3C6MA

Crystal structure of human spermine synthase in complex with spermine and 5-methylthioadenosine
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
361
structure length
336
Chain Sequence
SRHSTLDFMLGDGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYDSILNKVEERMKELSVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermine synthase
publication title Crystal structure of human spermine synthase: implications of substrate binding and catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 104
structure length 336
sequence length 361
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.22: Spermine synthase.
pdb deposition date 2008-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
A PF17950 SpmSyn_N S-adenosylmethionine decarboxylase N -terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 3c6mA02
3.30.160.110 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Siroheme synthase; domain 2 3c6mA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3c6mA03
4R05A 3G7UA 1WG8A 5DX1A 1R74A 4KWCA 5F2KA 2VDVE 3HA7A 2IH4A 2IDKA 5EIFA 1QANA 5KVAA 2FPOA 2KW5A 3A25A 1VIDA 5LR6A 4HC4A 5GIOE 1RI2A 3GO4A 3LCVB 2F8LA 3C3PA 4X63A 5K0LA 3D2LA 5DT2A 1JTFA 1XTPA 3BXOA 2BM9A 1T43A 3EMDA 2GPYA 4RTKA 3A7DA 1WXXA 2AZTA 3DXZA 3KPVA 1ZG3A 4OQEA 4EVIA 1X1CA 3M6WA 1DUSA 2PY6A 3TQSA 1HMYA 1XXLA 4B17A 1PJTA 2JH9A 5FWAA 1XCJA 3BZBA 3UFBA 2PWPA 3EVZA 3SX0A 2VP3A 3A4TA 5DRYA 5E9WA 4C07A 3R0QA 4FP9A 5M5BA 4PGGA 5E8RA 4RTJA 3Q7EA 7MHTA 3OU2A 5GP1A 4R8SA 3FTDA 2FK7A 3OE4A 4OBWA 1NKVA 3JWGA 3O4FA 2YXDA 1L9KA 3M6VA 3THSA 1BHJA 2VS1A 4M38A 5C0OE 2YQZA 3HVIA 3LECA 5DTMA 5B1SA 2EG5A 1KIAA 1FJXA 3FZGA 1RJGA 2NP6A 1JQ3A 2I6GA 2PV0A 3KQYA 1NW6A 1TW2A 4H0NA 4P7JA 3TKYA 2QM3A 4PYLA 4YUXA 2G1PA 1PRYA 3LDFA 3SVZA 2HR1A 3KQWA 1I1NA 4P7GA 4PYIA 5CVUA 5FWDA 1G8SA 1EIZA 1NV8A 2JJQA 5GIPE 3NMUF 3HA5A 2AOXA 2C7RA 1M6EX 3HVJA 4HTFA 3EVBA 5E8JA 2CKDA 5ICCA 1JG3A 3OFJA 2O05A 3R24A 3VSEA 3UJ6A 1X1AA 4PONA 1F38A 4BY9E 4PWYA 5EGSA 1RI5A 5ICFA 4E32A 3LKZA 4C08A 3SMQA 2BH2A 3V8VA 4KIFA 1L3IA 3AXSA 5FHQA 5CVEA 3SSOA 3PFGA 3SSNA 3CJQA 3MTEA 3LKDA 4UOEA 1FP2A 3A26A 3BKXA 3ERCA 4GQBA 4EKIA 3KQSA 2AOVA 2OY0A 5LQKA 2PWYA 5EVJA 2P41A 3EGEA 3EPPA 3GDHA 2XYRA 3HP7A 2H11A 2I7CA 1PJZA 2IP2A 3GRVA 2UYOA 2NNWB 2ZBPA 3P9IA 5T64A 4CTKA 3JWJA 4AUKA 5CD1A 2XVAA 3HCDA 4K6MA 3G2MA 4E2XA 1N7IA 2B2CA 1L1EA 3CKKA 5KYGA 4AZSA 3UJBA 3ER9A 2PT9A 1NW8A 1V39A 3HCEA 5DSTA 4ZTBA 3B7PA 5C9ZA 4F84A 2B9EA 1XDUA 2FYTA 2HWKA 2JHAA 4RWZA 4IV0A 4RVDA 3U81A 2ZWAA 2VDWA 2ZULA 5EKUA 2G8NA 2AOUB 3FUUA 5FQOA 2P35A 4BP3A 1AV6A 3P71T 1UIRA 4Y2HA 1ORIA 3A7EA 4U7PB 5HIIA 4HSGA 5K0NA 2I9KA 1VL5A 3H2BA 5E1BA 3FPGA 1KPIA 2XYVA 4PYKA 3FYCA 2ZIFA 1JSZA 1G8AA 1VBFA 5EEGA 2C7PA 3FTFA 5K09A 3DUWA 3GCZA 3EGIA 5FULA 3DMFA 5CUQA 5DSXA 5GOZA 5K05A 2O07A 5K0CA 5CVDA 2ZBQA 3NTVA 3ELDA 3P2KA 2UZ4A 2PGXA 2JH8A 5LQJA 4GC9A 2CWWA 2QYOA 5CM2Z 3RODA 3DH0A 5E9QA 4DMGA 3UZUA 2V7EA 4PNEA 3THRA 3DTNA 3LPMA 1X19A 3PTAA 3KU1A 3O7WA 1EG2A 2BR5A 4L7VA 4X1OA 1NBHA 3E23A 5HFJA 5KQSA 4KDCA 4QPPA 5E1OA 2IPXA 4RTNA 1H1DA 3FYDA 4OX9Y 1OR8A 5K0GA 1YUBA 5CVVA 3MAGA 3MCTA 3ME5A 4CKEA 3T7SA 4V0RA 4YUWA 3C3YA 4GOOD 2ZW9A 5K0EA 3GWZA 5GWXA 2HTEA 1IY9A 2P3QA 2QRVA 2YR0A 2ZVJA 3E7PA 4PIPA 1KR5A 2XVMA 4GEKA 4C06A 4ER7A 4LECA 4ER6A 2O0LA 5JR3A 4E31A 1KPHA 3EVAA 3KQTA 1R6AA 5DTRA 1O9GA 3DP7A 3LX6A 2FCAA 3NDIA 5LQRA 3I5UA 2PX5A 1KP9A 2IBSA 2PXXA 2PT6A 2ZSUA 3MQ2A 3P9NA 3Q87B 4GF5A 3VC2A 3X0DA 3C6MA 2AOUA 3BGDA 4QTTB 3C6KA 3RW9A 1EJ0A 4M36A 3P2EA 4E33A 2IBTA 3OU6A 4A6DA 2UYHA 3GGDA 2CL5A 3AY0A 3UJAA 5C1IA 3UA4A 4AZWA 1XJ5A 1XVAA 2GS9A 2NXEA 2Y1XA 3FTEA 2G70A 2XYQA 1FPQA 1NW5A 1RJDA 3V97A 4PIMA 3NJRA 3LBYA 4BLVA 5EMJA 1YFLA 5DM0A 3E8SA 1SUIA 2CMHA 2PX4A 3M6UA 2DULA 5FHRA 3K6RA 3SXJA 3OCJA 3KQMA 1L3BA 4E2ZA 1VP9A 2PX2A 4FT2A 3DMGA 5EMKA 2ZLBA 3M6XA 2EJUA 4KDRA 5T6BA 4MTLA 1R8XA 3TMAA 2I62A 4MQ4A 2FHPA 2GAFA 2PVCA 3L8DA 4BLUA 1YZHA 3TR6A 5EPEA 2YXLA 4RTPA 2AOTA 1YFJA 5EOVA 3MHTA 2FRXA 3BWYA 1P91A 4EK9A 4XCXA 3GRRA 5EQJB 4ER5A 2Y1WA 4V0QA 5JUWA 1I9GA 3G8AA 1D2HA 2LD4A 4QTUB 1X1BA 1G38A 5EZSA 5FUBA 3EVEA 2Z6AA 1XDSA 4X61A 1JQDA 3E05A 3NWEA 5P8WA 5E2AA 5IKMA 1JR4A 2VDUE 3DLIA 2NXNA 3HCBA 2QE6A 3OFKA 4QQNA 1UWVA 3KR2A 5E9JA 5GM2A 1F3LA 3KPYA 3OZSA 3UJ8A 1JTEA 1NT2A 3OU7A 2ESRA 2EFJA 5BW5A 4YUVA 1M6YA 1M0EA 3O31A 3EVDA 1G60A 1KYQA 4GC5A 1KYZA 1BOOA 2AR0A 3WSTA 2JG3A 1NV9A 3B5IA 2AN5A 1G6Q1 2Z6QA 1FBNA 1O9HA 3LCUA 1JG1A 3UJCA 2R3SA 3EVCA 5ERGB 3A27A 4IWNA 2Z6UA 5DM4A 5HIKA 2OO3A 3BUSA 3PS9A 5CCXA 1JQEA 4E2YA 4X60A 1QAOA 1SKMA 3KHKA 3CVOA 2OBFA 1PJSA 2OKCA 2HV9A 3GRYA 3KR9A 5EKXA 4Z2YA 3BGVA 3CGGA 1KXZA 1DL5A 3EEYA 4BP1A 1BKYA 2ZWVA 2ORED 1INLA 2OB1A 4HGZA 4QDKA 2BR4A 3NDJA 3UA3A 1P39A 5DTQA 2CMGA 3FPEA 1Q0TA 5IH3A 5HOQA 1U2ZA 2AN4A 3LDUA 4YUZA 3DXYA 4F86A 3GRUA 8MHTA 5LQNA 2AOWA 2IFTA 5T67A 3UBTA 3TLJA 2AS0A 3K0BA 4YV0A 5EZQA 3FPJA 3CCFA 3GJYA 3DOUA 1KYWA 3GU3A 5F2OA 4F85A 1VQ1A 5LSAA 10MHA 5DXAA 5F2NA 1NW3A 1IXKA 1JSXA 4M7RA 2AVDA 4RTMA 5MHTA 3JWIA 3AJDA 4Y30A 4OA8A 2ZZKA 5FTWA 3VC1A 3BT7A 3UWPA 3TM4A 3QV2A 