3C6MA

Crystal structure of human spermine synthase in complex with spermine and 5-methylthioadenosine
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
361
structure length
336
Chain Sequence
b'SRHSTLDFMLGDGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYDSILNKVEERMKELSVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermine synthase
publication title Crystal structure of human spermine synthase: implications of substrate binding and catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 104
structure length 336
sequence length 361
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.22: Spermine synthase.
pdb deposition date 2008-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
A PF17950 SpmSyn_N S-adenosylmethionine decarboxylase N -terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 3c6mA02
3.30.160.110 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Siroheme synthase; domain 2 3c6mA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3c6mA03
1G8AA 4E70A 4RTQA 4YUWA 4IKPA 1TW2A 4OX9Y 3P2IA 5HZMA 3MB5A 2I62A 1L3BA 2K4MA 2P7IA 2WK1A 2V74B 2ESRA 2JJQA 3R3HA 4QQNA 2P35A 4V0RA 5EKXA 1RJDA 1PJSA 3LPMA 1VP9A 3OFJA 2NXNA 1IM8A 3CGGA 2IH4A 1L3CA 3QV2A 1KYZA 1ZKDA 3KQPA 2VDUE 4PYLA 3OZRA 1UFKA 1NV8A 3E8SA 1VL5A 3GRRA 3RODA 5EHGA 3EPPA 2YUIA 3NWBA 2ORED 4AUKA 3EVCA 4KIGA 1FPQA 3T7SA 5GIPE 2ZZMA 3NVMB 2NP6A 3G2PA 3PT9A 5FQOA 3ELYA 4RTPA 4B17A 1JQEA 1JG1A 3UJCA 4MHTA 2HNKA 1R18A 2CMGA 1WY7A 3I58A 1FP1D 1N7JA 3PX3A 1PRYA 3O4FA 2Y1WA 5E9WA 5E8JA 1JG4A 1XDSA 2ONZA 3M6XA 1L1EA 1IY9A 3V8VA 4F86A 5KYGA 3LCCA 3U81A 4RVHA 2Q41A 4AZVA 1XVAA 5FADA 1EG2A 5CUQA 1FJXA 1V39A 1YFJA 4MTLA 5T6BA 4EK9A 2C7OA 3UJ9A 1KPIA 3HEMA 3ORHA 4CTKA 4O29A 3DMFA 4RSRA 4PIPA 5FCDA 1NBHA 4DMGA 4AZWA 3BWBA 1X1DA 2QE6A 3GNLA 5DRTA 2AOTA 1OR8A 3BKXA 5FA8A 2IPXA 3AJDA 4IV0A 3FRHA 4DQ0A 5CCBA 5LQJA 3TM5A 2IBTA 4YUVA 1Y8CA 5DWQA 5GIOE 2AVNA 5GM2A 5MHTA 5EOVA 4EMSA 3NW9A 3M33A 1XTPA 1EIZA 3A7EA 3OPNA 3VYWA 4PONA 3R24A 1KYWA 4BY9E 3TKYA 3M70A 3GU3A 4R8RA 1SUSA 2YXLA 4DCMA 3HCEA 1KIAA 2BM8A 4HRAA 3GIWA 5EPEA 5CD1A 2P1DA 3PTAA 3ERCA 1QANA 2GLUA 4U7PB 2GA9A 5DXJA 3CBGA 4PCAA 2NXCA 3DLCA 2XVMA 4P58A 3G8AA 3IEIA 4X61A 1D2HA 3TKAA 1ZGAA 5JR3A 3I64A 4M37A 4QVKA 2CWWA 2UZ4A 3PLAE 4PYOA 1YZ3A 3TLJA 4RTNA 3IV6A 1G6Q1 5DTRA 1WS6A 4PINA 4PNEA 4ATNA 3UJAA 1M0EA 2Z6QA 1SVUA 4GEKA 3DTNA 4PWYA 4C07A 3B5IA 4L7VA 5DRYA 3GRZA 3ANXA 2GPYA 5HILA 5DXAA 1SQFA 3S68A 1T43A 3E7PA 1VIDA 8MHTA 3EVFA 4YMHA 5D1NA 4AX8A 3QOXA 4FSDA 4HTFA 3TMAA 4E2YA 2OO3A 3FPJA 3OE5A 2O05A 2BR5A 2EJTA 1I4WA 3AWIA 3LKDA 3O31A 2B25A 2GH1A 2ZIGA 3KR1A 3P8ZA 4GOLD 4OBXA 5CM2Z 5FTWA 4C05A 5LR6A 3G89A 4CKBA 3HCDA 5DX8A 3PFGA 3ER8A 5K0NA 3NMUF 1XXLA 4Y30A 2HV9A 3BWCA 4QDJA 5E1MA 1MHTA 3UJ8A 5B1SA 2XVAA 4ER6A 3FPEA 2ZIFA 5EMMA 4ER0A 3P9NA 2BR4A 3CC8A 2VZ9A 3JWGA 2VS1A 2XYQA 3OU6A 5DLYA 5T67A 2G8NA 2ZFUA 1JTFA 2YTZA 2G70A 2YR0A 2YX1A 1D2CA 1YZHA 4E32A 2NNWB 3KQWA 5EIFA 3UBTA 4MIKA 3SMQA 5C1IA 5FWAA 4RTOA 4P7KA 2PV0A 5K0LA 3DMHA 2FCAA 1WZNA 2PX2A 4QPPA 3EVZA 4PGHA 3CJRA 3DH0A 4CWAA 2OBFA 4XUEA 2JH9A 2PY6A 4F84A 2OB1A 1RI2A 2F8LA 3DMGA 1JSXA 3PS9A 5EMKA 4ER7A 2ZW9A 2FK8A 2N47A 2ZZNA 3KHKA 3FTCA 3UZUA 3B7PA 1NBIA 4ER5A 1P1CA 1QYRA 2AOTB 3GCZA 3H2BA 3HVHA 3IHTA 1KHHA 3HVKA 2EJUA 2IDJA 3KQQA 1ZQ9A 3B3GA 3FYCA 5DM0A 5EMJA 2P40A 1VP3A 2I6GA 3V97A 4R05A 3TFWA 3K0BA 1AV6A 1JSZA 4BLWA 1SKMA 3MERA 2A14A 4FS8A 2EX4A 1ZG3A 2G71A 3NDIA 2I9KA 5CVJA 1VE3A 2FHPA 4FP9A 3G5TA 4BLUA 2OY0A 3EEOA 2GS9A 3ME5A 2O07A 1BOOA 5LQKA 3BGDA 4PIMA 1N2XA 5EG5A 2XYVA 5K0GA 3G5LA 2AN5A 4M38A 4RVFA 3FRIA 1SG9A 2AR0A 2PX8A 3THSA 3GRUA 5LSAA 2PWPA 3HCAA 2PKWA 5F2NA 2ZBRA 5ICGA 1M6YA 2Y1XA 3OU2A 1KPGA 5DM2A 1R8XA 3T0IA 4EKGA 5KVAA 4PYMA 3BWMA 1JTEA 4OA8A 4A6EA 2ADMA 3LBFA 4E30A 2HWKA 4GOOD 5DPMA 5EZSA 2ZCJA 3LGAA 2E5WA 2LD4A 3JWJA 5GM1A 2CMHA 2C7QA 3AY0A 3ELDA 3HA3A 4IV8A 1JR4A 5DM4A 4PYQA 3SM3A 4BLVA 3PB3A 3LDGA 3MTEA 2PX4A 3C6KA 2ZWVA 2B78A 3OZTA 2Z6AA 3EVGA 3NWEA 3FYDA 3F4KA 3CJTA 4QPNA 4HTFB 1KXZA 4RV9A 4X63A 3UA3A 4C04A 5KS2A 5K0JA 2BH2A 3M6VA 3DXZA 3A26A 1U2ZA 2AOVA 3MQ2A 5BW5A 3C3PA 3BGIA 5IKMA 3G8BA 2HR1A 5EZQA 3P9IA 3UJDA 3WSTA 1PJZA 3NJRA 4V0QA 2PWYA 1QAOA 4PYJA 1DUSA 5E1BA 2I7CA 3HTXA 1XJ5A 2IP2A 3TOSA 5CVUA 4ZTBA 5HIJA 4EVIA 2P3OA 3OU7A 3C6MA 3ELUA 3MGGA 2QY6A 3DP7A 4QDKA 5EGSA 5LQAA 3GRYA 2PJDA 4DM3A 2PLWA 3MCTA 3HA5A 4POOA 3LKZA 3KPYA 4FT2A 3ELWA 4RTMA 3MTIA 2WA2A 4YV2A 1WXXA 1ZGJA 3KR0A 3M6UA 3LBYA 3R0QA 4LWOA 3D2LA 4RYLA 4CKEA 5M5BA 1Z3CA 1R8YA 1AQJA 5DSTA 5LQNA 2O06A 3P71T 4GC5A 1NV9A 4KIFA 5K09A 2C7RA 2YQZA 1YFLA 3DXXA 4OA5A 2VDWA 1DCTA 4FGZA 5EQJB 5EMLA 3HNRA 2EFJA 4QTUB 2Z6UA 1B42A 3EVEA 4RWZA 1I1NA 2H11A 3FUTA 4QQKA 2G72A 1XCLA 4PYNA 2OKCA 3OZSA 2CL5A 3GXOA 1AF7A 2ZZKA 4KDRA 5T64A 4EQZA 3SXJA 1H1DA 3KR9A 4P7JA 1YUBA 1SQGA 3SSOA 3KQYA 3FPGA 5ICEA 4DA4A 3T7RA 1JG2A 3G2MA 3UFBA 3A27A 4P7FA 4E31A 1ZHFA 2AOWA 3UJ7A 1EJ0A 3HCCA 3P97A 5BW4A 1XDZA 1L9KA 5CCXA 4Z2YA 3PVCA 5GINE 2BM9A 3SVZA 4YUXA 2AN3A 2FPOA 2P3QA 3Q87B 3KR2A 1P1BA 3R6TA 3R9XB 1RJFA 5E2BA 2WA1A 2H00A 4RTJA 