3C6MA

Crystal structure of human spermine synthase in complex with spermine and 5-methylthioadenosine
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
361
structure length
336
Chain Sequence
SRHSTLDFMLGDGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYDSILNKVEERMKELSVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Spermine synthase
publication title Crystal structure of human spermine synthase: implications of substrate binding and catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 336
sequence length 361
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.22: Spermine synthase.
pdb deposition date 2008-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
A PF17950 SpmSyn_N S-adenosylmethionine decarboxylase N -terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 3c6mA02
3.30.160.110 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Siroheme synthase; domain 2 3c6mA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3c6mA03
4JXJA 4CTKA 1VBFA 4RTNA 4FP9A 2PX2A 1AQJA 3G2QA 2UYQA 3NDIA 5K0CA 3T7RA 3G2PA 5C1IA 4UOEA 4Y2HA 1KPGA 5HIKA 3TM4A 4Y30A 2C7OA 3KQYA 4FSXA 1AV6A 5EEGA 4MIKA 1NBIA 3ERCA 4PIPA 2LD4A 2P8JA 3EGEA 3GCZA 4PYLA 5EKUA 4PCAA 4YUYA 2NXJA 2NYUA 1I1NA 5ICFA 4U7TB 5CUQA 3TFWA 1SUSA 3C6KA 4P7FA 1R74A 5KS2A 4GQBA 4HC4A 3A26A 1SKMA 4M37A 3MTEA 1JTEA 4B17A 3I5UA 2BM8A 2EJUA 1H1DA 2ZWVA 3SR4A 3TR6A 3UJBA 4RTQA 5BXYA 4HH4A 2OB2A 4PYOA 3HP7A 3PS9A 2PT6A 4PYKA 5DM1A 4OQEA 1WS6A 1RI3A 5EMLA 4E2ZA 1ZGJA 4FS8A 5K0NA 4DZRA 3KU1A 3KQSA 5T6BA 4XUCA 3HEMA 5CIYA 1KPIA 3R6TA 3THRA 5FQOA 5EKXA 4C07A 4KWCA 4PINA 4RV9A 5EIFA 2YR0A 2YVLA 4ER6A 4HSGA 4QQNA 5F2NA 3TQSA 1XXLA 5EHGA 4U7PB 3KKZA 5HFJA 4ISCA 3VC1A 2OBFA 2YXDA 3HCCA 5CM2Z 4EVIA 5CCXA 3EGIA 2QY6A 5JUWA 2PVCA 2YX1A 4LECA 1ZG3A 4O29A 5U4XA 3H2BA 3UJCA 2IFTA 2OB1A 4KDCA 1X19A 3TM5A 3M6XA 2CMGA 1IM8A 3UJ9A 1PRYA 1XJ5A 4RTRA 1O54A 4Z2YA 2AOTA 4RTLA 3UJAA 10MHA 2P3OA 4PYNA 3RIEA 3DUWA 5G02A 2JHAA 3EGVA 3MB5A 3NW9A 2VP3A 3WSTA 4P7JA 3EEOA 3O4FA 2NXNA 5DX0A 3O31A 2R6ZA 2B78A 2G70A 2VDWA 1EIZA 2PV0A 2PX5A 4C08A 5GWXA 3UBTA 1HMYA 1RI2A 2PGXA 3EVZA 3P2EA 2P3QA 4ER0A 1X1DA 2PBFA 4X60A 3HCAA 5E1OA 2IGTA 5FHQA 3B5IA 4RTJA 1WG8A 5GIOE 3BXOA 2R3SA 2ZW9A 2F8LA 1P1CA 2XYRA 2IH4A 2OKCA 2PXXA 1SUIA 2GS9A 3OU6A 3M4XA 2DULA 3REOA 4V0QA 5CD1A 1JSZA 5HOQA 4OA8A 5LQJA 3GXOA 4V0RA 3EVDA 1Q0SA 3KR0A 2VDUE 1NW7A 1ZQ9A 4MTLA 3BWMA 5EG5A 4YV1A 5FTWA 4BY9E 4PIMA 5HIIA 5MHTA 4BP3A 1R00A 4R05A 2C7PA 1JG1A 2FPOA 3FRHA 5FWAA 4R6XA 1IXKA 5FA8A 4DF3A 4CWAA 1RI1A 3AWIA 3UZUA 1IY9A 2XYVA 5FHRA 4RWZA 2N47A 3FTDA 3GU3A 5D1NA 3BGVA 3QV2A 4HRAA 4HTFA 5IKMA 4CXMA 5DTQA 2ZSUA 5EMJA 4YUZA 1KHHA 3FTFA 3JWHA 2PWYA 5EMKA 4E2WA 1AF7A 5DSTA 3V97A 3T7SA 4KIGA 2JG3A 4C04A 3TPZA 3C0KA 3CJTA 2DPMA 4GUAA 4QVGA 4RVGA 5B1SA 1KXZA 5LQCA 5EZSA 2GA9A 2FRXA 4E70A 5HZMA 2NP7A 2BR5A 3NVMB 4AUKA 2CMHA 1TW2A 1R6AA 2AOTB 2P7HA 3A7DA 3OZTA 3MERA 4P58A 5T64A 1XDUA 2C7RA 2OO3A 4QQKA 1QZZA 1JQDA 3I9FA 1VIDA 5ERGB 1EJ6A 2FHPA 3RODA 3X0DA 2ZULA 4EKGA 2WK1A 2P35A 3BWBA 1XVAA 1UIRA 3P2IA 4MQ4A 5GOZA 1T43A 3HCFA 5EC8A 3GWZA 5LQNA 2ZCJA 3GDHA 4RTSA 1YFJA 1VQ1A 3ER8A 1RI5A 1L1EA 3FRIA 3VSEA 9MHTA 2KW5A 1BC5A 3NJRA 4GF5A 4XUEA 4E32A 3AXSA 1DL5A 3DMFA 5LQRA 2P3LA 5EIWA 2AVNA 4OX9Y 1SG9A 3GRYA 2ZWAA 3LL7A 5E1BA 1NV8A 4K6MA 5FUBA 5ICEA 3P71T 2FK7A 3HVJA 4DMGA 3CJRA 3PX2A 2O07A 3GRUA 4E2YA 1G8AA 3CCFA 5KQSA 1M6EX 2UYHA 3HVIA 4GC5A 3ELDA 3OE5A 3AJDA 3ELYA 3I58A 2QM3A 3UA3A 2EJTA 1L3CA 5DM4A 3FPFA 1PJSA 3DMHA 4QDKA 2OZVA 4AZSA 2NP6A 3EVFA 3ER9A 2B2CA 3OFKA 1JG2A 2A14A 2QE6A 3DR5A 3LDFA 2AR0A 1EAMA 2JH8A 4X1OA 3FUWA 5D1HA 5K0JA 1DUSA 1JR4A 2HTEA 3DH0A 3P9NA 5DPMA 5KYGA 3SVZA 2BZGA 4HTFB 3PFGA 4BLWA 3P2KA 2ZZMA 2IP2A 3KR2A 4ATNA 4CKCA 5FULA 5KVAA 2G1PA 3DMGA 2ZIFA 2GAFA 3I53A 4KIFA 1RJEA 5E1DA 1NE2A 1R18A 2P7IA 3NVKI 4IWNA 3GRRA 2PX4A 3KPJA 4XUDA 3G2OA 2JHPA 1PJZA 1RJFA 3E23A 2H11A 3HM2A 1INLA 2NXEA 3LX6A 5FA5A 3CJQA 3V8VA 1Z3CA 3ELWA 3THSA 3T0IA 1FP2A 2GLUA 7MHTA 2AVDA 4ER7A 4EKIA 3BGIA 1VL5A 3JWJA 4PCLA 5DM0A 2PSSA 3SGLA 3PTAA 3HTXA 4C05A 1YF3A 3M6UA 3DLCA 4PNEA 4RYLA 5DTRA 4E2XA 2GB4A 3NDJA 3M6WA 2IH2A 3GRVA 3EVAA 4GEKA 3C6MA 4POOA 2P1DA 2YQZA 1KYQA 3LECA 3BT7A 3EVCA 4P7GA 2ZIGA 3UA4A 3A4TA 3P9IA 2BR3A 3ID6C 4EMSA 5EZQA 2YTZA 4RVDA 4M36A 3BKXA 2AOXA 2I7CA 2ZIEA 3SXJA 4AZWA 3NTVA 3ORHA 5E2AA 3LBYA 5C0OE 2AOVA 3EMDA 2B3TA 4QDJA 4RX1A 1L9KA 1N7JA 1NW6A 3KQMA 4PONA 4RTPA 1N7IA 3EMBA 3R0QA 3ME5A 4GBED 3F4KA 3MCZA 4YV0A 5LQUA 2AS0A 4OBWA 2PLWA 3C3PA 4DCMA 8MHTA 4HG2A 2ONZA 3P9KA 4ER3A 3FTCA 2BR4A 2ZVJA 2Z6AA 1P1BA 2EFJA 4YUVA 1KIAA 5CVJA 4AZVA 1KYWA 1HNNA 5DXAA 4LWPA 4QPNA 4FT4A 5BW5A 3PFHA 3FPGA 4C06A 1ZKDA 2AN3A 3QOWA 4CTJA 3LSTA 5FADA 1X1AA 1MJFA 5EPEA 2I9KA 3PT9A 3LDGA 3B7PA 3OPNA 2XBMA 2AOUA 3OCJA 4IV8A 3UJDA 3HA5A 1G6Q1 3LPMA 1JQ3A 4MHTA 3LHDA 5K0FA 4PYJA 1WZNA 2V74B 2GH1A 5DXJA 2Q41A 2IBTA 3MQ2A 4IKPA 2NNWB 2PXAA 3GNLA 3LCCA 5E9QA 2OPBA 2XVAA 4H0NA 5ICGA 2ZZNA 2EX4A 1FP1D 2O0LA 1Y8CA 1F38A 3A25A 3BZBA 3G2MA 3HA3A 3M6VA 3OU2A 1P39A 5DM2A 3P9CA 1KP9A 5HIJA 2I62A 4C03A 4OQDA 