2ZCJA 1NE2A 5EEHA 2FK8A 1RI1A 4GOND 2PJDA 3ELUA 4HG2A 4QDJA 3T7RA 4AZVA 5LQAA 1P1CA 3ELYA 3GRZA 2BM8A 4PCAA 4PYQA 4RYLA 3UJDA 5K0BA 4MHTA 4ER0A 3EEOA 5K0FA 2HNKA 5G02A 4C03A 5KS2A 3LSTA 1Q0SA 4NECA 2P7HA 4YV1A 3FRHA 5GM1A 3LGAA 5H02A 1X1DA 3FTCA 3KQQA 1YZ3A 2EX4A 1JG4A 4G56A 1O54A 3KR0A 2ZZNA 1L3CA 1ZGJA 2YTZA 3I9FA 5D1NA 4PCLA 2C7OA 2BZGA 3TRKA 3EVGA 5DX0A 1TPYA 2IGTA 4HH4A 3ID6C 3BWBA 4RX1A 4WXHA 3PT9A 5FA8A 2O06A 1EQAA 3HEMA 1QAMA 1IM8A 5EMMA 1WXWA 2WA2A 1RJEA 2PKWA 2NP7A 2NYUA 3FRIA 4OA5A 4R6XA 3JWHA 5E1MA 2AVNA 4QVKA 1XDZA 4C4AA 1WZNA 2ZIEA 3C0KA 2O57A 4DCGA 3KQPA 3M33A 1VP3A 3PX3A 4C04A 4DF3A 1QAQA 4QPNA 4HTFB 1P1BA 5FADA 4GOMD 5DPMA 2IH5A 2ADMA 5CCBA 1R8YA 4MIKA 4DA4A 3ER8A 4CTJA 2UYCA 2YUIA 2PSSA 5LQUA 3DR5A 5DXJA 4ISCA 3G5TA 3BGIA 5HIJA 3IHTA 1QYRA 2ONYA 1WS6A 3BWMA 3I53A 2C7QA 4LG1A 2GLUA 4CWAA 2BR3A 1VLMA 3AXTA 3B89A 2NXCA 1AF7A 3ELWA 3G88A 3GIWA 5EMLA 5GINE 5DM1A 4PYNA 4PINA 4EKGA 2PXAA 1TW3A 2PXCA 2GH1A 4KVZA 1RJFA 4MWZA 3G2PA 4RSRA 4LWOA 3EMBA 3G2OA 5FA5A 5DM2A 9MHTA 1HNNA 1N7JA 2P7IA 1NW7A 1ZKDA 4RVHA 3EGVA 2EJTA 2G71A 3DLCA 5KQRA 4HGYA 3MCZA 5DRTA 4RTLA 1ZQ9A 3PLAE 1QZZA 5FCDA 3MTIA 2ZZMA 4RTOA 2ZIGA 3EVFA 3FUWA 3UJ9A 4DQ0A 4FS8A 3ANXA 3R6TA 3NW9A 3NWBA 4XUEA 3OZRA 3AWIA 4IV8A 4DCMA 4OBXA 2P1DA 3P9KA 4EQZA 4YMHA 2DPMA 4RTSA 5D1HA 4CKCA 2AN3A 2OYRA 5K0JA 3SR4A 2G72A 4PYMA 2IH2A 1R00A 1YB2A 4P7KA 1XCLA 3M70A 3QOXA 5BW4A 2YX1A 1SQGA 3CJRA 5ICEA 3OPNA 5BXYA 2OPBA 4E30A 5K8VA 3CJTA 4JXJA 1N2XA 2HMYB 3FUVA 4BLWA 1SG9A 2K4MA 2IIPA 2YXEA 3LDGA 1SQFA 3KQVA 4IKPA 4P58A 5CVJA 3DULA 3TOSA 4A6EA 4KRGA 3KPUA 5U4XA 1KPGA 3LHDA 4GBED 4DM3A 4EMSA 2PBFA 3F4KA 3HVKA 3REOA 2Q41A 4DZRA 2JHCA 1PJQA 5K03A 4FZVA 3P2IA 3P9CA 4GUAA 3HTXA 2GA9A 2OB2A 3CC8A 3MERA 3OE5A 1MHTA 2ZFUA 3HM2A 3HVHA 3PB3A 3TKAA 2QY6A 1FP1D 1SUSA 3HCFA 3SM3A 4FR0A 5FQNA 1D2CA 2V74B 3TFWA 3M4XA 2OXTA 1EAMA 4ER3A 2WK1A 4R6WA 1G55A 5EC8A 4RVGA 2GB4A 4YV2A 2ERCA 1R18A 3HCAA 1ORHA 2QRVB 4C05A 4YMGA 2P3LA 5DX8A 4U7TB 2A14A 3R9XB 3RIEA 4AX8A 4PYOA 4QVGA 1SVUA 2WA1A 3LBFA 2VZ9A 3PFHA 3QOWA 4LWPA 5DWQA 4CKBA 3G2QA 1YF3A 4PGHA 3KPWA 5DLYA 5LQCA 3BKWA 4AZTA 1RI3A 4KW7A 4PYJA 1Y8CA 3CBGA 5CIYA 1ZHFA 3R3HA 2R6ZA 2P8JA 1AQIA 3FUTA 4RTQA 3G8BA 5EHGA 1MJFA 2H1RA 3KPJA 3G89A 3IV6A 3MGGA 3T0IA 4RTRA 3TPZA 3LL7A 1BC5A 4M37A 3SGLA 4POOA 4OQDA 3IYLW 4R8RA 3FPHA 2ZBRA 4GOLD 4RVFA 4FSDA 4FT4A 3HNRA 1D2GA 5EHIA 3MB5A 5EIWA 3UJ7A 3FUXA 3NVKI 3SSMA 1RI4A 2ONZA 3B3JA 3ORHA 1VE3A 1WY7A 3GXOA 3DMHA 1KHHA 2UYQA 3B3GA 3G5LA 3KR1A 3PX2A 3PVCA 4O29A 4FSXA 5HILA 3I64A 5HIMA 4DKJA 4E70A 4P7FA 3LCCA 4XUDA 4YUYA 5EG5A 3I58A 3IEIA 3NVMB 4XUCA 2PX8A 4ATNA 3KQOA 1EJ6A 3P97A 2B78A 4WVLA 2YVLA 5K01A 1ZGAA 2AOTB 3S68A 3GNLA 2NXJA 2P3OA 5E1DA 3BWCA 1AQJA 4KIGA 5E2BA 3DXXA 3TM5A 2IDJA 5BP7A 1Z3CA 1I4WA 3P8ZA 3FPFA 3HCCA 4X41A 1VPTA 3KKZA 3HA3A 1JG2A 4CXMA 4HRAA 2E5WA 1UFKA 1NBIA 2XBMA 5HZMA 2B25A 1B42A 2N47A 2P40A 3OZTA 5ICGA 2B3TA 2ZTHA 4E2WA 3VYWA 4QQKA 4FGZA 5HEKA 1DCTA 2JHPA 2PLWA 3T7TA 4RV9A 2H00A 2OZVA 3B3FA
chains in the Genus database with same CATH superfamily
2JPDA 4R05A 1JVBA 1Y4UA 5FI5A 4KWCA 4TKZA 1O0SA 1X80A 3NBYC 4MR8A 5EIFA 4JI8B 3BREA 4ASUD 1K2WA 4E2XA 6ABPA 4ZXFA 4BRUA 1ATZA 1PEKE 4DM7A 4DR2B 1LX7A 2R44A 1I4OA 2HJVA 4DIDA 2FUNB 3OWOA 4N7BA 1Y6QA 5G0TA 5IK2D 1Q84A 2EM3A 1M34A 1IUKA 2Y1LA 1JT9A 1WXXA 1RWXA 1ZH8A 3A7DA 3CO0S 3R8XA 3B1WA 3HYRA 2BC9A 1HMYA 1NA5A 1JKJA 3L4BA 4IHJB 1TI7A 5JYDA 1BKSB 2WYHA 1SQ5A 3UFBA 3MRVA 2Q0HA 1MV8A 4BWFB 4Q34A 4C07A 3FMPB 2HRRA 4UU0A 2XQGA 4GOJA 4PGGA 3I5MA 4F5ZA 4AQYB 4RTJA 2SECE 1Q7BA 1QRAA 1RC1A 5I9LA 3A1EA 2FWPA 4UVDA 5ILGA 3LLHA 1QG0A 1X9GA 1KDYA 1WB4A 2WU3A 3F49S 1SBZA 3M6VA 3MQFA 3DS8A 1JH8A 4IRUB 3KKPA 4R2MA 3VJKA 9LDBA 2A0XA 4M38A 1DRVA 3ESRA 1HL3A 4TMFA 2EG5A 4PO9A 4ZOLA 3T8YA 1FJXA 2ASVA 5KYUB 1V7PC 2A5LA 3N76A 3UCFA 4RQUA 4V0MA 2BFBA 2V7QD 3W6OA 1BMFA 3U4QB 1YYWA 1R16A 1V5IA 2XDQB 4C0XA 4TS3A 4IS1C 1AQUA 1CZRA 5IHPA 1C0LA 3LHSA 4JLUA 5LMUB 1RC7A 1XKQA 2C82A 4GQIA 2F1IA 3RWBA 2XHZA 2VH2A 1KY4A 4TLCA 1JU9A 4HYTA 4CEJA 4HTFA 5B2FA 1UPXA 3BXEA 4C0WA 3T95A 5JTTA 1W87A 3G3EA 4FXPA 2R5FA 3ENNA 4QPJC 1PR5A 2L2MA 1O6ZA 1UBJS 5AI8A 4DGQA 2WWYA 1FRNA 1HV8A 1E6EA 3DD5A 1Q0PA 3R40A 2V85A 3HMQA 1NJ5A 4IP0A 4UVGA 2HHHB 3EUEA 3GJQA 4LMRA 4FN5A 4OO3A 4G0NA 3G85A 4L6CA 5GJCA 1EP1B 1OTHA 5K8TA 3RAFC 1JEYB 3U3JA 1JEAA 1J9EA 3RTGA 4AS1A 3KEOA 4HDSB 4QRDA 2YIJA 3ESXA 3JR3A 4I5GA 4IO0A 1GVNB 5DYIA 3EPPA 4CKEA 3O3NB 2XYRA 4ZEOA 3MMNA 4F9CB 1P9WA 2ZUCA 3D4IA 1K88A 4IH9A 4PSAA 4WOKA 4WKGA 4ZVPA 4AL4A 3DAFA 4PXYA 3K0HA 5FOWA 2VBGA 1XQXA 3V7WA 4A1OA 4M4SA 1MABA 1PJ2A 2HBYA 1A9SA 4HEIA 5E6RA 4AZSA 3ER9A 1XVUA 3EWIA 3QPBA 4UUMA 4QXOA 4WA7A 2FYTA 3W7BA 4OXNA 5MGBA 2WAYA 2WJ6A 3OX2A 1NBWB 3BCRA 1QDUA 2MWMA 2XCIA 4LE1A 3WLMA 5KNLA 2EL6A 3NATA 4QEZA 2OPHA 2BBGA 5E3IA 4RIHA 4IOKA 1PVVA 1AGNA 1Q11A 4MIOA 5HIIA 5IDVA 4UDNA 3GBSA 3W5SA 4B6SA 4TV9B 1RXYA 2VBCA 1RWBA 3COPA 2ZTUA 4UQOA 3FGNA 2UXDE 4J03A 4MJLA 5AE3A 4IJUA 1ESEA 2W2LA 3U6BA 1OLXA 1E3WB 2A33A 2FH5B 1YR2A 4AJLA 5C7LO 3FTFA 1ZXBA 4CF7A 1E3JA 4QJ5A 3KBOA 4KZKA 1J9ZA 2OZLA 