2C7PA 2IBSA 5EC8A 4RTRA 2NXJA 2G1PA 3GGDA 2KW5A 2UYCA 1D2GA 2ZULA 4A6DA 1R00A 5EVJA 3G2OA 5K0EA 2ZLBA 1R6AA 1RI1A 5K01A 5HIMA 3AXSA 5K0FA 2UYOA 1NW6A 2ONYA 3KKZA 4FR0A 5DT2A 5GWXA 4DKJA 1UIRA 4OQEA 2IH2A 2PX5A 1QZZA 4ISCA 2O0LA 5U4XA 4R6XA 2DPMA 2O57A 3A25A 2H1RA 2ZSUA 2JHPA 3CVOA 3I9FA 9MHTA 1NT2A 4M7RA 3SSMA 4LECA 4RVGA 1RI4A 2OPBA 2FRXA 3BGVA 4DCGA 3L8DA 2PT6A 3FUWA 5E1DA 2OB2A 4XCXA 1ORHA 4E2ZA 3KQOA 4PGGA 3KPVA 3LDUA 4G56A 2YXDA 3UA4A 1G38A 1EAMA 4FT4A 3G2QA 4X41A 3AXTA 3P9KA 3FTEA 2FK7A 2JHCA 2PXCA 1XDUA 3IYLW 4WXHA 3TM4A 3A4TA 3BWYA 4FSXA 4C08A 5K0BA 3JWIA 1Q0TA 4QTTB 3B3FA 4PCLA 1YF3A 3MAGA 3JWHA 1BC5A 1VBFA 4RTLA 1QAQA 3KPUA 3LSTA 4U7TB 5HIIA 5FHQA 5CIYA 2OXTA 1KR5A 2DULA 2PSSA 4YUYA 5FQNA 4RTKA 3HCFA 2JHAA 2XBMA 5E8RA 5ERGB 1MJFA 2IDKA 1I9GA 5DM1A 2PT9A 1EQAA 1O54A 3GJYA 5DX1A 4GUAA 3C3YA 1JQ3A 3LCUA 3FTFA 4JXJA 1G60A 5BP7A 4R8SA 5EKUA 1L3IA 2QRVA 3RW9A 3FUUA 3ID6C 3HM2A 4EKIA 3REOA 3HP7A 3I53A 2BZGA 5LQCA 2AOXA 2GB4A 4M36A 4DZRA 4E2WA 1NW7A 5HFJA 4ER3A 5EIWA 5K03A 1P39A 2GAFA 3EEYA 4IWNA 2B2CA 3NTVA 2V7EA 4DF3A 3B89A 5F2OA 4GBED 2ZBQA 3X0DA 4HSGA 3LDFA 4YV0A 3UWPA 5K0CA 2HTEA 3MHTA 2R6ZA 3THRA 2JH8A 5E9JA 3BT7A 2NP7A 3NDJA 1SUIA 2ZTHA 5CVDA 5DTMA 3HVIA 3ER9A 1X19A 1N7IA 5BXYA 2P3LA 3M6WA 2AN4A 3UJ6A 3EVBA 1RI3A 3G7UA 5E9QA 5D1HA 1VQ1A 1UWVA 3KQSA 4GOMD 4HGYA 1NW8A 2NYUA 3B3JA 3I5UA 3DULA 5E1OA 4BP3A 3MCZA 4PYKA 4QVGA 1VLMA 1X1BA 4RTSA 5KQSA 3FPFA 3Q7EA 3EGVA 1BHJA 4CKCA 4OQDA 1RJGA 2AS0A 1WXWA 3EVAA 1FBNA 3EGEA 3T7TA 4AZSA 5IH3A 4C03A 1BKYA 4AZTA 1KYQA 3BKWA 5FHRA 1O9HA 2IIPA 2IH5A 4LWPA 4X60A 4BP1A 2ERCA 4GOND 4HH4A 2AOUA 1DL5A 5HEKA 3KQVA 3E23A 2BR3A 2EG5A 2XYRA 1G8SA 5C0OE 3M4XA 2PXAA 3LCVB 3RIEA 4GF5A 3SX0A 2B9EA 4CXMA 1R74A 3OFKA 1F3LA 3KU1A 5P8WA 3VSEA 3LX6A 2ZWAA 5G02A 4PYIA 4LG1A 5KQRA 2QM3A 4FZVA 2PXXA 2CKDA 5GOZA 5LQUA 1RI5A 2YXEA 3KPWA 3GDHA 5FUBA 4E33A 4HG2A 5CVVA 3PX2A 2YVLA 3FTDA 4KW7A 4WVLA 5HOQA 1HMYA 2P41A 3DOUA 4MWZA 4Y2HA 4UOEA 10MHA 2ZIEA 1JG3A 3DUWA 3G88A 3FZGA 4C4AA 2OYRA 5CVEA 1KPHA 2R3SA 1HNNA 3FUVA 1EJ6A 2PVCA 4OBWA 3SGLA 3HVJA 2HMYB 2IFTA 3OCJA 1ORIA 2NXEA 2VP3A 4YMGA 3TQSA 3K6RA 3P2KA 3FUXA 4HC4A 5EEGA 4NECA 4C06A 3KQMA 3TRKA 4CTJA 4KDCA 3EMDA 2AVDA 2QRVB 4RVDA 3CJQA 3BUSA 1M6EX 2JG3A 3DXYA 3GO4A 5FWDA 2OZVA 2FYTA 3DR5A 5EEHA 1P91A 3TR6A 5FULA 4GQBA 1WG8A 3HCBA 3QOWA 1IXKA 1VPTA 3E05A 3KPJA 3GRVA 1YB2A 3LL7A 4HGZA 4R6WA 5GP1A 3NVKI 1PJTA 2IGTA 3LHDA 3P2EA 3EVDA 3DLIA 3PFHA 5H02A 5DSXA 4H0NA 3KQTA 4K6MA 1PJQA 4KWCA 2B3TA 3SR4A 4KRGA 5LQRA 1TW3A 1KP9A 1X1AA 4GC9A 3A7DA 1JQDA 2P8JA 4XUDA 1X1CA 5FA5A 3VC1A 1XCJA 2QYOA 4F85A 5C9ZA 4RX1A 4E2XA 4YUZA 2ZVJA 5F2KA 5K8VA 3VC2A 3HA7A 4X1OA 1QAMA 4XUCA 4MQ4A 5ICCA 1NE2A 3BXOA 2VDVE 1F38A 3SSNA 1AQIA 5JUWA 4YV1A 1G55A 3C0KA 1TPYA 2PBFA 2AOUB 2ZBPA 3EGIA 3UJBA 7MHTA 2PGXA 3GWZA 2UYHA 3OE4A 3CCFA 5K05A 1FP2A 3LECA 5DX0A 1NW5A 2P7HA 3P9CA 5EHIA 5E2AA 4P7GA 3TPZA 2AZTA 5ICFA 5HIKA 5DTQA 1INLA 3EMBA 1RJEA 3CKKA 3FPHA 4KVZA 2UYQA 3O7WA 1O9GA 1Q0SA 1NW3A 3BZBA 1NKVA
chains in the Genus database with same CATH superfamily
4ZPJA 3LT1A 1YDHA 1C7IA 1EEXB 2AKYA 5BSUA 1TYDE 1EZ1A 1E1QD 1Z39A 3HKDB 4XWOA 1U2DC 2CK3A 3D7MA 1T9GS 3FKQA 3KEFA 2MYTA 3WK6A 1RJDA 5K2MA 1EKXA 3NI2A 5CT8A 5IAJA 2GZSA 1HE8B 2HDOA 2HFKA 2OILA 2QD1A 4K28A 4O1MA 3EQ8A 2YWEA 2W6JD 3S70A 4AUKA 5L45A 2QRLA 5IT5A 5L95A 3AV0A 2BL4A 4B81A 1UDCA 3IAS1 3V8BA 1T8YA 2ZAIA 1UPCA 4IOJA 4D7AA 3GEDA 1P7ZA 3L0PA 4QRIA 4M1QA 4UHCA 4BLSA 2Z2XA 3VPHA 1J0DA 4PZDA 3TYXA 3TGWA 1JIQA 3AJ9A 1JQEA 2EOOA 2DY1A 4H7JA 1JG1A 4BNDB 3L9XA 4JP8A 4TSFD 4DARA 1WY7A 2GJ8A 1B8VA 1FP1D 2OC4A 3I58A 4I4CA 4C6SA 1AGXA 1TM7E 4WQMA 4MR9A 3ZHRA 4RKQA 2YTEA 1N3GA 3LCCA 4FEYA 4JLVA 1G3UA 1KMCA 5CUQA 2ISCA 3TJZA 4FXOA 8ABPA 5BN5B 1NDHA 4Q24A 3WHKA 3EG5A 1IY2A 1KF0A 4JP1A 3UJ9A 5IEJA 4DWWA 4I46A 1XQXA 1DG3A 2EL9A 2ECOA 1YPNA 2EG9A 2OBYA 2WNHA 4HY3A 2JBWA 3AHJA 2QKYA 5I4IA 5LM3A 4G5GA 5JBNA 1P9LA 4QODA 1IOLA 2IYNA 1YZ9A 1E79D 3GJ6A 5EQDA 1QGOA 4IV0A 3STXA 4HAYA 3U3RA 5B3LA 2VBGA 5AW7A 5IJ9A 4OGKA 4EHBA 2XA9A 3GI1A 2QYTA 1T2UA 1UBSB 4LGYA 4MPRA 1VJGA 2CNDA 1B14A 1ZR2A 1HYQA 1FRQA 1WB6A 4BKMA 1WSDA 2JK1A 3A1UA 3HRHA 1U2TA 1VGVA 7MDHA 4R2QA 1SCNE 2ATEA 4H2DA 4YMLA 1IQOA 3CPHA 1S89A 4X65B 2VTBB 5CD1A 2IOFK 2QZ9A 3B85A 1C9DB 1QANA 2YY6A 3KT6A 4IHAA 4F2GA 4PCAA 3WQSB 5FDFA 2XVMA 1NVUQ 3PKJA 3EFHA 1GSAA 4B3CA 4K3UA 4MQUA 1I94E 3L6BA 4S1PA 4DLZA 3BXHA 3SU8A 3A3KA 4YECA 1ICIA 1MKYA 4FFWA 5BSTA 2RBKA 5BR1A 3UC5A 3HUMA 2YOFA 3W4JA 1BKSB 5DTRA 1WS6A 4XLZA 2HCBA 4ATNA 3SF8B 2IDZA 2JXPA 2DM6A 5J5AA 1QK4A 3REQB 1M2GA 3K09A 2NO5A 3L02A 4Q7KA 3KWLA 3ENWA 4WKPA 4YK7A 3QKRB 4P4NA 4HGPA 1YC5A 2OGZA 4KQGA 4ZT5A 4LTMA 5A3RA 4F38A 4F9CB 1PL8A 4CR6A 1SD2A 5E7QA 4RIEA 3ILSA 1QCYA 4Q39A 2HF7A 3R7BA 4EGAA 1AUXA 3K15A 1M75A 1DQRA 2F67A 3BC1A 3CE9A 4JJKA 3C4BA 4L6IA 4Q3EA 1IQSA 5FOTA 5DX8A 1J21A 2PNFA 3RIMA 5FUVA 4FB5A 3NMUF 3JQ7A 5JO0A 2F43A 3I9OA 3CRZA 4GZ3A 3AM3A 5E1MA 3ZCQA 1P9RA 1B0UA 2QAJA 2ZJOA 5ADUS 3VZSA 4AY5A 3OLWA 3ZWMA 4D9EA 2M1ZA 5G0WA 4O4LB 1Z73A 3E5MA 1KOLA 4MB0A 4F2HA 1BE8A 3OQPA 2EKLA 1OX4B 2QDKA 