3C6MA

Crystal structure of human spermine synthase in complex with spermine and 5-methylthioadenosine
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
361
structure length
336
Chain Sequence
SRHSTLDFMLGDGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYDSILNKVEERMKELSVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human spermine synthase: implications of substrate binding and catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Spermine synthase
total genus 104
structure length 336
sequence length 361
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.22: Spermine synthase.
pdb deposition date 2008-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
A PF17950 SpmSyn_N S-adenosylmethionine decarboxylase N -terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 3c6mA02
3.30.160.110 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Siroheme synthase; domain 2 3c6mA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3c6mA03
3P97A 1R8XA 2P7HA 3KPJA 3KQTA 1EAMA 1JG4A 2VDWA 4HC4A 2OBFA 3EMDA 1YF3A 4YV2A 2AN4A 3M6VA 5CVDA 5LQRA 2NP6A 3MCZA 3R6TA 3UJDA 2NP7A 1NW6A 2YXDA 3M6WA 1RI4A 2QM3A 5DPMA 3GRZA 5KQRA 1IM8A 1FP2A 3EPPA 4CTKA 3SVZA 2EJUA 4DCMA 3ERCA 4PYLA 2YVLA 2AOUB 3EVFA 3HA7A 3TR6A 3ME5A 3OU7A 4OBXA 5HILA 5HOQA 1P1BA 3G5LA 2JG3A 2WK1A 5B1SA 1N7JA 3SGLA 4RVDA 3TKYA 3MGGA 2I9KA 4E2YA 5F2OA 3LBYA 2VS1A 1R6AA 2GLUA 2PT6A 4XUDA 3EVBA 3T7TA 3LDUA 1XDZA 2CMHA 2F8LA 1O54A 4OBWA 4RTLA 5EMMA 4V0QA 2PXAA 3M6UA 4RWZA 2O06A 1JG2A 2IBTA 2ZWVA 5BW5A 4PONA 3SSMA 4DCGA 5E1DA 3CJRA 3DMHA 3LECA 2UYHA 5F2NA 4QQKA 5ICEA 1G8AA 3PFGA 1KIAA 5IKMA 4R05A 3T7SA 1ZG3A 3NDIA 4OX9Y 4RTQA 5K09A 1P1CA 4X60A 2FCAA 2O05A 2VP3A 5HEKA 3R3HA 3IHTA 4RTMA 3HCEA 4PYJA 3G88A 3HCAA 1PJZA 5DX0A 2AS0A 2P3LA 5M5BA 3OFKA 3FTCA 1L3BA 3G2QA 3G2MA 4RTKA 3UFBA 1AQIA 2P3OA 3GXOA 5C1IA 1AV6A 4C07A 1JQEA 3SSOA 1FJXA 3LGAA 4U7PB 1I1NA 2IDKA 3E8SA 5ERGB 3A26A 1XXLA 5DXAA 1KYZA 3FPGA 3NMUF 1DL5A 3QV2A 2CMGA 1PJQA 4KIFA 5FA8A 3REOA 5LQUA 1RI5A 3LCCA 1ZGJA 3IYLW 