2X3YA 1THZA 3H65A 3JQ7A 3L7BA 4DMLA 3OSUA 1H2HA 3KEGA 3R5TA 5EMNA 1R6VA 1L7XA 3RUPA 2RK3A 2VTKA 3AERB 3T1NA 4GC9A 3T1VA 3U3DA 3U5TA 1KAOA 4ZU1X 2PT5A 2VQEE 2ZJ3A 4LDAA 1J25A 4JYPA 1HNXB 1NQVA 2XF8A 3ILHA 1ADBA 4KMSA 3VPDA 3H4IA 3M1YA 3WLJA 1QRTA 3EPHA 5KL3A 1AUQA 3DC2A 3LYHA 4NH4A 5LP6C 1B2RA 1NBHA 5DBFA 1QDLB 2D2EA 1O94D 2FDRA 3ESBA 2EEZA 4KO1S 4K5QA 4JP2A 4ETMA 2N3GA 2AEEA 4NLLA 1I36A 1PZNA 1W35A 4JJ4A 3QF4B 2REQA 4Q1BA 3RBVA 4XQGA 5BURA 1BN7A 4HWRA 2JCXA 3AEKB 4D4LA 4HAUA 4PAQA 4ZCMA 4LF4E 4UCQA 1SNYA 2Y27A 3EA5A 1ZYUA 2VTDA 3QVVA 2XNHA 5EXEA 1QZXA 4BLSA 5DTRA 1JNXX 4X7BA 1U1EA 3J80C 1XDGA 3PQEA 3QITA 4IGEA 4L8FA 4R9NA 5JXIA 4JI6B 4F6RA 3UT5B 3QZUA 2LVBA 4KWYA 3G1WA 4ZV7A 2X2PA 3PGMA 1KL7A 1Z45A 2JCBA 3P9XA 3K8OE 5DEOA 4MA4A 3OE7D 4RKFA 1E7QA 2H18A 3PT5A 4OH7A 2GZ2A 3PIDA 4R1OA 2HDNB 2AJTA 5F7JA 1B15A 2V59A 3DFMA 2BBOA 3ON5A 2WE7A 4C3ZA 4LYAA 4GXRA 2LKCA 2O8DB 1L5OA 2PMWB 1X6VA 4G1MB 2JLCA 4IEFB 5KYWA 2H51A 3DDWA 3CMCO 1T3HA 4YR7A 4BMZA 2GEFA 4D9IA 4J6EA 2G8LA 4BNWA 1ECBA 1WM1A 1P2BA 3O8OA 1QQTA 4II7A 2WBSA 5DTJA 5LA6A 1KETA 3BRQA 3WLLA 3A9UA 4TTTS 3GLGB 5IKOA 4DFDA 3Q2OA 2EGGA 3IUQA 2EQBA 1N2HA 5IULC 3AVPA 2Z1MA 3A4MA 2UUCB 1ONNA 4ZANA 3WK7A 3HB1A 3AYZB 4JLKA 4OGFA 4PHTA 3EBLA 5L4NA 2ZDQA 3WGJA 3OKAA 2P75A 4UEJA 4E7PA 3HKCA 3TG2A 1D8TA 2Q2VA 2BI7A 4RD4A 1X7GA 4HNHA 4J0QA 3IMEA 3INTA 2B1GA 4BRZA 4C78A 2SBTA 4CM4B 5BR4A 4OLAA 4WLOA 1G38A 1KKMA 5EXXA 4DUPA 2RGCA 3G2IA 3TSYA 5FUQA 4N5LA 3RD5A 4EPYA 2BLNA 5DBEX 2APJA 3O92A 1HI9A 3C3XA 4YRRA 5FOVA 4C6TA 3ZHRA 4CQMD 5EJ9A 4XE5A 3RS3A 2XGGA 4TTRA 4L5NC 1BG6A 4WWHA 1G20E 3UJ8A 4IKEA 3DXFA 5JBNA 5JANA 1NT2A 4R2LA 1U0FA 1SCAA 3G8YA 3QIVA 4W5TA 1WB5A 4J7CA 4RIEA 3WRYA 5A6BD 1UBSB 4X54A 1VSUA 1MRNA 1GAEO 2EATA 5L3ZA 1V5WA 3LAWA 1ZRSA 2JGDB 5GTDA 3UMMA 1U0BB 1UXGA 3EVCA 3KFXA 3JQEA 2O2ZA 3A27A 3EJ6A 3HLKA 4JL8A 2GPSA 1PDAA 4KVFA 1RWQA 4QELA 4WMLA 4EITA 3UGKA 3W2HA 1WPGA 3S2YA 4MCHA 5I6DA 3RC9A 4MVJA 2OKCA 3AR2A 5KTMA 1E8DA 3GNQA 1UODA 5HK9A 2BZ1A 4BP1A 2MT9A 3EF0A 3FIUA 2OB1A 1Z4KA 1ZK3A 2XMZA 4MI6A 3TOXA 3KQLA 1Y8RB 1O7JA 4YGYA 4EA6A 1RYBA 3PEFA 5DE3A 4DQUA 3KUDA 5CYGA 2NOAA 1RYHA 3CVJA 3DWIA 3KB6A 4U7HA 1PCXA 1JJBA 1Y80A 2R00C 1RRVA 3KWJA 2IEAA 3LDUA 5ITSA 3AW9A 1LZKA 3QX9A 1ZHHA 1P5ZB 4FYYA 3ZXXA 2AOWA 3AP2A 1GG5A 2QI9F 3LT0A 3PIIA 3K0BA 1SKQA 3F7OA 4IVPA 1C29B 1PGNA 4CN9A 4QGHA 4RORA 4RABA 1BGWA 1C4OA 4GP7A 4UDXX 3K6JA 2ZSFA 3SBXA 4C4ZA 2XWQA 3ZHUA 1YS4A 1Z68A 4LBZA 5GAJA 3SDBA 4R1SA 2BFEA 4DR6B 4ZVNA 2JS7A 1PFUA 3EDRA 1XCOA 3DBRA 3CFYA 3QG5A 3WGKA 3D3EA 5I5EA 1AKWA 3H2SA 3SXPA 2Z8ZA 5KPJA 1JW9B 2YJTD 2BHLA 2PJDA 3K70D 4DV4B 4GPIB 3ELYA 5CLJA 1MB4A 3DAOA 4MHTA 1TO1E 5C5IA 1Y6GA 2YCBA 3JARA 4LC9A 4PRYA 2YRXA 4R2DA 2AL7A 1XD9A 2R66A 2ORWA 3KUCA 3LOQA 1C2TA 3QWIA 4TTQA 3NHKA 3RABA 3S7TA 4NECA 2RSMA 3VYXA 1K1EA 1NM5A 2NM0A 2NW6A 2XYGA 2QSJA 3PFNA 3OCZA 4MW0A 4Q1DA 3RKRA 3GVHA 1D6JA 4G23A 4XAQA 3CWZA 1KI4A 4MPTA 4MIEA 4URUR 2NZ2A 2EDCA 3AR6A 5T3UA 1ZGJA 5CPFA 3OQOA 5HMMA 1VJ5A 4I55F 1RYYA 4LF6E 3TAXA 3WNDA 1U8TA 3WSWA 4TTPA 5D87A 4RTRA 1T8WA 2IYEA 5D7BA 5JZVA 2H1WA 1L4YA 3OFVA 4HWGA 5F12A 2OLKA 1CJUC 1P6QA 2J4DA 4MJ3A 2PGNA 3IDAA 2GRAA 1DFIA 4ACAA 2EOFA 1HT1E 1XZHA 5I47A 1YS1X 5HGXA 4C4AA 1U6KA 2W90A 2R87A 3L1VA 4KB5A 1A88A 4PSCA 4V0OA 4CU2A 1HZZA 4MUBA 1CUWA 3ZE8A 1Z4QA 1IHYA 1XKTA 2QRPA 3EOZA 1OZGA 2NQ8A 1R4NA 1R66A 1VL0A 2QUJA 1WX1A 2SHKA 5AW2A 2A0YA 4R8KA 2L3JA 4NYJR 4FN4A 1IG3A 2BFCB 2EX0A 3AFMA 4O8ZA 1RBYA 4AKEA 4JLWA 1RRPA 4IFTA 2ONYA 1I0LA 4IOLA 1PO7A 4R2XA 2GJSA 1CDDA 2X3FA 3NAZA 2OAEA 5FIUA 1HH4A 1Z75A 3B9PA 3H17A 5DLQC 2XQIA 3W6UA 1EFVB 4HUJA 1XKXA 1SURA 2JJ2D 1JLLA 3OTQA 1HRDA 1SXJE 1X7ZB 4HBZA 1S3SA 2B34A 1IQRA 4NU6A 3TLYA 3EEQA 1Y7IA 3WDSA 4NIMA 3W8EA 4BU0A 3IB6A 4G4JA 2R7AA 4PQRA 1HNNA 4R9VA 4O4HF 5G0WA 4EAQA 5DHTA 1TF7A 3ACBA 3QPUA 1WP9A 4YGXB 4IH4A 3T52A 3NRBA 3G0DA 1WIWA 1T9CA 1G8PA 2PUHA 3ZK7A 5M04A 1Y81A 5GV7A 2C0QA 4JBHA 3NW9A 4GLFA 5AK6A 3S40A 3QE2A 2PG3A 1P18A 3TIIA 1LD3A 3UJPA 1AO0A 1VPVA 1YAJA 4BAGA 1BEEA 5F5NA 2LRSA 1SMKA 3RIYA 4MOWA 3T7AA 2VPXA 5D1HA 2EJVA 4RKYA 1WPRA 1AXRA 3GARA 3AUYA 2G9NA 3TVDA 1T0BA 5C8VA 1WVGA 1JGTA 5LLDA 1E0AA 1DX4A 2WTNA 2IU0A 1UF9A 1NL3A 1W2GA 2YX1A 3DFKA 5G1OA 1NQWA 2Y0EA 3TMKA 2WFLB 4KTVE 4IKPA 4OXQA 1Q91A 2PWBA 2QGZA 3DULA 3KT8A 5ARCA 1NUTA 3MWLA 1QP7A 4P6VF 4JMPA 3EGDA 4Q4HA 2A0UA 2PBFA 2L33A 4Q7JB 4JU8A 3BCHA 2HCTA 1B41A 4LJLA 1LSJA 2Y6UA 2FW8A 3OE5A 1PJCA 4DJTA 2FX3A 3HU3A 2QIPA 4R2PA 4R1NA 5EIHA 1JHMA 1OROA 3OAAA 3CUUA 4YAKA 2BUBA 1WD5A 3EHEA 2OXTA 1G2DC 4ARAA 1Q6YA 4JYAE 2JI6A 5A1JA 5BOSB 4NFYA 3O8LA 1ZK4A 3D7SA 2MSNA 4G2TA 1I7SB 2EOXA 2X9GA 1U1CA 4YJ3B 3AL3A 2PTHA 2XOXA 3N05A 3MS2A 4ZDWA 4HWOA 1U31A 5KOIA 1NURA 3PDCA 4MQBA 4LWPA 4I81A 1OQAA 1IBLB 3G7NA 4UAGA 2Q46A 3PF8A 3U7EB 3CH6A 4QUDA 3VGJA 3UV7A 5IRCD 1T3ZA 4L4RA 3DJFA 1XK6A 1SCNE 4AU1A 4HGOA 3HKDA 5KNBA 3GGCA 2OFPA 3KPJA 5EJMA 4Z51A 1D6MA 3T0IA 2EOJA 1L8QA 1Q1ZA 4YP5A 1T6NA 4FR2A 4OHBA 4R8RA 1WL8A 2PSHA 1DO2A 3MGBA 1P2DA 1SWVA 1ZEJA 2ZBRA 3RBZA 3TLMA 3I12A 3L0SA 1FFXB 1AF4A 2VHUA 3IXMA 1FLDA 1N1GA 2AZMA 2W22A 1D9XA 2I1LA 