2X0EA 2W4IA 1SBYA 1T9DA 3HUUA 5ALKA 3SHFA 2JFZA 3OQOA 3B52X 2HT1A 1K5GA 4LVOA 1GZ6A 3FKJA 2D1SA 4J0QA 5K0LA 2R8EA 2FN9A 1M67A 4B6JA 1OQAA 3ZHBA 1IVNA 3NJ8A 2VTVA 3K9GA 4K5QA 1VRWA 1IQ0A 2VPIA 2XPCA 4XUEA 1BHQ1 1YU6A 3IHWA 4ZC1A 4DSNA 1LNSA 1O6GA 1FDIA 3SX2A 2GYVA 1R6VA 1W46A 1Z4QA 2TS1A 1RKXA 1TQ4A 3G0CA 4R0VA 1QHSA 1F6BA 3Q0IA 2W48A 4BTLA 3SHTA 2EZTA 3WLNA 4RXMA 1H9CA 3G2IA 4UU0A 3RTBA 3NRJA 3WNBA 4Q48A 4EDHA 1YWGO 5ABPA 4OLJA 2I6GA 4I66A 4LX0A 4PAGA 2VZEA 3C15C 3TTXA 4BO8A 1KXJA 3L0IB 1XQVA 4LF9B 2AH5A 2A14A 2HA5A 3JD2A 4FNAA 2QTVB 2V7BA 1K68A 2I3GA 2LWIA 2WC1A 3D7RA 2X76A 4PC7A 3U7RA 2OD2A 4RHEA 3VTFA 1HG0A 4J1TA 2CYAA 5G41A 1X0XA 1YBFA 1KK3A 3E2MA 3L07A 3FTPA 4KVFA 1E9VA 2VCHA 2C2GA 1GRVA 1BVUA 2IL1A 4KH0A 3WBFA 1PQWA 4UCWA 4BX2A 4EKGA 2O3JA 2QMEA 5FTJA 3AOEC 1JFRA 1NYLA 1OLUA 1IXRC 4AMZA 3C16C 1ENPA 3MWGA 2YYYA 1CUAA 2XUIA 2E4XA 5DOZA 1BGWA 3HBMA 5B6PA 4BLVA 3SM3A 1NPDA 3V00A 3WLRA 3ZTTA 3HL0A 1JRLA 4J7UA 4KHZA 2JLZA 1W5BA 2QPAA 3A28A 2CFOA 4N41A 2TSYB 4YRCA 4RV9A 2XRYA 1DI2A 1KEPA 1D0SA 4HTFB 2OVBA 4X8WA 2ZI5A 3O4IA 5ALGA 3RVNA 4WNIA 2GX6A 5FL7A 3MQ2A 4LTYA 1GRCA 3N0RA 3M6AA 1JS1X 1RYFA 4FBLA 4EZBA 1L9XA 2FU5C 5EZQA 2DPXA 4GRAA 3U4IA 2I7CA 1SG6A 4HXFB 4NICA 2RGBA 1PKPA 4NG4A 1V9LA 3SVTA 3J7Yp 5AK0A 2AFIE 2X1HA 2XT9A 3BMCB 2VXBA 4ZU3A 2WAOA 1TJNA 3KBOA 4LK3A 2QY6A 3SBOA 3K9FC 1Q1QA 1H5QA 4TMFA 2J09A 1DJLA 1RHKA 1TQ6A 3K2IA 4KOAA 4POOA 2Z5FA 5C3MA 1NUQA 5CYOA 2AKEA 2FPUA 1SURA 4WE3A 2GBPA 4JC5A 4S1NA 5J9FA 2NZ2A 3LBYA 1Z37A 4DRXA 4JI2B 1EHIA 1F2TA 2BE9A 4ND5A 5HGJA 4ZZ0A 4AIIA 1UPFA 2JD0A 3OZIA 2WUEA 2JGEA 3DEFA 3P71T 4QU8A 3WYEA 4CI0B 3COVA 5HUJA 1OU4A 3UM9A 4UC0A 4MS1B 4UTPA 3R76A 3VJRA 3PQ3A 3M3HA 3VR6H 3AHFA 3THNA 5DYGA 4JUIA 1A7KA 5HXAA 2F48A 2MINB 2EFJA 3PRKE 4K40A 3JALB 4D8WA 4MK4A 4MCJA 4MMZB 3L6EA 1VHLA 3O0DA 1KGSA 1SCUB 5TE9A 3MTQA 2D6FA 1LQUA 2IUSA 2LUQA 2CNBA 2YNMD 3BF8A 4LJ4A 1SIOA 2J3HA 3HVUA 1YUBA 3I32A 3ZXUB 1EHYA 1YZNA 1Z56C 3H3FA 3RHSA 4DLVA 2JAUA 3G0BA 4RQAA 5CDHA 1E1LA 5ECDA 4NH0A 5JAUA 1RXVA 4AULA 2VWGA 2Y1KA 2AOWA 2IYPA 2JIDA 3GV0A 4NYIQ 3COJA 3RS2A 1H2EA 2C3PA 3PC8C 4Q1FA 3QEBZ 3GNSA 5LP6C 3HBJA 4MB2A 2L2NA 3ZBTA 2FPOA 2W9XA 2H1HA 1JU3A 3KR2A 2CVHA 2ZUSA 3IB3A 4Q3LA 4YC7A 3R7LA 4XQ0A 4A2QA 3L2OB 1IPEA 2QP3A 3ZN2A 2ZI4A 5CB4B 3OLYA 2HBQA 4QTZA 1GKYA 4GKAA 4G1FA 5CLFA 4DLYA 4REQA 1MAHA 4GMDA 2W2TA 3OLXA 2NUPA 4HL6A 4NEGA 5DTIA 2J7PA 2W43A 5EJ9A 2OHFA 4J91A 3FLBA 4JVOA 4KO2S 1EK0A 4KZSA 2UYOA 2ONYA 5J4YA 2PD6A 1B6TA 4MLDA 4BO7A 1S3GA 1L7QA 3A25A 3R3SA 3UHJA 2Q1SA 4CV2A 3G1UA 1NT2A 1DB3A 3BGVA 1AKUA 3M9XA 3E15A 4LYFA 1R4MB 2PDAA 3AUFA 1P1FA 1WX1A 5IT4A 3VU1A 3UNXA 1EAMA 4JLSA 1YSAC 2JHCA 5FEMA 4Z4CA 1C9YA 1V9SA 4FSXA 4BJ3A 1Q0TA 3C4TA 3K6QA 1W30A 3MCUA 1KMMA 2J1LA 2CHGA 1UEJA 3JZIA 5J63A 3OURA 5EL0A 4WESB 1ZCBA 2W90A 3VZPA 1KR5A 2NU8B 3D2BA 1SU8A 1V6CA 1C41A 2R1VB 2X58A 4RTKA 4RQUA 4KKXB 2UZ0A 4F9TA 3MMNA 3T5MA 1ND6A 1DAPA 4QUKA 4XEUA 5IDXA 1J6UA 2DT8A 3ETDA 3IP7A 3V9PA 2YSOA 3DBLB 3X2SA 3KCQA 1Y37A 1K5DA 3GDWA 5AUOB 3M7IA 3NBXX 2BBSA 3RYFB 3BIXA 1KC3A 4WXPA 2WKSA 3QJ5A 3LH5A 4LOLA 3HP7A 5AXDA 5ALZA 1VL1A 5LQCA 1ZISA 1T1JA 3ZV7A 1RABA 1LSUA 1WUIS 4B3RE 3TAHA 1L5QA 1JVNA 3EEYA 3CE6A 1KQFA 3SE0A 2BMAA 3SWWA 3LTNC 3GUUA 3K8YA 4O25A 3DLHA 1MAAA 2HU7A 3HU1A 2XGGA 4FDTA 4WZ6A 3P9QA 1FUYB 1P7WA 4BJHB 1NONA 5BURA 1GNQA 3WYGA 4I4TF 2RHJA 2VTEA 1RI3A 2GK4A 3PHBE 1UKAA 4ZAFA 3IBTA 5IX8A 1WNTA 2QSYA 4WZBA 1KEEA 2O7NA 2V83A 1GU1A 1PI3A 3FSGA 1Z0SA 1KAGA 1U0OC 3HUNA 5DYTA 3RBXA 1VLMA 3LT4A 2NP7A 1HZZA 3EGVA 3L7AA 2DWOA 5CNMA 4A7PA 4Y2GA 1T4LB 1LS1A 3S55A 3OZWA 4BAZA 2AYZA 1LW7A 1XYYA 1ES9A 3C41J 4MVYA 4BX9A 3OG9A 1H65A 4MR7B 5IH3A 1G98A 4ZJPA 5FRDA 1DAHA 5BR7A 2UAGA 3KSAC 4DV7E 1KE2A 2ZRHA 1PV1A 1XTBA 4YPOA 1MPXA 3E23A 3ZU6A 1E6MA 4EYGA 1CQJB 3M4NA 4WX2B 4AIRA 4MLQA 2ZB2A 1FLDA 2A9RA 2BI4A 2OLJA 5J4VA 4IKOA 3UGQA 1J39A 4CQLB 1YA6A 1TMGE 2HCFA 5TR9A 2E72A 2P90A 5JZBA 1XRLA 1MAUA 5B3JA 2ZSAA 5C53B 2REXB 3VSEA 4JUAA 2D9HA 4PR3A 1CQZA 1EA5A 2C31A 3ZHSA 4EA9A 2AFHB 2W6PA 2HF8A 5C8YA 1GR1A 1SKAA 2EZ6A 1Z28A 1RI5A 5DNVA 2J0SA 4O3MA 3M49A 4HG2A 3HKDA 1OWPA 3C39A 3QYJA 4LISA 4XLTA 3DOUA 2HO5A 5KNDD 2IS6A 1EK5A 4K86A 2NW6A 1X3LA 1FSPA 1Z68A 4ETWA 2Y77A 1PSWA 3IXQA 2C2KA 1DUIA 5LZ9A 4BN4A 5B4TA 1U2GA 1KPHA 3OX4A 1FDTA 2P2LA 2FOLA 1XRPA 3G0HA 4QWWA 3H8WA 3OY2A 4MKGA 4RE5A 2W2LD 3MUEA 3HB7A 1T8UA 3NEAA 3H5IA 2YVKA 4M0LA 2XITA 3ON5A 4XWGA 1XI2A 1H6AA 1ZOPA 3BQ9A 3PGXA 1RYBA 4HH3C 3AESB 4JBGA 4MULA 1J09A 1IUPA 4R68A 3FUXA 2HA7A 1JXMA 1YDWA 2YWCA 4C06A 5HF8A 4EG5A 1CJSA 2W2QA 4N3NA 4C0WA 3KVYA 4ZEMA 4TT3A 2P9TA 4QOEA 4ZOLB 2J3JA 3GO4A 2VUSA 5AO9A 5I7HA 2VC2B 2J4CA 1VHTA 2ZROA 4HVTA 5BN5A 3G0DA 3G68A 2QX7A 1F7UA 3A1VA 5BQPA 5EIAA 1I30A 3TN7A 4B3BA 1NNLA 4XGQA 1IXKA 1BA3A 1HSOA 3HLKA 2D54A 3P2EA 1Q6ZA 4JZYA 4MROA 4UXHA 3UV3A 1Q5PA 3EG9B 2ZEJA 2G08A 3WWCA 5CDYA 3MJEA 3P9PA 1O0BA 1VM6A 2XRMA 4YJHA 3ANYB 2Q4DA 1PU2A 1TW3A 2ZUUA 3HJHA 1M73E 1U3UA 2WP0A 4BX8A 1EXNA 3A7DA 3PCXA 3MFDA 1MC5A 3PHGA 4WWHA 4CM5A 1KAMA 1XCJA 1HQCA 2WBLC 1Z36A 4RX1A 2IBSA 2HQRA 4XTRA 1WKBA 2ZVJA 1YJ8A 2HB6A 1ZZGA 