1G8SA 3B3JA 5CVEA 5DLYA 5E8JA 4E33A 4KVZA 2C7QA 5DSXA 3SX0A 5FCDA 3E7PA 3DXXA 5F2KA 2IDKA 4NECA 1I4WA 1RJDA 2O06A 1XCJA 2JH9A 3DXYA 3FUTA 4IV0A 2H1RA 2O57A 3SSNA 4RTMA 4F86A 3DXZA 3FYCA 2ERCA 2IPXA 2P41A 4OBXA 1SQGA 3SSOA 2ZBRA 2UZ4A 1SVUA 5EVJA 1PJTA 1QAOA 4PGGA 1ORIA 3G89A 5K0LA 3FUVA 2PXCA 4PYIA 2PWPA 3KHKA 3KPYA 4HGZA 3A7EA 4XCXA 1EG2A 1QANA 4FR0A 4ER5A 3SMQA 2HR1A 1XDSA 2PX8A 3KQPA 2IBSA 4RVFA 2AOWA 4QTUB 3Q87B 3LCUA 5EEHA 3G8BA 4QPPA 5K01A 5K0EA 3B3GA 3G7UA 4PWYA 3O7WA 4R6WA 3I64A 1P91A 4FGZA 5F2OA 4C4AA 1X1CA 3NWEA 1R8XA 3PX3A 4M38A 5DX1A 4QVKA 4KW7A 2Y1XA 3HVHA 2B25A 1D2CA 4DCGA 4PYMA 1QYRA 4DKJA 2XVMA 3LKZA 1NW5A 3ANXA 2H00A 2AOUB 5BW4A 5LSAA 1VLMA 3GJYA 1QAMA 3FPJA 3L8DA 3UJ8A 1YFLA 4FZVA 4RTOA 4E31A 4YUWA 2ESRA 3TKYA 4EK9A 1N2XA 5K8VA 4A6DA 1MHTA 3VC2A 3CKKA 1YZ3A 3LKDA 4L7VA 5E2BA 2OXTA 5K05A 3RW9A 1EJ0A 4RTKA 3KQOA 2P40A 3OFJA 5E8RA 3OZSA 4BP1A 2WA2A 4E30A 1L3IA 3G5TA 3DULA 3IV6A 5E1MA 3NWBA 4YUXA 3GRZA 3M33A 2FYTA 4X61A 1TW3A 1SQFA 5FQNA 1U2ZA 2ORED 5HILA 2JHCA 3BWCA 2PKWA 1VP3A 1R8YA 5GINE 4P7KA 2UYCA 3KPVA 1UFKA 3G8AA 3TOSA 3K6RA 3R24A 3TMAA 1O9HA 1B42A 1ZGAA 4YV2A 2V7EA 3FYDA 3G5LA 3LDUA 4HGYA 5DTMA 5EMMA 1M0EA 2CWWA 5GIPE 2BM9A 3HCBA 3LBFA 4YMGA 3KQQA 1YB2A 4FSDA 3MTIA 3FPEA 1DCTA 3AY0A 3KR9A 5FWDA 2VS1A 1VE3A 1KYZA 4DA4A 3R9XB 4M7RA 3CVOA 5DWQA 3UJ6A 2Z6UA 4F84A 3FZGA 1FJXA 3B89A 3UFBA 2UYOA 3K0BA 1NW8A 3PVCA 4ZTBA 5LQAA 2FK8A 2ZBPA 5EHIA 2OYRA 1KPHA 2G8NA 1JSXA 3CGGA 3Q7EA 4R8RA 1M6YA 4PGHA 4CKEA 1G38A 2AN5A 2YXEA 4MWZA 5EQJB 3FUXA 4KDRA 1JG4A 5DRTA 2HV9A 2QRVA 2ZFUA 3QOXA 3KQVA 4A6EA 5CVVA 3S68A 3CC8A 3HVKA 3SM3A 1G60A 3HCDA 4DM3A 3KPWA 2ZLBA 3EVBA 5CCBA 2IDJA 3UWPA 3GGDA 3BGDA 1BHJA 3E05A 2G71A 5GM1A 1EQAA 2WA1A 3AXTA 3PB3A 3DLIA 2CKDA 3PLAE 4LWOA 5DT2A 5LQKA 3EVEA 2IH5A 2Z6QA 3E8SA 2ADMA 3HNRA 3GO4A 2JJQA 5DRYA 4AX8A 1ORHA 2E5WA 5BP7A 1XDZA 3DTNA 3IHTA 1F3LA 4X41A 5JR3A 3EPPA 2HMYB 2AN4A 3OE4A 2PT9A 4GOLD 5HEKA 5LR6A 3DOUA 3HA7A 3BUSA 5P8WA 2CL5A 1I9GA 5KQRA 1WXWA 2HWKA 3OZRA 1BOOA 1RJGA 2ZZKA 1NBHA 3IYLW 1NV9A 1XTPA 2XYQA 5E9WA 3UJ7A 1JG3A 5K0BA 1D2GA 2NXCA 2OY0A 4X63A 2G72A 1FPQA 1G55A 2HNKA 3P97A 4GOMD 5IH3A 1YUBA 1UWVA 3FPHA 5M5BA 1JTFA 3FTEA 2BH2A 3BKWA 4KRGA 1WY7A 2PY6A 2YUIA 4R8SA 1RI4A 1OR8A 3VYWA 5HIMA 2O05A 3M70A 1AQIA 3R3HA 4BLVA 1NW3A 1D2HA 2VZ9A 1VP9A 3IEIA 4OA5A 3MCTA 1JQEA 4RVHA 2QYOA 5K0GA 4GC9A 2ONYA 3HCEA 5DX8A 3MGGA 2K4MA 5GM2A 5T67A 3KQWA 1ZHFA 5H02A 4YMHA 1BKYA 5GP1A 3NMUF 4CKBA 3LCVB 5CVUA 5EGSA 1QAQA 4PYQA 3B3FA 1L3BA 3ELUA 3JWIA 3KPUA 4BLUA 4DQ0A 3EVGA 3JWGA 4FT2A 5K03A 2VDVE 3TRKA 1PJQA 4EQZA 2GPYA 3D2LA 2IIPA 1WXXA 2FCAA 3CBGA 5EOVA 1FBNA 1V39A 3GIWA 4G56A 3TLJA 1YZHA 1NKVA 2Y1WA 1NT2A 4QTTB 1O9GA 2ZTHA 4AZTA 2I6GA 2QRVB 3MAGA 5C9ZA 3BWYA 3MHTA 1TPYA 4GOOD 2EG5A 4WVLA 2PJDA 2YXLA 4WXHA 3TKAA 5E9JA 3T7TA 3U81A 1VPTA 1X1BA 4LG1A 3KQTA 5K09A 3KR1A 3LGAA 3P8ZA 2B9EA 3SSMA 4GOND 4F85A 1KR5A 3G88A 3C3YA 2ZBQA 3A27A 1Q0TA 5CVDA 1XCLA 3OU7A 4RSRA 3DP7A 3FUUA 2AZTA 5ICCA 3EEYA
chains in the Genus database with same CATH superfamily
1F48A 4LGMA 4NX2A 4S1OA 1EFUA 1Q44A 4R1MA 5FOVA 5FP0A 5K0CA 4NBRA 3IP9A 4R0MA 3I2YX 3QU4A 4YBRA 3CVWA 2REOA 4YCNA 1TQDA 4OXYA 4D42A 1M2GA 5BQXA 5LJIA 5GONA 1SCIA 2CL7X 2Q3BA 1W36C 4PCUA 1L4BA 4YPOA 1CSEE 2FJUA 1JG7A 2V7TA 3DE2X 3TE7A 3TFWA 1YT5A 2ODAA 2VTBB 1JAZA 2F48A 4D0LB 1JJAA 2CZCA 1ZPDA 4H0CA 4N5MA 4DQVA 3NBYC 4K9QA 1KMQA 1UHZA 4BNZA 2ZRKA 3H2JA 3L6RA 4ZVVA 1NVEA 1SN7A 4M9SA 4GKAA 3BIOA 2RCYA 5DM1A 2DIXA 5K4HA 5FL7D 4NFLA 3RSQA 1D5CA 3DO6A 2X0KA 3O92A 4II3A 4WOPA 4FDLA 1IDOA 4PFSA 4V0OA 2EOHA 1NDHA 1IQPA 1TCBA 2V8QB 4PINA 5HJEA 3C5CA 1NVUQ 3ZZUA 3DAOA 2XMPA 3THYB 3JYLA 4KN6A 5F2NA 2GCGA 1XXLA 3A1TA 5CXSA 4WBNF 1I0ZA 2YU5A 1G9SA 4HN4B 4KLNA 4MROA 4BWYA 1B6TA 2ZXEA 2DR2A 1YQXA 1N6KA 2B6NA 2YTJA 4U3JA 5BNTA 2FR8A 4O4LB 4Q0MA 2FVYA 5JFOA 3HSSA 5JUWA 2HWXA 5G0WA 3X3HA 5HG0A 1QWSA 3E6AA 4IO0A 2O8EA 2JGDA 4UBJA 1DZIA 2ATEA 3CIOA 1GG2A 1GPKA 1O54A 3TQIA 4RTRA 3UJAA 1CFZA 1WIWA 1VYUA 3OIWA 3EAFA 4HXEB 4P35A 1SIUA 5G02A 1LBTA 2JEYA 2WIDA 3JQRA 5A3QA 1Y4DE 4EGAA 4YHHE 4DR4E 1NXVA 5G53C 4DV1B 2X23A 4EHIA 4A0RA 2EL5A 2PV0A 4TXHA 1WY5A 2ZJYA 3P9SA 1S2MA 5AVUA 2O8DA 1E7QA 1RZVA 1ZK1A 2H63A 3O1LA 5I48A 4G67A 3MCUA 3DBVO 4K81B 1QVVA 4MR7A 1B8PA 4M0PA 2D5BA 3DZJA 5KJ1A 1N5RA 3L0OA 2PXXA 3EAQA 3GGCA 4FGSA 2QTMA 4HLUC 4UHBA 3REOA 4EGFA 5K8UA 1PJ2A 5KOIA 4P1ZA 1ZI8A 3QE2A 1V8PA 2QLLA 1F2DA 2BFMA 4FDAA 1K5PA 2O3JA 2NU9A 1HT0A 2ECFA 2YJGA 1UXKA 3CZAA 1Q0SA 1HLGA 1S3GA 2V6FA 3EYAA 3LVRE 4WKGA 3BF2A 1HDGO 1JHVA 1VMKA 4OB7A 1PDVA 1PNVA 5EFOA 1WABA 3UCXA 4US2R 1Z5VA 2PCJA 1C3JA 2I2BA 2P6MA 1X42A 2IYVA 2WHYA 2FUEA 2FPOA 4HPXB 2E4YA 3EXEB 4FYXA 5FA8A 5I7VA 3PUZA 3PQ2A 3F98A 2HU5A 2YUTA 1W9MA 1R4MA 4NJMA 3K9WA 4JSTA 1KORA 4ZGGA 3P2YA 3VAAA 3GOQA 5A0TA 2FOIA 1ISJA 1N2HA 1QUEA 3JWHA 1ID8A 3M2PA 3F9CA 1KI9A 4R51A 4RL4A 1XR3A 2Z4SA 4BZPA 1Y3BE 4Q9AA 5L3ZA 4LBVA 2PBLA 4JDPA 1KU6A 3ZLVA 2VDKB 2OBNA 1KXZA 1A96A 1K7CA 4EY6A 2LIPA 2RJ3A 4ZVOA 2BR5A 2ZWPA 2H65A 1DV2A 1VCIA 3GCXA 2Z2KA 4IMIB 2FNAA 5CCEA 5L40A 4CEJB 1U7PA 3EK2A 4RH0A 2VSYA 