3FNEA 4MGKR 4ZKEA 2PZGA 3V4RA 2W42A 1A7UA 1ID1A 3TGPA 4IOMA 4L4UA 1QZTA 1RI4A 1MXFA 4X95A 4OM8A 1XMVA 1STUA 1YHNA 3D7NA 3L01A 3PX2A 4I9GA 4PV7A 4EB0A 4EHFA 5CFLA 3I64A 2IBSA 1NPTO 3IEIA 1E60A 2P5TB 3TVYA 1CDOA 4MLZA 1BWSA 3I9V1 3WYCA 1TM5E 2VN8A 3H9CA 2NAFA 2AI3A 4Q9KA 1NBEA 3U19A 4WDQA 3ZCXA 5JAZA 4EZIA 2IYVA 3UB3A 4DUYB 3GOHA 1T13A 2GVNA 1KU6A 2QZPA 2QDKA 4DUZB 2A5DA 3GQBB 1S2DA 3F7MA 2XZTA 1PBNA 3FPFA 2FV4B 1SVKA 4MW9A 4X41A 4CL8A 1G18A 1XV5A 1N0WA 2XEXA 2I3ZA 4DLAA 4HRAA 1BB8A 1UK6A 3LE8A 3JPYA 4XRGA 1X9HA 2YYAA 2EMWA 1UT6A 1KMHB 2AMVA 3LOPA 4NQRA 4GPBA 4XM1A 2H1VA 2QP9X 4FHCA 1MJGA 3FVTA 3ST7A 1O9BA 2F62A 1YZ9A 1ZAYA 3H9BA 3SMVA 4LRSB 3AB3A 2EM8A 1N9GA 2YN2A 2B5OA 2LZ0A 4BFYA 1II8B 3Q9LA 4TT3A 2QV7A 4UEOA 2AD1A 3KB1A 4PZ0A 2AE2A 1K6JA 2IVZA 3EDMA 4QRIA 1EFTA 1VJ0A 4M7WA 2BD0A 4HZUB 4AY4A 3WGIA 3A9RA 3VOSA 2D5IA 3IP8A 2QHXA 2QG4A 3T5CA 4US1R 4ZIRB 5JDIA 2ONJA 2B1JA 4JI5E 2BM9A 4WHMA 5DM70 4IHAA 5K4AA 1SIOA 1Z7EA 4AMUA 3NKLA 3RIMA 1XA0A 4B82A 2J5QA 1COWA 3MT0A 4EVIA 1X1CA 4BQPA 5J1SB 3H4VA 4QGAA 1YCDA 3TQSA 4BJ1A 4Z54A 1YASA 4MR7B 4BPRA 1JAYA 4FC7A 4NCAA 2XIQA 4ZCSA 2Y0DA 3W79A 3NZEA 1WMFA 3GP3A 4GMHA 4REQB 3WLIA 3UB4A 3WZ2A 5AVUA 3HLTA 2AX3A 4X1KA 3E82A 3HWSA 2FPKA 2QRLA 3NBZC 2AXEA 3NC1C 4OBBA 5LZ7A 3HB4X 1SK8A 5C3MA 3O4FA 3QJ5A 2VS1A 3QFRA 4XGNA 2XTMA 1RM0A 2WHQA 3K05A 1F6BA 1FE8A 4NPAA 1VPEA 1YOVA 4FYIA 3PZRA 1PVDA 3DA8A 1RMDA 1E92A 3KZXA 3OIWA 2W6NA 3O9VA 1TF6A 2Q3MA 5F7ZA 4WACA 3QKRA 4LY0A 2ZATA 1ZU5A 5CVUA 5FWDA 5TS3A 3SN6A 1G8SA 6ADHA 2OHXA 4ENPA 1SPBS 3M6AA 4QPDA 5EP2A 3UFXA 1V47A 3PFFA 4CIDA 2RG1A 2G06A 4PNPA 4XSHA 4IF4A 1USWA 1B0ZA 1YQDA 1ZOSA 4MVJE 7REQA 2I4TA 3R7LA 3EPLA 3CXRA 3QYAA 4D4GA 5I7RA 2QVXX 3WDLA 1HG0A 5REQB 2GM3A 4J2TA 4DIBA 2RGEA 4M8LA 2R1TA 3ZQKA 5ALXA 4ND6A 3K96A 1J7JA 5IT5A 4CLEA 4DV3E 2Z4SA 2IYNA 4FK5C 3WHPA 5F9MA 3UMVA 3O84A 3F3MA 4Q3EA 5CITA 1QOQB 4Q7EA 3H84A 1DT5A 4ZTZB 4PS0A 4EKIA 1S89A 4WECA 4O2BA 5I4CA 4N82A 1T9ZA 3IPYA 4Q48A 3VR4H 4Y2JA 1RCTE 4F9EA 5CEFA 1OC2A 5BV0A 4P5DA 1JEJA 3JWJA 5C32A 1R10A 2Q9AA 1GTVA 3EFBA 3HJGA 5AH0A 3EEBA 5G0UA 3KSMA 3X44A 4BWGA 3H1PA 2IZ1A 2OCKA 1YR9A 1NLUA 1G7SA 4TTSA 2AYXA 2PM8A 4H7IA 3BCSA 4AK9A 4ZMRA 5BORA 5DN6D 2IUYA 3HRHA 3KSBC 2AFIA 3ZXUB 2AJLI 1A1SA 2X7XA 2F8TA 1VGQA 5C2JB 2B4RO 2WJHA 4MGHA 5DO9A 5C4IA 2CV0A 5L7YA 3ANYB 4KWEA 4L0QA 5E38A 3R0JA 4G07A 1P72A 2C2KA 4F4FA 5ADHA 5DCYA 1I2MA 4G0OA 4E03A 3OKCA 3IEKA 2VUUA 2Q07A 4DM4A 2JEYA 2HDWA 3VX4A 1H8HD 3WGQA 3ZHZA 1VRCA 4CQLB 1CDEA 5FLXC 1FFSA 4LHWA 3U7FB 3TUJC 1RC0A 1VJCA 1IK6A 1SBHA 4O6VA 1ORVA 1NVUQ 3I72A 4L16A 3ONVA 5CUQA 4AUEA 2PCJA 5CFRA 5DU2A 1ZJJA 2EE8A 5ENZA 1YBAA 2AA3A 3H5NA 1QC5B 3SU8A 5LOVB 1PJ8A 1ZLXA 2ZU6A 4FCWA 4Q7KA 2COKA 4GRDA 4Y6OA 5LB4A 3DAPA 1QZUA 1Q3KA 4IUCS 3C5HA 3PQ7A 2CYBA 2QRJA 3IHKA 2FG6C 1Y8ZA 3EZNA 4FWBA 4QUKA 3PENA 2V89A 1EM6A 2DUNA 1HA3A 1RRFA 2QTWB 3LYUA 4MWGA 3RV4A 1YDWA 3GLKA 4J0IA 3UXEA 2C4KA 1SCUB 3O38A 1MJHA 1TNDA 4FK8A 3BZUA 4LKOA 2OXFA 1CY2A 3DCNA 4RTNA 1PX2A 2BRUA 4NBUA 3SXUA 2FSIA 4O4JF 4C2UA 2HRDA 2G9UA 4RMJA 2N9UA 4RQBA 5B12A 1FTSA 2EMIA 1SM4A 1NF9A 1IY9A 2QRVA 3ITKA 2F2TA 2Z3ZA 2ZSBA 3E1GA 4DMHA 2ABWA 2IYPA 1M1NB 4FOSA 2XHEA 3KQTA 4CTMA 2ZM6E 3AVOA 2Y1CA 5LQRA 2CJYA 2DH5A 2PX5A 1G5TA 2IU3A 4IDAA 2LCQA 2FQYA 3FMVA 3DTVD 4IW3B 1M3SA 4OL0A 1IJKA 3TH5A 3OHMA 4H6WA 4MQFB 4EMUA 1T4CB 1VXOA 3FCXA 4L8LA 1R0LA 2CL0X 2QE7D 3TINA 3BGOS 2V83A 4UJ5A 2AT1A 5JI2E 3JAKB 1I3LA 3JAWB 1Q3TA 1ST3A 1XJ5A 4W7SA 3WGVA 4YLGA 5IKPA 1P7PA 5K6AA 5EYPA 4W9NA 3E9RA 3STXA 1NW5A 4GKKE 3QU5A 2W6JD 4C6HA 3OPYB 5AW5A 3G49A 1N2GA 3Q3HA 3CX4A 1SGWA 3GD5A 4YDRA 2O2XA 4RY8A 1ZVMA 2OD9A 4O4LF 1SN7A 2F9MA 4RD0A 4ECEA 4MVJI 2PX4A 2JJ8A 3L0BA 1DC5A 4ZPXA 4BMXA 3T9DA 2XKBA 3K6RA 1JFSA 5J2UA 3PWTA 4H4EA 3LYAA 2IYSA 5E3JA 5FV4A 4RKEA 2RS7A 5AVJA 4OXXA 2VRCD 3SQOA 4O0LA 4F06A 4GICA 4BMNA 1R8XA 3TMAA 3EXFA 2PVCA 4PTZA 4I46A 4RTPA 1CUDA 1WEKA 4KMRA 5EVCA 4ZEXA 4PZYA 4F2DA 3MHTA 3R77A 4EK9A 4ND5A 2PGIA 2P30A 1EA5A 2W0SA 4OG2A 1PTJA 3PA8A 1HQDA 2P1RA 3UQYS 4GMKA 5IARA 4LK2A 2O54A 4OJQA 1O89A 3G0OA 1FNBA 5FUBA 1XP5A 3W6PA 2OFXA 1ZWLA 3HJTA 2O2SA 1CUVA 4C7JA 5IKMA 2PFGA 3MYYA 1KRWA 3QTBA 5BYKA 4N48A 4ALIA 1ST2A 2FQ1A 4RVNA 1BMDA 4BC7A 3DDHA 1K3UB 1Q44A 2B7BA 4NG5A 1R6UA 4OB6A 2MHCA 2BF4A 3E58A 4KE7A 3RHFA 4DOMA 4EB3A 1Y7TA 2QPAA 4KJZA 2XLCA 3NHRA 4B1FA 1NNEA 3ZKWB 1ADGA 1SKAA 3BFKA 4G41A 1M0SA 2JG3A 5JC1A 1NV9A 1KJJA 2ILTA 3K92A 4DLKA 4HAVA 1VPDA 3O8DA 2EBWA 1TT7A 3KJZA 3Q2IA 4OMDA 3E7WA 5CNIA 5KSPA 2GHIA 3ZOQB 3TCNA 2ZYTX 4BGIA 1QR2A 2W6PA 1J09A 4GYKA 4HXEB 3OF2A 1E94E 2PL3A 4NDZA 4RDCA 2IY7A 3WZMA 5IAAA 2QN1A 1OI2A 3BGVA 5ADZA 1RMQA 3GF4A 2FY8A 3EEYA 3HGTA 3BCUA 4JJ6A 1L5GB 2ZRQA 3VNAA 1EDBA 1IXZA 5JMPA 4JJKA 1UZMA 1KY5A 5LNK6 4YHHE 3M3DA 5KKNB 4Q9DA 1YJBA 1E99A 4JT2A 1GZUA 4YUZA 1AV7A 5CVCA 3THWB 1LXCA 2CKMA 4G84A 4M8NE 5L7WA 5E7QA 1DKUA 1PDWA 4LDJA 2XCRB 4PG4A 2GN2A 2HSJA 2QNIA 3LIIA 4H4DA 5AJTA 2YHIB 3G23A 4Z9AA 3LY7A 3RTBA 1QOZA 2LIPA 4KQXA 1E2DA 2DHEA 1SULA 3F8WA 4N7JA 1NW3A 1EH5A 4EG5A 1F2TB 2JFZA 3ESCA 4LHZA 3KT0A 4A15A 2LDXA 3KCQA 4RZIA 5HZHA 1BXGB 