3C6MA

Crystal structure of human spermine synthase in complex with spermine and 5-methylthioadenosine
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
361
structure length
336
Chain Sequence
SRHSTLDFMLGDGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYDSILNKVEERMKELSVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human spermine synthase: implications of substrate binding and catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Spermine synthase
total genus 104
structure length 336
sequence length 361
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.22: Spermine synthase.
pdb deposition date 2008-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
A PF17950 SpmSyn_N S-adenosylmethionine decarboxylase N -terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 3c6mA02
3.30.160.110 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Siroheme synthase; domain 2 3c6mA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3c6mA03
3SVZA 1VLMA 2ZIGA 2PT9A 3LDFA 2I6GA 2Y1XA 3G8BA 3P97A 2ZZKA 2I7CA 4DMGA 1SQFA 4CTKA 4BLWA 3CKKA 3AJDA 3MERA 3OU2A 2IDJA 4FSDA 5HIMA 1DCTA 2OYRA 5DRTA 3G88A 3LPMA 3BXOA 1FJXA 1L3BA 3KPWA 3UBTA 3HCEA 5HIKA 1VL5A 4DF3A 1YUBA 2VS1A 5GOZA 5LQRA 3TM5A 4R05A 1R74A 4QTTB 2YXDA 4FZVA 3FTDA 3D2LA 2ZBPA 1BOOA 2BR3A 1I1NA 5MHTA 4MWZA 1WXXA 1NKVA 5DXAA 1NW8A 5EQJB 3KQPA 4RVFA 5K0LA 4E2WA 2G1PA 2IH5A 4OBXA 5EMMA 5CCXA 2CWWA 3JWJA 3L8DA 2HWKA 3R6TA 4OQEA 4R6XA 2ZCJA 2G8NA 3SMQA 3UWPA 1ZGAA 3G89A 1WS6A 3HA3A 3NWBA 4M36A 5FCDA 1G38A 2NXCA 2Q41A 2ADMA 2IGTA 1PJQA 3HCAA 4FSXA 2BZGA 4R6WA 4E30A 4RWZA 5C0OE 2P40A 3TR6A 3KQWA 1RJEA 2V74B 2AOTA 2NNWB 3RW9A 5HILA 1M0EA 4E33A 3B3FA 2GB4A 5EMJA 3E05A 3GNLA 2PXAA 4V0QA 1HNNA 3V8VA 4WXHA 4X61A 5G02A 1KIAA 4PGHA 5D1NA 2ONZA 3OE4A 4CWAA 2OPBA 2PWPA 1I9GA 2ZTHA 5FA8A 5EHGA 3TM4A 4ATNA 3EVGA 4GOMD 4BY9E 4ER0A 2PX8A 5K0NA 1JG1A 2P3LA 2Y1WA 4OBWA 3BGDA 3QOWA 1SUSA 3DMFA 5E1MA 2PKWA 3HCCA 3P9IA 5CVDA 3BUSA 5BXYA 3LSTA 3O31A 5LQNA 2ORED 5LQAA 3KR0A 4A6DA 2AOWA 1PJTA 1KP9A 2YVLA 1RI3A 4HGZA 4HSGA 4A6EA 2AVNA 3CGGA 1KYWA 3R3HA 3DXZA 5KQRA 5FUBA 3HA5A 2PBFA 4GOOD 4PYJA 2ZULA 3NDIA 3GRYA 5EKUA 4KWCA 3KR9A 5GP1A 3NMUF 2B2CA 3LL7A 2AOXA 5FADA 5IH3A 1XXLA 4EK9A 3MQ2A 2FCAA 2K4MA 1P1CA 3VC1A 1D2HA 1R8YA 4OA8A 5K05A 1YFLA 4PINA 1QANA 5DX8A 3UJ7A 4BP3A 3BKXA 5E9JA 1R8XA 4EKGA 2ZZMA 1X1BA 2Z6QA 2O07A 2EX4A 3FZGA 4M7RA 7MHTA 4PYNA 4YUWA 5DTQA 2QRVB 5K0GA 1L3IA 1VPTA 5FWAA 2HMYB 3ME5A 4C03A 4ER6A 3UFBA 2XYRA 3NJRA 3PFHA 5K0EA 4IV8A 1D2GA 1XDZA 3DLIA 3ORHA 4DCGA 5GIOE 2G71A 3LKDA 3KHKA 1F38A 1HMYA 3KPJA 4GC5A 5T6BA 1PRYA 2O57A 2XBMA 2PLWA 3TLJA 5DLYA 2AOUB 4ZTBA 1N7JA 1G8AA 1RI5A 4E32A 2FRXA 4YUVA 3KQSA 1MJFA 4GQBA 2OKCA 3SSNA 3ER9A 3AY0A 3BWCA 2F8LA 4HRAA 3ANXA 3ID6C 4PCAA 3KQYA 5LR6A 4GF5A 4AZVA 1NW7A 4C07A 4M37A 3CCFA 1O9HA 3SM3A 3FUTA 2YXEA 3O7WA 3QV2A 3OZTA 4HGYA 1P39A 3GIWA 3FUUA 2OY0A 5EEGA 3GCZA 1RI1A 3I53A 3DLCA 1PJZA 5LQCA 3CJRA 2OB1A 4QPPA 5CIYA 5ICEA 3KQTA 3B89A 2IPXA 1SKMA 2GS9A 2PXCA 1YB2A 4LECA 2ZZNA 2AS0A 3ER8A 2PSSA 4XCXA 1I4WA 1JTEA 2ZWAA 1KR5A 3MTIA 5LQUA 2UZ4A 3IHTA 4JXJA 3MCTA 1MHTA 5K03A 3M6UA 1WY7A 3REOA 5HOQA 4YUYA 3X0DA 1VIDA 3VYWA 2BR5A 2GA9A 5CUQA 3BT7A 1JQDA 4KVZA 1FBNA 1NV9A 3PT9A 4FT2A 2N47A 2BH2A 2PT6A 2ZSUA 3EVDA 3B3GA 1L3CA 1Y8CA 1SG9A 1QAQA 4GBED 4L7VA 1ZHFA 2H00A 3HVHA 3M33A 4QTUB 5H02A 4C04A 5KS2A 2CKDA 2IBSA 3E23A 2NP7A 3G7UA 3JWIA 1JG4A 1RJFA 2FK8A 2HV9A 1WXWA 1EQAA 2GAFA 2XYVA 4E2XA 3NVKI 4XUDA 3M6WA 3PB3A 5CVEA 2CMGA 3HTXA 8MHTA 2YUIA 4F85A 5DXJA 4RTSA 3LDGA 4PIMA 5DM0A 4QQNA 3IYLW 4ISCA 2P35A 4DCMA 1L9KA 2WA1A 4PGGA 2YR0A 5M5BA 3DMGA 3G8AA 3SR4A 3A4TA 4FS8A 2WK1A 1Q0SA 4AZTA 5GIPE 1X19A 4AUKA 2B25A 3P9CA 1NE2A 2PX2A 3EEYA 3PTAA 1ZG3A 5CM2Z 3G2QA 5DTRA 1O54A 3PX2A 2FK7A 4U7PB 1EJ0A 2AN4A 3AWIA 1YZHA 3G2OA 5EC8A 1RJDA 3CBGA 3GRUA 2QY6A 3FPEA 4GEKA 4EQZA 3P2KA 5EMKA 4OX9Y 1T43A 3FRHA 2H1RA 2OB2A 2PXXA 2LD4A 2PV0A 5E1OA 2B3TA 1FP2A 3KQMA 3M6XA 3VC2A 5JR3A 3DH0A 4KRGA 3KR2A 4EVIA 3HVJA 4RVDA 4C4AA 5FTWA 1VQ1A 4PNEA 3HA7A 5FA5A 4Y2HA 3A7EA 2R6ZA 4DA4A 3GDHA 2P41A 2ZW9A 3PS9A 3PVCA 4X41A 1G6Q1 5F2KA 5EG5A 3SXJA 3FPHA 3T0IA 3AXSA 5DSTA 4RVGA 2AZTA 3Q87B 5BP7A 5E8RA 3T7TA 2JG3A 4QVKA 2EJTA 2EFJA 3G2PA 3FUXA 2HNKA 3TRKA 3TQSA 3CVOA 3JWHA 2ZVJA 1KXZA 2NXEA 3MCZA 4P7FA 3P8ZA 2IH4A 3LCCA 4WVLA 3UJAA 3MB5A 3OE5A 4FR0A 2QYOA 1EG2A 2UYCA 3BWMA 3ERCA 3PLAE 1DUSA 2VDWA 3V97A 3EGIA 3HVKA 3EVAA 3UJDA 1UFKA 3GXOA 3KQQA 4P7GA 3UA3A 3O4FA 4CKCA 1NBIA 3GRRA 3FTEA 2YXLA 2JHPA 5CVUA 2BM8A 3DR5A 5F2NA 3NW9A 3KQOA 3P9NA 4V0RA 5K8VA 3DXYA 5DX1A 2EJUA 4RX1A 4YV0A 5E2AA 3BWBA 2VDUE 3OU6A 2AN5A 3KKZA 1TW3A 2IDKA 5EMLA 4X1OA 5K01A 3I9FA 4MQ4A 5U4XA 4LG1A 5E9QA 2Z6AA 5CD1A 5FULA 3NVMB 2ZBRA 5E9WA 3MGGA 3IV6A 3CC8A 3M4XA 3P71T 2FHPA 2PX4A 4CKEA 4OQDA 1RI4A 4PYIA 5C9ZA 4IKPA 3KPUA 2IP2A 2XYQA 4AZWA 4X60A 2WA2A 4PIPA 3E8SA 5HIIA 4DM3A 5DPMA 2NP6A 3R24A 4E2ZA 2QE6A 2GPYA 4PYLA 4RTLA 1D2CA 5DM2A 2IH2A 3GO4A 3LDUA 3ELWA 3LX6A 2GLUA 5CVVA 2OBFA 5KVAA 3A26A 4BP1A 5ICFA 4HTFA 1JSXA 4FGZA 4G56A 5DT2A 3KQVA 4ER3A 5ICCA 4RTNA 