1AKYA 2ZULA 2MMCA 2XWSA 1EXVA 2FZKA 1OI7A 1NVDA 1XVAA 4UTXA 5E2IA 2WTMA 2BB8A 1T43A 3VX4A 1D6NA 4A4DA 4AJHA 2NUPA 3Q2IA 4I6JA 2Q07A 4AF8A 2MYNA 3JPYA 2NG1A 2XMSA 4R2IA 3T5GA 2R7NA 2X0NA 4W5JA 1Y6JA 4Y9RA 3UGJA 4RK5A 5AM4A 4LF8E 5EQDA 1YR8A 1D4OA 4Z0HO 4BNXA 4DYDA 3T4PA 1U1DA 1R0YA 2OVFA 2QG6A 2W2LD 3B20A 4IHJA 1CS0B 1FW6A 5E1BA 4B8ZA 3YASA 3P71T 5CDFE 1TUBB 2B1RA 3ED5A 1N5OX 4JI8E 2NV6A 1EJBA 4ZWNA 3TOZA 4WJZA 1QOZA 3OZGA 3CLHA 4COKA 1GPLA 4D74A 1PJBA 3ZZ1A 4LJYA 2WVJA 5A7HA 3H4MA 3IQDB 3HA2A 3S2FA 6PFKA 1NAHA 5B4UA 3KUDA 3O90A 4TXNA 4LY9A 3SF8A 3HKDB 5JMWA 1FX0B 2BMEA 4OUDA 4A0FA 3IOMA 4D80A 2YMPA 3EF3A 4JS0A 3STYA 5DPMA 3BMQA 4DDHA 4BCAA 2POCA 1D8AA 4YRCA 3EFOB 4NCJA 4H2DA 4RE6A 5E7QA 3RCBA 1U0BB 1H6AA 2FPKA 3L92A 1USIA 1W48A 4X24A 5AM1A 1I7QB 3UJNA 1GCIA 4DQDA 4MYUA 3KQHA 3HR4A 1C1DB 1XRSB 2BFDB 2VRBA 3AU8A 3H0CA 4DREA 4W9MC 3NVKI 2PX4A 3QI2A 2D0IA 1UL1X 1JLMA 2W6ZA 4Q9JA 2JHPA 1WKVA 3R44A 5HCIA 4LF5B 3N1UA 4IJMA 1P7PA 3TW6A 1CY1A 4JWKA 2VKTA 3CJQA 3RSGA 3TS1A 2NPOA 2BRUA 3TTWA 2RH8A 1S6YA 1UDAA 4B44A 3TVDA 1L5RA 3U4DA 4KTVE 1HNZB 1F8FA 2IZOA 4YWJA 1RKQA 3IP3A 4PCLA 4DG9A 5C46F 2AQ8A 2Z04A 3A9VA 5FFMA 2QZZA 2GB4A 1CFJA 3M6WA 4OM7A 1HNXE 4OREX 1E1KA 1DCMA 2Q29A 2CV2A 4KLRA 3VPHA 3ZDDA 1TYEB 4KVAA 1XLUA 1YRAA 5JD6A 1LC0A 2WMYA 5HCUA 1AT1A 1M2OB 2DQ4A 1R4AA 5EGNA 4BAZA 5JXGA 4R3WA 2P2ZA 3OT1A 4TWJA 2Y0CA 1JDPA 4OQPA 3ZNNA 3NTVA 4P9NA 3FNIA 4XWAA 1YIOA 1CEEA 1VCOA 3PWZA 1P81A 1GQFA 2VDMB 4J6FA 4P4TA 3LD9A 5FNVF 1J2UA 2JD1A 2OAP1 3CG4A 3GLQA 1TA0A 3R0QA 4JI0E 4UPVA 1E4EB 4F0JA 3R3UA 2DMYA 1LPMA 1SQ0A 2XYPA 1HQDA 1ZD9A 3WBBA 5EJ6A 2R48A 1KYTA 3QVVA 1KDYA 2A92A 4MCIA 5AW5A 2ZEJA 5AASA 4EBBA 4ER3A 1O1YA 4KAXA 4EFNA 2X3FA 3MJTA 4BAUA 1JILA 4L3OA 1O0WA 2O52A 5D7NA 1KERA 1R5BA 4XIGS 4AY3A 2Q8UA 1PLLA 1WDMA 3IUQA 1GRQA 4RMHA 1S2OA 3S2IA 3QOWA 4BMNA 1VSTA 2DSTA 2WMDA 2VAXA 4N01A 1T4GA 3WFZA 3WFJA 2ERXA 1MJFA 2PZKA 3CZ5A 2FUCA 1I94B 4C1NA 2QG9A 4XGKA 4IFTA 5F35A 4HEQA 4WOBA 3ZIAA 2VLIA 2FWAA 1LJ8A 2GUGA 2VPWA 3GP8A 1ZU5A 1QS0A 4Z0TA 2YTIA 2ZJZA 4GKKB 2YU8A 1UJ6A 4KE9A 5DXJA 3K1AA 4DLSA 4YFVA 2DERA 4IEEA 1KZYC 3FBTA 1WOMA 5C5DA 1VDMA 1MPXA 4ZOCA 3SQMA 1X7ZB 1CC1S 1Y8CA 4B8YA 4D81A 2WWTA 1G4AE 4DDWA 1KMNA 2MSWA 3P9CA 1VSQA 4LC9A 3NCHA 4EPTA 1IXRC 3KLOA 4PGFA 2TMYA 1EZ1A 1N0IA 1CX9B 2O2EA 3B3JA 3G23A 3EGXA 5EVCA 1R8QA 5E4FA 3ZUGA 2GUWA 3L8YA 5JU6A 4M0CA 4YAJA 1HFKA 2O20A 5I7WA 2WSSA 5BPHA 2HHAA 3ESDA 4BIIA 2Q1TA 1X70A 1Z4KA 1NCSA 4Q35B 3AI1A 1XZCA 3EGWA 3N3BC 3S1LA 3E5HA 3LT1A 3AVXA 2QT1A 5LQDA 4XVUA 2ZJAA 4QYWA 4BP8A 1U7OA 3OCVA 4CTNA 1BQEA 4IOLA 2BJWA 1C3OA 2AL7A 3MJVA 4OQZA 1UBMS 4S0XA 4TLDA 3RUDA 2LCEA 1TFUA 4CEIB 3C7TA 4ER5A 4B80A 2AG1A 4S2EA 2PX8A 4PZPA 4H7IA 2IV2X 1T5DX 2DOKA 4NPAA 4OSPA 4Y2QA 5HF5A 4MLZA 3G0OA 2PZBA 2O2ZA 3GLHB 1A72A 3P2OA 3LCUA 4JJ4A 4C21A 4CKWA 5AVYA 3PZRA 4PXYA 1DC3A 1GRNA 1UK7A 1YS1X 2PAFA 2Z3VA 3DEYX 4L3WA 2AFIB 4Y6QA 3H1TA 4Q7EA 4DIUA 3DJYA 4GM0A 1V41E 4DNQA 1CR6A 2OUKA 3KTFA 3W90A 3WO1A 3P9PA 2PUJA 5FI1B 1JXAA 2CMFA 3SXPA 3TZLA 4HNGA 1KMHA 2DE0X 4LIPD 4QECA 2H00A 2QQEA 2WKSA 5A5DA 4MV0A 4F71A 4WFTA 1I6LA 2PKEA 3GJYA 4FYVA 4PLYA 3DZBA 3PPVA 3F3MA 3JZMA 4RTOA 1EVKA 2M1XA 4YUWA 3MWKA 4EK9A 5JJKA 1P31A 5EQFA 3T12A 1IOWA 1BCRB 1IPHA 1E1QA 1H69A 1AXEA 1N3YA 1W2GA 3DDUA 3LKDA 4ITRC 2NXWA 3PNMA 4IXWA 4J3NA 2FTKE 4D8YA 3DFIA 1IZYA 1RACA 2UU9E 2P75A 3I12A 3NATA 4EMUA 4F21A 1L0BA 4F2GA 3NLLA 2EMLA 4L50A 1R6TA 1W5AA 2QE7D 5SYNA 2CLCX 4D02A 1G8JA 3K4QA 4FBLA 4FEYA 4B2PA 5I7HA 5DB4A 2BHSA 2ZAOA 2IEAA 2CDBA 3HXTA 1UKZA 3LGSA 4II7A 3QG5C 5EJFA 4YJFB 3WRYA 1G19A 2PJRA 3DZCA 3L3BA 1WCYA 3QFTA 4EW1A 1VP3A 3DDSA 2A7QA 1IRXA 4BO8A 3H17A 2R6GA 1II8A 1RJWA 3NHWA 4BUJA 3N2GB 3HEAA 1PS9A 3WQQA 4I19A 3PA8A 4I55B 1CVIA 5CYGA 1K08A 3NO4A 3B82A 3KR9A 4Q4CA 2PDAA 3WISA 2FSPA 1H9BA 1N3BA 3R0XA 2OCKA 3Q40A 3FW1A 1ZX1A 2A3RA 2NIPA 1NFFA 3BSSA 4Z0PA 4V1CI 4EPYA 1NUAA 1M1ZA 3H11A 1NQ5A 4UAVA 4PG8A 5JLJA 1QFSA 2WQ7A 2UZ3A 2EAUA 1F5SA 5FTMA 3WYDA 3ZZNA 1XG5A 4IDGA 2G8NA 2EOOA 4IIJF 5BW6B 3SYRA 3UAXA 2ZU6A 4PGHA 5C1OA 1YZLA 3I9KA 1IG3A 5L9AA 1MO6A 2FI1A 1NMQA 4JGIA 4NZYA 4Z9BA 1DPFA 1I3NA 2DU8A 1ND5A 5LWQA 4HQOA 1KOFA 1MN6A 4I4NA 5YASA 4AKSA 3IHWA 4RKRA 1PT7A 2CNOA 1OBFO 4TYMA 5BOSB 4KHPE 2F1HA 4FHDA 3AXTA 4YCJA 1VB5A 4HY3A 4BV8A 3GFGA 2HPHA 4DR2E 1VA5A 3SI7A 2NU6B 4GVPA 5ABPA 1MDFA 3HUTA 3RUEA 4H4DA 2WUFA 2X7JA 4LYYA 3FYUC 3UW3A 1KFJB 4B3RB 1V3TA 3HRKA 2FUG6 1MQAA 2OCPA 5FYDA 3JQ8A 3GJTA 4W1RA 4K1LA 4R2LA 3ZYCA 1N8SA 3BIDA 2WP0A 1ULHA 4IBOA 2VJMA 1W88B 1PR1A 4PPFA 1FPQA 3CLSD 1AOXA 4BCBA 1DEHA 3UV6A 1JHRA 1LU9A 2JRCA 4G25A 5GZ1A 1B43A 5ECYA 2RHGB 3CRVA 1SB8A 3DCYA 4BKRA 3D5TA 1NTOA 2PRKA 4ZC8A 3SCZA 3HMKA 4WK4B 1GKYA 3H2IA 4TS3A 1E8MA 1Z38A 2ZT5A 3L0YA 4YCBA 1J5XA 3GJ6A 2TMGA 3UJ3X 3UHPA 1CRPA 1ISGA 2UVQA 1Y3HA 1QV6A 1OFVA 2K4MA 3N8DA 1J33A 3AUKA 4QPJC 4R1LA 3V3TA 4B31A 4G97A 1BKYA 4G5SA 2R6FA 5JVDA 1HYEA 2XA9A 3KZZA 1SXJB 2P27A 4E5DA 3R8FA 4G84A 1T9BA 1CY0A 4ARBA 1Y8AA 1GVHA 4INPA 5IAAA 4QGGA 1PTJA 4DQ0A 4Z49A 2JP9A 4TKVB 3DL2A 1KDZA 4U4AA 3KEQA 1QGED 4CTOA 2WLSA 1XMQB 2J3MA 4WX2B 3LXMA 