2QVXX 2DFNA 3BVPA 3ZHYA 2M9AA 2F3SA 2JK0A 2YZGA 1KAOA 1NBMD 2W83A 3GDGA 4JHLA 5B12A 2YXNA 1JFTA 2V86A 3FVVA 4N6NA 3KG2A 5FNVF 1JKXA 2RARA 2IOHA 3VKVA 1MXHA 1T24A 5HJ5A 2QW8A 1IBLE 4AY2A 4OIMA 2H8KA 4CFSA 4N6OA 3I3SR 4Q3DA 3ZYZA 4I99A 3QKWA 4OP3A 3GWZA 1WVIA 3T7KA 1DC6A 2OTCA 3HJTA 5F3DA 2EM5A 1GTL1 3SD7A 1LSOA 2RG1A 3F98A 4ZV9A 1GT6A 4GM0A 2AZTA 3QUQA 4HLQB 1T2CA 2G7MC 3Q8KA 3QKRA 1IUOA 3HEAA 5E95A 4AN0A 4CIDA 4D3XA 3E0QA 1T2AA 4F9AB 1SY7A 3P0HA 1NKVA 3R0JA 3RVLA 4UUBA 1OA1A 2DHCA 4IKPA 1OXSC 2O23A 5HZMA 1WD5A 4TTQA 1AK1A 1C2TA 1H05A 4UHEA 1HNXE 3C85A 4FHCA 5HCUA 3CVXA 2EZ8A 4NR0A 4OHYA 4MINA 1XZCA 2AF4C 4XXHA 4P1ZA 3ESCA 2YUIA 1SOAA 4FNOA 2PUEA 3NBMA 4E5NA 3A9WA 3TIIA 4G0YA 4O4LA 3KJIA 1CRZA 3GLIE 3P96A 3OZFA 2B3DA 3I45A 1XZFA 4TMVA 1OX4A 3JZFA 4C21A 4B6SA 1JIIA 4W6ZA 1L8XA 4U6QA 4RD1A 3ZCRA 3U09A 3BCUA 4G89A 4UUMA 1U4NA 3VDMA 1A9QA 4DV3E 3N0XA 1XDSA 1DU4A 2VBFA 1IY9A 1HE2A 2FEXA 1XTIA 4AZVA 3IP8A 2Q3DA 5HMLA 3UH1A 3WIVA 4KNYA 4FQ5A 2A59A 4RPHA 5CA0F 4J6FA 4D96A 4QJIA 4KHPB 4Q9KA 4JJ7A 4JI7E 1WSBA 1FX0B 1L7OA 2F4VE 3EVTA 4G2NA 4RSRA 3EAGA 1E1RD 2Q9UA 5A6BA 5I7FA 1MIOA 2B30A 3FIUA 3BKXA 3PNKA 5FA8A 4DQ0A 2BRUC 3QKTA 2HL6A 4TN5A 1G8HA 3AY3A 1SEVA 5J4KA 3TPFA 2R97A 3DOEA 4AJ9A 5TRTA 2AVNA 3CRRA 2QLFA 5FI1B 1L4FA 3BQNB 4ZDKA 2TYSB 3B51X 2PZGA 2EX0A 1W1UA 1XU9A 2QTVA 3K92A 1S2GA 2V3WA 3DBHB 2YHSA 5AXAA 3W4IA 5AW6A 3SLKA 3TIGA 2P6OA 5I48A 3TQQA 3RBVA 5HJEA 1DQ3A 2J59A 4NF2A 1FSSA 1SVIA 3CWZA 2QP4A 4GKKB 4ED9A 1Z0AA 1NJ1A 2YJNA 1XQWA 2KBEA 4QASA 1XTUA 1I14A 2QVCA 5KB3A 3HUDA 2UZ4A 2IPAB 1ONPA 1U0EA 1UBTS 5JRZA 3VPAA 2JH3A 1G6Q1 1PR5A 1Z4PX 2C0CA 4HB2A 1J49A 2CXRA 1II8B 4L73A 8OHMA 4QWMA 2IHBA 1HTBA 4DW8A 5KX5B 2W70A 2HM7A 3CSSA 2LV8A 2NU7A 4XRGA 2FZGA 1K98A 4OMFG 3RBZA 1XTTA 1A1SA 1A8PA 2J0UB 3FFXA 1NVKA 3KUKA 3PQ4A 4G5YA 4Q4HB 1RT9A 5THKA 5T57A 2VF5X 3SR3A 4B79A 5A7FA 2W2MA 1Q74A 3DFMA 3ZJ5A 3QOXA 4E2YA 4HTFA 5CM9C 4I2NA 1MJ5A 1OUMA 4LQCA 4BB0A 5G0UA 3DONA 4OJMX 3RT1A 1GPBA 1S8AA 2GTPA 3AWIA 5HRUA 3KXPA 1E0JA 5EZYB 1ADJA 5MGNA 4V39A 5G4LA 1FQWA 3BGWA 3BXFA 3ABZA 1T5IA 3ER8A 2X9LA 2CVQA 1M2KA 1EUZA 1P4SA 4TTVA 3UJ8A 4AYXA 3LGXA 3RUAA 3SDZA 2LBPA 3BSSA 3BMCA 2QAGC 1BCSB 1U2RA 4HNRA 4DUPA 4FYVA 3OQ6A 4Q1CA 4J0IA 5JADA 5AW8A 1Y1SA 3AHCA 3ZNQA 3KKOA 5FPKA 1XCGB 3KAQA 3FTEA 2YJ4A 1Y1LA 1N7GA 1G2PA 2CYBA 3ZDRA 5EIFA 3SZGA 3UMSA 3PNMA 4RVCA 1M74A 2C8JA 3NH9A 4I9FA 4I9HA 1QU6A 4KWYA 1KETA 2D00A 2Z57A 3AQ4A 5C1IA 1L1FA 1F20A 6AT1A 1X5WA 2BGNA 821PA 4F4CA 2Q99A 4MS1A 1UZLA 4I5FA 4MDEA 2QVZX 4JR2A 2W2XA 1UILA 4LDPA 2EOXA 1W5AA 5HOEA 4P7DA 2QP9X 2PPLA 2MINA 4CNBA 5G1PA 3NRBA 2GBGA 2I2FA 3PXEA 4BBZA 3BTUA 1TI7A 2WM2A 5JOQA 4WLVA 5T8KA 1BBOA 5CDFA 4CMKA 1SCUA 3FROA 4Q5IA 1C30B 1RQPA 5JI2E 4EF5A 4J75A 4NY1A 3UJCA 1FTWA 2A1UB 4CUZA 4X62E 2P4EA 5IFLA 4LQLA 3D6MA 1YKFA 4YTEA 1EFDN 5D3QA 2XMQA 2H1SA 5ALIA 1VGRA 1ZGCA 4AUMA 1QZTA 2J4FA 2Q1UA 1H2HA 4QOGA 1EX6A 4RZUA 2J3QA 5AKZA 5IG2A 3TI9A 1DC5A 3AKDA 2G71A 3IR6A 4OYRA 4P34A 5FPSA 2F3RA 5DZSA 2FHPA 3JR3A 1FYDA 4M0FA 4AB1A 2JDIA 3B20A 4DFDA 4ENUA 4TYWA 4RORA 4ZFNA 3PFWO 3TE6A 1FSFA 1XZHA 1XKQA 1FFCA 4FN4A 3JS5A 2VQFE 1VMEA 5BSVA 4BFWA 5HE9A 5CB4A 3T41A 5KYYB 1H2XA 3AR2A 5TJHA 5J2UF 4D3DA 3VR6A 3F7NA 3GRUA 3R1IA 1VLQA 4O4KA 4OF4A 5LSAA 1N2JA 3L7DA 4FFOA 1KDZA 3HWRA 2J9GA 2WLTA 3UMGA 2Y1XA 4AECA 1RZUA 2XMZA 4OX9E 5K8UA 2XEDA 2HIMA 2V8QB 2R1ZA 4H17A 1YMVA 4D57A 2CLHB 5T6JA 3UGTA 3NONA 1DJMA 1ZIOA 1M2HA 1N0IA 1QO0D 2X2FA 4W1RA 5IWAE 2X9QA 1VE5A 5TARA 1H9BA 3JWJA 4HNTA 2CMHA 1ZESA 4MUNA 1AAYA 4Q37A 2CDNA 4UUNA 2RSLA 2RGRA 2JI8A 1Q0PA 1RPTA 3BB1A 3TKLA 1ECGA 1R4MA 4LCEA 3C3AA 4TS3A 2FOXA 5K0JA 1XYGA 4LY6A 1P9OA 2NWQA 1E69A 3WJAA 1TDJA 3BGIA 4K1XA 2B9DA 2FMKA 3D5TA 2A84A 1X6HA 2PWYA 3HTXA 1XZ8A 4PSUA 3P0EA 4U39A 5KAMA 3IBSA 4UE2A 4WESA 2FSIA 4QA9A 4A6XA 4B7CA 3G8YA 1C1YA 2R6FA 2NU8A 4ZTBA 3TW0A 3H99A 3OT4A 2R1VA 5DGIA 4FZRA 4CL8A 2H8GA 3CNBA 4EZIA 4V02A 2NNLD 4R81A 3WKAA 3B9BA 4LN1A 3GRYA 4D8VA 3OEYA 3GGCA 3IPAA 3MQFA 5A0TA 4PQYA 1ULUA 3CX8A 3TBKA 1XRQA 3DBLA 1T9BA 1GNVA 2ZT6A 2H5IA 3MSXA 1R8YA 3R5XA 3D7SA 3RYFA 4N6GA 4ZT4A 1RRMA 2VPQA 2QTGA 3ROEA 1L8OA 3QVKA 2ENCA 2OCAA 2OHVA 1OFHA 4X54A 4FHEA 2VDKB 1ZU5A 4AJNA 4WK2B 4H7IA 2IU0A 3ZU4A 1QIFA 3D0OA 3MOIA 4GXRA 4KPUB 4PYNA 3T1VA 3W05A 3IVRA 3L4EA 2EMFA 2WJ4A 2A25A 2I1WA 1G59A 3ZXXA 3DV9A 3OMWA 4W9NC 2NT3A 3KR9A 4MRVA 3RUDA 2Q7OE 1IEQA 5KC8A 3V48A 3SG0A 3P94A 3KQYA 2WVGA 1N1DA 4NPHA 3RS7A 2QAGB 4FJ0A 3PC7A 3RTCA 4PG5A 1QV9A 1UBUS 3DBOB 1BXKA 1KDPA 3DE1X 1XIVA 4P7FA 5LLSA 3VX3A 4IINA 3FFAA 4P32A 1DEHA 4QFCA 4X1KB 5KNCA 1CZNA 1U1FA 1QVVA 5HQ3B 4QDTA 4DDWA 4R5MA 4FC7A 3TK1A 3L7IA 4QARA 4NZOA 4DIDA 6CHYA 3JYQA 4O4HF 4UPVA 3PSHA 4M8NE 3CLSC 2COEA 2XKBA 3M4YA 2EC5A 5ES4B 2C7PA 4EHAA 4DR4E 4EVQA 1G4HA 3VSCA 1M6NA 1MC1A 4MR7A 2XYGA 3VZBA 5ISMA 4GXQA 3WWOA 5K0EA 1QBGA 1NDUA 2C5LA 3J7TA 2MSEB 4JL6A 4QBIA 3SKYA 4ZZIA 1ZM9A 5DGDA 3UAZA 5CBPB 3VYTB 1CQJA 1MH9A 3LA6A 4PHFA 5I8ZA 2WU4A 3UW3A 5BPHA 4Q3AA 2DMIA 3SEQA 5L51A 1USIA 9MHTA 2IKQA 2EM6A 1XNQE 1XLUA 4HPJB 1A4UA 4LJAA 2QXTA 4R1UA 4KNVA 2J9YB 4NX2A 4KN5A 3X2EA 2L2KB 