VA 4NCBA 2RJOA 4IAOA 4R2QA 4C4XA 1A71A 2YS7A 1NVTA 4U9HS 5C7OO 4UTXA 3CB4A 4HZUB 2OHFA 1Y5LA 1N0VC 4KV9A 4Q7QA 1OILA 3MAGA 3ZEIA 4BFYA 2LGJA 5J23A 5ILGA 4GI3A 2V9PA 4RJ2A 3UAXA 3RUEA 4UE6A 3DSRA 4FLEA 3I72A 4B17A 5CCDA 3W5SA 1NXSA 1BQ4A 3CX6A 4CNQA 3N6XA 5AI5A 5GVRA 2P4HX 2WWFA 4F3TA 5AFSA 3LPMA 4M0LA 3R8XA 5JMOA 1D4ZA 1NEIA 1MVLA 3EGXB 4I36A 1OX6A 2GPBA 3KTAA 1H2RS 5IEBA 3CWQA 2BEKA 2DPXA 4INOA 1KVSA 1RYYA 4QYTA 3NV9A 1DQRA 4PICA 2H4JA 2HPVA 5JCXA 1XDGA 1CDZA 5JYEA 2LIPA 1QUEA 5IJZA 3Q8KA 4EUSA 3ICOA 1ODTC 4DMRA 2QRUA 2M6SA 2AGVA 2PUWA 3JPYA 2O2ZA 4G25A 3CEJA 1MO2A 2QD4A 5BN4B 1SOUA 2LIVA 3BJEA 1J9GA 4UHCA 5E0KB 1JMKC 3W5BA 4M9RA 3ZDRA 4IUYA 2ZU0C 1O8CA 1H4SA 2ECOA 5EINA 5JCOA 1QU6A 2PUBA 2UZ4A 4O8CA 4AZWA 1Q1NA 2D2FA 3OZIA 3QMWA 4IDOA 4M88A 1KH1A 2AUMA 3BYZA 4LRYA 4NARA 4YIHA 1VKOA 4YO7A 4LF8B 1XNGA 3Q98A 1KR5A 2IW3A 3OJCA 2HD4A 3HA5A 5D3ZA 6REQA 4LNAA 5JAZA 3ORHA 5TGTA 2B4TO 4W6ZA 2ZWIA 3WYAA 4Z6KA 1X80A 3GZTB 4X7MA 4BO4A 2WYWA 4XD2A 4B6JA 3MXTA 1WLYA 2JI7A 1CUSA 1NAIA 1WVGA 2Z1MA 1YAHA 3PICA 5G3ZA 4GSLA 2ODEA 3HB0A 3WLIA 2FPRA 4JJZA 2ZUBA 1SU8A 2FMXA 2I9IA 4D3YA 2JI8A 4I8OA 4RJKA 2CMFA 4NJMA 4LWZA 2D6FA 2YHSA 4JQOA 3PEWA 4WFKA 1TKAA 1RMQA 1VIVA 2J46A 4AJLA 4I5IA 1ONNA 2A0WA 1YACA 3DJYA 4LX0A 2GVZC 2DHDA 3TI9A 4D9EA 4K6GA 4YRRA 4FFMA 3AI2A 3GQVA 3U4AA 3VR4A 4BB6A 1HTTA 3QXJA 1FTSA 1REQA 1XKLA 2W6PA 3H97A 3LDAA 1SVWA 3QKTA 1L7AA 1IB6A 2J1LA 5DLQC 2ZETA 4I1PA 3ILYA 1SU7A 5ALUA 1J00A 3U37A 5AHKA 2ZFUA 1KQNA 2FF7A 3ECRA 1BMDA 3HADA 2C97A 3PENA 2ZE7A 5B4UA 4M83A 1NV9A 2RD2A 3J7Yp 3NM5A 1T5OA 1OH7A 1Z2CA 3KZOA 4MJXA 1T4CB 3K6JA 1GITA 2YJNA 3D4LA 3ENWA 5AKHA 2P91A 4WHMA 5CPFA 1G2DC 4R2AA 2XWJI 3JCZA 5M34A 3EARA 5EMNA 3EGWA 2IXGA 3KYDB 1QVZA 3KTDA 1A97A 3CRRA 3R3UA 4RHYA 5FOVA 2HTFA 3DT6A 4ZEWA 4O02B 2PY6A 1I24A 2Z5GA 4PPGA 2JH3A 1CQJA 5FTLA 2DFKB 2AE1A 3VTAA 4BZQA 4E09A 3OPYB 2NAFA 3R2JA 2QNBA 3I0MA 4TLEA 3R7WA 2AEJA 1M9NA 3L5KA 1GQFA 4PPNA 4PLHA 3IIIA 1NVMB 3FMOB 3MCZA 2YX1A 1JILA 3AR5A 3AHHA 5FBHA 4CR7A 1LTHR 3VKFA 4DUYB 1DC3A 4XKJA 4FYMA 1N33B 2REXB 2WFLB 1NTRA 5CM9C 4GC9A 2MT9A 1T9KA 1XQVA 