2AN3A 1SQGA 2HR1A 1N2XA 1H1DA 3THRA 3AXTA 4ER7A 5FQNA 4CKBA 2R3SA 2P7IA 1ORIA 4UOEA 3BKWA 1M6YA 5DRYA 3CJTA 1JG2A 3HM2A 4RSRA 5K0CA 3I5UA 2ZBQA 2P8JA 4PYKA 3FPGA 1VE3A 1PJSA 2B9EA 1G55A 4RV9A 5EIWA 3I64A 4FT4A 2I62A 2VDVE 3BGIA 3JWGA 3EGEA 1XJ5A 3NDJA 5DM4A 5T64A 4PYOA 4RVHA 2P7HA 2YTZA 4MTLA 3KPYA 1JTFA 3MHTA 4DKJA 3OPNA 3H2BA 3A25A 2BM9A 2ZIFA 3OZSA 5F2OA 2Z6UA 4AX8A 3GRZA 1VP3A 4AZSA 3HCFA 4P7JA 1JR4A 3QOXA 2PX5A 4KDCA 3ELDA 4QVGA 5DX0A 1DL5A 3GU3A 3FRIA 5FHQA 4Z2YA 3SX0A 1G8SA 4F86A 3DULA 3FPJA 3OU7A 2PY6A 2FPOA 3EVCA 3FUWA 3EMDA 2VP3A 3K6RA 5EGSA 4E31A 3EEOA 3MTEA 4KDRA 5KYGA 3LCVB 1M6EX 1RI2A 4GC9A 5DM1A 4C06A 4YV1A 2FYTA 5ERGB 4POOA 1WZNA 3EVFA 5BW5A 1TPYA 2EG5A 2DPMA 3GRVA 3R9XB 5E1DA 1N7IA 2E5WA 2ESRA 4OA5A 3LCUA 2NYUA 1XDSA 5FQOA 2NXJA 1UWVA 5T67A 2ZLBA 4MHTA 3BWYA 4DZRA 3A7DA 1IY9A 1XVAA 3TMAA 1BC5A 3TOSA 4IV0A 3FTCA 2ONYA 3NTVA 2YQZA 5FHRA 1B42A 3PFGA 1BKYA 2DULA 3TKAA 1X1CA 1G60A 2P3QA 5B1SA 1NT2A 4FP9A 3WSTA 3FTFA 3A27A 2PGXA 1KYZA 3EVZA 1OR8A 3OFKA 3RODA 4YMHA 1Q0TA 1INLA 1VP9A 5HZMA 1VBFA 4YV2A 4R8RA 3DOUA 4NECA 3R0QA 5K0FA 3P9KA 5EZSA 3G5TA 3P2EA 2O05A 3SSOA 2B78A 2JH8A 3HCBA 4R8SA 4GOLD 5IKMA 3OZRA 3BGVA 2XVMA 4IWNA 5EKXA 3UA4A 3CJQA 5JUWA 3P2IA 4HH4A 2IFTA 2PWYA 5HFJA 1ZKDA 3C3PA 3DXXA 1AQJA 5EZQA 2HTEA 2G70A 3EPPA 3SSMA 1SUIA 2G72A 3G5LA 4H0NA 3NWEA 5EEHA 2H11A 3OFJA 2AR0A 3HP7A 1JQ3A 3C3YA 2QRVA 5E8JA 5FWDA 4RTOA 2ZFUA 3F4KA 1AQIA 4E70A 1O9GA 3B3JA 4DQ0A 4RTPA 1XCJA 4O29A 1X1DA 3KPVA 5EVJA 5K09A 3B7PA 1XCLA 3DMHA 3Q7EA 2AOUA 1AF7A 2C7OA 10MHA 2I9KA 3EVEA 3THSA 3UJ9A 1P91A 3UJCA 1JQEA 3HEMA 4M38A 5K0JA 1QYRA 2UYQA 5BW4A 2C7QA 2CL5A 4LWPA 1XDUA 1RJGA 4YMGA 1NW3A 1YZ3A 3U81A 3UZUA 3C6KA 1IXKA 3B5IA 4PWYA 4HG2A 4LWOA 2PJDA 4KIFA 5E2BA 3LKZA 3S68A 3K0BA 3M6VA 5GM1A 2XVAA 3LECA 2OO3A 1L1EA 3LHDA 1ORHA 1X1AA 1KHHA 3MAGA 4YUZA 4K6MA 1IM8A 1Z3CA 3GJYA 3UJ6A 1AV6A 4P58A 2AOTB 5D1HA 2UYOA 5LQJA 4BLVA 4HC4A 2O06A 4HTFB 3ELYA 4P7KA 1FP1D 3TFWA 3T7SA 1FPQA 2ZWVA 5E1BA 2OXTA 3VSEA 4QPNA 1EIZA 1KPGA 1ZGJA 4PYMA 1KPHA 5LQKA 2IBTA 1F3LA 3LBFA 3M70A 4MIKA 4C08A 2C7RA 2BR4A 3EVBA 2AVDA 5CCBA 2O0LA 4XUEA 3HVIA 4YUXA 4KW7A 4Y30A 1KYQA 3DP7A 1NV8A 5DTMA 1XTPA 3TPZA 3G2MA 5EIFA 1BHJA 3FUVA 4GOND 2QM3A 3LGAA 1KPIA 4E2YA 3KR1A 4B17A 3DUWA 1QAMA 1YFJA 1NW6A 1JG3A 3C0KA 3DTNA 3FYCA 4U7TB 1NBHA 5LSAA 3FYDA 5DSXA 3TKYA 1QAOA 1SVUA 2C7PA 4EKIA 3KU1A 4CXMA 2ERCA 2PVCA 4PCLA 1ZQ9A 4QQKA 4ER5A 3GWZA 2P1DA 2JH9A 3LBYA 5EOVA 4RTQA 1EAMA 3RIEA 3OCJA 4RTKA 1EJ6A 3PX3A 4BLUA 1R00A 1TW2A 2UYHA 1V39A 5P8WA 5HIJA 1UIRA 2JHCA 3HCDA 2KW5A 4RTMA 3C6MA 3IEIA 5GWXA 4PONA 5HEKA 2A14A 2OZVA 5K0BA 3EGVA 4X63A 3EMBA 5EPEA 4C05A 3FPFA 3I58A 5EHIA 1R6AA 1QZZA 2ZIEA 5CVJA 5GINE 3BZBA 2CMHA 3T7RA 4F84A 4XUCA 4KIGA 3HNRA 1U2ZA 4PYQA 2P3OA 2VZ9A 5GM2A 2YX1A 3UJBA 1P1BA 1R18A 4QDKA 2AOVA 3GGDA 4CTJA 4RTJA 2JJQA 4QDJA 3SGLA 5C1IA 2NXNA 1NW5A 4GUAA 5KQSA 2V7EA 3E7PA 4EMSA 2GH1A 2IIPA 9MHTA 1YF3A 4RYLA 5DWQA 3UJ8A 5ICGA 1JSZA 2JHAA 3ELUA 1WG8A 4RTRA
chains in the Genus database with same CATH superfamily
2H8GA 3GLHE 2VUHB 3IP9A 3DBHB 2Y6VA 2PCLA 4TWIA 1KEEA 3K1YA 5EMHA 5HF9A 2AKEA 1KP3A 3BXHA 3V1TC 2P62A 3N2NA 4XM1A 3P0HA 3SC2A 1IY8A 1D6MA 3OU2A 4JQSA 5K2MA 1DCTA 1FJ2A 2F3RA 3WGLA 4REMA 2WFAA 5TQ0A 3KPWA 2G77B 2DGDA 5HIKA 3EOZA 5JAMA 3S8EA 3MJDA 1A8IA 3HY3A 5HS6A 3OZCA 5DNEA 1R74A 3VPFA 1C9EA 1V8PA 2YXDA 3OESA 1GM5A 1ZXLA 3M6IA 3EXEB 5REQA 3NIBA 1I2BA 3MWDB 1Z2EA 3PNSA 3SJZA 3ML1A 3OTHA 2FSSA 4N1AA 3SEZA 2ZCJA 3HABA 4RV4A 4C29A 2JJYA 4IICA 4HRYA 1E6WA 3DTVB 1VDMA 1N36B 1R4ZA 1F8GA 1UAYA 1DIOB 1I4OA 4H1VA 4ZKEA 2XMQA 5D5QA 1DFGA 3LBIA 4KVGA 3GZNB 3TR6A 4D92A 2ZBFA 1CEYA 3L5OA 1DBVO 3PXXA 2C83A 5HILA 2X3YA 3B3FA 2PHZA 2ZG6A 3A3OA 4C0LA 5FUYA 4PS0A 4LVUA 2HU2A 4YJHA 4FXOA 1YNOA 3FIUA 5FWNA 5D1NA 1NSTA 1FSFA 2WU4A 3OE4A 4JYMA 3A9RA 1AZSC 4A16A 1TCUA 3LK7A 3TM4A 3B48A 5P21A 6ADHA 2W2KB 1QCDA 4COOA 4ER0A 1IXZA 5KYKA 2AJTA 3VH2A 5JNSA 1JG1A 3NBMA 3DZIA 3SZOA 5AVWA 2DR2A 3DC2A 1TFRA 1K9VF 1YE8A 3EAQA 1SR8A 3GBPA 4YH1A 5G0UA 3VRHA 3EIFA 3P9IA 4YUAA 2RK3A 3THWB 4WVFA 3A4NA 1U3FA 2YV3A 3L8CA 4FYHA 1UBSB 2OHXA 3BMOB 1BXGB 2IWHA 4C0AC 4WSPA 4M8LA 5GMOA 5GJWC 2ZBVA 4NCAA 2C99A 1TKCA 1XRRA 2Z56A 3HDJA 1FUIA 3O1IC 3ROGA 5COBA 3OX4A 3X2SA 5JJBA 2H1WA 4D9HA 4KJXA 1YRQA 4ZVMA 4HVLA 4PYJA 2CJWB 3HN6A 4ZQIA 1UDAA 2IHTA 2GBCA 4L5YA 4KQ2A 3A9UA 3AG6A 4JQZA 3A1UA 1SM4A 3G23A 1FUKA 3BSSA 1HYQA 1VGVA 2OXEA 3IILA 5FADA 2X5OA 4PICA 2RI1A 4HPXB 2G06A 1D2HA 1NUQA 1Y1QA 2VR1A 2GEVA 3DBIA 3LWZA 3E58A 4B71A 4KREA 1KYIA 3JQ9A 3RG8A 2PCJA 4FDUA 5C5DA 3BGOS 1TUGA 2Z6QA 4JC5A 2HMWA 2QRVB 3NTUA 3P9QA 4BLRA 1RVV1 3WLTA 4FE7A 5TQ2B 4UHEA 4W7HA 1ZWKA 1X1RA 3HKEB 5BNIA 3ZEAA 2I7VA 2VT7A 4X8LA 2VQEB 2DWPA 1JHDA 1P29A 2EORA 3KHKA 3LXXA 5JU6A 1X3CA 2O8VA 3IUPA 1TZCA 1IPEA 1UQUA 2N1MA 3ADPA 3T3HA 5KQMA 3DEYX 1J1ZA 3CZ5A 4GI2A 2H2IA 2FRXA 2JLCA 4M9VC 4NE9A 3UPTA 4M49A 3SSNA 2FV4B 4TGLA 4U7DA 1A96A 2NLOA 2Q5QA 2F8LA 4PCAA 5ILOA 4JYZA 1C8VB 3KQYA 1OI3A 2J31A 3U19A 2PUCA 2WLTA 3BD6A 3FVVA 4M2ZA 1TTHA 3A3YA 1COZA 4BVAA 4YPVA 4HGYA 3K73O 4BPRA 4WLOA 3PWTA 1QBGA 