2QTMA 5L3QB 5H3LA 1YBHA 5P21A 1CUXA 1U81A 1F6WA 3ZBPA 2AFHA 1ISJA 3G2QA 1FLAA 2YDYA 1OSNA 1RQ7A 2AR7A 2Q3MA 3PQ7A 3QOFA 1C1DB 2B1JA 4IDNA 4IQFA 2AJ8A 4P4TA 1D2NA 4UNPA 4UREA 4XA8A 4BFZA 1R16A 3BDVA 2GNAA 4RABA 3K7EA 3FPLA 2QUBA 5H9WA 2EJ4A 3OQNA 2YT4A 3VR0A 3LK7A 1SXJD 3MTDA 1P6QA 1JFFB 4HKTA 1DKQA 3ESQA 3F4BA 3OETA 3RSZA 4EO7A 5FLEX 1J9ZA 4DR2B 4UMDA 4B8ZA 2R6CA 1OV6A 4NU6A 4U8GA 4DRYA 2E49A 1TYAE 3MTGA 1I1QB 3T38A 1ND5A 2ZI6A 4L8LA 3SNKA 1Q2XA 1A8HA 2EJWA 4J7CA 3ZV3A 3UMYA 1O54A 2EOQA 1GTSA 5G0TA 3QPWA 1DT5A 3AF3A 4MYHA 4RM3A 2BMFA 5IDQA 5GADl 4YWJA 3FTFA 3PNBA 2XCQA 5DBHX 2AJDA 3AESA 2JAXA 3ND5A 4CKEB 5IM4F 1L4EA 1OKKD 1RQXA 3E9RA 1CP2A 1GT91 3L92A 5ECYA 4BQOA 4BVEA 4C7VA 4LDAA 1G0NA 4ZOLA 5BSFA 1E61A 4BMVA 2XTMA 3U6KA 1XPRA 3D3WA 1I80A 3FDIA 1D6JA 2OV2A 4DV2E 5FUQA 1E3LA 3NBQA 4ZO8A 4CM6A 4F8YA 2JIRA 4PQRA 4IRUB 2VQSA 1HEUA 2ZJ1A 3CEHA 4YV0A 3ECRA 3ES9A 1XDBA 4Q4AA 5EESA 3BMXA 2Q8NA 1JIVA 4QZVA 1SUIA 3DMDA 3EG9A 5F5NA 3I61A 4WXDA 2FW0A 4OB8A 2ZR8A 4YWHA 3NTLA 3CUSA 3HJBA 3O4GA 4RK5A 3TL2A 2WD8A 4WSOA 5B6JA 4GRDA 4PQEA 1OHHD 1UWVA 2Q46A 2H4ZA 3F8WA 1HE1C 4NSNA 2WQZA 2BE7A 1N0WA 1K2WA 1ADFA 1C81A 3VGJA 1U9IC 4IJ6A 1J8QA 1VPEA 2RAUA 4OM8A 5EUCA 1WMSA 1J5EE 4CMHA 4QUAA 4FC6A 2PMEA 1L4LA 3C1OA 4YH1A 5E4JA 3ZS8A 5HZGA 5ALOA 2XNDA 4IIYA 4Q1AA 3PFCA 4ALNA 2H36X 2C2BA 2PZJA 2YASA 1XMJA 1OBVA 4GQIA 2BGWA 3NAGA 4G6ZA 1LCIA 1QFXA 4CF3A 5HEKA 3O92A 4WUVA 1JAHA 1N6OA 1VA5A 1DEOA 1L7PA 1CJCA 3KLOA 5DWVA 2DIXA 3GRPA 3R8XA 4ZJYA 1ESDA 3RLIA 2L69A 2PZMA 4J0EA 2BF7A 2YHUA 4JX8A 1HURA 3GEEA 3L05A 2CDRA 3GY0A 4MVJM 3U2QA 4D56A 3GPLA 3TJRA 1GSHA 1IAVA 3JQ8B 2PLAA 1YR6A 3AY6A 2G28A 2XXJA 2G4VA 4DNFA 1DO2A 2PXXA 1D8TA 3JCZA 4BRWA 4AJLA 3OCVA 1R6DA 2G63A 1A5BB 2A8YA 2WWWA 2XIQA 5JDCC 3UN1A 3MJRA 4DLKA 3WRXC 4D8TA 3QW4B 2PRZA 2HIAA 4QDZA 2ACWA 3ZH9B 1P61B 10MHA 2W00A 3BRSA 1YR9A 3WLAA 1P77A 4XUGB 1PZNA 2CBXA 1DELA 1NSFA 3TLCA 1DLJA 1U3CA 5LMZA 4KJZA 1V45E 1A0OA 3BE8A 4QRHA 3U13A 2NZYA 5L7WA 2ZSHA 4BO6A 2IFTA 4M86A 3FWPA 3CUKA 1XQ9A 2HA0A 2ZWIA 3T9AA 2YW2A 1WXHA 4D9GA 1RHRA 3BJZA 1E2JA 2ZKIA 3GJ8A 3GEIA 3QPBA 4HC4A 4Q9LA 5JWHA 4GZ6A 1VL8A 1YJAA 4KDCA 5EWJB 4KLRA 3PHCA 1W76A 1M6EX 3MWJA 4YCJA 4ZV7A 1TU4A 4W5JA 3WLEA 1QQBA 2B2NA 4TSRA 5DYWA 5KSZA 2CVPA 2H4FA 1CR1A 1F8YA 2I4MA 2PWAA 3QXCA 4Z49A 3JPYA 3B1WA 4OOEA 2BTOA 3RVRA 4F4IA 1FX0A 1L4HA 5JYBA 4M9CA 3QOWA 3SC6A 1B8NA 1CJBA 1GNLA 2H1IA 3KWMA 3CLKA 3E3NA 4JLUA 2ZRKA 3GVXA 5D84A 3U3XA 1Y3AA 4DABA 3GLTA 2X8LA 5H02A 1FVHA 1ZA2A 2PT5A 3ESDA 3KQTA 1K1EA 4K6MA 1YQDA 5EJFA 5T4FA 4EPVA 1K92A 4RWEA 1WQ1R 3QG5A 4G1UC 1QOPB 4K8OA 2IODA 4LZAA 1STOA 2JGDB 1MXFA 2OBBA 3DBHA 4LMRA 3VO9A 4F85A 1E0AA 3HXLA 4WLNA 3KKPA 2YWJA 2LO3A 4F2DA 1YQXA 2WW8A 3DDSA 3N59A 2NA2A 3TOVA 2P65A 3GLHB 3KKKA 4UHDA 5FPQA 3DVLA 1KO4A 3O9MA 3R6WA 1GFZA 2DLDA 5IDWA 2SKEA 2C2MA 3KJHA 4BNFA 1Z18A 3BXOA 3SSNA 1CY7A 2VWHA 3MJCA 2QUIA 3W4KA 5JALA 4YRAA 5KSYA 5JSYA 1IWBB 1UFRA 2ZBPA 3E8MA 4JITA 4IWXA 5JS2A 1QE0A 3UJBA 4BKUA 4DBLC 2VF7A 1II8A 4CDGA 2IU4A 1SM4A 1SOUA 1H4TA 3RDPA 5KX5A 4LF8E 1RBMA 2CBGA 4QD3A 4UBIA 1GZ4A 3NHAA 3U5ZB 5CVTA 3O7MA 1HT0A 1NVGA 4NDZA 4P7GA 1MV5A 4IQGA 2J0UA 5HIKA 4L07A 4EG6A 4Q4HA 2EIXA 2R6R1 3LTEA 4OQXA 4RE6A 1WP4A 2UYQA 3K6JA 1JDSA 1CKEA 1A04A 4QXQA 1V6AA 3JD3A 4X8HA 1PJBA 3R09A 4ZU1X 4EW6A 5ADVA 4B4WA 5LLDA 2VOJA 3FNBA 1FC0A 1GL9B 4RY8A 5EZYA 4FGKA 5MN5A 3U17A 3QI7A 4ZVVA 3WB9A 4L72A 5EP4A 4TL7A 1FNMA 3ASYA 4XAQA 2LCIA 1K63A 1V1RB 3CNOA 4PZAA 3T5CA 4OJTA 5AJWA 4RZHA 3BIDA 3V1YA 1JYEA 4KIGA 1O0WA 1BCSA 4AK9A 1TEVA 5EPUA 5ITSA 1E2DA 1GKLA 1YVDA 1VPDA 2J32A 2Z2ZA 3DUFA 3R6DA 5KWEA 1M2OB 2ZETA 5FQOA 1AZLA 2IA5A 1DIRA 4OAOA 1R7RA 4CNQA 1H2FA 2GJKA 1Z83A 2PL9A 4IKEA 2RHOA 5LB4A 3CGWA 4HATA 1N2GA 1N7JA 2C4MA 2VRCD 1PRYA 3DOJA 4RD0A 4W5OA 1GNSA 4G5RA 4F86A 2P5SA 1ZH6A 3FVTA 4KI7A 5KNBH 3FM9A 1I3NA 2FPPB 3HDVA 2OO5C 2VDPB 1K8YB 2H92A 3PWTA 2AF3C 1LS6A 4GT1A 4RVHA 3WDMA 3WHIA 1Y6ZA 5EE5B 4N0QA 1G1AA 3BH0A 1KPIA 2FN3A 2RS6A 4HYTA 3VAAA 4YALA 2LRHA 3D3EA 1OY1A 3G9ZA 3LHSA 4J3JA 5HDBB 5B5SA 1AB5A 1G16A 2ZGVA 2NOAA 4F93B 3FA2A 3BD8A 1M5RA 1FMCA 3GNLA 1C30A 2VAPA 3MWLA 3PR1A 3V5NA 3ZWOA 3HI6A 4G26A 2A1UA 5K8CA 2CN1A 4UM8B 3U1BA 5DWQA 1NHGA 1WRBA 4GL2A 1Z6XA 5J4HA 4TPKA 2J30A 1JDNA 3EF1A 3LQRA 4L9WA 2JFXA 1AXRA 1L4YA 4OQNA 3VYWA 3VO2A 5LZ2A 1T8PA 3FHCB 2Q5IA 4KR0A 1UPXA 4GM1A 5HW0A 3H1BA 3HSSA 4NHRA 1U28C 4FN5A 3QG1A 2OQIA 4LXIA 3CZ4A 3PUKA 3KXDA 4NDNE 2B8WA 2P1DA 2X9NA 4PZLA 3FCYA 1H1LB 4MZDA 3LBHA 4MVJF 5EE0A 1Y81A 3QWBA 4HNAB 3RTGA 1I33A 2QI9C 3KAKA 4KO4S 4WKOA 2YY5A 4X61A 5SY6A 1LDGA 3CMMA 3WWPA 1X9IA 4DUGD 3ROGA 4B74A 5FLXA 4ZYGA 3GT4A 4WN9B 2DP4E 1T5SA 2R9VA 3OP1A 1LJLA 5K4HA 2VJYA 3MRSA 1Q16A 3CVVA 1E8MA 4HWRA 5FI5A 4K26A 3KZYA 2CHUA 4NONA 1FMFA 1CJKC 1MABB 2CXUA 5DRYA 1X49A 4WNYA 2X2OA 3EXEB 5KZMB 4EJSB 2FTXB 1ISRA 1JQLB 1SBNE 1SQFA 2XQGA 4M9SA 4YHHB 2H17A 3GARA 5K3SA 2R8OA 1KDTA 1T43A 3A0UA 3G2JA 1L4NA 2ZTVA 1T9AA 2FSVA 3R5HA 5KHAA 4EABA 3QGMA 1JMVA 3EZ6A 1RBQA 1W25A 4QXOA 4OXYA 5FV4A 4ON9A 4DQKA 3P8ZA 3L5OA 1Z6AA 3GAFA 2VXOA 4MQ5A 4RD4A 5G1NA 3V8QA 3VKUA 4KMOA 5C46F 