1Y5LA 3VZRA 4BLQA 1V39A 5HK9A 1YZHA 3GHHA 1T4CB 4XSHA 4Q3DA 4Q47A 3STWA 3U5ZB 2WFAA 1O0CA 4TS4A 1EDZA 4MCJA 4CR8A 5IXMB 3LJKA 4MP6A 2EHJA 1XPRA 1Q84A 4YACA 5KBYA 1GGMA 1H8ED 4CMHA 1PK9A 2FLKA 4Z51A 1M2HA 1VLQA 4QUKA 3PC8A 3TKLA 3WXMA 3ANLA 4KHZA 4XIIA 2EMXA 1CKEA 4LV5B 3RVNA 3WYBA 1C7QA 1NJ6A 1V5GA 5FAXA 3VPGA 1NRJB 1OZGA 1P2DA 5FTLA 1AB6A 1PV1A 3DP7A 4CQNA 3AB3A 1CQXA 3KQUA 2XUDA 4MQEA 4QATA 3ZU2A 1AD2A 2UDPA 3DCJA 3NGXA 3WIEA 5K9ZA 4E2FA 4O5GA 2EOSA 1NKTA 1SCKA 4MLPA 4QTYA 2C7OA 1OXMA 2V7XA 1GQEA 2Q6LA 3FHLA 4HBGA 1SXHA 2NUEA 3JVDA 3IIJA 4MAAA 5JBQA 1WUIS 2OECA 1M0SA 1Z15A 3RIMA 1YC2A 2V7BA 3WB0A 1AHHA 5BNIA 4YUYA 2W00A 1WVMA 5TSDA 2IP4A 1HXHA 4LK2A 3U40A 1DPGA 2GLXA 3TQCA 4M37A 3FY4A 2QSYA 4RHFA 1VKHA 1EH6A 4LFCE 2I7TA 3QX7A 1TAQA 1UKCA 2BM8A 2ZTSA 2GN0A 4G37A 1W73A 2C2XA 1Q0HA 2OB2A 3AR2A 3HP4A 4IILA 2OBYA 3AHDA 3FH0A 1OAOC 1VXRA 1ZW6A 1RI3A 3GC6A 3M3HA 5FUVA 2ZTUA 1LQUA 3F1LA 1NAIA 3AFNA 3NHZA 3HQ4O 3KQSA 3QEMA 4WMLA 3U48A 3ACDA 4B48A 4RK4A 3U7QB 1G4UR 3BBLA 5JLAA 4CGYA 5CDUA 1ILEA 1G1MA 3M6AA 4DYHA 3OURA 3AJRA 4KWCA 3TQTA 3A3PA 2FE4A 3OTQA 3JQFA 1BGWA 2UXDE 4KQIA 5KPDA 4P7BA 1V5FA 1NIJA 4MQBA 1Z0FA 4QPDA 3OMWA 1IULA 1M2FA 4KQJA 2YXDA 3ETNA 4CG0A 3ZVKA 3BE4A 1TJPB 5EWJB 2X13A 2CUKA 4RMJA 4LJLA 3AIMA 3I39X 3VKGA 3IEUA 1DTSA 2P68A 5DN6A 5SY9A 1TGYA 2WWXA 5IKPA 3L82B 1A1SA 3NR2A 2VA8A 2Y0EA 1ACMA 3QP9A 4TYPA 2HA5A 2JLSA 1A8PA 1OJLA 2L18A 3A37A 3W78A 4DXAA 4GI2A 2VPTA 1ULZA 2JD2A 1JR2A 1Y8QB 1KNQA 1TTQB 2W6IA 3DTTA 4MVJD 4RM2A 5EJEA 2Q9BA 2Y0DA 4BBPA 5A9SB 4UZEA 3K7EA 1F2TA 3RFCA 3OZAA 4J3FA 4DB2A 2PKRA 5IDVA 5BSEA 3CZQA 5KOJB 1UFOA 1SOVA 3L8MA 4B43A 1QHGA 4IDOA 2RI1A 1JSZA 4QD3A 5BPFA 2WG0A 2IHYA 3KOMA 3PFWO 4ZO4A 5KNDH 1FRQA 2WBSA 3AIOA 3QBEA 4K3VA 5JD3A 1KZ7B 2JLRA 2JWOA 1E1YA 16PKA 3LQ1A 2VJYA 5IT5A 4CI9A 4MUYA 4XM1A 3UMJA 4R3NA 1JKMA 2R86A 1KE1A 3PXGA 3ZQJA 1WQ1R 3BGHA 1SAYA 1Z25A 2OR3A 3FRHA 1IXKA 1QG0A 2XUPA 3L5KA 3OLYA 4L73A 1A8SA 4MOWA 1LX7A 1Y4ZA 2R1ZA 4PY2A 1K66A 1UZNA 1UQRA 4Q7MB 4PZUA 4UM7A 4N0PA 2D2VA 2DY1A 2YHIB 1P3DA 2JFBA 2M9MA 3GU3A 4XASA 5G4LA 3VKWA 4F1WA 2VYCA 1L7QA 2BW0A 1BCSA 2P9FA 3H1BA 1JPNA 3TLAA 2W2VA 5H3HA 3ZE1B 1GGFA 3TLBA 1YZFA 4L2IA 1NLYA 1YJXA 1T15A 1ZXXA 1LRLA 1AS3A 1VOTA 2ZB4A 3C0KA 4HDCA 1S7CA 3MBIA 2DPMA 3ZY6A 2V5VA 2BTQB 2ZE8A 2WHXA 2GEFA 1LBQA 2AWNA 4G0WA 1XEXA 4G81A 1BHO1 1MMFB 4LHXA 1BWQA 1Y7PA 3ZBQA 4BNUA 5KAMA 3AVTA 3C3KA 1BWPA 2CMHA 2PKQO 4AUKA 3OZTA 4MW9A 2I1QA 3A7DA 4P58A 3JYOA 1EK5A 1JS1X 4NXME 2Q3FA 3TUJC 4AYXA 4IDPA 1LI4A 2MYTA 3H9JA 5EJ7A 4OQ4A 4AF6A 1U2QA 3ORRA 5KNCH 1YQWA 1A1VA 1NPYA 4BO0A 2VQFB 2QN7A 1HC7A 4MV8A 1EE9A 2LUPB 2R97A 3FRIA 9MHTA 1X74A 3RD5A 1N7HA 3A0RB 3TJMA 2HBQA 5FFFA 4Y1FA 4PHFA 4FD3A 5AICA 1T5IA 1K2WA 2LIVA 5G0TA 4GF5A 4WJLA 2QJTA 4EG5A 1JG6A 4EG0A 4NATA 2CPNA 4GS5A 4AS3A 4B09A 3L7YA 1O87A 1QH0A 1TK9A 1SIWA 1ORVA 4GPAA 4MA5A 4U39A 1J22A 3CJRA 1E3WB 1EM6A 4BNGA 4MA0A 4OMDA 5K4GA 1VMEA 2XE6A 1THGA 4JMLA 1RE1A 3EOBI 3PQCA 1PJSA 1P4RA 3QE3A 1TK3A 2EFYA 2JBAA 2JANA 3ADIA 5AR1A 3LLCA 3RU2A 4B33A 1K89A 1T9KA 5D1HA 4OEHA 4CDNA 2PUEA 1PW5A 2H08A 2X5OA 4REQB 1IXYA 3M1AA 5LUAA 2DG2A 1E5LA 3EISA 3CONA 4CKCA 3B48A 5FULA 1R27A 2G1PA 3AO0B 4RLFA 1G5QA 3VO9A 3E61A 5IT4A 2PQMA 2MKDA 2UVPA 1BH6A 1RE0A 1RJEA 4CLOB 4DEYA 2BFCA 2HJJA 2ORWA 1SVNA 3TNYA 1KEPA 4DCTA 2N8XA 1Y48E 3AVPA 3F6CA 3R7WB 1E89A 3N0XA 1RJFA 4CKXA 4EKNB 1O95A 2L2KB 3FOAA 2PCLA 4QNMA 2AMVA 1PS0A 3O75A 4D56A 4MQ6A 3WOHA 4UHKA 1OKKD 1WQ4A 2FEWB 1NY6A 2GZHA 2FWJA 2W48A 1OTYA 4KE6A 5B58T 3QFRA 4LA4A 4RVSA 1E1RD 3S2UA 2GBCA 1VL5A 2DMIA 1GNQA 4YEDA 3N2YA 3D7KA 2A4KA 5F5LA 2D1SA 2E37A 2Z98A 4GT1A 4UHEA 1PUXA 2FCRA 1QG2A 3GFTA 2VNIA 1AN9A 2GZ1A 3EVAA 2RGBA 5JNWA 2V7QD 5AQEA 1BAPA 2HJHA 3KEFA 1SOAA 1EUCA 1KNXA 1UWCA 3OJWA 4HVTA 4M55A 3GEPA 3SE7A 3WICA 1N1MA 4JASB 4M87A 4EENA 4C0QC 3SYLA 2RAFA 3GPCA 1KWKA 3I1FA 4HPWA 1T3SA 1XEFA 4OJMX 4AJLA 4E07A 3EWIA 3AKYA 4QNRA 1N25A 1QHHB 4M2LA 2JFHA 3KDSE 4V0LA 4DPKA 1K7FB 4P08A 3A6PC 4EKYA 4F3KA 4I7EA 1EH7A 5J58A 1XMIA 4YJKA 1QPZA 4OKSA 3KTOA 1MABA 1NVTA 1LLMC 2BF7A 1FTQA 2VCEA 1FW8A 2HJSA 2W37A 3B13B 3FWKA 4R9SA 2PZ8A 4EB0A 1UAYA 4EY4A 2EC5A 2VAWA 2XA1A 3BF8A 5DIFA 2YIMA 3H2KA 4KLCA 2WE8A 3KDPA 1J90A 1JDNA 3OY7A 1MJGM 4JR2A 4EDFA 2Y71A 2HSJA 3D2CA 5IBQA 3HLTA 2ADRA 2I1LA 1S01A 3C1AA 3CT6A 2ZVJA 1ZNWA 4L6CA 3KAJA 3CV3A 3L6EA 4LHEA 3R20A 3GW8A 1V43A 5AXBA 3H9BA 1NW9B 5IZCC 1PGOA 2XT0A 4MGYR 5KYXA 3FMVA 3LMKA 4RK1A 1E2IA 1G6OA 4JEMA 1NGSA 4BXOB 4RLSA 4KRFA 3IGFA 3LSTA 1MAWA 2EWWA 1L5HA 3DSRA 1N77A 4I1OA 4ZANA 4C6SA 2QMYA 2XCLA 3LVFO 1F2IG 3LDGA 4R9VA 1A9PA 4HFJA 1J1UA 1F4PA 1OU4A 4U9UA 5ELMA 5G4KA 1J0AA 3CEAA 1JFTA 2AMLA 1ZR4A 2CVQA 2P4EA 1E2QA 1HDZA 3C3MA 2GM4A 1FZTA 1Y6QA 4N5HX 1UMDA 1M8KA 2J3HA 5J9FA 4BRUA 3SY8A 1YQQA 3ODGA 4HFRA 1PYOA 1I4EB 1NM5A 4YGYA 4B3FX 4CZ2A 4PX3A 3K0FB 1HE3A 2WF5A 1M1NB 3R5SA 1F38A 1N1DA 3HN7A 4HS4A 2B0CA 4IF4A 4BKMA 3S2YA 1ZIXA 3I04M 1N8TA 3GFSA 4MPPA 1TD1A 5JFGA 4A03A 3G0IA 1Q1BA 2Q7XA 4C03A 3BDIA 3QLVC 1AUOA 2J4CA 4E15A 1TL7C 3H5WA 2L3CA 4YR7A 1S1CA 4K5QA 3RVOA 5BNZA 5FPKA 1N32B 5AE3A 2P1RA 5GADl 