2QTVB 4IF6A 4Y2SA 3T5TA 1Q0RA 2EMAA 3LRXA 4MVJG 4AJ2A 2ATIA 2CUTA 1W96A 1BOFA 2HU7A 1G64A 1TKBA 1JFRA 2GZDA 3KSDO 2AS0A 1D07A 1T4OA 1QRRA 2PSSA 3LLVA 2ZWAA 3SAJA 2IU4A 3ESZA 1QDEA 5F1PA 4H1UA 3B70A 1I32A 4CNBA 2GA8A 2ZWPA 1QFMA 3O3MB 1Z6XA 4LJ9A 1KKMA 2LDXA 2QLLA 2O3TA 2JFNA 1MC1A 2O7VA 5CCDA 1UBMS 3GMDA 3K09A 4RORA 4ENSA 1L5KA 2PJUA 3VYRB 1U3WA 1ITZA 5D3QA 3T7KA 3L9XA 1QKKA 4J4BA 1SU4A 2EOHA 1SU8A 2G82A 4GBED 4EO4A 2YJ3A 3U2QA 3CZ9A 1ESMA 1Y4AE 2HX1A 3NHBA 1GZ6A 4KFTA 3VNAA 4C20A 2WOOA 4LXUA 5KSWB 2YHAA 4MDEA 4DC9A 3LYLA 2W11A 2QYHA 3D81A 1G8GA 1GYPA 2AFIA 1E2GA 1L8LA 3KYCA 1B0ZA 3NBFA 5DGIA 5CITA 5IW8A 3THNA 2CDBA 4TZ0A 2VRCA 3HTXA 1SG0A 1FFEA 1DDIA 3HRHA 3RVQA 1AHIA 3OICA 4JQCA 5LXTA 3HJAA 3AF2A 3I8OA 1FMTA 3T5AA 1QP0A 1KH1A 4W4TA 4D4GA 3UV6A 1PI3A 3QEKA 4BVJA 3P45A 3SYNA 2DETA 4E5SA 2QJRA 1L5LA 1F6WA 2A67A 2YR0A 3DKIA 2V4ZA 3PPVA 1G2IA 2FX2A 2ZI4A 1QQ7A 1E3IA 1ZD2P 2NZVG 1YL7A 1E1CB 2PSEA 2ZBDA 3L8EA 4OIFA 3JVEA 3FCXA 1C4WA 4RAOA 4RVSA 5LN1A 3Q5GA 4BZZA 3SU8A 1O0SA 1X1TA 2JJ8A 2J3IA 1CRZA 2GD6A 1JEEA 3EQ6A 1U04A 4RESA 5IT4A 3KLNA 4HAZA 2H07A 1B8VA 3TCXB 4EI9A 1SHKA 2NZYA 4HJXA 3TX2A 1S8NA 3DH0A 2R8YA 2YV1A 3AHEA 5FTWA 4BYGA 1UC9A 3P5BA 3HKDA 2PKEA 2WVGA 3E7DA 5TF4A 4DA4A 1TO2E 2RS6A 4KFCA 1JDPA 1H2HA 4FYJA 4X41A 3ABSB 2G5PA 1WQ4A 2Z2JA 5AUNB 4BLPA 2Y4NA 3FSEA 2WM9B 2GPIA 3CRNA 3FPHA 5DSTA 4DREA 4G41A 3NIWA 2AZTA 3AIMA 3R5KA 1RYZA 4L07A 4NU5A 1WD7A 4JEIA 5CDFA 5BP7A 2IYLD 3ZJ4A 1GD1O 1GU0A 3ZXYA 2EJTA 1SG6A 1RQGA 4L78A 2R5WA 2PWBA 2O1WA 4PZUA 1BROA 1KXZA 5AE1A 1NMSA 1ULZA 3U5ZB 5D51S 4ZOEA 2R62A 2WICA 1P2UA 4OOGC 4LYEA 5B1IA 1U8AA 3HRKA 3OE5A 1Z0IA 5CW1A 5TE9A 3AHFA 1DFHA 5BUSA 3UA3A 1ORDA 3O5AA 4IFEA 1L4YA 3BRQA 4RD3A 1NBIA 1X94A 1FS6A 4W6QA 4HQKA 3DEZA 2YXLA 4BAGA 3J81A 3EA5A 1Z4KA 2YHIA 1C7ZA 1HQCA 2JK1A 2X8LA 2LTSA 3G79A 4CKBB 2XW6A 4G4JA 1A9YA 3KS9A 4RX1A 1WKCA 3OPYB 3HL4A 2AN5A 1KAQA 4QUJA 3DJWA 1ADJA 2RIRA 3LX4A 4D9IA 1T8PA 5CA1B 1NVGA 3EJWA 3PUKA 3QVOA 3PC3A 4OXXA 1CUDA 3KETA 2ZIWB 3GG9A 1PO7A 2WVHA 2QV7A 1DRWA 3U3RA 4DLAA 2IPNA 4CMKA 4PPGA 1XFAA 1H0RA 4DJ5X 5F9HA 4M0UA 4KUEA 4OUKX 3S2GA 4DIOA 5BN5A 1Z2NX 1Q19A 5IAEA 2EM0A 2Q4EA 1E3QA 1P2BA 3ICQB 1MO5A 3QXGA 3V4RA 1M66A 2UUAE 4O4KA 2DMYA 1JG6A 1T5SA 4OF4A 4OQFA 1AUPA 4F72A 2HA2A 2CBGA 2GPYA 2OG1A 1N75A 4PAWA 4C3ZA 4G24A 2GGSA 3A14A 3PQCA 4DV5B 1I5RA 4I55B 5KTKA 1NLZA 2EJVA 1QG4A 1H9AA 2FPRA 4GWGA 3KZMA 3KB6A 5ECGC 3EF0A 5CDYA 3PCRB 1V9LA 1Y6ZA 3AXTA 4A0RA 1PR0A 4RW0A 3A10A 1QMPA 2KPOA 1H6DA 4FWIB 2BFMA 2V3VA 3RS8A 3HM2A 1JG2A 4NSNA 1XQ1A 3QQ5A 2CVZA 1A9SA 1HSOA 2GBLC 3I42A 4JLMA 3R4CA 2VDVE 3WLAA 4E12A 3HBLA 2LNDA 5DT9A 1AUXA 3OFND 1PWEA 2V98A 3GNTA 3MHTA 2WKWA 5I47A 2F43A 2FMHA 2PBLA 4G09A 2ILVA 2PYDA 4XGQA 4YT8A 1VP3A 2IEGA 4QVGA 4C4OA 3ZOQB 3M1LA 8OHMA 1R1DA 1YHNA 3BG5A 3FPJA 4MUGA 4F86A 2Q3HA 1TQ6A 1TLFA 2FPOA 3ZKAA 3KT0A 4DUZB 4YAIA 1RXEA 4LDPA 2IYPA 1U8XX 4FVTA 3KOZA 4FLFA 1PX2A 1QTNA 1CQZA 1P2FA 1LSUA 4POOA 1ZAYA 1NXTA 1W88B 1EVIA 2QSUA 2X3UA 2VJMA 4U7HA 2JIQA 3K4QA 4QHSA 1J33A 2CLOB 2NWQA 2VC2B 4NBRA 3H86A 3L0ZA 4ZVUA 1IWBB 1CJMA 1MVOA 4ZVOA 3ZK7A 2P69A 1UKEA 2JAHA 3L0DA 5T67A 3V42A 3GP8A 2XQKA 1JR6A 3VPBA 2JGKA 1OUMA 1ZSVA 1F3OA 4GZ6A 3UNXA 1HG1A 3KSBC 2A4MA 5I8PA 2GK3A 3UBMA 2BGKA 4IKOA 4IV0A 4M60A 1ENPA 1EFUA 5KQGA 1M3SA 4RKWA 2A92A 2UUBB 4XR4A 1YB7A 3GOHA 3WKAA 4J90A 1IY0A 4U00A 1GDDA 1A72A 5KWJA 1X1CA 1EVZA 1UODA 1OAOA 1S4QA 3R7FA 3MM4A 4MWSA 2QLBA 5AM2A 3KWLA 1I1HA 1YA8A 2OFPA 1XO1A 3C7TA 4MVJP 5FLKA 4YMHA 3O8QB 2E89A 3C6YA 1MH1A 3N86A 4YV2A 1R8JA 3RTBA 5L3SB 1V0JA 4H9GA 3C39A 4IVPA 1MLDA 1TADA 5GPBA 4AYXA 4JIGA 2FI1A 1U1IA 1T6NA 4N3NA 3UHJA 2IZ5A 2WWTA 1XMPA 5TIIA 3GRFA 1QYDA 2G4LA 2RK6A 2W70A 1VYHA 3QUSA 5A4FS 5LYJA 1BQEA 2W6ID 5E6UB 2C96A 2KB0A 3B6IA 2ZR7A 3TXXA 3VYTB 4GI3A 3SZMA 4OTZA 2H3HA 3RLFA 3O0TA 3G5LA 1RYBA 3IUMA 2DC1A 2VRWA 3PGXA 5G0VA 1U2EA 1FTNA 2XAAA 1Z5NA 3C3YA 5FWDA 4PG8A 4ZK2A 3WZ2A 2YJGA 5KJFA 5B7GA 5IBRA 4AJ1A 4LNUA 1LVHA 1RWVA 2X2FA 3F9CA 4PPYA 1EEHA 1PYGA 4BP9A 4WLFA 5BWMA 4E5VA 5KL7A 1M9NA 2P2SA 4WKNA 4MLCA 4RTPA 4O29A 4WL0A 4DILA 3RRFA 2O0KA 2DSYA 5KU7A 1KFEB 1AF7A 2ODTX 2LE0A 3TTWA 1M8GA 2FMKA 5HBGA 1DGQA 5ESRA 3MIZA 1IEVA 2ZUDA 3EGDA 2QSYA 1CE8A 2P5UA 4RIHA 2CL5A 4HDKA 2GN9A 4IXWA 1F20A 1B0PA 1XWWA 4RZUA 5H16A 5FDFA 3HUMA 3I5XA 3GUHA 4KODA 1WHTA 4NEHB 3M6VA 2EAUA 4BVBA 1OIXA 4D1YA 2OE2A 4M7OA 4MAMA 3D0QA 3UUEA 1YKGA 4MP6A 1IM8A 3KKLA 1T8WA 3RHZA 3MD9A 3GJ5A 4L8FA 4P58A 4RMHA 2ZE7A 3K2BA 4HTFB 4FPXA 5BW6B 2ZJ2A 3P4UA 1L4BA 4TT3D 3CB2A 2YWFA 4D6PA 4JN6B 4RDCA 4RNCA 4JKOA 1V3UA 4YFYA 4TLAA 4C08A 1MX1A 1W73A 4OSEA 4HEIA 1NG1A 2HQBA 3D31A 2EKLA 3C5EA 1OB2A 1NV8A 1YASA 3ZVNA 3HGQA 2A0KA 2AZDA 4FDMA 4QNRA 5IT5A 1TMKA 3S6JA 1ZRHA 4GOND 2XGOA 4E2YA 2B6HA 1Z88A 3IIEA 2V7UA 4C89A 1EVYA 1K0FA 4BFZA 5LSAA 1VKHA 3VZRA 3F73A 2RARA 2GAIA 1QG0A 2PR2A 3HS3A 5C7YA 4DMUB 2OCBA 2ZYAA 2WUGA 4TKMA 1A1GA 3ZX4A 4LRYA 2W83A 3N2ZB 1G8HA 4RTQA 4M4SA 3OCJA 2PGOA 2VFAA 1ULAA 4I50B 2F4VE 4MEAA 1OH6A 3RBAA 1A77A 5BURA 4PYRA 1QQ6A 2X5XA 4QYWA 2X6RA 3K5HA 1Q17A 2IVZA 3KFVA 2CHQA 4JROA 4PONA 4C5BA 