1EI9A 1R2QA 1PNTA 2OC9A 5IXSA 3M1AA 3T5TA 2D0OB 5EXPA 1NP7A 4URWR 4PBTA 2QGFA 1R0LA 1EUYA 4DC9A 1NL3A 5A05A 3OU6A 3WQBA 4Y3UA 4D99A 3EDOA 1E9CA 1TCCA 1Y7LA 2P68A 3OOYA 1FYEA 1TF2A 5J43A 2O3UA 1IIRA 2HU5A 2YR0A 1PZFA 4NZZA 3RU2A 2PUWA 1A9RA 3WA6A 3ROQA 4PF1A 4YCDA 1O95A 3BD7A 2EOFA 2C9YA 2PGOA 1WXDA 3MWEB 1KKMA 2OBFA 4FCVA 2H2GA 2Q3HA 1JWLA 1P8JA 2OB1A 3AVTA 5E4FA 5EMKA 4YDSA 4K9KA 5ALPA 5AE2A 2IYWA 3IFSA 2O8CA 4YR9A 1R5BA 4KRYA 3PD1A 3O1IC 2AX4A 4P35A 5ICSA 4J7XA 4FQ7A 3VRHA 1QK3A 3IHTA 5IAOA 4EGSA 3FKSD 3F6PA 4KLCA 1Q1EA 2P40A 3VJLA 2JI9A 5DLPA 4DXHA 1JLMA 5AW1A 4RLQA 1FFYA 1FXWA 2PMCA 2QJTA 1IM5A 1LZKA 2R2AA 3I9V1 1QVZA 3NM6B 4B4KA 1WBBA 2PAAA 4X1KA 5I5GA 4MP6A 3JYHA 5ENVA 5HQ3A 3PWZA 3B7WA 1VXOA 2EATA 3AKEA 3SSAA 1XALA 4JGBA 5LQKA 2O07A 1BOOA 2GYUA 5IN5A 4L4XA 1T29A 2PKCA 4PCVA 3BXPA 3W9BA 1Z22A 2QNBA 2AUNA 4HWSA 3W8FA 3CH4B 3NKLA 2VYNA 5FF9A 2BD0A 4LC9A 1Y80A 4XCVA 2NSJA 1QKIA 2JFNA 1WDMA 7REQB 2EVWX 1JBKA 4N8SA 2NYVA 3CG0A 4FFRA 5CBPA 1RU3A 1BXGB 3UIEA 2E5WA 1IJFA 2XA2A 3MBIA 4ZO9A 4L22A 1EVJA 2WUFA 3D8TA 1JR4A 4IV8A 5LA6F 2BGRA 3LQ2A 3LDGA 4YCMA 5KCZA 1NBWB 1T6YA 2ZWVA 4LY3A 2QD4A 1G20B 3KKLA 4DLUA 3PLNA 3PPXA 4QPNA 2X3YA 1KXZA 1CQIB 1V11B 2WICA 4II2A 1SOVA 1YR7A 5D7BA 1DBVO 3L3BA 2J3DA 5F5LA 3WIUA 2QBYB 1C1DA 2C1ZA 1JGTA 1RLOA 4MX8A 5IZCC 1M1NB 2ZIAA 4V0QA 4KO3S 1RRGA 3O74A 4URZR 4GZNC 1JFFA 3RADC 2G36A 4HXEB 4KOEC 2DFDA 4ZYHA 1E64A 4GNRA 2D5BA 3MD9A 3DYIA 4DSAA 1BN6A 3DEYX 3RVOA 4Z1MA 4BWFB 2XI4A 4OYYA 2QW1A 5EGSA 1AUPA 1WDLA 3URKA 1PGOA 4IDDA 2AN9A 4EUNA 4G0OA 4J49A 2VA8A 4J0KA 4F4UA 3HR4A 4CIYA 4HRVA 2NUGA 3FN4A 4RF3A 2OV6A 4DM7A 1IQPA 3CPSA 1ZGJA 4CKEA 4X65E 3ZE1B 1XT6A 3I4LA 3WIOA 3A04A 1KZ7B 3F1KA 3AVUA 1E5XA 1Y5RA 2IE8A 5DLQC 5CCDA 2HEGA 3PRYA 1C0LA 4PZEA 3WGQA 4EJFA 3O21A 5DSTA 4PX3A 3WVNA 4N0DA 3DTVD 2WY2D 1GXSA 4ENPA 2C5FA 2LW7A 2C7RA 1SXGA 1PFKA 2Y8EA 3LP6A 4GW3A 3CLRD 3R5SA 4F3NA 2DVMA 1MG0A 4D0LB 1LRKA 2BUAA 5KKNB 5JNSA 4BFVA 3GT3A 3WC4A 2VF4X 6LDHA 2IWRA 1ODFA 6REQA 5KEIA 1CUVA 2WTBA 4DV0B 1XPOA 2QTBA 4NJEB 3DTYA 1L7EA 4NAHA 3DJWA 2IU6A 4ALJA 4RGBA 1IC6A 3VH4A 4H1HA 3A1EA 1SQGA 1AG9A 1YS9A 4YBZA 4LZWA 4ZGWA 1WZCA 2IEYA 1DJOA 3DFFA 1LFAA 3QF7A 1EU1A 5KSWB 2VAWA 3V8PA 3K6SB 2F62A 2C5AA 3WLKX 3EZNA 3BORA 2ZAGA 1AV7A 1P2GA 4Q4LA 3CNNA 4H60A 3WGMA 3LA8A 1B16A 1DAFA 3OEED 5TS2A 1GTVA 3FNIA 3SQWA 2YQ4A 2ZE8A 2OFXA 3WHLA 1CIVA 1COZA 1TVEA 1U7ZA 1TAQA 3DKKA 4BFLA 5IBCA 4RTJA 1Y8QB 1TFUA 2WSSA 1EYZA 1D2GA 2D0DA 4NV3A 1HLGA 5ALTA 3VFDA 1XPUA 2H1OA 4MVJD 2R6HA 4DKJA 1NI5A 2OCYC 2YCBA 5E6SB 3EGCA 3TGLA 3FW1A 1TVKB 3RKRA 2Q6OA 3CG4A 1T9HA 1SH7A 4LF7E 4W9NA 2PS3A 1T2FA 1KH1A 4A03A 5IXJA 3M5CA 4M4SA 4BUZA 5A2QA 4K03A 5JY1A 2FR0A 3DQPA 3T5AA 3AIIA 2FRXA 3C14C 2PT6A 3KEQA 3JQ8A 2M9MA 1K6EA 3G0GA 3LDUA 4G56A 3F6YA 3LC2O 3KO8A 2I6SA 4FT4A 1OVMA 4RH1A 5BSWA 2Q3BA 4ZMRA 4TMXA 5B7PA 2FK7A 2PLFA 5AHXA 1JVSA 2XA1A 4DCSA 4B31A 1PFWA 4L6AA 2EMWA 1G19A 2CCJA 3NUGA 3HUEA 5JBIA 1Q14A 2I6UA 4K46A 1Z06A 2C2HA 3NOOA 3ZDYB 5LXTF 1GG9A 3KPUA 3DL0A 4U7TB 4Q3OA 5FHQA 1FFBA 3D7LA 1X7ZB 3NAQA 1JJBA 3WTCA 3TR0A 4D4MA 5H16A 3D1JA 3EDYA 4FSHA 4ZOBA 1NOJA 5E4TA 4HZUB 2ACVA 2JJMA 5JROA 2QR3A 4LF9E 4WN3A 1QQAA 2PR2A 3A2LA 2W5UA 3W79A 2Z2JA 1ZXXA 4I6GA 4N7JA 3LCUA 1ZLYA 1VCHA 1Q0LA 2FSPA 4HEA1 4HPWA 4Q01A 1U7UA 1ZSVA 1MEJA 1XSEA 2Y9MB 4HNHA 1OROA 2NO7A 3C3CA 4ANFA 2PN1A 1L3IA 4JODA 5EWJA 2O2GA 1E5LA 3PGLA 2UZAA 4WKGA 1R5NA 2ZG6A 3GH3A 1DFHA 3PD7A 5BYJA 4CCSA 1HDIA 3FVQA 2ZR0A 3VOBA 1CUBA 1I6KA 2L33A 3I4FA 4LDNA 3RU7A 1SZDA 4BLTA 5J47A 3A2KA 4A0HA 2PZEA 4FDVA 5HFJA 4WNCA 4WTOA 1KQ3A 2PSEA 3LS2A 3ZLBA 2E2WA 3C8DA 3RT7A 1KGDA 1OIVA 3S2FA 4XVCA 1Y5IA 5IC6A 4OU4A 4GBED 3ZD8A 5JIBA 3ZDDA 3JVUA 4MJ3A 4RHBB 3QVWA 5CFFE 3RGWS 2DC1A 4DANA 1RLMA 4O24A 1EXMA 4QGBA 1KI7A 3RLFA 1KP2A 4Y2JA 3TECE 1QMPA 5BXYA 1ZVVA 5B2FA 1GAXA 4PFSA 4XYGA 3WGNA 4ESVA 3G7UA 5LZ5A 1U7XA 1SQ6A 1ZD5A 2FEAA 2NACA 1QH1B 1R15A 2MSLA 3CW2A 4LQ4A 4V3CA 4UDYX 1W48A 2JGDA 2VYFA 3HO8A 3VPFA 3W8EA 1WJGA 1GLNA 5JH7B 2IXBA 3N3AC 3GJ0A 3OQ1A 1ZUNB 4XM0A 1NWHA 2JBHA 2I7XA 3GLSA 3GLHA 2WKWA 3IT2A 5C2JB 1A5ZA 2HZ7A 2XUOA 3OA2A 1V3QE 4YIHA 1VB3A 1W93A 3DVQX 3LCJA 5A71A 4Y6GB 4TRJA 4WA7A 7GPBA 1NVVR 3DBRB 2WTNA 4P3OA 1D04A 4QDOA 3F3SA 5CYFA 2B20A 1P0MA 1EDDA 3FCXA 3KTOA 3NHZA 1DL5A 3PXCX 4IWYA 4Q1DA 5CK5A 5DW0A 1KZ6A 5AVQA 5JAPA 5C0OE 1G17A 2ZYDA 4XGRA 2ZANA 1IZ7A 4JI2E 1OASA 3RUHA 4M46A 4MW9A 2RHRA 1DIGA 1QV6A 1IM2A 1R0XA 1R74A 3LQFA 3MA0A 4I6EA 3U7GA 4TWBA 3ZGZA 1N34E 3AUJB 4QUJA 3WGOA 3O1JC 3D4OA 1T9CA 1DADA 1R6XA 1HKUA 3I6QA 4LJ7A 5F1PA 5BQ5A 5JASA 1OXUA 2PUAA 1H69A 2PS9A 2R1TA 1J24A 1O58A 3PJRA 3QQ5A 5FUBA 4NCBA 2YU8A 1T3LA 1THTA 1CUEA 1MX1A 2ZP1A 3H4TA 3OJWA 4IQ4A 4I8DA 5HOQA 4GGMX 4F96A 5I45A 1N2OA 1NKSA 1LTKA 1M76A 3U7EB 4HDRB 4YBRA 1ZWLA 4Y67A 3VU3A 4QT4A 2HGHA 1AUQA 5F73A 4DJEC 5IFKA 4W5QA 4CEIA 3L79A 1A9XB 1W9MA 2ZSDA 1PDAA 4HTAA 4YP0A 4RNCA 1AGPA 1OCEA 4CIVA 1JB1A 3B2NA 1M2NA 1JDTA 2XDAA 3ZU5A 4AKEA 2PRSA 5FI3A 1H4QA 1HNNA 1N3YA 1IATA 3DZBA 4DS3A 1M2OA 2GBFA 1EFRA 3N2GB 4R51A 3GUHA 3HO6A 4F4DA 5LQMA 2VP3A 2Y68A 1P44A 4U9IS 4FYYA 1A82A 4K9SA 