2Z9BA 3L8EA 3T3OA 4HAOA 4MX8A 4KXYA 4IV0A 2C7VA 3BE6A 3MTQA 3IEVA 2ZPUA 1EWVA 4S1VA 2H4HA 1FB5A 3FYCA 2ERCA 4DJAA 3PRHA 4OBXA 3UT0A 1FNSA 2XGSA 1H0RA 1UINA 1PJTA 3M0EA 1E62A 3R0JA 1L5MA 3KKMA 3HDYA 4IUCS 2QM0A 3O3NB 1QC5B 3O8DA 1PT9A 1UFQA 4D8WA 3OLQA 3GI1A 2RG7A 1QGUB 2IQIA 3WGTA 2XNKA 1VG1A 3ZWPA 1IOZA 1KZ6A 2L8TA 1QZ3A 3WKAA 4BMDA 1I7SB 3FLAA 4IFIA 1EZ4A 1IZ8A 2IW3A 4K05A 1JFRA 1A1HA 4KV7A 4ND4A 3RREA 1J1ZA 4DPMA 3PX3A 2MSNA 2Q5HA 1XNRB 1IZZA 3RYCB 2KB0A 5G1OA 1VKZA 3DJFA 3GRKA 4GKJE 1D2CA 4DCGA 3WL3A 4QA9A 1Q74A 4DLBA 1DKMA 1JALA 1GNLA 1JHAA 1NXPA 2OG1A 3DAGA 3O1HB 3GJ8A 3WK4A 2QR5A 3L7IA 3M5WA 2WKQA 1QPGA 4IJDA 1QSGA 4CMGA 3BWVA 2GPNA 4PQGA 5FBWB 4CQMD 4S05A 4JXXA 2WJ4A 3KOUA 3ZU5A 3W2IA 1LBSA 3BJZA 3KAPA 5A04A 3BILA 1Q0ZA 3VR6A 4E5UA 3WIVA 4JLJA 5NULA 4EVQA 2Y1KA 2G83A 5BXQC 5K05A 2Z9CA 1TU4A 2WIFA 1TEHA 3OJFA 2QRZA 1KHTA 2PH5A 5TLSA 3JZAA 4QXPA 2C3OA 4RA9A 1CUJA 4MITA 4KITB 1DIHA 1VHDA 4Q1VA 3EA5A 4BQPA 3L7DA 4D44A 3DA8A 2OD2A 5IUKC 1CHDA 1HFEL 1SQFA 5CXUA 3I2KA 2C8JA 2XTNA 1XI2A 4F45A 2JFUA 4EELA 2G82A 2GVNA 4TVOA 4BQIA 5KYKA 5GINE 1DTWA 4FFOA 3ST7A 2GPIA 2WWVD 1V0JA 4KQEA 1G2PA 3ZU6A 1UJCA 3TMAA 1IMOA 1ZGAA 2FU5C 3G5LA 4GAEA 4JVLA 5BQOA 4PV7A 2FJ0A 4B7ZA 1CRLA 3GFFA 1F0NA 3N8HA 4MCHA 5EE0A 5IAEA 3A4LA 3RGWS 2DLNA 3N86A 3BIWA 1DJLA 5CIWA 4N0QA 3FGZA 4KWEA 3QQ5A 3V1NA 1VPDA 4QQFA 1PD0A 4DR5E 3THNA 1YCGA 4LVCA 3VSAA 4G23A 3CH5A 4ZCMA 4CIBA 3M83A 1PQYA 4LJSA 1J7JA 3I5YA 4W99A 3RG2A 2UYOA 4U8HA 5B2EA 3PTZA 4OXKA 2A9RA 2PA3A 3VR5A 4YRMA 4Y2SA 4L4ZA 1C7ZA 1SC3A 3E8XA 3D1VA 1ZGZA 4Q1FA 2I2XB 2YV3A 1YR1A 3TVTA 9ATCA 4CKEA 2VP6A 3PHGA 3ANMA 2QOEA 5HE9A 2WOJA 2ZUWA 2CFTA 1RWMA 3FZNA 4WUVA 2Q2OA 3CC8A 1EP1B 2QVCA 3NKVA 4YJ2F 2UVDA 5CVVA 3R3YA 5F33A 4A82A 1VFPA 2VTEA 3KPWA 1SPXA 4PVCA 3HJFA 5CYOA 4UHJA 2HY7A 3GB9A 2JCBA 1BU8A 4QEDA 1X7WB 1ZAKA 2HQ1A 2WA1A 3J81A 3VUEA 2R0QC 3UHOA 1ZISA 1FTNA 3ZDEA 1P2SA 1SC9A 3OY2A 4LWOA 3PLAE 2WF9A 3HNRA 3HYRA 1LTKA 1E6CA 5CR9A 4NCNA 4BVJA 5A1TA 4NK5A 5JVDF 3O8NA 1Z5NA 4X9XA 2WB4A 3AI2A 1JIUA 3EZXA 1EXNA 3RHSA 2E3JA 2YC2C 4OGGA 3ZVMA 4GOLD 3C70A 3L02A 5E7JA 4J75A 1IJEA 4Q9NA 4AMZA 1MR3F 2VI5A 1FE8A 3NS7A 2ODQA 3UJ7A 1MAUA 1VRCA 4HJXA 4BX8A 3K6KA 1MHPA 3OICA 4X97A 1DV1A 3FSEA 1XZFA 4TX1A 2XTJA 3JAMC 1H66A 3UB3A 2XUOA 2VTBA 2JYAA 3D0RA 3O1JC 1H2YA 5ESXA 3ZY4A 4NZ9A 4OLJA 3W9UA 1AQYA 1K0FA 4IUBS 1IXZA 1WSDA 4JU8A 4FXPA 1XQ1A 3NHAA 2QVGA 3LUAA 4N12A 4XGNA 1KARA 3HO6A 2WHEA 3UCEA 4DCCA 3PE4A 1GUAA 6NULA 3AV3A 1WNFA 4YRBA 2A9PA 3CG0A 3EG9B 1XGKA 1VMAA 4PYQA 2X86A 1S8FA 2XNJA 3L46A 4JJIA 3JWGA 4P4NA 1TGVA 5AMXA 2GILA 4PRLA 1WULS 3OMLA 2A5LA 3RRFA 3RVJA 2FEAA 3FRJA 1XF9A 2AD5A 3CUWA 4C3UA 3THYA 4NESA 1UBHS 4NXNE 2C7BA 4A8PA 1EGQA 4BNJA 3VVLA 2XYGA 1D6JA 1FYXA 2IUYA 4O4LA 3E2IA 1G2FC 2UUOA 2QQ5A 2CEAA 5ELLA 4RD3A 1RWWA 2L82A 4DGSA 3MZ0A 2EN2A 3EUAA 3KQTA 2GEUA 2PL1A 3LGAA 5KL5A 1JAIA 3DHEA 1TDJA 3OC6A 5A5GA 3SSMA 3VGJA 1N2ZA 1DDOA 1B2LA 1QZUA 4DDKA 3W1EA 1SIOA 2QXTA 3R1IA 3FUUA 4KYUA 1J8MF 4ZZ3A 4LF7B 4XDYA 3EJWA 4LZNA 5CFPA 1ZA2A 1YYOA 2VK1A 1EX9A 3G9QA 2Q5CA 3V9AA 1GQOA 5I4IA 2FN8A 1KU0A 3JQPA 1AKUA 1ESDA 3JTMA 1Y6ZA 4V3BA 4WOJA 3TG2A 2RBGA 4O8ZA 3B3QA 2BCJQ 4URXR 3J7TA 5AI5A 1E7WA 4H3HB 4UUAA 3R41A 1QCZA 3F2IA 1RBZA 1XB2A 4Q9LA 3L04A 2IHNA 2IX3A 5T5QA 3DLTA 3D4NA 4MUAA 3CEPB 4LMBA 4WZBE 4H9KA 4U02A 3A70A 3M2TA 4GZ6A 3TIVA 1E9FA 1W87A 4UW9A 2B61A 4HC4A 1ONNA 5HZHA 3GPIA 5CFQA 4DDUA 1GTRA 3UJBA 3EG5A 3IAM6 5WRFA 3MCVA 4MINA 3LP6A 4OQEA 2GYYA 5AJUA 3D8TA 3O95A 3VOSA 421PA 3EXEA 1ZOSA 4BN4A 1I7DA 3WMRA 5M2QA 1UKBA 1OW3B 4Q93A 2QK4A 4MICA 5TC4A 4UPEA 3ECSA 2J7PD 5IDXA 5AC5A 1L7PA 1G2DC 1ORTA 1Y7HA 2J3QA 4WADA 4M0VA 2J9ZB 3R4CA 1TM2A 1AAYA 1NXQA 4PTYA 2YHUA 2BBOA 2EM9A 2AH5A 2HK6A 3N53A 3WDMA 1A9XA 1JTVA 3EGIA 3NZEA 4YECA 3H2BA 4ZXPA 3WDLA 5CB4F 3I4LA 1RYFA 2GZRA 1WEKA 2VSFA 3A3KA 3PJDA 3VPSA 3VYRB 4ALNA 4ZARA 4S35A 2PS9A 1I24A 2GN8A 3BL6A 3Q1KA 4LE0A 1HE5A 1PFKA 1U7ZA 2E4UA 2QZPA 1V1MB 4Z2YA 4NCAA 4CEJA 3DNFA 3G8CA 4AUEA 3EGCA 1U7HA 5A4MS 4DIBA 1PDAA 4N5NA 3S5UA 1UF9A 1GPNA 1ISSA 5JT1A 4J4TA 4OBEA 3KKLA 5DX0A 2P67A 4P78A 5EJ2A 4EY7A 2XRZA 3E1GA 1EIZA 3IKTA 1UPCA 4R8OA 2CNDA 1L4FA 2PGXA 4NCHA 2C0PA 4ER0A 5BMOA 1OLXB 2C5SA 2OV3A 3ECAA 4RK6A 2MYUA 5E1OA 5ESWA 4RTJA 4C6RA 3BXOA 4F4JA 3JYQA 2M1ZA 1CS0A 1W581 2RHCA 2GARA 2ZW9A 5D6OA 4ARZB 4MMYB 4PBSA 4CBVA 1RDFA 1TUBA 3OUTA 1K7XB 3IT2A 4BGVA 5B7NA 3CHYA 2Q1YA 3FYTA 1EFCA 4I50F 5LU8A 3RV4A 4GD3Q 1UXIA 1WDTA 3PR2B 2FDXA 3Q11A 1E3LA 2E4WA 2QN2A 2PR7A 4UVGA 1TYBE 4UEJA 2VJOA 3DFMA 3ULKA 2C84A 4RAOA 2WJVA 3OCXA 1GL6A 1V8BA 1KQNA 3SM9A 1U94A 3CQ9A 1EGAA 2NU8B 3HKDA 2UXCE 1FX0A 1VPEA 3AOEA 3IMKA 3IVXA 4LGVA 4P4GA 2I3AA 4PLWA 4QU8A 5CITA 5JMOA 1SXPA 4UJ5A 5H4HA 4Y9SA 3EFOA 5D1NA 4J7UA 3AHFA 3UMGA 4AYTA 5BWNA 1GKIA 1XOIA 2QYSA 3JQEA 1AF7A 2DH6A 4KP7A 3W4JA 5KWEA 5LOVF 4JOCA 1C1DA 4IXNA 3NVAA 1QCYA 1TA4A 2CXSA 2F43B 5TT1A 4URVR 3BRWD 3VPDA 4LUCA 2AJLI 3JVEA 5D00A 4M0MA 3IJEB 1ODFA 2B5WA 2R4TA 2VT6A 1KBOA 2A88A 2OQ2A 2WJJA 2XUHA 3DGFC 4I46A 4LWQA 2GAIA 2HCBA 1COWD 2C8LA 2YOHA 2VWPA 4M1QA 5CTAA 4BZWA 1FVOA 1CYEA 5EXEA 