2X42A 2YQ4A 1X7WB 4V24A 5JADA 1YR8A 2OEPA 4UW9A 1SBCA 3DCJA 2R00A 4NYIR 4R84A 2BF4A 2ZRQA 3CX8A 1I9CA 3LLSA 5LP6B 1HR0B 4Y6GB 3D3EA 3GJRA 3N5KA 1R64A 4Q21A 4I1UA 1KY5A 4WQMA 1XE3A 4YREA 3SF0A 4ARBA 1GCGA 4C21A 5JLJA 2VAPA 2XF8A 4V0NA 4B8WA 2NYAA 2XUFA 1U9JA 1E79D 4UNIA 1OV6A 2FDRA 5BQXA 1UFOA 3D5EA 3IQFA 1VCIA 4A2QA 5DWQA 4EJSA 3QW2A 4R2IA 4P54A 2BT4A 2GFIA 3ELUA 3MMZA 5EE3A 2DRIA 4WPGA 4OAOA 4MR8B 1C80A 3C8UA 3OMXA 4M9CA 3O8LA 2QRLA 2QY9A 3OT1A 4JJ7A 5IJXA 3SIPA 4G5GA 5TB5A 2IDJA 3RVMA 3LDHA 3QE3A 4JOSA 5CAEA 2PNFA 3PHCA 2ON6A 2WAXA 5C4MA 2JI6A 2J3LA 5AK0A 4FNGA 2V6JA 1A1HA 1U31A 1JPJA 2IOQA 2VN8A 1SELA 2NX2A 4NY1A 3W2EA 4MQ6A 4R05A 1MEEA 1MABB 5AM3A 4IIBA 5H4HA 3GJXC 3NEPX 2GAJA 3D2LA 3P7MA 3H4MA 1RLJA 4RA9A 1DX9A 2BLNA 1Z5ZA 2MYNA 2VF2A 3RS7A 3TTTA 1NW8A 1N3LA 2BSXA 4RVFA 4DMLA 3TECE 2Z04A 1ULSA 2PTHA 3JATA 3WLOA 4YMWA 4EKDA 3QVJA 3DAFA 5EZYA 2RAVA 1D09A 3R6LA 2XXAA 5JISA 1QV9A 1TF7A 1U7PA 2H2DA 2BKVA 4YQEA 3C3EA 3W5HA 4BWGA 4C14A 5C8VA 2EM7A 2HT6A 3TKAA 4E30A 1G3RA 5K3BA 1MPTA 2IJGX 4FNMA 4IKEA 2JGLA 4YDRA 5ITVA 3ECCA 1UJNA 1JECA 4WN9A 4CKWA 5AJUA 3E05A 3DDWA 2NZ8A 1RHRA 4RLSA 3ZI0A 5F3WB 1AM4D 3PNQA 4LF4E 2IYFA 3FW1A 4CWAA 4GOJA 1O8BA 3NC1C 4WOCA 3ZV4A 4YXWD 1XZQA 4A10A 1XMQB 1WP9A 2FDCA 4G0WA 2EN7A 4BY9E 4K6CA 2CNBA 3AKYA 5K3FB 4BNZA 2G25A 1RMDA 1GLNA 2R44A 4R68A 3VOTA 1PQYA 2R6CA 3RVLA 2NSLA 2X14A 3KHUA 3W4JA 2C82A 5CX1B 3H9CA 2LUPB 2EMLA 2HGHA 5IU6A 2GN0A 3AUTA 3BXGA 2WMOB 3P19A 3KR0A 1XROA 1J2YA 3CUTA 2A86A 3NVDA 1RAAA 4MW0A 4TN5A 4UBIA 4OJTA 3KK0A 4JI4E 2JEZA 1MAHA 3RJZA 1ID8A 2H1SA 5I48A 4KR2A 1K08A 2AVNA 2F9MA 1KJJA 2EMCA 4YACA 2VKTA 3ADKA 1RWWA 1NMQA 2HHJA 4W8GA 2NV0A 3VJMA 5A7FA 1OX4B 5K8JB 1W52X 1KSHA 4EI8A 2ZKIA 1JQKA 1VECA 3JZFA 3FY4A 3LVFO 4LX8A 5GP1A 3H5VA 3N7AA 3RNLA 5K0TA 3U4MA 1VLJA 2IBMA 4HYEA 3C2QA 1ZO8A 2JAUA 4UXHA 2PZBA 2VT3A 1K5GA 1MAAA 4Q3AA 3N3AC 3UJ7A 4B3XA 4D9NA 2ZZMA 2JRLA 3MF4A 2JFBA 4ZC1A 4IDAA 1W0KA 3ZY5A 4EY4A 1U90A 3IS3A 1WCV1 5CH3A 3GLGE 1JVSA 4FD2A 3EDYA 1J0DA 1FRNA 5AM4A 1QV6A 1DXQA 2GPTA 2H29A 2H7VA 4I9NA 4MWOA 2PWAA 4O1MA 5GGYA 1US8A 2C4KA 2EM9A 2YN2A 3O4RA 5JO0A 1NM5A 5EPUA 3ORHA 5ALKA 1E20A 4CVNA 5ADUS 3TLGA 4M8NE 2E2WA 2R1VB 5JH7B 4XQCA 2Q4RA 3LUBA 2AF4C 2QBYB 2R5FA 4ZV7A 5EWLB 3JSXA 1V37A 3BK2A 3O2QB 1MGOA 4GX0A 3RFCA 1RCTE 1V4VA 3UH0A 2LBPA 5KJEA 1DXHA 1MO3A 1V1JA 2FMTA 1JHQA 1T4CB 2P2YA 4YCJA 4DIKA 4CKBA 4CG1A 2FETA 1YC5A 1N6HA 1MJGM 4YHHB 4LC9A 1G42A 1ECCA 4AXXA 4CIXA 2EOOA 1G20B 1M2OB 3EVNA 4F4FA 5A1JA 2GRUA 2PPVA 2QMOA 4MR7A 4P4SA 2FEPA 4PZ0A 4Z4QA 1HX7A 1XB2A 3ICPA 4N49A 3GCZA 3O47A 1K8XB 2AG0A 2EMZA 4BO2A 5FUMA 3F90A 4CCYB 4EYSA 1CQIB 5JYBA 2PJRA 10MHA 4JBWA 4HGPA 1AC5A 4RH3A 3RLIA 5C53B 4PZPA 1X87A 4QBFA 2ORIA 4LV5B 1FYWA 2ZZNA 1C3LA 2IKQA 4DRXB 4X65B 1JTEA 1PHPA 2P3SA 4D79A 5JQGA 3KKMA 1UIMA 2C88A 4DG5A 1KBOA 5K03A 4KN5A 2XSZA 4KPGA 4JI3E 1WDKA 2ZB2A 4IL5A 2FEOA 2EN3A 1U3DA 2F8BA 2LMZA 1RMYA 1VI2A 1RZUA 3WGVA 5DE3A 5GONF 5DHAA 1H22A 4CM9D 4BFTA 3ZIDA 2YVAA 5BV7A 1FDIA 1G7SA 2WWRA 3EE6A 3PBKA 4HDAA 5FNVA 1ZVJA 5BYJA 3R8XA 3ICEA 2FGGA 1JBKA 1E2IA 4UM5A 3E0XA 4X94A 5KQLA 1UDRA 2QVGA 3JD3A 4S0ZA 1ODKA 5CT4A 4J7XA 1X5WA 1E9VA 4IH4A 3VPGA 2F62A 3GQBB 1SUBA 3LWBA 5LNK6 1E1KA 3L05A 1YJXA 1SRQA 3NBYC 1CD5A 3IAS6 4YIKA 5SV2A 4L6IA 2KI5A 2VJKA 3M3PA 2IOHA 3R3SA 1IVNA 3QWFA 4O4HF 3TCNA 3K1AB 2FSHA 1E62A 2Q1TA 3LHSA 4CT5A 1C30A 5J2TA 3C3CA 1TD9A 3TZBA 1ZP6A 1WTCA 4IP0A 4OY3A 4F98A 4ESVA 2AQKA 4LSGA 3ZWBA 4HI0E 1Q91A 2VUSA 2FN8A 5KQPA 1Q5PA 1GLGA 1UZLA 3OTWA 4LY0A 2R1FA 2H4YA 3QKIA 1GQ2A 3IT2A 3PTAA 4TRRA 1JMYA 3AF3A 5EUMA 1H69A 1UBRS 5ALPA 4Z7JA 1RXCA 2GLXA 2HQ1A 2PSDA 2IYNA 3IVRA 4Y9TA 3DV0A 4DEVA 3K0FA 2CSXA 1JP7A 4EF4A 3O4VA 3FN4A 1GPUA 3B1XA 4R3WA 4O4HB 4TV9B 2Q6TA 2IRWA 3FXAA 4K6KA 4EQZA 5DNWA 1UWKA 3PUHA 5A1TA 2PXXA 4JBNA 3RYCA 1MVNA 1NMYA 4IS3A 1GCAA 4U7WA 1R37A 2X0FA 3WKCA 3LZCA 1F8YA 4IJQA 4IIFA 3H9EO 4BV3A 4C7BA 2W2LD 1KDZA 1S9HA 3IV7A 4XPIA 4KTTE 3JRXA 1CS0B 3PVCA 4N9WA 5JO9A 4D4JA 5CDFE 3SQXA 1GSOA 2DHEA 3CH5A 3IDFA 4LBWA 1T15A 3GVPA 4RVGA 3AHJA 5EP4A 1AV7A 1PJ4A 2B0JA 4D80A 1I4EB 2VDWB 4Q12A 3T7TA 5KNDA 2JG3A 2RMKA 1Y8RA 4PBTA 1TU4A 1Q1ZA 2EFJA 3S3TA 4CCSA 4EHNA 5K5EA 3UGJA 2O5CA 1CUXA 1R12A 1BDIA 2NXEA 3S7TA 3MSCA 4F4UA 4IDHA 1PF7E 2D2EA 1KEZA 4JLSA 3E27A 4RD2A 2CBXA 2QRPA 4DV2B 4R8LA 3BTOA 3I3SR 2XCQA 3QNUA 4EHHA 3OQPA 2GZSA 3J7AG 1QRAA 1EGHA 1DUSA 2F64A 1F60A 4XIGS 3HVKA 3L7IA 2JD2A 1KHTA 3O9MA 5I3ZA 4YRDA 2CVOA 3O91A 5A69A 2NUTB 3AJAA 3QBVA 4D02A 3KD3A 2OXFA 4TSRA 3KQOA 2AC2A 3Q11A 3RTEA 3URMA 5KEIA 2NUBA 2X4DA 3HBMA 1Q12A 3FB1A 4TT8A 2QSZA 2A33A 5E2AA 3VNUA 1UP6A 1T3ZA 4K9OA 3X3HA 4YYEA 1BBGA 3PGA1 2Q7DA 1N8TA 3KKEA 4HX5A 3GGGA 2YICA 1UBCA 1WOYA 2WJZB 3RYHA 1MN6A 1PS9A 3QH4A 1E77A 4H7KA 1NP3A 4M0KA 1S9DA 3FZNA 5B3AA 5LP6C 4WNYA 1T4MA 3ZE7A 3CC8A 1BHQ1 1GG9A 3MJTA 3TR5A 3CWQA 3Q7IA 1AZTA 1XTQA 4BJ3A 1X92A 5EE5B 7MDHA 1T35A 1QIEA 5HIIA 4HAOA 4MRMA 4UBKA 1KMCA 3HB1A 1G5IA 4X85A 2CXPA 1XTUA 4KH1A 3CRQA 1TE2A 5CM8B 1J5XA 4PYLA 5AKZA 5EJ7A 5CJJA 3H5NA 3VNQA 4G3XA 4NE7A 3ESRA 3LCMA 4F2HA 3G13A 2HZ7A 2NUAB 3UOWA 3UWDA 