2DMIA 1FFXA 5G40A 3WZMA 3ZE0B 2X0FA 4RQAA 3V2UA 4TZ6A 1BE8A 1SG9A 1ZH4A 1V4BA 2NO9A 3R77A 3TM5A 2O9JA 4AY3A 1F3OA 3NOVA 5I7EA 4QU9A 2FQWA 2XA9A 1XTJA 3BRWA 4X3CA 4PS1A 1XU9A 5JYDA 1TYCA 2JAWA 2QW8A 2REBA 5HKKD 1PV4A 3Q0EA 3ZD8A 1JG7A 5JBQA 1R64A 3UOAB 2G70A 4NS4A 3ZXYA 2YXPX 2DR2A 1MO5A 4PHCA 1UAYA 4C1NA 2WF9A 4MYHA 3ROZA 4IUDS 1YL5A 5G53C 4D26A 4A0RA 1MW9X 1C7IA 4LF6E 1KY2A 1MIHA 3OKCA 1MDBA 3IBSA 3UMCA 5HQTA 5K20A 4S05A 1Q11A 5A05A 1AUXA 2X58A 2JFZA 5AJTA 1UIRA 1GA1A 1HQKA 1SGWA 1ZVKA 2Y0EA 2XCTB 1HFWA 2QY9A 3NHKA 4F5ZA 4LWQA 2FPGA 5IAEA 4KJXA 2RC6A 5GY7A 4CM8B 3OF2A 2RQLA 3V5NA 5EJ8A 1QZUA 4B34A 3D3EA 4DZZA 3WK5A 4ZQCB 2RGAA 2X1MA 4QYWA 1GUFA 5K8LA 2VAWA 3KVNA 2OGWA 1I32A 1BAPA 3LI2A 3WBFA 4YCCA 1WU7A 1CR0A 1BXRB 2F9MA 2GZAA 5ERXA 3R09A 2W6QA 3CUUA 4NYMQ 4TMYA 2BFFB 2ZSJA 5SY6A 3UJ7A 5AW7A 3I92A 2Q6TA 5IARA 2O6LA 2WUFA 5B58T 3SKXA 1PD1A 2AZMA 3CY6A 3EVCA 1II8B 4IOKA 4N3NA 5EMMA 3WP1B 4ECEA 5JASA 2FFJA 3OZWA 2EFCB 2XSZA 3B38A 4OFBA 1PJTA 4GX5A 2QKYA 1SZCA 1IAVA 4D97A 1DO8A 3LBYA 4H6VA 2HA2A 4MPTA 2GD1O 4MWDA 3PXBA 1X9GA 4MI9A 2BKUA 2AW3A 3AZQA 1G98A 4WN3A 1NBAA 3CO0S 4O4HA 2Q50A 2EL9A 2BMDA 2I0FA 3VI4B 1P4AA 1VCHA 3FFWA 5FLEX 1V9SA 1X42A 2JI9A 4RK0A 1TL7C 2ZGVA 3O8LA 2PPLA 4L5JA 3LY5A 2VE7C 3EIOA 2I6SA 4L8WB 4NIMA 2HJJA 4QLBA 1ZKDA 2BSAA 5BT8A 3H5AA 4DMFA 4GGOA 1YI0A 4JROA 3VR4H 4JUBA 1H93A 3N2KB 2PGJA 2FAXA 5A6BA 1UKAA 4H1VA 2NVWA 3GLRA 2XGOA 4Q4HA 5DJ5A 4Z4EA 3OAAD 2IHNA 1UJBA 2C20A 2XNCA 3HN6A 4FEGA 3UPTA 3TKYA 2BV3A 1XPJA 1XBTA 4CQMA 4KYUA 4TRJA 3AQ4A 4IZIA 1OKKA 1D2AA 3A9WA 2QYOA 4QOHA 4MJLA 3GCWA 3DVRX 3CH6A 5LWHA 3QHQA 4TSFD 1I0ZA 4P4SA 2P9QA 3KRTA 3V4ZA 4GSKA 1D6SA 1U0HC 1YMQA 3V80A 3HU2A 5M7EA 3ZU4A 3T7AA 4XEHA 2E4WA 4P54A 4S0ZA 3QW2A 3OY7A 4UD2A 1E2EA 3W90A 1MO4A 1GU1A 3KHTA 4KIWA 5AJXA 1YOVB 3FNEA 4PZLA 3M1LA 4R1UA 1D1QA 1KF0A 4JUAA 2DGDA 2JLAA 1GSOA 1RIIA 5E6UB 5AT1A 3OIGA 4MR8A 4JD5A 1YYWA 3KWMA 3CZCA 2YQ5A 4WBNB 3OM0A 4X44A 1RLMA 4DV3B 2H08A 3GFTA 3WHLA 2V5AA 1EZ4A 1N25A 2VTEA 3P0EA 1BEEA 4FIZA 2VP6A 2FA9A 5DULA 4DV2B 1FX0A 4DV4E 5EZQA 1O6CA 2YFHA 3ZVNA 4NZPA 3HKDA 1RZRA 2A3NA