2LUOA 3AY3A 4HLNA 4BASA 2GZ3A 3GZTB 1JQDA 2ACWA 4GLJA 1EJ6A 1NF9A 2FSHA 2Y1EA 2ZRGA 1FJGE 1Y5MA 1N75A 1C4KA 1ZNXA 5D3QA 2C9YA 3E9DA 4DIDA 1O94C 2VDWB 1TLTA 1AHNA 2EN4A 1QVRA 1U3GA 1I7NA 4RZ3A 3NAQA 3V00A 4O4JF 1REQB 3RVQA 3I5AA 1J24A 2G08A 2GT1A 1WOYA 4Y2UA 2I3ZA 2X9VA 3AXSA 4UZSA 4PYRA 4D7AA 1M2OA 3OD1A 1ZCJA 1A8QA 4OX9Y 4WACA 1Z6AA 2ECOA 2JD0A 2I65A 1QGOA 2L6MA 1PR5A 2H36X 3L43A 4MPRA 4TSKA 4WHMA 2O07A 1HDCA 1E7MA 1TRHA 2QM7A 2RDMA 2ZB2A 3MT8A 2Z3ZA 3NXKA 3ROMA 3TSAA 5KREA 5LD2C 1DCKA 1A50B 1FRVA 1XD8A 5FIUA 3VH4A 3GP3A 3DMHA 5CJ2A 3OPVA 3WOVA 1E4EA 1WHTB 2YINC 3OTOE 3EMVA 5TF4A 4DV2E 2YJTD 4ZDIA 2JY9A 1OFHA 4Q4JB 1LPOA 2OO5C 1QB8A 2FFHA 4ENVA 4GXRA 5H70A 2KMLA 1T0JB 3D3WB 4YTEA 1P0MA 1YE5A 3K0KA 3LY7A 2XYHA 4Y0AA 4RF4A 5ALOA 4J1TA 1EQUA 1WBJB 3QOFA 4L4YA 4EX7A 1QZXA 2JDID 1V2GA 3CX4A 2X0JA 3C24A 3DEKA 3OUUA 2ZRFA 3B2EA 1B8UA 3FYHA 4NNOA 4BEJA 5JSZB 3AM1A 3FNBA 4K6HA 1XT6A 1Z5PA 4M3NA 1H9AA 5FJIA 4UOQA 1XCMA 1YDMA 2J6HA 3PC2A 4PZZA 4B2YA 1VKOA 3ZIUA 2PBZA 2VRCA 4BGEA 4FM9A 4MUJA 3SC2B 4DJFC 1INLA 4Q9KA 5F1KA 5CLHA 3RF6A 3N8IA 4LHWA 3VOAA 1GUZA 3NT2A 3ZK8A 3HJGA 4EA6A 1MZPA 3MUNA 4FBGA 5FBVB 2C4NA 2P4SA 3OQIB 3P52A 3T0IA 4QBKA 2UZ1B 5ALHA 7MHTA 3ZVRA 1QB7A 4FMDF 1WB9A 2VRWA 1X7ZA 1CUZA 3HTXA 1MC8A 2ZVDA 3U16A 3QXXA 3ZK9A 5IU6A 4EVSA 2G5PA 1DBPA 2YTDA 3RKUA 1MG5A 5ERXA 1KJNA 2P6RA 1KYQA 1NU6A 3PNVA 4WUTA 5CNMA 4B3HA 1VBMA 1ZVVA 2EN3A 1SVMA 4ZT2A 3IP5A 3FAKA 4DAOA 1SU6A 4XDGA 3NIFB 2EBUA 3QEKA 5DI3B 2NUAB 1GPH1 4CIVA 4DILA 4F5WA 1TJYA 4FMCB 1CY2A 4D9MA 1QIMA 4LBZA 4BC1A 1Z0KA 2FGJA 4M0FA 3W8NA 4KACA 5FBRB 3W3AA 5EFZA 5KYWA 2NTEA 4FR2A 2OZEA 4TZ6A 5IAKA 1G3MA 1JEEA 4CEIA 2R8PA 3L4BC 3K5PA 2ATCA 3U49A 1PO7A 3VTFA 1QIDA 2AMYA 1BRTA 4RORA 1HE1C 1RQXA 1BBOA 3BHIA 4RDCA 1HOXA 3L7AA 3GLHA 1KBZA 4B84A 4HG2A 1XMOE 1B73A 2BR4A 3MTBA 4HO1X 1UZAA 4P3NA 2IHTA 4YJHB 1OA1A 3KSBC 2QN6A 4KDFA 2AFIA 4ZOAA 2C88A 4UOZA 2XRMA 4B46A 3WLQA 2REBA 1HNNA 2GBLA 1JEAA 3K6SB 3L8HA 1U2TA 2YN0A 3N87A 1DQPA 3KV3O 3QUBA 4GXQA 3HZZA 3AP2A 4U0KA 2OEPA 2GYUA 3EZLA 1QO0A 4L22A 5FADA 4I1VA 1BSVA 2ELYA 1WKCA 2WE7A 2X0IA 5L7WA 4L8GA 3S3TA 1O9BA 2DSYA 2WHRA 3AILA 2BKAA 2B0JA 1OXSC 4NRDA 2VXCA 3VRHA 4DC0A 4RCVA 4MHTA 1VI6A 1V8ZA 3UOWA 3HYLA 4PYJA 1TF2A 4BCDA 2X7HA 3OHPA 2FMTA 3TAXA 1BCRA 4FR5A 4KWTA 4HDKB 4QASA 2EMYA 1U0HC 1F0YA 2QKYA 1FLVA 3CB2A 3K8ZA 3WLOA 5ICGA 3ETJA 5A3JA 3R3VA 3V48A 1WCIB 2IUEA 5AKEA 4CLRB 3Q9SA 2HDWA 4IW3B 3NEAA 3LUPA 5LLQA 1JVNA 2NAFA 3FIUA 1JHDA 3JU3A 5HIJA 1PIWA 2MMGA 5LNK1 3CURA 4JQYA 3K53A 5IKEA 2ZUDA 3O2QB 4D9CA 2VBCA 3CLVA 3RADC 3TN7A 2I67A 6ADHA 3FSJX 3WIOA 3CLTC 3QK7A 4RU1A 4W5TA 5CAEB 3DQPA 3R3JA 2WJZB 4AVYA 1XP5A 3N2GA 4LQCA 2OLJA 1XA0A 2XHZA 4TT3D 3W6UA 1ARZA 2CF6A 4A0HA 2OGSA 1E0KA 4UREA 1D7OA 5K0LA 3G0GA 1UXJA 2ELZA 4FFPA 1LQTA 1NQVA 4JYAE 4LMAA 3MWLA 4N3CA 2OK7A 4ETNA 3EQ8A 5C37A 3R0VA 3IIEA 3QV1A 5KJCA 2JFPA 1X9IA 1O7JA 1Y9EA 3C4BA 1BQ4A 3Q87B 4YN3A 4ACBA 1OIWA 1DIBA 3QEBZ 4PQYA 3DFZA 1C8VB 2JI9A 4NG5A 5A4IS 3EAGA 5HGXA 1GZ4A 2WG1A 5C51B 3H13A 5DLEA 5HUJA 3PEWA 2NV0A 1JBQA 1SK8A 3DW3X 5HJ2A 3NETA 4KW7A 2IEDA 3QRWA 1Q77A 5ES3A 1VG9B 3TXAA 1Z83A 2B6HA 3AESB 5E6SA 1ZMRA 2F8MA 2O4CA 2WM2A 3N2LA 5AI4A 1GN8A 1L5SA 4Z8XA 5BSKA 4DV4E 2GETA 4R2EA 1KVQA 2AOUB 4EI2A 5LSAA 2DGDA 2IPNA 1HT3A 3BH7A 3GY0A 4QRDA 5BOSA 5KYTA 1KK2A 4NF2A 1N1GA 5IDQA 3PENA 4QBTA 1N2XA 1V11B 2V8BA 1CUHA 4OXRA 5DHSA 4DKXA 3C74A 2NU6A 1OFTA 1OB2A 3LUCA 2I13A 2CK3D 2R5WA 2W7TA 5KNBD 2P40A 3Q12A 1ZW1A 2CNBA 3AKCA 3W5UA 3OE7A 1FP4B 1VHTA 2FG5A 3KJZA 2B21A 3IV6A 3LIIA 2BGRA 3M1YA 1M7BA 1YUIA 2AHOA 3UK0A 4UTOA 4JI1E 1FDRA 4P33A 4BV2A 3ENKA 4EGQA 2Z9DA 4URWR 3WK9A 2NSYA 1W88A 1P2VA 5FEUA 4NAHA 4M7WA 2XZLA 5C7YA 4JK3A 4C2UA 1OT3A 4HADA 3G8AA 3ET4A 3KYJB 3WVNA 2XAUA 1AZTA 3SR0A 3OA0A 2V7EA 1RHRA 4WNIA 5DTMA 5KWSA 5HKBA 5CW1A 2AXQA 2CWWA 2P9HA 4U63A 3UXMA 3Q7SA 1I7PA 3WP1B 2NO6A 3P0JA 2LBPA 2QL9A 2IV3A 1NA5A 1RC0A 1WVIA 3RUCA 1BEEA 4TUYB 2DBZA 3LBHA 3PFCA 1A4IA 2QF7A 3I6MA 1ITZA 1A5AB 1WXDA 3B89A 4TS1A 1KI8A 1YDEA 2XDQB 3ESZA 1NW8A 3AF0A 3MRTA 2LV2A 5C18A 5ILQA 2RGNC 1W4LA 3H86A 5ESDA 1O97C 1L4KA 1L8AA 4G8BA 3MT7A 3REGA 4TKVA 2DYKA 1WBDA 1M6YA 4IIYA 4IIVA 4IXDA 4K2HA 1SHKA 3PGJA 3ZBTA 1T4CA 3FOCA 3EPHA 1FNNA 3MPOA 2HV9A 4KDRA 2OYSA 2BTEA 4YCCA 4R2WA 4D3ZA 3UHAA 1I9CA 4H6WA 4TWIA 1K68A 3HVKA 1VLJA 2UUAE 4GE0A 2DQSA 3EVBA 3QWBA 4CT4B 1M34B 4IUYA 3BGDA 2JJ1A 1GPMA 3VR4H 4MUXA 1BDHA 4BYMA 3A1SA 5E95A 3RFTA 2ORYA 1MAVA 1IBME 1Z08A 5KL3A 2YRWA 3DLIA 4G4SP 4I08A 4YONB 3NIWA 1NXTA 3DEZA 1LPPA 4YQEA 4I2VA 3FMIA 3SFVA 4GX5A 3ILXA 4JHLA 1Z06A 4LQLA 5HEKA 4DMIA 2Q6OA 3H6KA 4U6NA 5FBZA 5KQRA 2G9RA 2R47A 3WGOA 3V1LA 1EFRA 3RYFB 1XD2B 3D6MA 4YRKA 1HQYE 1JIJA 2EBWA 3G2KA 4KQMA 1RZ3A 4EO4A 5CA1B 5JO0A 3AB7A 4DSNA 2LWIA 3MTJA 2R2GA 1YUBA 5DJ5A 1UC9A 1CJKC 5JS2A 3GH3A 3ZE8A 5JXIA 4AS1A 2WT4A 1JFSA 3CN9A 1OWMA 2O6LA 2YUIA 4R1OA 4RO0A 3SZGA 3KBOA 1W44A 2Q6IA 3M7IA 4WN3A 2R68A 5CB6A 3ZE2B 2CVHA 3OP1A 2WUGA 3JD3A 3QM1A 1JQEA 4OYHA 2RAVA 4QUJA 1V35A 4KMRA 4QRHA 4P53A 1XF1A 2YVQA 4YA6A 3QF7A 4PLTA 4ZHQB 4JD5A 3GGOA 4FEEA 2ZRHA 5IC6A 1Z8DA 3RS9A 