3K8OE 1VE9A 5EJAA 1MHPA 4L8LA 4NXNB 1Q21A 3H4IA 2DQZA 2IYWA 2FDXA 2GBFA 2QWXA 3VX4A 2WV9A 5DRYA 1P80A 2ENCA 1YZFA 3CTMA 4G0XA 3NBZC 4CF3A 1EX7A 5DDIP 2FNAA 4B5LA 1FNBA 1R5OA 2MIIA 3DVAA 3E03A 1A4XA 1GCUA 5MN6A 3V4ZA 2NZJA 5CU7A 5PGMA 3N5CA 3EYAA 5AK5A 3M4YA 4OHCA 2Y9PB 1U3CA 1UEXC 2LDBA 1V7CA 3D3WA 2UXDE 1EB8A 2WJHA 2VYND 3Q88A 2H7YA 3QFCA 1U9IC 2K6GA 2PN1A 4M9RA 4MIEA 4NV3A 3GU3A 1VA5A 2Y99A 1KORA 2ATCA 4G67A 2VJBA 5DX0A 2I1VB 5F21A 2Y4OA 4FNOA 4UOZA 1AXGA 5KL5A 3V1LA 2B98A 1EUCA 1IUPA 1M33A 3LHFA 3GVXA 3OE7D 4R54A 2VRDA 4RY9A 5J5VA 4O4LF 5KYGA 3PP8A 1LUAA 1M6EX 2RDMA 1KYVA 3QKUA 5HPYB 3DL2A 4OM7A 1ZCAA 1O6CA 1Q7GA 2YHSA 3QWHA 4GRDA 4B3DA 1XMOE 2MYTA 1EMDA 1V7ZA 3H75A 3GRVA 3A06A 4BE4A 1ZOIA 2POCA 2X5NA 4P4TA 4RS4A 1WU7A 4X7PA 4D96A 1XU7A 4HLUC 3UOAB 3DE6X 4GIBA 3SFZA 3ZNPA 5IEJA 2Z9CA 2OESA 3U7FB 3AKDA 1ECFA 1EZZA 2CWDA 3RFVA 3IQWA 3SYMA 4YDQA 3ZWVA 4ZMRA 3EQ2A 3IE1A 5DV9A 2FF5A 1EXVA 1X1QA 1U6JA 2DULA 3PHLA 4H60A 4CW7A 4JR0A 5ICMA 1QIIA 5B1SA 4FP9A 2AUNA 4MGZR 4RMGA 3VJLA 4B75A 1KEKA 3RK0A 4WCFC 5F23A 1Y8ZA 4X1YB 4ZQGA 3DTVA 2HHCA 3U4IA 4F9CB 4KRXA 3W7BA 2JGMA 2IXTA 1VP9A 4YC7A 2R1TA 5AUOB 4GBJA 2GXQA 4ZCQA 4II3A 2QU7A 2VCYA 4M9ZA 2LBSB 5I7AA 2W58A 2EKBA 3PQEA 5H80A 3FGOA 3GV0A 3TD2A 5KPJA 3L01A 4GOLD 3AUZA 1EHIA 2VTEA 1NVDA 2XB2A 4AP9A 1GY8A 5JATA 3KG2A 4OBBA 4WV3A 4GH5A 5FUVA 3RBVA 3HZHA 3GMSA 2HF7A 2PO5A 4K9NA 1Z6ZA 2X76A 4TWZA 1IPHA 4AT1A 1M6WA 1JH8A 2Y93A 3PQ3A 4X44A 1GSAA 3GDGA 5HQ3B 3HP7A 3KZXA 2OD9A 3QJ5A 2QL9A 3BFJA 3E9DA 3OFNA 2ERXA 5LC1A 5EXTA 1L7QA 3D8UA 1FYFA 3T1YE 4OKSA 1YVDA 1J00A 2ZB3A 3BGSA 5A5GA 5K8LA 4TS9A 1NVKA 2D5LA 1A4UA 1SD1A 2VTVA 1QO7A 2EJBA 2NO4A 3EWIA 3MCVA 4RKRA 4A2CA 4B2YA 1MRSA 2PD3A 1L6IA 3AVWA 4L0QA 5AI6A 3THSA 4HADA 1XF1A 3UJCA 4M38A 3EZ9A 2HWXA 4DR5E 3ZDCA 1YB5A 2O2ZA 3OY7A 2Q7XA 1A2QA 1FU4A 3ONNA 4N7MA 3GUZA 4BJHB 5F78A 3AOGA 1UM9B 3TTVA 4QGAA 1SXJB 2L42A 3LC1O 1P8AA 5L8VA 2IK8A 3PGLA 4UM7A 2G3YA 2PEZA 3O8CA 1O5TA 1XRPA 3WG9A 2P5YA 3N28A 3AERA 1G2FC 3EQ9A 1GZ7A 2OORC 1FP1D 1E5XA 4B4VA 4NULA 1FNDA 1TMGE 4ALJA 4Y2JA 4EG1A 5JS7A 5THKA 3O6VA 1LJUA 1JVBA 4HBGA 3WWZA 1AH2A 4L51A 4MGHA 5BN5B 1X74A 4ISBA 3TPZA 2F1IA 3HMQA 4MPJA 1EYZA 4PHFA 4PHHA 3MUFA 4FE4A 5K7SA 1AKRA 4HDCA 2BTEA 1JDZA 4I50A 4I14A 1CP3A 2OGTA 1M1ZA 4YRNA 2QXUA 3AFOA 4NQZA 5JNUA 4LK3A 2EOJA 1IN4A 1GNQA 1XJ0A 3TKYA 3ZXUB 4HNTA 1V45E 1BWQA 2PVSA 2V7QA 4CM6A 2Z1DA 3HDTA 5LPNA 5C3MA 5AXAA 3VTKA 1VA4A 5LP6A 5NULA 4XSVA 1XQ9A 5SYAA 2XLBA 1IQUA 5F76A 3GRCA 1M2EA 1DTWA 1CDOA 2IEYA 3OJCA 2QUJA 2QZPA 4MNTA 4TYQA 5EQTA 5K0BA 1N0HA 4C05A 2PT5A 1IXSB 1R6AA 2LWIA 4H7PA 1H42A 3SMVA 4UFPA 3TL6A 3C74A 5C8XA 3VKVA 4CL8A 2OCAA 3K9CA 5BYBA 1U2ZA 3AI3A 5BUCA 2WILA 2NUPA 3FPLA 1XXHB 5JBNA 3FYTA 5HTOA 2AOVA 3LBHA 5SZIA 2OP0A 4I5EA 1W5TA 1T1GA 1T8YA 4RK7A 4KG7A 4RS3A 3DT9A 4RETA 2V7EA 2L2KB 4BTLA 1PG0A 1MEJA 3A6DA 2QTNA 2Y92A 3H2GA 3L0IB 3ZE1B 2PLFA 5ELXA 1K7CA 3G5MA 1C1XA 1SC9A 1VBKA 2FW0A 2XIJA 3FFTA 2VP6A 4ZZ0A 4E7PA 3ZWPA 3G8BA 1Y63A 1U8ZA 2IOFK 3ZGLA 1U8TA 221PA 1NT4A 2VPTA 2ZE8A 3RR2A 4C4YA 4CTKA 4AUMA 2JIMA 4UTPA 4KFRA 4REQB 4P53A 3GWGA 1VSQA 2B8NA 2IU3A 3A4VA 2H9YA 3DTYA 4BMSA 4UHCA 1L3BA 2JGDA 3GOQA 5L45A 2I65A 1HOTA 2G5GX 2WYIA 2VPIA 3ICOA 1C2YA 4S35A 5GOZA 1U98A 2AG6A 4ZEOA 4KI0A 4PLCA 3AT1A 2BFDB 4BVLA 2HJVA 2CT1A 1V71A 3UWOA 4J4HA 1CEEA 4YGYA 4G63A 4FEAA 5JZBA 4RPCA 4Z7OB 2Y3IA 1U1GA 3J7Yp 1J2EA 4FCTA 3RRBA 5IBCA 4U2CA 2ZJ1A 4P80A 1EWKA 3GLIA 3MGCA 3H2ZA 4UAVA 3EISA 3FNQA 1VHWA 3QUBA 4UQOA 4EJ2A 3MTDA 5IJ9A 4LI0A 5MDHA 3KJXA 3H7AA 3NWBA 1OJLA 3KUUA 5DM70 2Y27A 4MJ3A 4OAPA 1PJQA 1RQNA 1T6BY 3HCAA 4DPKA 5I7WA 3GW8A 1EK1A 1T1JA 2QTWB 2HF8A 5I9BA 3TX6A 5BMVF 2ODWA 3RW9A 5IM4A 2CTDA 1YGPA 2CXXA 3VU8A 3IMEA 2ZI7A 3GNLA 2JAPA 1YMUA 4P35A 4P82A 1JL3A 1R88A 4IMRA 4ABYA 1BKDR 5TS3A 2J5KA 1VB5A 4N7BA 3W6PA 4EG3A 5EJ5A 5FD8A 3T5BA 2W00A 1UINA 1F17A 1CTQA 1BQ4A 5EHGA 2NA2A 3F46A 1U7DA 3P0RA 2MSNA 3FNEA 2RC6A 1JLSA 1V2HE 3LOPA 3H5IA 3IERA 1X49A 1VIMA 1TCAA 1FNNA 1PT6A 4K6FA 1Z4QA 3VR1A 2DBQA 4GR9A 2QROA 1PN3A 4IJKA 4QO8A 1Y7TA 2AMVA 1IB0A 1ODLA 4FS3A 4BHTA 1GKIA 1GTVA 4ARCA 1LK0A 2W2KA 3VHTB 3K2EA 4M88A 4WRRA 2CL0X 2C42A 1ZN7A 2JFVA 3AESB 2UVQA 4UFNA 4GS5A 4JJIA 2NTNA 2H2FA 3V1KA 2ODAA 3NVAA 2MC6A 2H9IA 3N59A 4WJLA 3O90A 1JAYA 4TYPA 1OIVA 2E82A 3ODGA 1ZRMA 3ZZUA 4ERXA 1ZU1A 2C84A 1IBSA 4FFLA 3UAWA 2R6DA 4OI0A 2JI4A 2EZ9A 1DQZA 1ZJ6A 3AEQA 1Y82A 1FB5A 5EE1A 3V34A 2R2AA 5EIHA 1QHHB 1T38A 2HOQA 4OA8A 4EFLA 2H2GA 3KYIB 3S8YA 3GEBA 3BEOA 2IEIA 1H0KA 2DT8A 1U0JA 3ENWA 3IUEA 2O6LA 3NBAA 4XFJA 4B47A 4RQAA 4EY6A 2CNWA 2GCGA 4BASA 1II8A 2UUCE 2HC9A 1I2DA 1CB7A 3DMRA 1M34B 4FJ0A 4NYIQ 2JLZA 1OGJA 3UFBA 2GM4A 4DV1E 3T3MB 1S7CA 1G63A 4KRFA 1L5NA 4HSEA 4JC4A 4Q3OA 3ZY2A 5LD2C 3Q9NA 4JVMA 4V0ME 4YJ2A 4Q7MB 1Q1NA 1UJ4A 3IAAA 2JFPA 4MDHA 5ALSA 1NXOA 4CEIB 3ZCUA 3ID6C 5LR6A 5FLYA 3C8ZA 2UXBB 3OF5A 1L6RA 4I55A 1W87A 4CM1A 3E53A 1TM2A 2ZSJA 2Q2VA 2XCLA 1TKRA 4GKKB 1CY7A 2FMUA 1PGOA 3FUUA 1PK7A 1QHEA 4LVOA 4N0QA 2GHQA 1A71A 5K8TA 2GEBA 2W2XA 3NHZA 4I3GA 4BEBA 4YAUA 4GM1A 2GR9A 2GKSA 4K9QA 1LNZA 3TEMA 5KNBH 5CIYA 3U56A 