1T4DA 3JWIA 3BSWA 4UBJA 3I2JA 1T8YA 4G4SO 2DFDA 1K8YB 3PNKA 2Y92A 4KFRA 1TL7C 2QTLA 4DQLA 2B7CA 1Y34E 2PAAA 1JIXA 2W11A 1G8HA 2J9FB 3RSGA 5K8JB 1QHSA 1QVWA 4OIMA 1WJPA 4EM6A 4B8YA 3P4YA 1O57A 3TZEA 2KLBA 2VHWA 2J85A 3DBVO 2YHBA 3E2MA 2EPUA 1KAQA 3GMIA 2HNKA 1JDPA 3SYMA 5KS2A 2QJWA 2ZYWX 2XB2A 1N7GA 4LOJA 4B4WA 2AW3A 2HLNA 1YL6A 3G5MA 3KOWA 3AINA 3VHXB 2IYZA 2J3MA 3VKVA 2ZWMA 4PRLA 3ZCPA 3FVQA 4QG7A 1XK7A 2YNMC 1M6VA 2F3TA 1T9KA 3BX1A 4I5FA 4DB2A 2G07A 2VPQA 1VGVA 1LLUA 1NUPA 4HB4A 4LRUA 5JCJD 3W2GA 1OPXA 3RYHB 3SK0A 1DBVO 1EWYA 2LNDA 1QAMA 1Q1BA 5I4BA 5C8YF 1RJEA 2FP4A 3TZKA 2AZXA 2F4VE 1U2GC 5ALRA 4DY4A 4OMCA 4YASA 3UW3A 9ATCA 2H4XA 1CZOA 5HFAA 1M67A 3VU9B 3P1XA 3C0KA 3TEMA 2WWFA 1VM6A 1JPNA 3FMGA 2NU6B 4R8VA 4X85A 1QAQA 4ZI7A 4KTTE 5JISA 5CX1A 1KQNA 4A5SA 1ZCZA 4PVCA 4TWJA 1ZGHA 4DYDA 4IIYA 1XX6A 2AG1A 3ASVA 3CB4A 5K6TA 3IA2A 2V58A 1ZR4A 3ER8A 1JALA 2OMKA 5CB4F 3VPGA 1QNLA 4TLMB 4DMKA 4XIGS 5C8XA 3L8MA 2HCBA 1TCVA 4DA9A 3U5ZB 4AJ1A 1NUSA 3B1VA 4Z8YA 3RAGA 4F7WA 3SYLA 3TZLA 4FFWA 1AF7A 4IEIA 5CLQA 4B6GA 5HX7A 4L9WA 5DM1A 5EIXA 4JC4A 2IHR1 1SELA 2Y76A 3ZIAA 2VUTA 2PXAA 5B53A 4UM7A 5BQOA 3TPCA 5KNDH 2WRZA 3ACCA 2RHJA 3VSAA 3UWMA 4GO1A 4XD7D 5COAA 3IWBA 5B1DA 3UUGA 9MHTA 2WUVA 3D4OA 3W34A 4KBFA 3GVIA 4IJVA 1Q7GA 4LF7E 5CA1A 1NWCA 2XLBA 4QOFA 1XWIA 2E49A 1T5LA 2F3UA 4DLNA 2G83A 2P2YA 2CLMB 1PR9A 3BL5A 1S2MA 5FCDA 4JVLA 5K2MA 4NXMB 2ZZMA 3L4EA 4WFTA 1Z25A 2XRFA 3PHIA 4S05A 3OH8A 5IMSA 5L3SA 2XSZA 1TADA 4QL3A 2VYVA 4DGSA 4EEKA 5IZCA 4EPRA 2DGCA 1X2EA 2QZJA 3PV0A 1A8IA 2XEDA 3MHHC 2BMEA 3K2BA 2FFAA 1N6NA 5JD5A 1NVGA 2HK6A 2PPLA 4N54A 1GRRA 3IULA 2JFWA 3U3XA 3ZD9A 4UUAA 3OKFA 3LH5A 5K9ZA 5DTIA 1HT3A 3CLVA 2E18A 2OPBA 4JXJA 3TLAA 1SWWA 3I9MA 4NBRA 1SG9A 3PYXA 4YP1A 5EWMA 4F7DA 2OXIA 1PDVA 4CM3A 1BFDA 5AICA 5EGNA 1JR3E 3P9ZA 3WI7A 2PR2A 4RZ3A 3EPJA 3AIIA 1QIEA 3WKBA 5JH7F 3NBAA 2RARA 4CM8B 4QATA 4YQYA 2YTJA 3KTDA 2ZSAA 4C0AC 3P9CA 1VMKA 2AFIE 4IJ5A 1IVSA 2DUMA 1W0KD 4U2DA 2FWMX 3F6CA 2WP0A 1FJGE 1TJ3A 1U28C 1P1KA 1KQ3A 1V8OA 3CX6A 4HQRA 4RE6A 3RC2A 5HRCA 4DLXA 5K3EA 2VJMB 3GLIA 2IHTA 1KTIA 5FPTA 3QQ5A 2FMTA 5ALQA 5EZYA 4DJ5X 5LP6F 2NMVA 2GB4A 1WWKA 1CZNA 2R2GA 2MDTA 3D6VA 3HCAA 5AM1A 4DXDA 1WR8A 3TF5A 3AEZA 2A14A 3T35A 3R9XB 3RIEA 4QXRA 5AOVA 4WZAB 4LYDA 1KFJB 2EJBA 4LK3A 1XZNA 3LBFA 3NHAA 3QOWA 3DZ8A 5EZ6B 1CVRA 2C2BA 1CT9A 2W6MA 3DDSA 3FAKA 3I4LA 3PPVA 4KLNA 1T4GA 3EJWA 3UK0A 4HH1A 4E5PA 2PUVA 3PFBA 1BGVA 1ENOA 5EIAA 5LQCA 3PC3A 2I22A 3CX3A 3IVAA 3FR8A 3SKXA 3TNFA 2EJWA 3Q3CA 3EXEB 2GVDC 1ZK2A 5KQPA 2C2HA 1FDSA 5BO5A 5C1BA 1G41A 5BRJA 4OOGC 4NU0A 2OXEA 1H4SA 1MO6A 2BZ0A 2X8JA 4RFSB 4G0MA 1XRSB 4O02B 5IF9A 4WPGA 1PQWA 4D9MA 3G2KA 5KOHB 4DT1A 2FEKA 5C8ZA 4RM3A 2P9HA 3NVKI 3TLZA 1E6MA 1OHHA 2E2WA 4OBEA 4AB1A 5DSTA 4Z4IA 2QROA 1GG2A 2G1AA 3HR7A 2VJKA 2ZS7A 1WSWA 2N3ZA 1G2IA 3EXHC 1I14A 2YH2A 2F48A 1JWLA 2Q5IA 2UAGA 5G3YA 5AFSA 1FP4B 1FC0A 1ZD4A 2BFFB 1E64A 2C8KA 5MFPA 1OFUX 1YL7A 2Y1KA 5DCUA 1IQUA 2J07A 2IRWA 4O2AB 3VDRA 4AIRA 5IXYA 4OJYA 3S2GA 4NCBA 1IH8A 4IFIA 3EFOB 1JQBA 5BP7A 4RDXA 5K0TA 5BMVA 4I14A 4C1BA 1TFUA 3KO8A 3BPSA 4PHGA 3V2IA 4IY1A 5DNYA 1J7KA 3PCRB 1G98A 1ELOA 3WWOA 1I4EB 3H0KA 3NNNA 4TWIA 1C8VB 1B42A 3ETDA 4S35A 3AP1A 4XDYA 2VJQA 1HDRA 2GJ9A 3CH4B 2B3TA 4OHUA 4BCBA 2EN8A 2OV8A 3QXGA 4Y2YA 3A3NA 1JB1A 4NMWA 5HEKA 821PA 4WXPA 1KI1A 2Y2UA 2ZI7A 4EVQA 2O8CB 5A9SA 5ALDA 5DGXA 4U39A 1WG8A 5G0SA 3H2GA 1SFEA 2EPMX 1GUBA 1AK9A 1M1YE 3F6PA 4HC4A 1B26A 4F5DA 4EGSA 2WSLA 5F51A 1XTVA 1Z0AA 1B6SA 3NEJA 4PC6A 2I2AA 2I55A 2VQFB 4S1OA 4AMZA 1MNQA 3DAYA 4EI8A 2CCKA 3LPAA 1U4SA 1YZNA 4QOJA 3J81C 5U1PA 4B34A 2AC2A 3D2BA 1EFUA 2OCAA 1OU0A 2X2FA 4O4IA 3DMTC 4OXRA 3RT1A 2GGSA 1NJFA 2J4FA 2D7JA 2LP4Y 3NASA 4JITA 1NC1A 2IZ5A 4PO8A 4EFDA 1NN3A 3ANTA 2EOAA 4B3FX 4KN9S 5IG2A 3RNOA 4ETIA 3N75A 4DV7E 1OXUA 4UTOA 3AJAA 5E8RA 1VIAA 2W2PA 1DXYA 4AKHA 1H9BA 2RONA 1NQXA 1O08A 4DJJA 1LU9A 1X3LA 2RAUA 1MT0A 3DUFA 4WTOA 4RVCA 4YJKA 2YXDA 1L1QA 2JZOA 2VHJA 3L43A 4OFWA 3SQNA 3ZI7A 2EBUA 4DRYA 1GTG1 4UNIA 1DCFA 1G3UA 3QMVA 1UPUA 4A91A 1TW2A 1AT1A 1XHEA 3OJFA 3VI4B 3GC6A 1UJBA 2FX5A 5TS2A 4XYEA 4IXTA 3F8SA 3LDFA 5AVQA 2WIFA 3QU4A 2RHRA 1Z6AA 1NQTA 2TS1A 3O4RA 2CXPA 4ZCTA 3TB4A 3WMFA 1SXJD 1YOBA 1PUJA 4DEYA 2HC5A 3J7AG 4JYBA 1J5PA 2ZBFA 2Z5LA 4EHDA 2EOMA 3SF8A 1XCGB 2YRWA 2ADFA 5CFMA 1O96A 3W5CA 4PONA 5ALFA 3LKBA 2VRBA 4IVNA 4TGLA 1Z0UA 1OIXA 2HF9A 3I2YX 1TGVA 4YRCA 2E5FA 3LV8A 3FCAA 2BFAA 3OQJA 4A23A 1MLDA 1CBUA 7AT1A 1L3IA 3GJRA 3MHSC 2QSUA 4O3FA 3PFGA 2P68A 1ZC4A 2V7WA 3NXKA 1TU0A 2O2JA 2Q2QA 1O77A 2YMQA 3CJQA 3F5SA 1E5XA 3NFRA 1Q0UA 1RHJA 5EE3A 3VR6A 3WRVA 4NXNB 1LV7A 3JALA 2FMIA 3BIXA 1GPJA 3KYDA 2UYOA 1ODKA 1DAIA 3HRIA 2VZEA 3I9NA 3UG7A 1UT8A 1L1EA 2ZUBA 5E0OA 1YZUA 4JUIA 4L74A 4X94A 1G5IA 4QREA 2WTEA 1V39A 1B8OA 3Q7PA 3KZYA 2CLCX 4S0ZA 4ZTBA 1TRHA 4S2UA 1HQYE 1A5ZA 3U81A 2P0YA 4HVCA 1T1IA 4I8XA 2ZULA 4BFTA 1U2SA 1MAUA 1UDWA 2AOUB 2G8NA 2WWXA 4X7PA 3BWXA 4KGZA 4XQ9A 1UOEA 4LISA 2GOYA 4A2QA 2HRZA 4HSGA 1HLPA 4MUHA 3X1JA 4PAOA 1E9EA 5E1BA 3FPGA 3C3BA 2VRWA 1BJKA 2XYVA 3LPCA 2G4LA 1TECE 3CF2A 4BMDA 4EF6A 5L95A 