1Z62A 3EIHA 3G0BA 5C1BA 1IB0A 2JFXA 2HCRA 2V59A 1CF4A 1HI9A 1R5OA 4MW0A 5D8DA 3U7QA 4Z4GA 3HBMA 4OI0A 2BV3A 4QDOA 1VFNA 1EUQA 2YYAA 5FJJA 1N3GA 3NHFA 3WHPA 3TRKA 1QU3A 1T25A 3OPXA 3GEHA 4ZO6A 4Z99A 3UAZA 4E21A 2VBFA 2FGKA 4WXMA 1FBNA 1Y1RA 2WIGA 3QVWA 4IX1A 5TGTA 4QUIA 2BM0A 5HKAA 1JJFA 1N6NA 1WMDA 2PUDA 2PPLA 4F3RA 3I5XA 2EG5A 3GVCA 3WNDA 4EZIA 1SHZA 1Y8RB 2XVYA 1OXTA 1U2DA 1WW2A 4OOEA 3WQBA 1NNLA 2F3RA 4ZALA 5LA6B 2CXOA 4N76A 1D0VA 1ZC3A 4IDEA 5J5AA 4DEVA 4IGFA 4GPIB 2GJ9A 3QFSA 5DWDA 1GTJ1 3OLZA 2AR9A 3R5TA 4F91B 3ZI7A 3WY9A 1GEGA 5CT5A 2ZBGA 2MINB 2RAUA 1YJBA 2V5UA 4LXUA 4RTNA 3IPXA 2GJAA 2XXJA 3QPBA 4Y0VA 4H6XA 1ZHHA 5BQPA 1TKCA 4RJ2A 4A8JC 4ND7A 1UBGA 3O3CA 1SBYA 5C5IA 3RSCA 8ABPA 2ZBVA 2H0RA 3ASUA 2PAAA 4L8YA 2L92A 4UNIA 5JYBA 5KOJA 3ZFTA 3EGEA 3MEQA 4K6OA 1NI4B 3MUFA 4CU2A 1CBUA 3I52A 5C8VA 1C1HA 4U7TB 3PU6A 1C3XA 1WM1A 3IPAA 3HCOA 4ETIA 3HCWA 2BAGA 1L4UA 2QRLA 1IWBB 2VDLB 3A26A 5B12A 2JIZA 1ODTC 4PGAA 3GFVA 3HHPA 3CWQA 4C7OB 2EJUA 3TR6A 4WZZA 4MA4A 1OX4B 3OD5A 2WVGA 4U7WA 1E7RA 4WLVA 5BVGB 3K0AB 3J7Yp 1AQ6A 4HSEA 2R1FA 5DCLA 5B3KA 3JALB 4LZAA 4UNNA 2Q0SA 3JZIA 4XOIA 3TEJA 4DC9A 2D7CA 4ZKDA 1E79D 1E1LA 3OWOA 2HBZA 1ZOPA 4G24A 1XLVA 2BZSA 4TM7A 2EPNA 5EIHA 5AW9A 4ASUD 3QVKA 3U4QA 1VCNA 2VP2A 2YHIA 1B1CA 1D7AA 3UH0A 1CB0A 3TSCA 3HDJA 5FFNA 1UEJA 4CHTA 2IS6A 2QRHA 1MRZA 4F2JC 3AR6A 1FX1A 4MRSA 1HRKA 1FSPA 3RAPR 4YRAA 3RASA 3KKZA 4JC0A 3SF0A 1Q0LA 3GJQA 4ZDWA 1Y9ZA 3OTGA 1IIRA 2QUJA 3ZD7A 2YNMD 3B1FA 3FXAA 4GXNA 4H15A 5INTA 5JZVA 3GJSA 5LZ2A 1UDXA 2BTQA 3UT6A 2HSGA 5HRUA 4WK2B 2DB2A 5FPYA 3TLCA 2ZJFA 3S2EA 3TM5A 1FDSA 1R3UA 3JQAD 1IWOA 5JZOA 1TKRA 3T9FA 4ZCTA 4YDQA 1W47A 4RPHA 3FF1A 3HU5A 1JDBB 4QJ3A 2ACKA 4OL0A 2EPZA 1YKFA 2H48A 2VSNA 3IDOA 4AUMA 5AKLA 4JP1A 4DMCA 1TZMA 5EXXA 2ZREA 3O3OB 4URZR 2RAPA 2XB4A 3IUPA 3O4FA 3K70C 1VYTA 1ISMA 2NXNA 2PFSA 2J7KA 1NVVR 5A5FA 3UBTA 1DFGA 1XKQA 1Q3TA 3M6MD 1T5TA 1T2AA 3A2LA 3BVPA 3F6PA 2VG8A 4W9NA 1RWNA 4Y1EA 2CFRA 2PBFA 4GU5A 4KIWA 3B5IA 3B1KA 3W3AH 2VDRB 1UOPA 1Y34E 3VI3B 4BMZA 2ZKLA 3T54A 2FZVA 2QL6A 4P84A 4UHCA 5SZKB 5JS7A 3GFPA 4FKBA 2IU4A 2N75A 2DULA 3NAZA 1E3WA 4W5QA 1UBOS 4NBSA 4JL8A 4M0UA 3ANTA 2PE5A 1JAXA 1PHRA 1O6ZA 1UT6A 1T2DA 4DV1E 1DBWA 1ZCBA 1OGJA 2CMDA 2IPMA 1TQ2A 3HUDA 4JA2A 5LZ7A 1YRWA 3M6IA 4UM9D 3ZTYA 1YZNA 3GJ0A 4Z4HA 4GECA 4GLOA 3ZWVA 3V55A 4KJXA 1E3IA 1LV8A 1CEQA 2C5EA 2Z4TA 1A88A 1KZ1A 4LYGA 1RI1A 3UZUA 3SFTA 1EFVB 1IY9A 1I2DA 1PFUA 2E82A 2IEBA 2N42A 1P5JA 4MV7A 1KY2A 3O4HA 4REQA 4J16A 4O63O 1A5ZA 1HE4A 5DHFA 4ZHSA 1AK1A 3BGVA 3F9IA 3QV2A 4OFBA 2G4LA 1H94A 3RI3A 4B34A 5F9FA 1YUMA 2CJWB 1SRQA 2WAOA 5EMKA 5ILGA 4MMZB 1UM8A 1G42A 3H9QA 3MAJA 3Q8XB 4EEZA 4RVCA 1HV8A 4CLOA 5AK5A 3WHIA 2PK3A 3KKKA 4JLUA 3BB4A 2GNOA 3B12A 3KDAA 3R7WA 1J0BA 2SBTA 1YWGO 1GPUA 4BVFA 2V83A 5KHLB 5EZSA 5BNFA 2ZAMA 4L8LA 3FMOB 4R41A 4AJPA 2FAXA 1PT5A 2QHXA 4K3UA 4KN5A 4GPD1 5K6TA 3HUEA 3KSDO 1A7AA 4TOIA 3P2IA 5EC8A 1KF0A 2AG8A 3FWNA 5JMTA 4ZVLA 1STOA 1L1EA 2YIDA 2XF2A 2AD1A 2ODTX 3G5AA 4GH5A 3NX4A 4RK7A 4JB2A 3R7AA 1HYGA 4BFLA 5KB3A 2DPGA 2HMSA 2P5UA 4XUEA 1GRVA 3JVUA 4AJJA 2IIVA 4OSOA 2BEUB 1DL5A 2AQIA 5BR7A 1A98A 1JB1A 1K3TA 3OF3A 1YU9A 2PT5A 2FDRA 1US8B 1PVDA 1SG6A 1I5OA 1NV8A 1QHHA 1U65A 4DOMA 1TQ6A 3EARA 4IUDS 3PX2A 3E9CA 4LW8A 1NUPA 5KQSA 4A3SA 3CCFA 3JQBA 4RELA 3EEBA 4F5ZA 1X6VA 3I58A 1WKBA 4AKHA 2C2YA 3MSWA 2ZDGA 3EVFA 2Z5GA 4ESHA 2PMWB 2QTCA 5CX4A 5CYPA 4EEKA 2AR0A 1KP2A 3ZV3A 4B6OA 4DR6B 3ICPA 1JIXA 2P6NA 1BEZA 3K0HA 4OQXA 2VHEA 5CM9C 5THKA 3TTTA 1J0XO 4RZSA 1DBVO 4YQZA 5KSOA 2AX4A 3OOYA 3VTAA 1S2NA 1FRFS 2ZIFA 4K1XA 2EZTA 1IQSA 1AM4D 1JU9A 4ONEA 2NSHA 4QYMA 4AJ2A 1BS1A 5C53B 1IBKE 2PUWA 1XZLA 4MUHA 4O0LA 2Q49A 4CLXA 2QP3A 4RY2A 4ZXFA 3ZDQA 2H11A 4WYQB 3DF6A 3QXGA 3AF5A 4JJ6A 3IO5A 3OCWA 3B53X 4O25A 2EM4A 4MJ7A 4ERXA 1L7XA 4REMA 3WTCA 3PCXA 3OIGA 4C78A 2YASA 1JVSA 3ZU4A 5BN3B 5AJTA 5JADA 2RHHA 4X65B 3LX5A 2BUAA 1Q22A 2EOQA 2YTFA 4KFTA 3IIMA 3F78A 3K0FA 1M1NA 5IK2D 2W2LA 3KLBA 4K9NA 5L3QB 5IJ0B 4EITA 2QL7A 3NDJA 3TCKA 4B76A 4FKMA 3G8YA 3ZGNA 1YQGA 3KK0A 1KKUA 5A6VA 2W83A 1M2WA 2AEJA 1Y81A 4L08A 4BFSA 2EQBA 3B1JA 4BBAA 1H4QA 4KXQA 2GBGA 3BT7A 3HSKA 1Y80A 5AM0A 1DXQA 2IKSA 3TTVA 1CIJA 4BO9A 3DONA 5EZQA 5DYTA 5F2EA 3QIVA 3K70D 1CR1A 2FR8C 2QVBA 3ASZA 3LBYA 1M9NA 1IBRA 4A27A 3V7NA 2W6JA 4S1PA 3OE1A 2B7CA 3R7FA 2CXPA 3VYTB 4DLKA 5A5EA 2YZTA 2EOYA 3H75A 3D43A 4Q3KA 4ZZ2A 1ULSA 3ACBA 2JFVA 4NV3A 5G0SA 1QC5A 3QPDA 1J9EA 4EYSA 4AO6A 1RXIA 1KE2A 1KH3A 3NBQA 3P0IA 4S24A 2PLWA 4DCMA 1QGUA 1WUTA 4UU0A 4G0ZA 2LGJA 1TU3A 3E9NA 4URFA 5KKAA 4AY5A 3I0MA 4RIFA 8MHTA 1AVTA 2P30A 3P9KA 2Z3WA 4UMVA 3SMVA 5C8DA 1MB2A 2AWOA 1ENOA 4YUVA 4HMOA 4R5MA 5ETJA 2HGHA 3DV0B 1VLZA 3OZVA 3A6DA 2Q3MA 1P0QA 1X6HA 1A9YA 1QTIA 5AOCA 2EHDA 1WSWA 3OIDA 2RB4A 3LPAA 3RYCA 3L00A 2HHCA 1F0PA 3FPGA 3KJGA 3M1LA 2G9ZA 2YXBA 2J0QA 1H6DA 2EOJA 3R3ZA 4CTJA 4RHYA 3SZLA 3UV7A 1TIKA 5CK4A 3TIFA 1M8PA 4HKTA 3OPNA 3KVOA 5GOTA 4JDUA 1YVEI 1KAGA 1EVIA 3I2HA 4I55F 4NOKA 1BH2A 2HQRA 2PHZA 4JJFA 2R8YA 4RY0A 4DLZA 2IY7A 1KEEB 1Z0SA 3NALA 1Y6GA 1YOBA 4XYEA 3C4JA 4ZI5A 1Y9JA 1SXQA 1A9QA 