2HV8A 2HF9A 1RXWA 3QX7A 1SKMA 3ENKA 1DBWA 1QIJA 1A9XB 3GFOA 2HGSA 5A6BD 4TV8B 4PLZA 4K86A 1JA9A 1UKYA 2JKYA 4HQLA 3ROTA 3ZIUA 3DBRA 3X0DA 1XZIA 2SICE 1TAQA 4G8DA 4LJ4A 5DNYA 3ZW9A 3BT7A 1FFDA 4TKVA 1W5FA 3R41A 3IIKA 4C3VA 3PT9A 4FT2A 4MUIA 1KJWA 2IPOA 4WCFB 2LO3A 1R9JA 2D2IA 3AM4A 5UKDA 3NDPA 2JIZA 3CZRA 1R27A 4B79A 4DWOA 2AE1A 4CMIB 2CFCA 3FFWA 3OECA 1SVOA 1T25A 2P6OA 3WIDA 1QF9A 1OYYA 1XQVA 1PE0A 1JLLB 2GXAA 2EW2A 1JG4A 2NPOA 5A6JA 3IBYA 1GXSA 3OD5A 5COAA 4WXDA 1YR6A 2I3DA 4RK5A 1Z5WA 1GKYA 3QEMB 4O6VA 1E1MA 5HJ2A 4B4UA 1PV1A 1XZMA 3AR5A 1P81A 1THZA 2OG2A 3EDMA 1YJBA 4AECA 1YL5A 3JQFC 3OD1A 3O2SB 2X0EA 2Y66A 4EZIA 3W4KA 1QFZA 1R4NA 5F7ZA 3ADIA 1QDUA 2ZVDA 4UAJA 1TUBA 1ZN9A 2WJIA 4DADA 3ANTA 4MIYA 2ZBUA 3VHQA 1DADA 4L3OA 1SBNE 4AZTA 3QA3E 3E15A 3UQZA 1PDWA 1R4MB 3G0DA 2Q9BA 5KNCA 4ZQEA 1C4OA 3HG7A 5J2UF 3OCXA 4S1VA 4QGGA 2QN9A 1HL3A 5AW6A 3T94A 1J0BA 3CUSA 2FWAA 2PAAA 3OZUA 3PNLA 2Z8XA 1VLHA 3DWGA 2Q5IA 3NV7A 3RHFA 1EFCA 2EWWA 2NQTA 2XNJA 1E1CA 3H83A 5INTA 5FA6A 2QI9C 3OP4A 4G1CA 2BOVA 4FN4A 1U3TA 4IIDA 3EZ7A 3O26A 4RELA 4PZZA 4LF7B 4EP1A 5CVCA 4Q35B 2JPAA 3VI4B 3UT6A 3DYIA 3NALA 4F9AB 1SQSA 3INGA 3S2YA 1G2QA 3W7AA 4EPRA 1KNQA 1SD5A 2R6ZA 5LL6P 4Q47A 5AKHA 3SQMA 5CBPA 3AR6A 3NDRA 1Z8HA 2GN6A 4WNIA 5ENZA 2V8BA 2QTGA 3AEQB 3Q0TA 5EI5A 1HE4A 1OBOA 3GLQA 3ISTA 1C7IA 1NI5A 1R9MA 1N2ZA 2ZE5A 3F5QA 3KEQA 4NRDA 4LC1A 3EIWA 2G08A 2HJ9A 3N2IA 3WLJA 3ZN2A 1Y5NA 5FI3A 4GVPA 4JLWA 1ZMBA 1ILEA 2DHQA 1WPGA 3T7EA 1F2UB 3I8XA 3UAGA 1E3EA 2R48A 3NUZA 3EQZA 3A1TA 2WP8J 1ZW1A 1ZOSA 4O3FA 1LC3A 5G53C 3CW8X 3GXOA 2UU9B 2WLSA 1V1MB 3OLCX 2WSYB 3WHPA 3NHYA 1Z75A 3LOQA 4OQNA 2PKRA 5I8ZA 2O4CA 3MINB 2YJ5A 4HXEB 4EI7A 2DFKB 3NBKA 3DR5A 2ZRCA 4PLWA 1YB1A 4RZSA 2H06A 5F2NA 5JVDF 1WZIA 5DX1A 5J4VA 1E18A 4IM7A 2G4VA 5H8WA 3WLNA 1TKAA 3T3PB 4EBBA 2AI3A 1UOQA 2WZDA 1GQEA 1SHTX 2CVHA 3LVQE 5K01A 4LOLA 1Y5IA 2WKPA 5E9QA 4B48A 3CNNA 2O48X 4XTRA 3HBJA 5FULA 1P4GA 3HWRA 3EASA 4GKVA 4PAMA 4C2BA 4F71A 2NVBA 3P71T 3KM0A 1D4OA 2D2XA 3PJDA 1W94A 4AZWA 2K7ZA 2CCJA 2PRKA 3EOAI 1PFQA 3I6YA 3DLTA 1TYZA 4HLQB 4NFLA 4YV7A 4DDKA 3G7NA 1M5UA 1SCIA 4YDHB 4F9TA 1D2CA 1KETA 2FEKA 2WJ6A 3L0CA 3Q40A 3AL3A 4JL6A 1IYZA 1E5DA 1U0SY 1AB6A 3C87A 1HQYE 3DBLA 1P4RA 3ZXXA 3A2NA 4GT1A 1OI4A 5E4YA 2M32A 1UFRA 2F4NA 4DV3E 3QXCA 2X8JB 5ELLA 1U7ZA 1GPH1 3KE8A 1P2SA 1JLKA 1XNRE 1X15A 1OOEA 1WA5A 2R3SA 4C6TB 3MLAA 2RB4A 3EUAA 3RIHA 4Z7QB 2LJHA 2DPXA 3CJTA 5K0CA 4F4CA 2P8JA 2X7JA 2WWWA 3VR2A 1N3IA 1LF0A 1CY0A 4Y1EA 3AR4A 1E3DA 3OEEA 1X14A 4DCCA 1N2EA 4MPRA 4DKJA 2ZJ0A 2PV7A 3OZSA 4MHOA 4P36A 3KDSE 5DH9A 4D44A 4ZCPA 5TPZD 4HWSA 1QHXA 3L8MA 4J0KA 2QPOA 4X90A 1BB8A 1I6KA 3PUVA 2DH5A 2H51A 1G8YA 2D7CA 4J16C 5I8WA 4AX4A 2E7ZA 2FPSA 5FI0B 3AM3A 3MTEA 3NGLA 1W48A 2GTPA 3BERA 3CX7A 2G04A 3BWDD 2CZGA 5AVJA 5B37A 1THGA 1U28A 2IHKA 2PUEA 3FR7A 1X7XA 3ZFPA 1XEAA 5CHYA 3UHPA 1L5ZA 2QNBA 1IN7A 2ST1A 5TMBA 3RWOA 1DIAA 3AI1A 1LEHA 1RXVA 3D6FA 3SYRA 4FHFA 3GLGB 3OM0A 3LYAA 4IUDS 3GJ3A 5CYPA 2H65A 4RY8A 3H7IA 1OZ0A 1WUHS 3CG0A 3I83A 4R1TA 5BVHA 1TYDE 4HNUA 2JD1A 1MAVA 3PFGA 4RSMA 3F0TA 4X6UA 1RKBA 2IQ5A 4GMKA 2QAIA 3MJEA 4PQFA 2F3PA 1ODFA 4OJMX 4WEQA 1GQRA 5ESDA 1GQQA 3JQAA 2ECPA 3WBKA 1JW9B 1JXOA 1I3OA 1ZM7A 3FPBA 4P5DA 5IDVA 3BMQB 2XXAB 3OFKA 3L40A 1P4JA 2RGGA 4N6NA 1INLA 3TFQA 1LLCA 1M1YA 1KSJA 1MJGA 2CB0A 2O7NA 2M4IA 5A6SA 4Q05A 4R8RA 4TLDA 1G8FA 2P67A 3O2NA 5JALA 1DCMA 3BJRA 4FIDA 4C4PA 1XRMA 3NEYA 1OAOC 1A1FA 2F00A 5K0SA 1YE3A 3CEHA 3EQ7A 3OIFA 2JGNA 4NZOA 4BGDA 5D84A 2FUG1 2FUKA 4NCKA 2I2CA 1Q0QA 1P5RA 3CG4A 4R2HA 2WDPA 2XNSA 4NIMA 4N5NA 4GOKA 1B3BA 1E6KA 1JXQA 3E3MA 5HE9A 3ROXA 1VG8A 3SJUA 3K6SA 4AKSA 1M1UA 3QPDA 2MC5A 1XCMA 4B74A 1SUIA 2G9UA 4IVQA 2H11A 2W2NA 3NHFA 4CLOB 2W90A 4ECEA 4P22A 3HCNA 1CF9A 4TSFD 2IS2A 4QLOA 1A8PA 3GZTB 1Z39A 4IIJB 2PM8A 5SZHB 1CUSA 1KJQA 4KYVA 3TZKA 4EHJA 3QFRA 4DQ0A 4UC0A 4UNNA 3SC3A 3LBNA 2TS1A 1MEOA 2I4MA 3PXUA 3IPCA 3UEOA 4BMYA 4ZYLA 4Y2XA 1MV8A 3ZBTA 2CJXA 1C7JA 3CEAA 3U16A 2Q2WA 4RA6A 3N53A 1MEYC 5CH8A 5DCLA 3UJ9A 1KOJA 1P91A 2R76A 2G40A 5KTPA 3HEMA 2IYSA 3HFSA 1XMOB 1R4AA 2KYRA 2P0AA 3MT0A 3MQFA 4NZZA 2Y1FA 3N87A 2B20A 1XTJA 2I4OA 4R5HA 4PZYA 1UPTA 2Y1DA 4QUEA 1RJGA 3AERB 1CY1A 2E4VA 4BS9A 3RMPA 3PE3A 4ZOAA 2Q9CA 4E5KA 2H9AA 2JVIA 4HNAA 4LBVA 3VR6H 4JA0A 1BWSA 2PJDA 3ZIAA 4DGSA 2OCKA 4GP7A 1SHUX 5AXCA 4H9KA 1JALA 2K2QB 3PK0A 3N9IA 4YRRA 4ETIA 4X71A 1E1LA 2ZU6A 1J70A 4OH7A 3TBHA 3CRVA 1R15A 2O8BA 4ROSA 4ENVA 2O06A 3K8QA 2R8PA 4JEMA 5G1PA 4O4IA 4D74A 2BI4A 2EJCA 5E1BA 4QPNA 1CJSA 2BBGA 1WHTB 3HFGA 3TRHA 2IF2A 1BWPA 2B99A 1S5PA 1ML4A 3LVBA 3CZAA 1ZUIA 3N2LA 2X13A 2AVDA 2A0UA 3DEFA 1WXHA 1DARA 3PUIA 2I3AA 2GNOA 3HI6A 4PO9A 2XZLA 3Q7SA 4ZN6A 4TXMA 1GZ5A 5F1OA 1Z17A 2J48A 4ZD6A 5TJ9A 1KK2A 4TVBA 1EFVA 4KLRA 1WV0A 2EFGA 1Y7HA 1X77A 4Q9IA 2BFBB 1E2EA 2OXCA 2Y0CA 3DTNA 3RIYA 3ZZMA 3PGKA 4DUPA 4NU8X 1K8YB 2Y1GA 1B2LA 2CNNA 1LS1A 1OH7A 3BULA 4EKIA 1MO4A 5CPFA 3SKVA 4JCOA 4XWKA 4AY2A 4CXMA 2CFRA 2C31A 2QW0X 3HSKA 2PVCA 4NENA 3ABOB 3EMKA 1EAMA 1N77A 2PX6A 2REOA 5DNDA 3TLAA 1TW2A 2GEFA 5AXBA 2PSFA 1JHZA 4DA8A 1DKPA 1AUQA 2B4QA 