1VLLA 3ZDBA 5KYUA 1JSZA 5A6AA 3QVXA 3HPZA 4ZAVA 1U7TA 3L4BC 4UUBA 3Q85A 3U4QA 3SS7X 4MHSA 2X5NA 1JDJA 1FRVA 2ZJ8A 4G5YA 5FB3A 1A8HA 1QIHA 2ZBQA 3I83A 1IXRC 3IDOA 4GH5A 2CXSA 4QTXA 4WLFA 2ZJ6A 5T4FA 3TEJA 1VSTA 1QQBA 3AR4A 1Z12A 3EWAA 5AT1A 3EISA 4HJRA 2PNJA 1VKJA 3W5UA 5AVXA 2WMDA 3SIPA 1R9MA 2GYUA 1V5EA 1L5NA 5KUTA 2GEDA 4Q35B 2WSIA 5E0KB 4EEZA 2EL7A 3ASYA 4OAQA 1ECJA 1OAAA 1X1TA 3IEPA 4F3NA 4QPCA 4JC5A 2RGRA 4R8OA 4J0JA 4DHEA 1J23A 3DVSX 3PKJA 3FYDA 4NHRA 4E94A 1CJKC 4QXPA 4JI1B 4H1HA 2OWEA 3TQIA 3LXMA 4ND8B 1WCYA 5YASA 3PGXA 3OZ7A 2JIRA 2BSXA 3K9WA 3S1AA 5LQSA 1XUOA 2VOJA 3OX3A 3TEFA 1R9NA 1RQPA 3KP1A 1PJ4A 4R83A 3WMEA 5BNZA 2RHWA 3ZFOA 2JK0A 2MR6A 3I6ZA 1V8PA 2FI1A 3P0IA 5AKZA 1SUDA 1FLNA 3FPBA 4FOLA 4BB9A 3VKFA 4FEAA 1QH8A 3D5QA 4FW8A 4LDPA 2GNOA 1B8PA 4M1WA 1GA1A 2OHIA 2I6SA 1R0BA 2VPZA 2POCA 1S4QA 2E4YA 2WFAA 3AY0A 4I7EA 1QU3A 1ORRA 5EUCA 3SX2A 4DKXA 1RKXA 2G1KA 2F1JA 2O3RA 3F6GA 1ISIA 4YCDA 1Z8NA 2C5AA 3NJRA 3DBHB 3IXQA 1L8OA 3CS3A 3GMSA 3LBYA 4HD8A 4WN9B 4YAWA 5PNTA 5JATA 5AOAA 3DE3X 3AEUA 4MO2A 4X8HA 5TQ0B 3L1KA 4CHTA 1JECA 1F06A 1HTBA 2QGFA 2AGVA 1SD1A 2Z2JA 3G9XA 3I23A 4JK3A 4WV3A 3VXKA 1L3BA 2GBIA 4E2ZA 2PX2A 4QQ8A 4DCVA 2JAOA 1U3VA 5KC9A 1KBQA 1NNSA 2R2AA 2ZLBA 5GJWC 4B2PA 3FNFA 3L8DA 4D0NA 4KP7A 4GL2A 2GN1A 1D03A 5HTKA 2K7IA 2P62A 2AIRA 3B1KA 4IWYA 1GUZA 5FI0B 1J97A 3VZBA 4FMDB 2FJUA 5BN3B 2Z5FA 3PRHA 4YCAA 1P91A 2P2DA 1NI4A 4RH1A 1VDZA 2X9LA 1NG1A 5EQJB 3UC5A 1ZVVA 3GZJA 1LC0A 3JATB 4PAMA 3GCXA 1AOXA 4Q4AB 2ZWOA 1X74A 3AG6A 4KAJA 1ENPA 2I4OA 3MWYW 3QF4A 5B3KA 3W4JA 1NWHA 3NGMA 1A1HA 1ZSNA 2CBXA 1QO9A 3AEKA 1JZSA 2JOBA 4QZVA 2RH4A 2ZSIA 2Q1YA 2YZNA 3BEOA 4INAA 2HHHE 2PUGA 1KOJA 4OL9A 1UWVA 3Q41A 4UBIA 3LP5A 4N01A 2GM4A 3HCOA 2ODPA 3EEIA 4P3NA 721PA 1E2EA 1RBZA 1UIMA 1U8EA 2Y71A 1JKFA 1Z2PX 2EFJA 4PQYA 3TIFA 2HJGA 1KVTA 1TLTA 3F7TA 3M4ZA 3O3MB 1WCWA 4N0QA 3D2AA 3GVPA 1KA9H 3J81k 4M1ZA 1Y3IA 1NFQA 2DVMA 4MAMA 5L3QB 1JDBB 2G40A 4DLYA 2HW8A 3KE8A 2UUAE 3UCEA 1J2JA 4Q3OA 3RBAA 4A7PA 5IJ0B 2BBSA 3IP9A 3HUFA 1OAOA 4K0KE 3SG0A 3WMGA 1U7OA 1MRZA 1V2HE 5CCXA 1IFXA 8MHTA 2PSFA 3YASA 2XF2A 4ZZ3A 3VR2D 4RH0A 2JVKA 3BK2A 5DJ5A 1HDEA 5B64A 4QDKA 3DV2A 1LDYA 1P39A 5DTQA 1V3TA 2GBGA 5M3BA 1BWRA 4CYMA 1BVYF 3ICPA 3R76A 5DHPA 4WKNA 1K3TA 2I71A 2FWJA 1X86B 2X41A 3DLHA 5JEEA 3LUGA 1LB1B 4KREA 3NANA 5F2OA 1EVYA 1OYVA 1GN9A 4R7GA 3HYTA 4JXXA 2GK7A 1DEXA 1VA4A 3TLGB 5KJCA 1OOEA 4GKVA 2HHCA 2YQ4A 4IBOA 5NLLA 1QKJA 3CZMA 4CM4A 5LZ9A 3OA0A 2ZK7A 5MHTA 1N5IA 4N6NA 3JYPA 3ND7A 2OGUA 3PHHA 5LCXA 4JJAA 3GJTA 1FMLA 2ZCJA 1T4MA 4ENVA 3ZIUA 3DZKA 2QT0A 1P1CA 2NPIA 4PCAA 1PJRA 2JIMA 5CCDA 4CM9D 2GARA 1NMQA 4MI3A 5HF6A 4E4YA 4CI9A 4WADA 4WCDA 1QHGA 1Y7LA 4YALA 1XPRA 1QE3A 4U2BA 5LIPA 3SHFA 3SC2A 5JNUA 2J67A 3ENVA 3IIIA 2KI5A 1O54A 3KR0A 4RA9B 4O24A 1A8SA 3BYZA 5KL2A 5ES4B 4P4TA 1TFRA 3EVGA 3RS2A 1UJ4A 2WNIA 4RPJA 2JAXA 1DJPA 1T26A 2Z8YM 3GEIA 2W8ZA 3JD0A 4U7GA 1W5AA 2AFHE 1IM8A 1PBTA 4KN8A 1WXWA 5KTNA 1VYUA 2PWZA 1AUVA 4TVKA 5KTKA 3WIUA 1KTVA 1P4AA 1YQWA 1TCUA 2HLPA 3FWZA 1F9AA 1SHTX 1Y8RA 3WGTA 2PGLA 4E3ZA 3WWYA 1PG0A 3KCNA 3TPFA 3G6KA 2ZSKA 3FDIA 5FADA 2V0CA 2IOYA 1QFZA 1FYEA 5FV7A 1JK2A 3TLKA 2GZSA 4DKKA 1NE7A 3C3CA 4MIKA 2WB2A 3R5SA 3S8MA 3VR3D 2YUIA 1KZHA 5FBHA 4HAIA 1Y5RA 5LZ4A 3ZN2A 5DXJA 1I6LA 3QY9A 2PJUA 5HIJA 5HZKA 3DFIA 1WS6A 5DN9A 1CJBA 4EJSB 1OJLA 2C83A 4Y1EA 3E81A 2IEIA 3M99B 3FSGD 3W2IA 5B36A 1LCIA 3TTTA 4BECA 4QFDA 5IU6A 4ZGBA 4KXVA 3QYJA 4B83A 1OLSB 2DQZA 1KZ7B 3RC7A 1P62B 4I50B 3I5YA 3O4GA 3T54A 1YRWA 3E3LA 5EI5A 3F4LA 4G63A 2XNDA 5KYXB 3A6ZA 5HGJA 4JV5E 2GBCA 1USIA 4LWOA 1VDMA 1Y3DE 5D84A 1XMOE 3JXEA 4HQ6A 2H8GA 4DBVO 2HA6A 2Q9UA 4FYJA 4OJNA 3VBEA 1ZQ9A 3KAKA 4E3WA 3T5DA 3D8SA 2VHQA 1C7EA 4KKVA 3DCYA 4PSUA 5JLAA 1UBKS 4UXHA 3W8FA 2NUPA 3JAMC 2J30A 2YU8A 3M5CA 3AX6A 4FS8A 4LPKA 3RADC 1IHOA 1DRKA 1P0MA 3DE1X 4FOOA 4LZLA 1JQJC 1C4WA 1R0XA 5A3VA 2WE8A 3RQSA 3VTFA 4EQZA 5B1YA 3A6JA 2DPMA 4R2IA 1UPTA 2RFLA 3EH1A 3AV0A 3NIFB 3RSQA 4C7BA 3DM5A 4GP9A 2QBYA 2NVUA 1K5DA 3ZLUA 3PX7A 1R00A 1I3MA 3SE7A 1A9QA 4H0CA 4DR5E 1GILA 4KX5A 1FDWA 5AJXA 5BYBA 4B3JA 2IP4A 3VZCA 4GPTA 1N2XA 4KFSA 3K3PA 2F8MA 2BH9A 3QA3E 4F4DA 2XNKA 1CV2A 5BNIA 1KPGA 2YHUA 2QRUA 3ESAA 4KR9A 1NRXA 4JI4E 2GCNA 2YJ4A 3B36A 1AGXA 2YIVX 1DQRA 1E2NA 2QP4A 1JEDA 1MFPA 4FFDA 4FJ2A 4KXUA 4YT8A 1FCJA 2ZJ2A 3GVXA 2MSDB 5THXA 4DC1A 2RB4A 1V43A 1UFRA 3OLZA 4HDNA 4EGFA 1UMBA 1UWKA 3DOHA 3HV0A 5D8DA 3TSZA 1VBNA 2ID8A 1JHDA 5IXSA 3JVEA 3AHDA 1G291 4R9SA 4XFJA 4KNYA 1Z8HA 2O52A 1JEQB 4YJ2A 1DDOA 1FFGA 1VZ2A 4RVGA 4C05A 4YMGA 1R18A 1ORHA 1AKTA 1QX3A 2P3LA 3VZSA 4LX0A 5DNEA 4LE0A 1H2RS 1UP4A 3TNJA 1E4VA 3Q3JB 5E2IA 2OEPA 3VKGA 3DBLA 4NZNA 1O2DA 1R6XA 3A6EA 5JSKA 1KMMA 1U8FO 1ZJYA 3H99A 3LUAA 3S2IA 4BNNA 5A5GA 1X8JA 3MD0A 3OQ6A 2J0UB 4J4HA 4PGHA 4REOA 5I9BA 4EBBA 3BKWA 3GBPA 4OEHA 4YV7A 3OTOB 4J0KA 1NX9A 4GEQB 1RPJA 5A5EA 5BSVA 5KHLB 4UM5A 2I76A 3FUTA 2WILA 3ROTA 1W8IA 3LRXA 5TGDA 1ZI9A 4LRTB 3RB8A 1PR4A 3UMGA 1HLGA 2O2YA 4HAYA 3TPZA 1IOWA 2Q0XA 2FMXA 3BXZA 3MBKA 4NCHA 4FEYA 1NVWQ 5D6OA 5EMHA 4DSTA 2HT1A 3BBLA 1YNOA 2AH5A 4FT4A 4PANA 