4ND6A 4O08A 3WNQA 1FQOA 5BN1A 4Q12A 3TSWA 2PL5A 3FHOA 1WSAA 3CJQA 3R40A 4KXFB 4EF6A 3ADBA 1GSOA 1OLOA 1S1CA 2BAGA 2A33A 2FPPA 1J00A 2Q8PA 2VDOB 1LRLA 3QVTA 4GMXA 1EBBA 2FYTA 4NG5A 1JKIA 2I7DA 2FX5A 2WD9A 4MW1A 4TXLA 4J0DA 2NN3C 4AQ7A 1K3UB 1JH9A 3RUFA 2ZVQX 1HGXA 4C20A 1YDEA 2XIJA 2A9PA 4MA5A 5LBIA 2QU8A 1OREA 3CIFA 3KT3A 3MLBA 3ASZA 2IGTA 1IN1A 2X42A 1FDRA 1PR6A 1AHIA 3O4JA 5E7JA 5AW9A 2GM3A 3O3MB 2IZ5A 2EQ1A 4BVGA 2XV1A 3WL8A 2DQZA 1E18A 2YTIA 1KP9A 4F9BB 2QYSA 4PO8A 1Q12A 3RC9A 2HQ1A 1JR3E 3ILYA 2FNAA 3DDHA 3FJOA 4A92A 4BS9A 4HAWA 3CVWA 4R1QA 3N5KA 3CZQA 1SBHA 5JYCA 3M6MD 1JHAA 3HY3A 2IZ0A 5E9AA 1OPRA 1H1LA 4X1OA 5KNBA 1PV4A 1NXVA 4UHBA 1OB2A 1T5OA 4TS4A 4GDMA 4CUJA 1AQIA 2PV7A 3GP3A 4LZLA 1RPAA 2B7CA 4WN9A 1IU9A 2RGNA 3GN2A 1W7AA 1T4GA 5D51S 4BFUA 2ENAA 1F8FA 1AKWA 1TLTA 2B92A 2IYRA 3BCHA 4ZK6A 5IJXA 1MABA 1CUFA 3LC7O 5EHIA 3F47A 4ZKEA 3EXEA 4EJSA 1RSZA 1U2EA 3S4YA 4OAQA 5DTQA 5FEUA 2UYGA 2BKVA 4KCGA 4EB3A 2OWEA 3G2KA 1XRMA 1W0KD 1UBOS 3O7WA 4I1SA 1WMBA 4R69A 2RH5A 1BU5A 2PEZA 1YRHA 3NCTA 4GSLA 4YRTA 1KTIA 5IKOA 1JJFA 1L5MA 2DCMA 5ETJA 2K4MA 1RKBA 1E2MA 5A69A 1E3IA 4KREA 5EKXA 1HLPA 4Q3NA 2GCEA 1KYZA 2AZ4A 3O8QB 2BH9A 4TS9A 3UK1A 5I3ZA 1UFKA 1NV8A 4COKA 2H9IA 4NMWA 3E3OA 1TCBA 1NXPA 3IJ5A 2FVYA 2DERA 3BAZA 5FR1A 1F7VA 2DFVA 2GEJA 3KZNA 3ETLA 1SHJA 3QITA 3KALA 2ZM5A 4X64B 1EVKA 1AURA 2GPWA 2XCOA 2ZVPX 3IAXA 3IP5A 3DVRX 3PUHA 1YU9A 4GR5A 4TYQA 5ECGC 5EE9A 1FNNA 1FSGA 5I6DA 4MHTA 1QZ3A 4G1VA 5E9WA 2PGLA 1Z5NA 2GBLC 1CZOA 3FLEA 4IGKA 1GQEA 1IY0A 2R44A 2AD5A 4PX9A 3ICOA 3V8VA 3MWEA 2MU1A 3ZU3A 1LBHA 5HYVA 5JECA 4P9NA 1XMOB 1FJXA 4KAFA 3TX6A 4LDRA 3EIQA 3Q3VA 3AGPA 4EP1A 5K6AC 4N12A 3EE6A 2O4UX 1XYVA 3OIWA 3BTOA 4B9EA 4HLCA 2UZIR 1QOQB 4O29A 2WWFA 5HJ2A 1RYYA 1ECJA 3TEMA 4RHFA 5JPDA 4DMGA 1ST2A 2CLSA 1YZTA 4K9MA 1W36C 3BWBA 1X1DA 2AHOA 3L7JA 4GLFA 4PFKA 5K0TA 1OLSB 1SBTA 4ZA2A 5CCBA 4XYBA 3TM5A 3Q41A 3JQCA 3I2IA 4JJIA 1R9MA 1WQ3A 1XNJA 3EOZA 2EARA 5CX1B 4INAA 4IVRA 2KOUA 2OQ2A 2AWNA 1VHWA 4FEEA 4M53A 4P4LA 5DBEX 3ZBUA 3FOEC 4RQBA 5A6AA 3NAZA 3AUKA 4EPTA 1NBAA 2H9YA 5DYNA 1ZC3A 2YS7A 3AP2A 4L95C 3RREA 4NOMA 3BD6A 3HCEA 4C0LA 3EZ2A 4W5WA 3UYKA 3PGKA 4XOUA 3F6GA 1IDN1 3EQ2A 3O2QB 1EZ4A 3CBGA 3V6LA 4XYLA 1O97D 2OO5A 5KC9A 1AH2A 2I3AA 4J0JA 4QFBA 4F3KA 1CEXA 2CVOA 5F12A 1BX1A 1QSGA 2IYFA 4XGKA 3K9QO 2Z8ZA 4BU1A 7REQA 4QBTA 4AROA 3ZOQB 1W2WB 1CEEA 4JASB 2RKOA 2X86A 1PS8A 1U0JA 2LGJA 4JLDA 3UXHA 1P33A 2Q29A 4DJ5X 1EBUA 1BXGA 3IIMA 3MG9A 4JBIA 3V7YA 1CUIA 5CB6A 4PWYA 2VF8A 5JEDA 4BFTA 3OX1A 2L82A 3EWIA 4MA4A 4BJ5A 2WPNA 2JFGA 5HILA 1RTTA 4BJ6A 2I22A 3MS4A 4MW2A 1LKZA 3DEKA 1C9NA 3AF1A 4YMHA 3O75A 1G20A 3TD2A 1XVLA 4ARBA 1N5OX 3BN3A 1CQIA 1DEKA 3TLYA 2QBYA 3NORA 1KIMA 1E1NA 4TLLB 4F1KA 4L74A 4NEQA 5EPEA 3BGHA 1L4MA 5JD4A 1SR8A 4Y1RB 4JI0B 1C4KA 2PZ8A 1M1NA 3HCDA 1UXGA 2RAPA 1QG4A 4IDBA 2P9FA 4BNJA 4BMSA 3ZZUA 3CLVA 3HB1A 3EXG2 4RGVA 2XVAA 2ZYAA 3A70A 5EIBD 1H9AA 3GA0A 5C32A 1YFHA 3VHXA 3C7DB 3JWGA 4KWHA 4ECEA 3LUKA 5KDLA 3MF4A 1JTFA 4P4SB 3U3MA 1H85A 4ZEWA 2VK2A 1LV7A 2WUGA 4ACAA 1NAHA 3DO6A 2HH9A 4KK3A 5EWMB 2ODRD 4JEMA 4O4IB 2QJRA 4M1WA 5JJBA 4PGHA 2IT1A 2YTGA 3RFVA 4CWAA 2X8WA 2A35A 2PA0A 3AW8A 1XTVA 5I7WA 3WBBA 4ARSA 4ZT3A 2K87A 1GUDA 2GYWA 2F8LA 4B76A 5BMVB 4O4JF 1LVHA 4QYXA 3BFPA 3AUZA 1HQYE 2XUAA 5E0KB 1SVNA 2N9UA 3KTDA 4J1NA 4AKIA 4ZZ1A 2CHQA 2ZRLA 2WIFA 4GEGA 2DHRA 3UZUA 4NJEA 4EFLA 2C4NA 1HQDA 3BILA 3BXEA 2WQ6A 4NFHA 3HVHA 1N9ZA 2HSZA 2FPLA 4HX5A 2IYYA 1KE1A 3GEPA 3TFWA 5LYJF 1L8AA 2B61A 3IKMB 3LLVA 2HK8A 1YR1A 3MRTA 4KO1S 4CMEA 5JYEA 3I12A 1BGVA 2VEOA 2CXNA 3D4PA 4FS8A 4QFMA 5JLAA 4CLRB 3IELA 4O6VA 4BDTA 5AI4A 2Q5HA 5AIBA 1JAXA 3TG2A 2AEEA 4I6JA 2OBMA 5T7BA 2IPMA 3TDKA 2B21A 2P3SA 1J2TA 3L6UA 4ND3A 1ZIDA 5G1OA 3M6LA 4M38A 4DY6A 4FBMA 4IMPA 4C2TA 2X1VA 1Y8QA 1GN9A 2Z6VA 3T4UA 4PTZA 4JNCA 5AE3A 2HHLA 2OCBA 2V87A 1SGWA 2I6QA 3CXUA 1KPGA 4DR5B 1U7DA 5F1KA 3D3KA 4PYMA 4Q47A 4IVNA 5E6SA 1CY4A 4RANA 3T9DA 1TVKA 1NBEA 1I2BA 2R7NA 4JOSA 4MPJA 4JP3A 4E7OA 4RIHA 2UXDB 1CQPA 3THXA 2JJ2D 2C5EA 3AF5A 4WDRA 3MEQA 3ZFNA 5DM4A 2E21A 5EY5B 4ZDJA 1OYWA 4BEJA 5AFSA 3MYRA 2AW3A 2BGJA 3EXFB 2I67A 4D6YA 3M1YA 1KS2A 3L4BC 2WBSA 2EKZA 1OWNA 4KE7A 2XBUA 4HNQA 2I6XA 1J5PA 2L3CA 4K6KA 1J0CA 3VU9B 4F9GA 3DXZA 2QE7A 2X4LA 3W1VA 1U4SA 4IL5A 3FOFC 1O08A 2IBMA 4UCQA 5LD2C 2O2IA 3DPIA 1M2EA 4H16A 5HUQA 1D09A 1D1TA 1X7ZA 2IP2A 3WRVA 1UJ4A 2HRBA 4P08A 1QIHA 1P4RA 2AA3A 3I1FA 3N2IA 2CT1A 4NBVA 4QOFA 4D44A 3IEMA 4DR6B 1GPNA 2H3HA 4H9KA 2V65A 4L16A 4BO9A 2HA6A 4ZANA 1G5FA 3FB1A 4C6TB 1W85B 1Z4OA 1EWQA 5TT1A 4ETMA 3E61A 3ASUA 3JYNA 2ZIZA 2I4RA 3K16A 4KXMA 1IY8A 3CW9A 5LZ7A 4TZ0A 1NV9A 5GY7A 4IDCA 4MO9A 2IHTA 1KS9A 3O6VA 3U7QB 2Y1EA 4ASUA 3J7AG 3A1WA 5D8DA 1M0WA 1HFKA 1X1QA 3RVJA 2UUAB 3WB0A 1NJ5A 4R2DA 1WUKS 2FN4A 3GF4A 3E82A 4YAGA 4YLGA 2Q49A 4QQKA 4UEQA 1AMUA 5B55A 1XTQA 3HZZA 2EPNA 2ZRBA 2SICE 3COYA 3Q9SA 1GYRA 4A5SA 3OQVA 4HBZA 1DTSA 2H0QA 4EYKA 3OD1A 4IDGA 4F46A 2AMLA 5JDIA 2QVYX 1I32A 2AFRA 3RS9A 1XA3A 2ZPTX 4J43A 2FPIB 4LZOA 1II9A 1XAJA 2TMKA 1GCIA 4MICA 1DRKA 2ELYA 4PRZA 4PG4A 5AKGA 1ZHFA 2WKPA 3C6QA 