2HSZA 1GITA 4J1NA 1UZMA 2OZVA 2R8XA 4QWMA 5CB6A 3VFDA 1NKTA 3G2IA 1V96A 4EBFA 2EMWA 3TIFA 3LP6A 2PQ6A 1QE0A 4ZCRA 1Z8NA 1CULC 1DOAA 1MXHA 4GE3A 2ZRKA 4K3VA 2I6TA 3LK6A 4WFQA 4L8VA 3OMLA 5JNWA 4W5JA 4N9QA 1YVPA 5AOBA 2H1OA 1UKAA 2WJAA 2WYUA 1I7DA 1R18A 3EJ6A 3FKJA 3H0EA 4UVHA 4EG0A 1HNZB 4HEA1 1KERA 1XJWA 2AI2A 5C1IA 5JT1A 4RJ2A 2YRKA 2O3UA 3IQIX 2FXIA 5EYPB 1UKVY 2HH9A 4CETA 2BN4A 2P4HX 2WAMA 1ZGBA 4PU0A 4R16A 4RKYA 1E1RD 3B1JA 4B3JA 2G5CA 5AJHA 4DCNA 1JIJA 8GPBA 5F51A 2P1RA 5CLHA 1PK8A 1BWRA 3U7JA 1V2GA 5F73A 3A11A 3AJDA 2FQWA 4G01B 2CUNA 2WHXA 3BXOA 4QLAA 4DA9A 2AFHB 1ZDMA 2QL6A 4KQIA 1ZJJA 3Q72A 4WKCA 2VYVD 1BFKA 4ZGGA 3G8CA 3U4AA 2XYPA 1YUBA 3F5FA 1UMDA 1LQ2A 3OG9A 3VVBA 3OT1B 1G8KA 1N6NA 2CJPA 3VOAA 1P9LA 4QTTB 3MOIA 2PA0A 4WK0B 1BOOA 4CEHA 5AJWA 5ALRA 3WSWA 3W8NA 4IAOA 3OJEA 1GFWA 4E51A 3ISVA 1PFKA 4OQEA 3R6TA 2GM9A 2G9ZA 4N03A 4DR2B 2IVFA 1CUAA 3FR8A 4BBAA 4QOFA 4DQVA 2Y71A 3REQA 5KS2A 5LWQA 5HSGA 3EQ8A 1KI1A 3RYFB 2P2GA 4EYKA 1QIKA 3EZLA 3D4BA 2B83A 4C22A 1HGXA 2RH4A 3L06A 2GPBA 4Y9UA 1BFDA 4MS3A 3BF8A 2DZDA 1NFQA 3JASB 2ZYRA 1W5BA 1GQOA 2PXAA 2PUVA 2ZYVX 4XM2A 2FQQA 4WXHA 4X61A 4KQHA 4YP1A 4EEKA 2ONZA 3CUVA 2PWPA 1I9GA 3FVRA 1WF3A 1TVMA 4OHPA 4RCZA 2EN4A 3IQXA 2BFFB 3EVGA 4RJTA 5I7SA 1ABEA 3VXKA 1RQ7A 5KL3A 4XJSA 3VAYA 8LDHA 2IYZA 3PUYA 1Y5LA 2NO1A 2W93A 3VDQA 2VT2A 4U2DA 3OOEA 4UMFA 2DCMA 1XP8A 5DW3A 2HJGA 3C41J 3O31A 4RQUA 1DXOA 1IHPA 2Z3ZA 5DHPA 4A6DA 4YY3B 4KVFA 2A9QA 2TMKA 4KLAA 2N75A 4YIHA 1XPUA 1G5RA 2OZLB 4Q3DA 1P60A 1BCRB 4RQTA 5LJIA 1RTKA 4JI8B 5JYDA 2R1ZA 1OYOA 4UVEA 1ZJZA 1VLZA 4AKEA 5FUBA 2OPHA 3WL8A 5LA6A 3KCNA 4UNPA 3U13A 3GJ6A 5BRNA 3SD7A 2V6FA 2AFHE 4OD0A 2V6BA 1F1BA 1ESNA 1QZTA 3R3VA 2XKJE 1BMDA 4Z99A 2NUTA 1PR6A 3R7DA 2YTQA 1P1CA 2QDKA 4IDPA 2WHEA 2AZXA 1BCSB 4AQDA 1NAHA 5C8DA 3KAPA 4RL6A 1VC2A 1AZLA 3MBIA 1SB8A 4ADSG 4JI7B 2A9OA 5TQ0B 2JP9A 1RKQA 3UW3A 2R97A 4C4SA 1PUJA 2ZUVA 3D0KA 2O7QA 3AP2A 5TGZA 2UXDB 3CCCA 1F6DA 1ECLA 1U7XA 1O95C 1ZMRA 1A9PA 2PQ0A 2QP9X 3OPMA 3U3XA 3UG7A 3ZEIA 5K6TA 5HF5A 2J9FA 1N0IA 2EOMA 1SJ9A 2PL9A 3PC4A 2LXNA 3ZE9A 3GEMA 3TFOA 2C59A 3E2PA 1L5RA 1YDEA 5GIOE 3LKDA 5KOJB 1W0KD 1WQ1R 2JI9A 2XI4A 3G0IA 1KDVA 1I6WA 2XBMA 2NVOA 2XWPA 4QDXA 1GV1A 3A6EA 4J0JA 1HTTA 2OXRA 3IVCA 1JHAA 1S7GA 4Q1BA 1Q77A 4KXFB 1Z2PX 5TC4A 4N5DA 4UEWA 4HRAA 2FZVA 3ANXA 4M7PA 1M8FA 1VSUA 3MHSC 1PWZA 4NOKA 4OM8A 1TECE 3WBBA 4AJOA 4P7BA 2HU8A 4C7XA 5LBTA 4QX6A 3NPMA 2GBPA 4KPYA 2I91A 1GUDA 1KK3A 3WY9A 3CNQS 4IEIA 5BV1A 5BWOA 2F1KA 1J8DA 4LNUB 3WJ7A 3C4BA 1OWOA 3GLFE 3T61A 3RUDA 4MX8A 2JY9A 3DAGA 1M1XB 3E7FA 5L3QA 5A3VA 2AK2A 1SC6A 4N12A 4OB6A 5C34B 5MF6A 2R68A 2X8AA 1Q74A 4L8YA 4LJ5A 4ZT6A 3T3GA 3THWA 2GKGA 2ZUSA 1MHTA 3Q3GE 1UMCA 4DTIA 1X80B 1K1EA 4YCCA 1VIDA 1DBIA 2B7LA 2ZIAA 3KSRA 3NGXA 5CUQA 3WYEA 3K71B 4KB5A 1YVUA 1WSWA 3F47A 4F91B 2IV2X 3STTA 4ZOQI 3K9WA 1ZRNA 4IOLA 4N0EA 5B7NA 3N2KB 1JJBA 2ZRFA 5HRAA 1TF3A 5AVKA 1SB9A 1KY3A 4LA4A 4N3BA 3DFMA 5ARCA 4EHBA 4AY5A 3M33A 4W5QA 4YJFA 1ODSA 5CFMA 2ZR9A 3NTOA 1DAFA 4J8PA 4LRWA 3JD2A 2Z09A 1RJFA 3RSZA 4X9JA 4JYPA 1WUJS 2XYVA 3PD0A 4L5BA 1G3MA 1QPBA 4JY7A 3RUEA 1R0CA 4BGEA 3RK4A 5KJ1A 4J07A 1J06A 1IEXA 4CMEC 1FK8A 1RE0A 3UV7A 3FPSA 5KAPA 2FSVC 4JITA 2YUIA 4MVXA 3D7SA 4KXLA 3TTUA 1GPLA 3UMJA 2Q2QA 3CLTD 5EFZA 3SDZA 1NZFA 3NCHA 3QV1A 1QYIA 5GJBA 4ZA2A 3FCCA 1GZ3A 1WMBA 2R7NA 3D8TA 3L7CA 4UZEA 5J47A 2ZRDA 2HUPA 4NBKA 1L9KA 5DHFA 2AHRA 4JBYA 2YRWA 4PGGA 4U3JB 3P4YA 3QP9A 4G0OA 4TMYA 3DMGA 2G6TA 3I4FA 3SR4A 4FS8A 2WK1A 1S2IA 3FB4A 3PHHA 3C5CA 1TM7E 5F5NA 1DO8A 1SVWA 2YCLA 5ITZB 3B2QA 3DHWC 1IN1A 4MQ5A 3ZQUA 2DR0A 4J2TA 4W9RA 4B87A 4IUCS 4OFZA 4Q4AB 1PFUA 3SFTA 2RJNA 1PWXA 4E07A 1VPWA 1PNVA 3P2KA 3HDQA 1B14A 1K9SA 4C0QC 3PI6A 1RQPA 2PV0A 2B3TA 2N9UA 1NUUA 1EH6A 3NHPA 3E5RA 3GN1A 4NCJA 3VC2A 1CSEE 2PVPA 2XIQA 4BP8A 1XWIA 4QTXA 3UO8B 2JASA 1TEZA 1LD3A 4QOJA 2QD5A 1VHLA 1JAXA 2BEVB 3GDHA 5C8YA 4WXCA 4J0IA 1V25A 4P2BA 4XDHA 1Y9DA 3GNSA 4U5XA 1G6Q1 3D8RA 4AB1A 4QUBA 2OECA 3DEAA 1Y4UA 4LCBA 1D03A 1GQYA 1X80A 2ZSIA 3R7BA 4TQGA 1ZD4A 3A1FA 3PXDA 2ROQA 1XAHA 1SUAA 3OAAA 3TQCA 2EYQA 5AVRA 1WW2A 4GYJA 5LIPA 4NU0A 2LIPA 1FA9A 2HNKA 2EMXA 4ZYGA 1IHUA 3PSAA 1DTSA 1EDDA 3HWX1 2IY7A 3MCZA 4IRUB 3K0EA 4BBYA 4COKA 5JRJA 2GJKA 5DLPA 1DPGA 4H6WA 4NICA 1N2SA 4FEGA 3LT0A 3WR5A 1YBFA 5JPCA 4B3RE 2HADA 1C9DB 2VDWA 5DEOA 1Z6QA 3V97A 3KQQA 1DE0A 4PX2A 5AOVA 3AFIA 4CIAA 3ZZ1A 1SK8A 5CFZA 1EE2A 3TSYA 4BUJA 4WFTA 4WIAA 4ZT2A 1YZVA 5CVUA 1NRIA 4QFCA 3DD1A 4NNPA 4Q28A 2Q7OE 3SS7X 3ZX5A 1U5AA 1RYFA 3MS2A 4BO0A 3CVXA 4C3OB 2WVJA 2XT0A 2BZ0A 1T36A 3BXZA 5THXA 3G5UA 3N76A 1IY1A 2AXQA 3KEOA 4KGXA 3MFQA 4ZMSA 1T9GS 1PJBA 2C3UA 3UVEA 5F77A 5A4MS 1HR0E 2BEUA 1ZGZA 1LBQA 3K0CA 2BEWA 5CD1A 2CC2A 3B20A 1EHYA 1WM1A 2DKNA 2VJPA 1BSVA 2E21A 3HADA 3EEQA 5JAUA 2VRCD 1Q44A 3FWNA 1O0BA 3PHJA 2GSDA 2PRJA 4LKRA 3TQMA 2YZKA 3A1WA 3GLKA 3GNQA 4N4AA 5AKIA 5HKLA 3RS4A 5EWMA 5HQ3A 3QVSA 1BA3A 2L33A 3DEJA 3JU3A 5CJ2A 3ZWDA 1LVUA 1FFHA 2NP6A 2PUJA 2X19A 4AFNA 1HDIA 5TS2A 4HNVA 5CTAA 4RNDB 4XTCS 4HYTA 5DU2A 5KL6A 4RTNA 3KQVA 1I7LA 3ET5A 3OCUA 5DWDA 2B1GA 3TNLA 5CCEA 