5B30A 2B7TA 4PVDA 2X1MA 4HVLA 2LV8A 4JAVC 1T9HA 2B3DA 3BK7A 1K5HA 2M2IA 3N8KA 1QV9A 1NZDA 1TK3A 3WGYA 1DXQA 4OQPA 2REOA 3EVNA 2W2KB 2ZT5A 1GTZA 4LWZA 4A82A 1KZYC 1B69A 4EA7A 4YBRA 3ZWVA 5FWXB 4YUYA 5A2QC 4FGSA 3TRIA 1I80A 4EUNA 2HQSA 5AW4A 2ZJ0A 3F3YA 2WTBA 1NX6A 4ABTA 3NM4A 2ZGVA 3JQ8A 3T61A 3ZCVA 1E1DA 3QKTA 2EIHA 3M89A 2JB9A 4ZRDA 3K9FC 5KSZA 3H04A 5JQGA 2X2EA 3MBOA 1FQOA 1SQSA 2OL4A 3B9BA 3EY9A 4M2ZA 4JZYA 3UAXA 1GAQA 4YAGA 2JGEA 2H7YA 3K8ZA 2ZCUA 4JI7B 3PFKA 4N3GA 3AHHA 4BMVA 3H7AA 2JFPA 2B25A 1GTSA 2QXYA 2ONCA 3GK3A 4PW0A 2EPRA 1OFIA 4H9GA 4YJ3A 3CSDA 4CIXA 1NGSA 3KU4A 3RC3A 3SQDA 5DTMA 2VE7C 1AGPA 3FPLA 1SHLA 2W2TA 5DX1A 5B58C 1AURA 3HKBB 2VDVE 2JCVA 3ICCA 1ZD1A 5F2KA 2IH4A 3D1VA 2RI1A 4QJ4A 2ODBA 2PEZA 2C3YA 1YZLA 2WVHA 3AF0A 3DZFA 3BOSA 4DLUA 5EJ2A 5ICMA 1H05A 1IBCA 3AW8A 1E2IA 5DT2A 4HNGA 1LBTA 3GAAA 2PRYA 3IB3A 3KPVA 4HX5A 3EH2A 4FIDA 4L28A 2MINA 3IKLA 4OQEA 2G09A 4WLEA 4OXIA 4LE2A 4DILA 4Q37A 2QTZA 3QVSA 5FXMA 5FWAA 5IVDA 4AYTA 2CVHA 3AVQA 1U4NA 3D6JA 3DZBA 3EIWA 3IUEA 2PWPA 2VJOA 4DA0A 4QE3A 4XQ0A 1UPFA 1V3QE 2J0VA 1FUEA 2Q3BA 3R0QA 4A0RA 3THYB 3ADOA 2FPXA 4ZVQA 1V1RB 2R8YA 2ZRAA 4ADSG 2FFJA 4RANA 5JXGA 1E3TA 1OE0A 1NKVA 3JVVA 2RB5A 5KL4A 1IQOA 1WABA 1P4JA 3NS7A 4FYWA 1BHJA 1DAPA 2X1LA 1PV2A 4U2CA 3G2HA 3ZU6A 1XEAA 3MJTA 3QPVA 5B1SA 3HFJA 1AQ6A 2NPOA 2WSYB 3HU1A 4I1SA 2CL6X 4LRYA 3SHVA 4EO9A 1FVFA 2NP6A 1BVHA 1BE0A 5DWDA 3TKYA 3B5EA 3ZWPA 1TM7E 1LI7A 1VFPA 1HR0E 2XOEA 3JTZA 3LCRA 2V86A 2XBUA 1N8SA 4L3OA 2PBZA 3G9ZA 4QX6A 3CXUA 2Q8NA 2HPVA 4EUHA 3HVJA 3BMOA 2H2AA 2PD6A 4MVJH 2F1OA 1PG2A 3NWPA 4JNCA 2I3DA 4ARSA 1KMHA 2XAAA 2F4NA 3OJOA 4N49A 4OI2A 2FEWB 1OLOA 2I2BA 4B3ME 1CUHA 2IYYA 1SOVA 3GPDG 2QJRA 4KMMA 4CRWB 2HQ1A 2AYYA 2ZBDA 2BEVA 1FQKA 1GOTA 2EWWA 4Q1VA 4BV2A 4JENA 5KYYB 3PL5A 1II8A 3WYEA 4AKSA 1OY1A 4XPIA 5H8WA 2Y0CA 3PC4A 3VH4A 2IF0A 5I4IA 4WBNA 4TL9A 2P41A 1XGKA 3HP7A 3L8ZA 4NICA 3P9IA 5LYJF 2OO5C 4YXFA 3H5LA 4B3TE 2GHRA 2XXAB 1QRUA 3G0HA 2C5EA 2CVFA 3TSOA 1OXVA 3O03A 4V24A 4Q6BA 1XAGA 2WW8A 3HFRA 3UJBA 2BGGA 2PT9A 3BMXA 4CF4A 1E9FA 2LCEA 3B7PA 4MR7A 1C3LA 1UL1X 1XU9A 1QGZA 2E72A 3NM5A 3R23A 2G6TA 2HM7A 2VDWA 4GNKA 1ZH0A 2B2NA 1PT9A 4REQA 4EYKA 5F35A 4BP3A 1JR3D 2BHSA 3H8SA 5C46F 1DBQA 3UOGA 1FQWA 2JLRA 3VU8A 2FW7A 4IIUA 2VNSA 1HT0A 2FUKA 1FS5A 2BGNA 3CX7A 3LP8A 1Q0QA 4PXAA 5KVQA 4EG6A 1JYEA 4OQYA 4QU8A 2EPKX 3PUZA 3VV2A 2HK8A 1AKEA 1G7RA 1CU1A 3PJGA 2V7UA 1FX1A 1EFAA 3UTCA 3OC0A 1W49A 2POQX 5HJ2A 2QENA 1V25A 4BMJA 3DUWA 3QE0A 4H0FA 4LGMA 3FSEA 4LBVA 4NULA 1FXUA 3GPLA 2DR3A 4HJXA 4CM7A 3W90A 2B94A 3MD9A 2ILVA 4RNCA 2P9EA 2RK4A 1YQEA 1G2OA 1RZ3A 4FFOA 3NO4A 5BUSA 1JFFA 3N0TA 4W5JA 1EEXB 5D3KA 2NU9B 4BNMA 5LQJA 4MS3A 1LNSA 2AI1A 2HPZA 1XMQE 2XTJA 3II6X 1ABBA 3WKDA 1UBRS 2H3EA 1TQ6A 2V7EA 4JT4A 4KE6A 4KK4A 4L8GA 5TPWA 2I9IA 1X19A 1GPLA 2P4UA 4Y2XA 5ALPA 3VKHA 1CF2O 3PNOA 1MW8X 4G09A 3ZX4A 4WE3A 2JLZA 2DHQA 1FFYA 2NO5A 3ZDZB 2X7HA 3FE2A 3M49A 1LPBB 1Q1QA 4BNDB 4YRMA 5ADUS 1IBME 3ME5A 3CH7A 1VBKA 4UZFA 4YUWA 4E4RA 2LBSB 2GZAA 3IC5A 1GCGA 2HTEA 2GWRA 1L4KA 2XRMA 2IW3A 4TYPA 1CF9A 4PLTA 2E3JA 2R1ZA 4HDQB 2HNAA 2PSEA 4E31A 3EVAA 4H2DA 2FNAA 2WTAA 4LC1A 5EWLA 3NP7A 1XNQE 1JEEA 3DW3X 1HYGA 3KOOA 2PYIA 3JTEA 1OV6A 4WOCA 5JS2A 1KP9A 2CLIB 2W2VA 4NJMA 4I9NA 1L5QA 3MQ2A 4W1SA 4KC0A 4LBYA 3KEQA 3C6MA 2KHXA 4BKMA 1EJ0A 3GN2A 3P2EA 1USKA 5A9RA 1PW5A 1V5FA 3PJEA 4QT4A 2EW2A 2AQ8A 1V9CA 5HUHA 3IQZA 1HNZE 4XX1A 3KETA 1HL7A 1GZ3A 3HGMA 4GW3A 4QFBA 4ARZB 4HNVA 3QVUA 1I6MA 2V4MA 1ISJA 3LU1A 5TVGA 1H9CA 4NBNA 3ZLBA 1I0IA 1KQOA 1O5TA 4HGNA 4PQFA 4UMFA 3JQAB 1I7PA 1NSTA 2AC7A 2CNKA 4KWTA 2BFOA 3VHRA 1QC5A 5LOVA 1VP9A 1C81A 1RWPA 3USCS 2ZAOA 3KNZA 1CP2A 5CFQA 3PXDA 5BN5B 4K88A 1PN3A 5MN4A 2QLBA 2R76A 4DMIA 2WUGA 2AEMA 2VDNB 2YXLA 3A32A 3HBMA 1X6HA 4OUKX 4TUYA 4OI1A 2AOTA 1YC5A 3ZDXB 3ZJYA 4K2HA 4BZQA 1I13A 3R7NA 3Q1LA 3TX2A 1NOKA 2HIAA 1Y5NA 3K9GA 4D4MA 3W3AA 1I9GA 3GNTA 2EZ6A 4I1UA 1Q92A 1GPYA 3IIKA 3ROPA 1ONPA 2QVGA 5EKDA 4IUYA 2E21A 1IPFA 1H2EA 2J9XB 1WF3A 2OCDA 1H69A 3CN9A 3Q7QA 4PPQA 1EUCA 4O08A 4G0WA 4H17A 4AN1A 3ZFRA 3C14C 2ODAA 3NTRA 4ZAFA 4KG7A 1ONBA 3ZFPA 1MO5A 1M1NA 1IZ8A 4TTJA 5JD3A 1FYWA 2A1UA 2Y66A 1W1WA 2ZVQX 3TLBA 2FMHA 4CPDA 4R84A 4CUJA 4Q47A 5BW5A 3ZWWA 3R3YA 4Q01A 4Q1CA 3X1DA 2RKBA 4B4OA 1QK5A 3L8GA 1SEVA 1EWQA 1H93A 3ECAA 3NHFA 1C7FA 2VK2A 5J4VA 4QUIA 4MQFA 4MP3A 1NXQA 4MYUA 2FN9A 5K4HA 5JNWA 3OECA 4I66A 3VJLA 4O8CA 2CZQA 5K3OA 4IWNA 3UAYA 3VJRA 1KEVA 3JAKA 3JAWA 3NVDA 4OLHA 1Q2UA 1MJ5A 4UD2A 1JQEA 1YS2X 3HCPA 4NFSA 5CTAA 3KHKA 4NZMA 1OFGA 1HDYA 1Q3HA 4ZZ0A 4YRSA 2FHSA 3L7MA 5AKXA 4EELA 4JKIA 2BIFA 2BP7A 3T5GA 1BXZA 5TQVA 2ZRLA 1N5LA 4FHDA 2B92A 3HDVA 2HO4A 2WPDA 3NAMA 4JB8A 3E61A 3UA3A 3OOWA 4PCVA 4UBOA 5KNBH 3MVEA 1QKIA 3AR3A 1C7RA 3FTPA 3FPEA 4FU0A 4JB3A 3EG9B 2R6AA 3A6LA 5FD8A 3RG2A 3ZGYA 4YCSA 3VPBA 1X0VA 1G1AA 3DM9B 5LQNA 2FTKE 1W4AA 3ZWBA 3KZOA 1A72A 3WZLA 1Q57A 2AS0A 2FLVA 1T5DX 2ZRCA 2ZRPA 3K20A 4P22A 2HU8A 4W9NC 3A2KA 4B46A 3A4NA 3U7QA 4F85A 5AVSA 2B5VA 5F2NA 2VNIA 4P78A 2EKBA 4MWTA 4LJKA 1GNQA 4L5BA 4D9JA 4AFNA 4EGJA 5IABA 1NY6A 2HGSA 3OEEA 1SUPA 