4NCAA 1QH1A 2VOEA 3CR7A 3AVPA 3B53X 2HRRA 1Y1TA 1KARA 1CF2O 1YONA 1ICEA 2EF0A 1LWNA 4IJWA 4Y98A 3RHZA 3RUCA 2KLHA 3W8NA 3WICA 1C2YA 1ZUNA 2P3QA 3IGFA 3TOZA 3ZQKA 2WF7A 4PRYA 5IYZF 4CYMA 2ZSFA 3GCDA 3VDNB 4M83A 1WHTB 3KUXA 1IONA 3K8ZA 1FX1A 4F98A 3LLMA 5GJCA 3WL7A 2ABWA 4HAUA 4JDPA 1WUHS 5AVZA 2UYCA 4LYYA 4A6DA 1PTJC 4CEHB 2Q8QA 3KIPA 2DKFA 4B43A 1V8BA 3ONEA 1YA8A 1JLRA 2YYAA 2LBSB 3KKZA 3OLCX 2UZ1B 3R5JA 2PIAA 5BSHA 5FLKA 2ZJZA 4NBTA 2YYZA 3DAHA 3AJEA 3OM8A 4D3FA 4MUEA 2Q21A 1YZUA 1WP9A 3FUWA 5BUZA 3L0CA 3H5TA 3KQOA 5FKJA 2O8DB 3ZYCA 4AJOA 2NUAB 3H97A 4Q18A 1G8PA 4J1QA 2ID9A 2CNWA 1OWOA 2A4MA 4YRJA 1NMZA 2X0IA 3KVOA 3OPMA 3RANA 4X8MA 6YASA 1JEQB 5LNK6 3DVSX 3R4VA 5KWVA 1AY0A 1KFCB 1U7OA 3BOSA 4HDRA 5K3FA 3SKXA 3TTSA 4C0XA 4CQJA 2BEWB 4FMCF 4WASA 5E6UA 1TMKA 2OAEA 3UK7A 3IT1A 1U5CA 5JJ5A 5E38A 2YINC 1A9XA 4EW3A 3H2JA 3EY9A 3TO5A 4ZVUA 1T4OA 5TVKA 4QSHA 4LX8A 1N6RA 3GFPA 4DEYA 4Y0VA 4KXQA 3GPIA 2PT9A 5AW5A 2I9KA 4C2UA 3N2GA 4QX6A 1KI6B 5FT9A 4B32A 1NNEA 1ZKMA 2O52A 4QSMA 3V3TA 2JLUA 2XCUA 3LHKA 2RI0A 3ESXA 4R8SA 4AJ2A 5IVHA 1W4RA 5KPDA 3M3DA 5FAKA 3RWMB 3HM2A 3VTZA 2DSYA 4TXNA 2DB2A 3REOA 2OGTA 4ALKA 2B83A 2IHNA 2GB4A 3RS0A 3STWA 3QBDA 1ZMXA 1L5OA 3T3OA 4IDHA 2JJYA 5DOVA 4B8YA 1D3AA 1FYFA 1RYZA 3DDOA 5JHHB 2YTJA 1I2DA 5TJ9A 1A1KA 1ML4A 2OV4A 5FIUA 4BC1A 1C3XA 1H2BA 1I9CA 3PBKA 3LE8A 4N4AA 4BKRA 2AV6A 4RPJA 2HTEA 1XJCA 5LD2B 3OTOB 5TEWA 2CJWB 2JH8A 3U37A 5B7GA 4MI1A 2VNAA 3HVIA 1P0QA 5AW3A 3AFIA 1NVAA 3ADLA 1Z4LA 5IJZA 1UINA 1UMBB 1TQHA 2PCLA 2Q50A 3EVBA 4MV7A 3ZE6A 3H87A 3O4HA 2EBWA 2ZRQA 4KMRA 4BNYA 5EXTA 5E1OA 1US8B 2XXBA 4ZMBA 4QVGA 1GVNB 1UMKA 5IT9C 5HK8A 1EWRA 1VYTA 4JJEA 2JCYA 4RK4A 5T4HA 4MLVA 4YP1A 2A3NA 2YXPX 2ZB4A 4QYMA 3FRJA 2ATCA 2X2PA 3E9MA 3AJ8A 4C03A 1B73A 4NMXB 1KYQA 2X0NA 1O9HA 4LA4A 4KQFA 4HFRA 4U7FA 5AHWA 3RAJA 2V1XA 3DFIA 4EIWA 4R7TA 4Y9TA 2JOBA 5IF9A 3EXHB 3BRCA 4PGAA 1QFYA 1M34B 2C57A 1GGEA 3W3AA 3UUEA 3RM3A 1Q44A 4WLEA 4HDOB 5LP1A 1GG5A 1PSDA 1GPH1 2RB4A 1C1HA 2A4KA 3LCVB 3NNNA 1M1UA 1RADA 3C8ZA 1GAWA 3SX4A 5ITVA 3R7DA 3GG9A 1LK0A 1A77A 1NW4A 1XTSA 1ATIA 4LG1A 4AN4A 3OZGA 4I8IA 4RY0A 5GOZA 2H2WA 3UHAA 3UK6A 5LQUA 3COPA 5B4UA 1AKTA 2F90A 3CRVA 5C5DA 4YCCA 1WPGA 1HMYA 4JT4A 1EFAA 1RWVA 1FNBA 1S1MA 3I92A 3KT8A 3LNCA 4QLOA 2R6JA 4Y2HA 1M1ZA 1EAYA 1SO8A 2H3EA 1TYBE 3O8QA 3K70D 5I9TA 3OJXA 1TAUA 1HEYA 4QUEA 1IZ0A 3FDFA 3T15A 3V4FA 1NSYA 1LDMA 4UDXX 2OYRA 2PA3A 4RJIA 1JB9A 4P2BA 2QPOA 4OBWA 3K0HA 3MWKA 2FWIA 3LCRA 2XYHA 1LPPA 3FOAA 2VHXA 3VI4B 3PEEA 5G53C 4QOHA 2B8EA 4YMGA 3S40A 4XFDA 1EX1A 1LLMC 1XTKA 2LP4Y 3KQMA 5CJ2A 5EHXA 1BD3A 4MPDA 4N76A 1VPVA 1UBMS 2GJ9A 4Y2VA 4JI4B 2GEVA 4QLBA 3RF6A 4YUAA 3AZPA 1PV2A 3DXYA 4FOSA 3KWRA 2Y0PA 4ZQGA 3VR4H 1ZPDA 1XHEA 1B0PA 1AT1A 1TQDA 1YRYE 4FDUA 4NYMR 4ZYEA 5EJIA 3GELA 4LHEA 4LCBA 1TE2A 2WFAA 3BMOB 2MMGA 2WSYB 4JQYA 1WETA 1EVLA 3G6KA 1IH8A 4PVCA 2X19A 1RQ0A 4ZEXA 3RNLA 2EP7A 2PE5A 1EK6A 3QPVA 2G1UA 3LPLA 3MTBA 1JKMA 1JJAA 1GQQA 3Q6NA 4HMQA 4RMNA 3V3KA 4C1BA 1XUOA 3BEOA 1AKMA 1ZXBA 3LHDA 1OLSA 5IDYA 4WKBA 3ZK9A 3V4LA 4TM8A 2V7PA 3EH2A 4MV9A 3USCS 3ZTWA 2P0AA 2FX2A 2OHIA 3EY4A 3LD9A 4MYCA 1KL7A 1YYOA 5COQA 5CX1A 5TQ0B 3SE7A 5BUCA 4WRRA 4B2LA 1G5HA 1PFYA 2Q3JA 2WU8A 2PX3A 3PI6A 4Q9JA 4BNZA 4F60A 1QTIA 1GDTA 4LVUA 4WH0A 2C9ZA 1LTQA 4H6WA 5SZIA 4PN3A 3WGHA 4MLZA 3HQ1A 4YJ2F 4BE4A 3I5YA 3STTA 1EH6A 4KMMA 3EEFA 4BQIA 5M29A 1XMPA 1NF8A 2VDVE 3H83A 1KI1A 2C82A 1NPTO 3LVRE 3ZJUA 1SBQA 2E55A 2B7TA 3OC6A 1ITZA 5T8KC 5DTEA 3L18A 2NAPA 2ENWA 5TB5A 4Z54A 3OOHA 1I36A 4DV6B 1NN5A 1Q11A 2BI8A 1SUBA 1BHSA 1NW5A 1PNOA 2FQQA 3IPRA 1DFGA 4LZJA 1GEGA 4BOYA 2O1EA 2Z3ZA 5AICA 1TRHA 2EOEA 1YTLA 4X1IB 3H04A 4K81B 3SICE 3ZIAD 2FX3A 4CQNA 1YI8A 3TWOA 3CKKA 1SR9A 2PEYA 1NXXA 3WLJA 5F4BA 2WHEA 1SBZA 4H1UA 4W5HA 1GG2A 4B87A 2WHPB 5CIYA 1OXMA 4BX3A 1VHJA 2Y0EA 3PRHA 5D00A 3RF7A 3IOYA 3C3KA 2P7IA 5SV2A 4KX5A 4NXNB 4Y1RA 1BVHA 3DPSA 1IK6A 4NBUA 5DNWA 1PJSA 3RYIB 2JEZA 2ZBDA 3H6KA 3OEWA 1QJCA 4KG7A 5SY9A 4B73A 1VYVA 1L7RA 3OC0A 1MAWA 3I83A 3PEUA 2V6FA 3S2IA 3RO7A 5JXGA 5KKAA 3EFBA 8ADHA 5AVVA 1IXSB 1KTVA 3PWKA 5L4NA 3KL4A 4FW8A 1U65A 2XODA 4RK7A 3S2UA 3SYRA 4Q7QA 4KH1A 4S0XA 1UBJS 3PLRA 5I7SA 4Q0MA 4FTWA 1I5RA 1QIJA 3IIEA 1ABEA 1Z15A 3OIUA 4P4SA 4RC9A 1KQNA 5GZ3A 1EXVA 5AM0A 3R9XA 1T1EA 1NR1A 1GZVA 3DZJA 2XMPA 3T1NA 3DBVO 1MF7A 1P2TA 2QT9A 1QB7A 3F9IA 4MPTA 3VC1A 3GPCA 4BVFA 3ZR4B 4P92A 4O4IA 3H2GA 1L1EA 1WF6A 2WF5A 2R00A 4QE3A 1Z7BA 1Y9JA 3QNMA 1DHTA 1OYOA 5GJWC 1XVAA 4C7OB 1J5XA 1QJ4A 3F5DA 1ZW6A 4IH4A 1TO6A 3DHNA 4ND2A 2IQIA 5HG0A 3RSQA 4LS3A 5BMVA 3RYCB 2VBIA 2C7OA 2O14A 1SHZA 1A3CA 1WDKA 3DMFA 3DW1X 1X2BA 4GYJA 4O8ZA 2QLNA 1X7WB 4AZWA 1FYWA 2EPZA 1PL7A 2ZYVX 3NB0A 3H9EO 5KI6A 3NDRA 1MBZA 5DWDA 1DUVG 1X15A 3L00A 1Y3HA 2VPWA 2G9NA 4C0BA 1SD5A 4DLTA 1MW8X 5GM2A 4PGFA 3NW9A 1S9DA 3T35A 3K9HA 4LJ9A 4L8YA 4CLRA 1NG1A 1N2EA 2F3PA 2Y1FA 4EW1A 3IDQA 3U19A 5AKKA 4MUGA 2Z4RA 1KIAA 2OBNA 5EUQB 3NR2A 4B5LA 2PK3A 3HNOA 3RVKA 3MAAC 2GA9A 2FG6C 1I7LA 2H5JA 2NXCA 2V8BA 2YW9A 1K88A 2B98A 2HJGA 2WSBA 3DLCA 2XSZD 3G8AA 1KDYA 1C14A 1ZEJA 1ULSA 2IHYA 2NZ8A 2IKSA 5GGYA 4EKNB