3ZLVA 4RD6A 2Q99A 2ID4A 2WM3A 3KKNA 4YK7A 5BYKA 3BKWA 4E1AA 3ZCTA 2XE4A 4R71A 2OBBA 3C4QA 4HX9A 4Y0AA 3AFHA 3W5IA 1IDOA 2B21A 3OQ1A 3ANYB 4HGQA 2FWRA 2L18A 5AP9A 1GTZA 4IGIA 4ZC8A 2C0PA 3AETB 1AD2A 4RHFA 1MPXA 3RC8A 3L4BC 1Z5UA 4CHTA 4NP6A 4U7FA 3RVOA 4OGLA 5T6MA 3TLEA 3H2BA 1KY4A 1GCIA 3DW1X 1YJQA 2XCIA 3ETNA 3BQMB 3D43A 1ZCJA 2C20A 2H1LA 4LMAA 3L7KA 4DUYE 1XTRA 4G8BA 4YRQA 3VJRA 1T91A 3ELBA 3PDJA 1KY2A 1Z2DA 3DULA 4EB8A 2DEUA 4RVUA 1IMOA 3O4JA 2ZSKA 1GL3A 1XAJA 1XVUA 3K6RA 4J1QA 5AHXA 1TYEB 4DLVA 1F0YA 4B3TE 1U6IA 3H11A 3RRZA 2K7IA 3ZHTA 1AUVA 3C16C 1W5EA 2QENA 2WJGA 3C3XA 1HLDA 3HI4A 1SBIA 2GBGA 1HQDA 4G1MB 4R98A 3CB4A 4BBZA 2EG5A 4DPLA 5BW5A 4MYUA 2BJWA 2RGEA 4L15A 3EXG2 1HDRA 1KMNA 3UGTA 1NN1A 3RUAA 4KLZA 5FBRB 2V0GA 3ILSA 1WBJB 1XDSA 1W34A 3GJTA 3OQIB 3QUTA 1NA5A 3WOHA 5HJEA 3ZD6A 3A2MA 5JPIA 2R6GA 1IZZA 2D2VA 3A7DA 3I37X 1O5IA 4G4SP 4YI5A 1X39A 2GLTA 3IP8A 1KI6A 1KQNA 2ENHA 1BCSA 2GPNA 3R09A 1MDBA 3DVQX 4QARA 3SNKA 3V2HA 5ED4A 1DEKA 2FRDC 4MS1A 2HIMA 1KI7A 3IUSA 2RONA 4YVFA 1KDOA 3SX4A 1EVQA 1SBTA 1ZJ5A 4JSRA 3J7AC 2GETA 1XTVA 1T8SA 5KTNA 4BC9A 1Q0TA 3CSUA 1K6JA 1OR8A 2R8ZA 2V7GA 3RODA 5KPDA 2J3KA 2NNLD 4DAEA 3PIIA 2HBZA 1CE8B 2W7TA 1Z9BA 1WPQA 1L7EA 3DFFA 3NNDA 3QKSA 4HFJA 1CZLA 4P6VF 3PRYA 2JLUA 1JIXA 4LYAA 5HM8A 4Q18A 3T0FA 5C3UA 4YPFA 5A05A 5JS6A 5EKXA 4LF7E 1IHOA 2P9JA 4IVRA 4J94A 4FFRA 3QE9Y 4BAUA 5CA0F 1FNSA 1ODJA 5G3YA 2BFCB 2QVZX 4I2VA 5DIFA 2RG1A 2ZUWA 3HLYA 3L8YA 1KAOA 3ZWOA 4H59A 4QNMA 3NWEA 5EEHA 2G9VA 1Q50A 2H16A 3GJQA 4I66A 4W1QA 1X48A 2J9GA 2QE7A 4HVTA 4DCOA 4B46A 4ZYEA 1P1JA 3DTTA 2FPWA 4U9HS 4U8GA 4WN3A 2YHIB 2OC4A 5C37A 1XV5A 1HDOA 3KEFA 3MAAC 1X8KA 2XTAA 3HWSA 4HGRA 4WAUA 4H6XA 5LWHA 3NT5A 4V0LA 2ES4A 5CLJA 1T5TA 1WAMA 3AR2A 4C6HA 3EEIA 1T0BA 1XZ8A 4CM8A 3C98A 1F2UA 4JP2A 4ZQBA 2J0EA 4BC1A 3MRTA 3HGTA 5K3CA 4LGCA 3EXIB 1OZFA 3MOGA 1A7KA 3RIGA 5B2ZA 5JWOA 1L9XA 4HB4A 4QXOA 4N82A 4MIOA 2N46A 4PWYA 4H16A 4KSYA 3WGGA 4AMGA 1LK5A 2HDNB 1JIVA 3A36A 4FDVA 3LUJA 2APJA 2PSHA 4FYXA 4KDFA 3L7YA 2EATA 4IHJB 5ILQA 1X1AA 3UK0A 4FFBB 1NJGA 4IQ4A 4UTNA 2AG5A 5IT9C 4O2RA 3VR6D 3IHKA 4L22A 5ALGA 4BLVA 3ELYA 3TRIA 1E5VA 2X9QA 4NBLA 4KBFA 2D06A 4H0FA 2JAOA 1KPHA 2AMFA 5ERYA 3EVBA 4HNSA 3HUTA 3O38A 1KVSA 4AJ4A 2PWZA 3ICVA 2ODNA 2RH9B 3ZWNA 1J0EA 2OAQ1 1RFGE 4N7JA 4XFDA 3TS1A 3RFUA 3JYNA 1B1CA 4B17A 1ZVQA 3DUWA 4KDEA 2P2LA 1Z0FA 2L2NA 1TT5A 2PH7A 4ZVKA 3ZCXA 3N7UA 1FJGB 3NJ4A 2FLWA 1IN5A 5KYXA 4DV5E 3O8OB 4AF7A 4HFRA 3HDYA 3WX0A 3NAGA 3A58B 1Y3DE 2ZI3A 1RRVA 3P5SA 3PCXA 1Z6AA 1F1JA 4HL6A 4A3SA 1E6CA 2C5SA 3L6BA 5EKTA 1LY1A 4UBMA 1EJ6A 3GGSA 5E6UA 1GTKA 3B5EA 3HN7A 4QUAA 4B3CA 1UIRA 1AK9A 1E4VA 1F9EA 3MMXA 3IKMB 4RHBB 3MWLA 4TZTA 2NSJA 3FLMA 1SCUB 2A14A 3QG1A 3PWKA 1L7BA 2PZGA 3HUNA 3EGVA 1F0KA 1C3VA 1CVLA 1PV2A 1NNEA 1X9IA 3WB9A 5EHIA 2ZJ8A 1HM5A 1KP2A 4I5GA 3ZLBA 5B3KA 5HQTA 5JNTA 5JAZA 2JGJA 3H6KA 5C35A 1PFWA 3FKSD 5IKXA 1EGAA 5AUPB 1JEYA 2YX1A 3KD2A 4RTJA 4CTJA 4O4LB 2Q4DA 3SGLA 1KEEB 2XUQA 4RPLA 3RM3A 4YRMA 1L8OA 4EQ6A 3AHHA 1OF1A 2XMSA 3PE4A 4HDNA 2IIPA 4JI8E 1NLUA 2YVUA 1G5PA 5J23A 3KXKA 1IBRA 4F6MA 1WNTA 4G1VA 5CYFA 1FOEB 3LDFA 1RXSA 3P97A 2ZREA 5H9VA 4BHCA 5TEWA 3TQTA 2I7CA 1G5HA 2KQUA 2WUWE 4UHFA 2IHJA 2IUEA 4J7CA 3I12A 3PQFA 2XX3A 3CVUA 1KRXA 3S55A 1ZESA 4P34A 4B7UA 1LBHA 2AC4A 2OBMA 1ZICA 1Y8QA 2VP5A 5TT1A 4RENA 2AZMA 3R0XA 2DXIA 1KO8A 4DSAA 4MI6A 5FR2A 3VU3A 1RZRD 3T15A 1KEWA 4TS3A 4HDMA 4UREA 3CISA 2EP8A 2KS6A 5F3DA 4R2MA 1PZNA 1AQUA 2BD0A 3TDKA 5FLXA 4CT4B 2A7QA 4YQYA 3UCFA 4IQFA 2NSDA 1YRAA 3AV0A 4LQCA 4DV0E 5DXAA 5HOEA 2DX7A 2OCYC 4OBXA 1SOAA 4RF4A 3W9BA 1Z63A 5EIXA 3KVRA 4XYGA 1IHYA 2J45A 1GAWA 2GTHA 2QBYA 3UWPA 1D2AA 4DV7E 3CXRA 3DBVO 2J5BA 4N65A 2J5XA 4E7OA 3BJMA 2MKNA 2BKAA 3ESQA 3LNTA 3ETGA 1UBOS 1L7AA 4LC0A 4TN1A 5GV7A 5IF3A 4ZCTA 1J99A 4BBJA 4KXYA 4FSXA 3BREA 4R6WA 3DPUA 2QR3A 2RGDA 2AOTA 1T1IA 3EGCA 1BA2A 1IM2A 1G4UR 1UK8A 2FOXA 3Q98A 2OAP1 5IAOA 2CLMB 1SCKA 3V8VA 5G02A 5TXGA 2EN8A 3DWFA 2X9GA 2RKWA 3M2TA 4QM7A 3TNFA 2DTDA 3T9BA 4MEBA 4AMUA 2I6UA 1XNHA 5FA8A 4RABA 4MA0A 1NBEA 1JH9A 4GOMD 4HDKB 4TPKA 4L08A 1LC0A 2FSVA 4QLBA 5K0NA 3NRBA 3SZUA 2F1RA 3HUFA 4DR6E 3ED1A 2NMVA 1Z16A 4WA7A 1CKEA 3ADDA 1Z8DA 4B2PA 4BV2A 2F7SA 1O95D 4AO7A 4H1WA 1QMGA 4QZVA 1CLEA 1U9CA 1WXDA 1NZJA 5TY0A 3SQDA 1E1YA 4GEQB 1JJ7A 3H87A 4DJEC 1P75A 2WUEA 2LE2A 2V45A 5BORA 4OEHA 4QTYA 5B3LA 1ZSNA 1BYIA 2C4TA 4OLAA 4M0DA 2W4QA 3Q15C 2R25B 1BZYA 1UMBB 3QGMA 3SHQA 4OHXA 4GMDA 2HCRA 4JXKA 1QP8A 4IO1A 2B2CA 1O94A 3G8DA 2AOXA 4DCTA 5L4SA 1DT5A 3I2HA 3CPHA 5I9IA 2ZR8A 3ZD8A 1GO2A 1T3SA 2FCAA 5ADVA 1W46A 4F9BB 2B2XA 2AD1A 2BC9A 2RE8A 2AW5A 2RHLA 3CT4A 3FJYA 5DX8A 1LRLA 3NAMA 2KHXA 4FYWA 4I3FA 4JI5B 3WLRA 3WLHA 1N5MA 5I9NA 5CMLA 5A2QA 5IVIA 7MHTA 1BGVA 3DMPA 5JV5A 3AQ4A 4NH4A 4FK5C 3CUWA 1L3IA 3GA7A 2Q0SA 5JTTA 1KDYA 3OOYA 3BM5A 3LQ2A 3BK7A 5K0EA 3QF4B 3MJHA 2WU8A 2RGAA 3H16A 3FNHA 1QJCA 2HN9A 3KPJA 5T6BA 2ETXA 1EE1A 2QAGC 2YIVX 1OFIA 3ZE2B 1BXGA 5LLDA 1ZOPA 3MWEA 4PHTA 1JDTA 1WDLA 1JIUA 2HSJA 1GTL1 2PLWA 3PSHA 4Q00A 4WSOA 1PDOA 2ZUCA 4DG9A 5AIBA 2H2WA 1IATA 4GQBA 1ADFA 3W5CA 1CB0A