3TUZC 1QYWA 4AQ7A 3P0EA 4N76A 2W2QA 4KWIA 3C6YA 4E5MA 4CEIB 3BT7A 3JQQA 3M1IA 4UE3S 2ZIWB 4GSYA 1Q7RA 2ZXUA 1LBEA 1NE2A 2YCLA 2Z58A 3AHGA 3ELUA 3ZFTA 3OEHD 3D8NA 1HQCA 2C2WA 1GR0A 3OQIA 4G8DA 4ENQA 2Q6VA 3E03A 2EQ3A 3IWDA 4RKQA 3UJNA 1YMUA 5IJ9A 4ND2A 4CDNA 2X1VA 1S3IA 1PR1A 3ETCA 4IGFA 1L1RA 2ZROA 4HNAB 5F5LA 1AS2A 5IM4F 2BBTA 3BC1A 4C7OA 1GSAA 5C7YA 1EESA 1POWA 3ZKWA 3PXGA 1PKXA 1EH8A 1DIAA 2AXPA 2JFQA 2YTZA 3K0KA 5D5PA 2YRHA 2EMFA 4V38A 3CR8A 1ZO8A 3D4NA 1CZKA 3EAGA 3FCSB 4G3XA 3RFFA 4LY9A 3WHIA 3ZYZA 1MN6A 3E0XA 3UWDA 1LH0A 1ONOA 5FA8A 3I3SR 4G0PA 2HLDD 1U3TA 2QQ0A 3PSAA 4W7HA 1LPOA 1S7CA 2JI7A 1UMCA 4Y6QA 4OK3A 1JQKA 5A4DA 4OA5A 4L0MA 3WL3A 3WLRA 2GD0A 2WJVA 1XDZA 4A36A 4O25A 1E2GA 1R8QA 3JQ9A 4NJOA 1X94A 2ZIEA 3P9RA 1YUMA 4LMPA 4X8OA 1XAJA 3O91A 4XQCA 3DL4A 1GQQA 1EFHA 1P0QA 5EPUA 3R9KA 3WDMA 1KE2A 1UKBA 2GJAA 5EUQB 1R5BA 3OCUA 4AJ9A 3THWA 4L8YA 4UASA 2J0QA 1JG6A 2P5SA 5JAPA 2EPZA 1SKYE 1HE1C 1N9ZA 3ANMA 3RYIA 1OWPA 5DI3B 4OKSA 4H6XA 3KX2A 3K09A 3FG9A 2M4IA 4L3WA 3KKNA 3V8NA 1UZNA 2YHIA 3B52X 4OY3A 1E2LA 3WWZA 4HFJA 3BE5A 4K6HA 4B6RA 2C95A 3I53A 2BMJA 2Z1NA 3CGWA 3CO5A 3WL7A 1F2TA 1I33A 3IHWA 2GCOA 1B74A 5GINE 3CLKA 2RKWA 1YQUA 2ST1A 4TVBA 4UPDA 5F78A 2EFHB 4CDRA 3P2YA 4C6RA 4EVRA 2CB9A 5BR8E 2LIVA 2CNWD 5CG1A 1KEPA 2R8XA 4MWZA 1ZOIA 1CEEA 2GPAA 2Y1DA 5FR2A 1X7YB 1H2AS 3MOGA 3A1FA 5EIEA 2I6FA 3EMBA 3N9IA 5DM2A 2MU1A 4E5SA 3EN0A 1E1CB 3A58B 1CRWG 2VDJA 3UBMA 1CHNA 1RM5A 2EJTA 1M2OA 2NQTA 4GPD1 5FX2A 4DR4B 2JWOA 3AKYA 4OSOA 4ZO7A 3ZOZA 3PLAE 1KJIA 2JFOA 4UULA 2X13A 3DEFA 3MMXA 5FNVA 4U4AA 1NLZA 2EL9A 5EZ5A 3VHXA 1H94A 2BV3A 4DQ0A 1F14A 3TBFA 3DHWC 1ZIPA 1IUOA 2WKPA 1A1KA 1DEHA 3TUIC 1LLQA 3FGPA 2D2VA 1HY3A 4IIGA 3QTTA 2RJOA 5DCLA 3PC8A 3IJRA 1T6XA 3ZU2A 2AF3C 2LUOA 1SUCA 3HACA 3QVTA 6YASA 1JG7A 1BBOA 1X8KA 4CKCA 3PNPA 3M5WA 2GT1A 4HQKA 3MGCA 5M34A 5CGZA 3W5DA 2Q4OA 1XZEA 2ZI5A 5F1YA 4Z4CA 1Y82A 4OH1A 5AJVB 3A05A 5CAEB 2IV3A 4E30A 3UT0A 1MU0A 4KQHA 1JKMA 1M2HA 1MORA 2NU6A 1LNZA 2QAGA 5C51B 4WK6A 4XWGA 4LRXA 1H2BA 1XD2B 2FR8A 4ZOCA 2ECQA 1PT8A 1U90A 4JBNA 4YT5A 4DM3A 2DPYA 3RJ5A 3IQXA 4D57A 2X14A 1PJQA 4L1KA 5DHFA 1V11A 5B6JA 1FDTA 5A0VA 1WXQA 3MERA 2GXQA 4MUYA 4BUCA 1XBTA 2PA0A 3FNIA 2M6RA 3GUHA 2QL9A 3I9KA 4BHBA 2G5GX 4FR0A 3PLNA 2MDRA 3EDOA 3JQFC 4KQWA 3L7AA 2FZGA 2I4NA 3MUOA 4IZIA 1D4OA 4R81A 1U5BA 3ZZNA 3PUIA 4R6WA 5JARA 1JMKC 5BY2A 2VEOA 1WDMA 1M2VA 3B7GA 2VDMB 4MROA 1YIOA 4R4JA 2J87A 1MVOA 3OY2A 1RWVA 2JGAA 2V5VA 4F8YA 4R1MA 2WG1A 2C2MA 2XMCA 3OEWA 3UMBA 1PGJA 1BCRA 1QIFA 2FFQA 4UNQA 5AJYA 5LMNE 1TA9A 4Y9UA 4CFZA 4CTNA 3GG2A 2WD9A 1UZLA 4MKFA 1KDRA 1L4UA 2FRDA 4GT1A 2EF0A 2HQOA 1J06A 1GFZA 1NOJA 1BEUB 2QPOA 1JQLB 4EW6A 3T1TA 3GX1A 5FBRB 1BS1A 1Y8AA 2YMMA 3KKMA 3PU6A 3GUZA 1N1MA 2AF4C 1PT6A 5CYFA 3UUWA 1SKUA 1UFOA 1W46A 1BE1A 3QFSA 4FNAA 1L5KA 4LMBA 1RZRA 4OQXA 4M37A 3W6ZA 5LLTA 1DP4A 3SF0A 4NZOA 2VOEA 5DBOA 1I5RA 3D8RA 3L7LA 2DHCA 3KZNA 4G85A 4BO8A 1AHIA 5BWLA 5KREA 3OJLA 1WUTA 3VFDA 4V03A 3H2YA 2VXCA 1P0FA 4FI3F 3AUAA 1EI9A 3OZCA 4I4TB 5DBHX 5IH7A 1WCIB 3LY9A 4JWTA 2C57A 5C53B 3LMLA 2LUQA 1T0IA 4FYPA 4ZOBA 1VE7A 3AJRA 5J4LA 3Q11A 3OE1A 4R68A 4A6XA 4XUCA 2Q1UA 3N2ZB 3QWHA 1VLZA 3QENA 5K6RA 4Q9NA 1T2CA 1TVKA 4FVTA 4MI1A 3TB6A 1UMKA 1EVQA 2FGGA 4KITB 4IIJF 2FZLA 4EYGA 3BIJA 2GZMA 4HOYA 5HNKA 3D6HA 1V2GA 3S70A 1MJNA 3D7RA 4WPYA 3REQA 3S2UA 1SXIA 2VF7A 2NZXA 1SHUX 2P4HX 3P27A 1XQVA 3MIZA 1I7QB 4FYHA 3DEJA 1ZDMA 5EHZA 3I0NA 5KSWB 4HS4A 1YJQA 1SJ9A 3N2LA 1E6WA 1MAHA 3RFTA 3ZWCA 1TXGA 3R9XA 1N5JA 5JVDA 1M5TA 4HGQA 3T7TA 3L04A 1IM5A 1S7GA 3T34A 5JHGB 5LWQA 3I9FA 2C7RA 1A27A 4XJSA 3PDUA 2VCHA 3TNYA 3AKEA 1IHPA 1VYTA 3ZGOA 3FHOA 1X5WA 3HXPA 4V1CA 5JD6A 1FFDA 4FFNA 3UT6A 2RH5A 4JHXA 4OP1A 5H5JA 4ZPJA 3ZBPA 3AEQB 5AESA 2G9VA 1KGSA 4OF4A 2QMEA 1FRFS 5CDFE 2ZS9A 3EXEA 3K0FA 5DHRA 4ES6A 1FMFA 2OHVA 2JIBA 4I2VA 5IBPA 4Z3OA 1JHPA 2RHOA 2KYRA 3NALA 4LBWA 4RFSA 1VYHA 3HEBA 4NPCA 1UC5B 4JUAA 5CT9A 3GG9A 4XLTA 3NWOA 1E62A 5BUCA 1CFJA 3JVDA 2QR5A 4Z1OA 1QVRA 3RPEA 3ZW8A 4HHEA 1GLVA 3FDZB 2QRGA 4L9RA 1THTA 3T41A 2DMYA 1AO3A 3K32A 4RPLA 1T36B 4LXUA 4RW0A 3OM1A 4GLOA 4TN1A 5KL7A 1M8FA 2CJWB 4GE3A 1KIAA 3OZWA 3EXIB 1AS3A 4KQFA 4HAWA 2OE2A 2YNMD 3HY6A 1PEDA 2ZI3A 1VE1A 4PYLA 3AF5A 3HPSA 1NZFA 4O2AA 5HCIA 1H3EA 1Q1GA 3O8RA 2LUPB 2DWOA 3DFFA 3SVZA 3EFOA 1FTGA 2IPOA 1XNGA 1VJDA 5ERYA 3LWDA 3DEYX 3CSSA 3RASA 3BE4A 2C94A 2D7CA 3TXAA 3RMPA 4HH3C 3T5MA 4AZ0B 4RXTA 1E66A 1UM8A 3UJ6A 1X1AA 3TOCA 3R3WA 1CUYA 5DOVA 1JJVA 2UXDB 4QSMA 1PEAA 4AI6A 1FSSA 3QBVA 4K3UA 1KJ8A 3DE7X 5B3JA 1M75A 4C08A 2O8BA 2EPNA 4L73A 4R1UA 1MV5A 2X9QA 5C52B 2Y2VA 1DUVG 3HBJA 1L7EA 1IZZA 4MWSA 3TQQA 5JC8A 2WKRA 3FMOB 3L8YA 4IIEA 3BKXA 4XUGB 4HKTA 3PUJA 3LF1A 3KQSA 1RQNA 4PLWA 4UEKA 3ZTYA 4F04A 4TKVA 2WMOB 5B3LA 3L7KA 3ORHA 2N3HA 3DBOB 2EORA 1PJZA 4BFSA 2JAQA 3HA2A 3A9TA 3ZD8A 1TQ8A 2XVAA 4MMXB 1N1DA 1T4OA 5HCUA 4CTOA 2I4IA 1ZIYA 4ZT5A 4CCYB 2XUQA 1F8GA 1WULS 2JLBA 4NCNA 2I1WA 1EA7A 1NW8A 2MR5A 4MV3A 4Y7DA 5CA0F 3CINA 2TSYB 4C4PA 2HWKA 2BLLA 4AMYA 3U62A 4BNLA 1E32A 4RETA 5BPHA 1UDAA 4IVQA 4KUGA 1P2SA 3B6IA 1R0SA 3JQBC 2OGZA 5EWJB