3IOBA 4U7HA 2X0EA 3DL7A 1TO2E 1YS2X 4G0YA 1QOQB 4LJ5A 1BOFA 4ZMSA 5KYYB 3AERB 5FORA 1ZESA 1M2EA 3GBVA 4XE5A 2CCGA 1UCFA 5G0UA 5BSFA 1UMCB 5TGZA 3JD4A 2BDEA 2Q1UA 2AJDA 1OTXA 2WHPB 3QPCA 5IYZB 1TNDA 1RXCA 3X2FA 2A5DA 3QKWA 2PN1A 1PU2A 3X2SA 1U0EA 3CH6A 2YRKA 4RTMA 1ZAYA 1QJ4A 2M6KA 3P27A 1XUOA 1ZMXA 4NCXA 2LO3A 2EMBA 3TXXA 3EQ6A 5EVJA 4DLXA 3TPFA 3ZOZA 1SCQA 4F2HA 2PZLA 1JR3E 1M1YB 4HGZA 1GSAA 4NFYA 2J59A 4H60A 4M9RA 2D1FA 3UO8B 1NBEA 3I6ZA 3NOOA 2QUBA 3I72A 4CCSA 3DE1X 2LNDA 3WWZA 1EUDB 3SQWA 4HAIA 4Z2AA 4GM4A 1H2WA 5GZ6A 1KK3A 3C5VA 3LUJA 1P91A 1U2RA 4MP8A 4IDBA 3LQFA 4YAEA 4Q1EA 5EPOA 5AUOB 3U4QB 4RNCA 1ZD1A 3IIIA 1CUIA 5AW1A 4JFAA 1JBKA 5K8TA 1QU2A 4FW9A 4HHEA 3CXRA 4QG3A 2R1UA 1CDDA 3AEQB 2XVMA 4LGYA 4OXNA 3ZWBA 1F7UA 3G1TA 5HUQA 2FEOA 1FNCA 3CN7A 3CMCO 5DWVA 4JBWA 2E49A 4Y6PA 2ARKA 3DJWA 2ZM5A 5JDIA 4JLVA 3LPCA 3WIUA 3JS5A 1MOZA 1OV4A 2XNCA 4FN4A 1X7WA 1RP7A 1T6XA 1P8AA 2QRJA 5GZ3A 3IB3A 2YPNA 5AOAA 1YJAA 2AFIE 5E2BA 4NS1A 3IPLA 4ZYGA 5AH0A 2LTSA 3WYFA 1ADYA 2VPPA 1G3IA 2YWHA 4I6EA 2QNIA 3NFYA 4G0NA 5EYPB 1G38A 2QW8A 3OZSA 3ZNOA 1EFDN 3LFUA 3LY9A 1TMYA 4ICIA 1ZUNB 1M5RA 3C98A 1R1DA 1PQWA 1RR6A 3VDXA 2WFMA 4M0DA 3T7DA 3BJRA 4BWFB 3Q5GA 2YTQA 1IZ7A 1CJTC 3I2JA 2Q62A 3HXKA 3KYDB 2C3MA 2TMKA 1RZUA 4IEIA 4EOGA 2Z2XA 3QHQA 4UBKA 3Q7TA 5TGDA 4DVGA 4UUQA 3ZWYA 3JTEA 3I01A 3ZHOA 3DOIA 3OFSA 4M6WB 4X3CA 3QELB 5EMMA 2AGVA 2AKEA 2VUTA 2ZUUA 4G2TA 1TZBA 4D6PA 1YB2A 2IOFK 1TLLA 1PZGA 2OXIA 3W0LB 3LFTA 2CVFA 5LXTB 3AY0A 3OT4A 4W6QA 3H8SA 3RNLA 2WJ6A 1CUEA 3CVOA 3LF1A 3O3MB 2HPVA 4M46A 1DLJA 4MGKR 4DR4B 1PCXA 4BS9A 1KZ9A 1FJXA 1M73E 1WZEA 3Q85A 3ZE0B 2DCUA 2EMZA 4QT0A 3HN2A 4O0MA 1KRXA 3EG9A 1E18A 2EQ0A 3UVEA 2FK8A 5H83A 1I80A 3VVMA 1PI3A 3KVRA 4C7MA 2I1VB 4RH8A 1IEVA 3BFJA 1DHRA 1CQPA 4UXIA 3TTYA 4BE9A 4Z3OA 4GI3A 3A31A 3RHFA 1M8GA 5AKHA 3IBCA 2LT7A 3BD9A 4IMPA 3DLHA 1FYFA 2LXNA 4H31A 4R2HA 5DNUA 1TLFA 2CLHB 1QRSA 5DNWA 2E9SA 2HRRA 4JIGA 3GZ4A 4KPGA 3T3EA 3E22B 3SOZA 5KJ6A 1Z34A 2X9LA 2ET6A 4LDRA 2C5LA 3RVPA 2AEFA 3TSWA 4OKIA 1T4MA 1FFSA 2LV8A 2WAMA 5LBIA 5EKTA 3RYHB 3NJ4A 1KQFA 1R0BA 5AWFC 2YW9A 5EE9A 3EQZA 2OQVA 1Z4LA 3FDFA 3PJFA 3QBTA 1ISIA 2RGAA 1FDTA 4ZQFA 4E0BA 3LUFA 1IN4A 1I9GA 3DO8A 3WRVA 2EYUA 2JKZA 1UANA 3MGKA 4E5NA 1L7NA 4RPGA 1NBHA 1NX9A 2IYNA 5ALWA 4JCCA 2C4VA 4R9NA 3T38A 1GKKA 1GTMA 5JSUA 1AZWA 2EDAA 4GDFA 4JL6A 4F96A 1T91A 3SYTA 5JQWA 3DHNA 5C4IA 4N5IX 5F3RA 5M5BA 4WFJA 1Q12A 5C7IO 3CUVA 1WHQA 3N75A 1GUFA 1Z4MA 2OFWA 3CNNA 2IYZA 4KQGA 5FUYA 4BLVA 1XKLA 3PYXA 4WZAE 1Z7YA 2IK8A 1GEEA 3ZLUA 1T3ZA 3B5JA 3MJSA 2CE2X 1SULA 4YCMA 1QORA 5BV1A 1OA0A 2UUBE 2QVXX 4M1MA 3A28A 3NMUF 2XWPA 2H2GA 3OEHD 1ZJZA 3H2GA 3ND5A 1BE8A 2AMFA 2ZSIA 2ZYAA 1NOIA 3ONEA 3JSXA 1WXIA 3A36A 3F67A 2P2NA 3W05A 1N2CE 1U1GA 4A1OA 5BV7A 4LF8B 4Y1GA 4J0EA 3UIEA 2IIPA 2GEVA 1ONOA 3ICQB 1TYCA 3IODA 4QQ8A 4LOJA 4M9XA 3EQ9A 1NKVA 2D2XA 5EPUA 2Q45A 2C82A 2QSZA 2R4UA 1E9BA 1ZZEA 1C7EA 4WEOA 1KBQA 3BWYA 3CZCA 1DO8A 3IOYA 5DTIA 3VJMA 1C8KA 2CLSA 2JAPA 3E1SA 2VSQA 5EIEA 5E9JA 3COZA 3U81A 1R0WA 4GBJA 3T4XA 2Q99A 5AKGA 5ALLA 1Z63A 2ZUFA 4CVNA 4B4UA 2RIRA 1RLOA 1SXJE 1HYBA 2B9EA 2CCJA 1VE1A 2W4QA 4OK6A 4UTZA 2C9BA 1V1MA 4ZAVA 3A27A 1D04A 1SVOA 4DQXA 4RSRA 1Z39A 4ZT4A 3L4KA 4Q3BA 2PUVA 1XMQE 1U28C 4OXIA 4C3OB 4NZPA 2A0KA 3K8QA 1HKHA 4CTKA 2ZJ5A 1DNPA 4UDYX 3MMNA 2GRAA 1T8UA 4FP9A 2VJKA 2HIHA 1QLJA 1FYWA 1MUUA 2FJPA 3OTIA 1YIAA 1Q1NA 3PC7A 3JD1A 3BJMA 3IS3A 3LW7A 3IV9A 4FSXA 3ML1A 4ESEA 1OLXA 3QWAA 5T6MA 2G7HA 4OHKA 3KOXA 5EZ6B 4H7JA 2GBFA 4E88A 1FTWA 2D59A 4RNDB 5AW3A 4GWKA 2REQB 1M6NA 1AH2A 3D7SA 2FVXA 3NIGB 3BORA 4V0MA 3RC9A 4EJSC 5CFZA 2FE1A 1RRPA 1Z5UA 4P7FA 2SICE 1QF9A 5AVQA 4AXXA 2RGWA 2JJ8A 3K9FC 2RHBA 2ECQA 3JARB 5JWRA 1EA7A 4KE8A 3CO0S 5EJIA 1H1DA 1T1JA 3KJQA 5BXYA 1MPTA 4HH4A 1CZHA 3BYZA 1QVAA 3M89A 1QO7A 3BHNA 4GYWA 4MKZA 4QBGB 4HLQB 4D9GA 2NU8A 2RFLA 4L1KA 1Q7GA 4CKBB 2IHUA 3GJ4A 1NVBA 1HNXB 3CRW1 4JJGA 2V54A 3FKSD 1IBCA 3IRVA 4TL8A 2JCVA 3AJ8A 2CBGA 1X6EA 1N9GA 2ERYA 3SJUA 4PRZA 1H8EA 4LRUA 4KPFC 2XBUA 1P7WA 3LV8A 2ZI3A 3RSSA 3WRYC 4RQUA 3K0CC 1JP7A 4IIXA 1ONBA 2GK3A 4WE3A 2CXQA 1L5YA 3LLUA 4V39A 1BE1A 1PE0A 1TJ5A 3RJZA 4ITVA 3UHFA 2OXCA 4C29A 5JISA 4WH0A 2QY6A 4KXUA 3UY4A 1EMDA 2X2EA 3BK1A 3UJCA 4M8IA 3JCZA 2HJVA 3ON5A 2B5OA 4RC9A 1UZUA 4M53A 2C5GA 3GCGA 5KKNB 4G0VA 4JI0B 2X5NA 4G09A 5TJHA 1MXFA 3M81A 2EFCB 4PZYA 4PYNA 5HS6A 3RIEA 1X80B 3VVCA 5CEFA 1F6BA 2XDAA 4R54A 1AK2A 2JHAA 2VF2A 1KZ4A 3EGVA 2OHHA 3PIIA 2VHXA 2VP3A 2ZQYA 3PK0A 4BAGA 4R1QA 1AUQA 4CMCA 4O2AF 1BJTA 2QGFA 4MKGA 1S4MA 2VDWA 4V1CB 4HB3A 4MYRA 3DZGA 5IULC 4C08A 4RZXA 3VZDA 4DIEA 5IP5A 3EVZA 2TRSB 2P3QA 1REQA 4AIIA 1X0VA 1XQVA 3IXQA 1DADA 1E0DA 4JI5E 2VYVD 2H7CA 4PN3A 2V97A 4CLEA 2BJHA 3NDPA 5AHKA 4CRWB 3ZWCA 3VH2A 2H8KA 5CBPB 1T5SA 1PKXA 1UBLS 2J48A 2VQ6A 3UT5A 3SVTA 1WJPA 1UILA 1U6IA 1NQXA 1CNFA 1XX6A 1Z26A 4JCOA 4RENA 4Z3DA 3KR0A 3F90A 3SZRA 4CG3A 4NCBA 4NC9A 3BPSA 5I47A 2OM2A 4BY9E 2H0AA 2EGHA 2EL9A 2H5JA 3PXXA 4FSHA 2XUGA 1XDBA 4MTCA 1WHTA 3WV4A 2I4IA 1F17A 4DG5A 4QKQA 2WW8A 4NYJR 4Q4JA 3DAYA 5A9RA 3N07A 2Q3EA 2XOEA 3ZGZA 2X6TA 3D3WA