4YUVA 3EEOA 4RTOA 2P35A 3CJTA 2BR3A 3M4XA 2BR5A 3PX3A 2O07A 1P91A 1VBFA 3DP7A 3KU1A 5FQNA 3BZBA 1R74A 3OFJA 3QOXA 2ZVJA 1NW5A 4QPPA 1JTEA 2XYRA 1M6YA 3BWYA 4XUCA 1G38A 5EKXA 1MJFA 5EVJA 1G55A 9MHTA 1XDSA 3BXOA 3LBFA 3P9NA 3PVCA 3GRVA 5GIOE 4IV8A 3MQ2A 1BC5A 3DLCA 3E7PA 3EVZA 3UJCA 1D2GA 3U81A 2GA9A 2H00A 3OU2A 5BP7A 5F2KA 4RVHA 5DSXA 1VP3A 2QRVA 3BKXA 3E05A 3MCTA 3V8VA 4CWAA 4ER7A 3O4FA 4P7JA 3KPVA 5EQJB 5E1BA 5FWAA 3BKWA 2ONYA 1ZHFA 4QQNA 2BZGA 3DLIA 2QE6A 3HP7A 2YQZA 1Z3CA 2XYVA 3B5IA 3C0KA 2GB4A 3GWZA 2R6ZA 1SKMA 4DA4A 3I9FA 1PJSA 3X0DA 5ICGA 3NVMB 2OXTA 3G2PA 3IV6A 2PXXA 5C0OE 3GU3A 2I7CA 4EKGA 4F85A 5K05A 3HTXA 5DX8A 3A7EA 3NVKI 3LKZA 2AOUA 2PKWA 4YV1A 1N7IA 4E2ZA 5JR3A 1UIRA 2VDUE 2Z6UA 3AY0A 4AZSA 5EEHA 1RI3A 1G8SA 2ERCA 3MTIA 4PCAA 1SQGA 2AR0A 2K4MA 2PX4A 3HM2A 3NTVA 2FHPA 1QAQA 2NXJA 2N47A 1JSZA 1L9KA 2ORED 3TQSA 3UWPA 5K0BA 2PBFA 7MHTA 4B17A 2ZFUA 3KR9A 3QOWA 4GEKA 1VQ1A 3I5UA 5HIIA 4E2XA 2BH2A 5DTQA 1XVAA 3BWBA 3FRHA 2EG5A 1OR8A 2UYOA 3LCUA 3Q87B 2HWKA 1ZQ9A 3DUWA 4PWYA 4EQZA 1EG2A 2AOTB 3SX0A 3BGVA 3C6KA 3FUXA 3FYDA 3P8ZA 5K0GA 3GJYA 3KR2A 1QAMA 5EIFA 5GOZA 4OA8A 4RTJA 1WG8A 3IEIA 4FSDA 2OPBA 2P8JA 3TKAA 2Z6AA 5LSAA 4DM3A 3JWGA 3OE4A 2VDVE 5K0CA 3DULA 4C03A 4PINA 4RTPA 1X1BA 2OKCA 4YUYA 1IXKA 2OZVA 3HNRA 5FTWA 2VZ9A 4F86A 3KQOA 2C7OA 4X63A 4XUEA 4G56A 5C9ZA 1X19A 2IP2A 1KYQA 1JG1A 1JTFA 1SUIA 3CVOA 2ZIGA 3UA3A 5D1NA 5DRTA 4X61A 1KR5A 1AQJA 2Y1WA 2ZIFA 3HCCA 3KPWA 5EEGA 1EIZA 1WXWA 2KW5A 4FT2A 1TW2A 1VP9A 3GNLA 1SQFA 2DULA 4FZVA 3TMAA 3TPZA 4C4AA 1X1DA 5EG5A 3UJBA 2Q41A 4MTLA 4QVKA 3EGIA 1XCLA 2AVNA 3HVJA 5HIMA 3ANXA 3AJDA 1YZ3A 2LD4A 2B3TA 3BWMA 3CBGA 3B89A 2I62A 3KPUA 3PFHA 3TFWA 3GCZA 3EVGA 5DM1A 1ZKDA 4ER5A 3DOUA 4GOMD 4AUKA 4MQ4A 4AZWA 5DWQA 5K03A 3TM5A 5KQSA 4HGYA 1FP1D 5CD1A 1FPQA 2B78A 3KPYA 2ADMA 4QVGA 1B42A 4YUZA 2ZBQA 3FPHA 3CC8A 2ZCJA 3M70A 1BOOA 5DT2A 2UYQA 4LG1A 4HGZA 2ESRA 3LX6A 2JH8A 3O7WA 4HH4A 3WSTA 3KQPA 3PB3A 3EVAA 2P7IA 3A25A 1R00A 2YXEA 1JQ3A 1VPTA 2IGTA 3KQQA 1BKYA 1PRYA 3G8AA 5CVEA 2ZZKA 3FZGA 2QRVB 3HA3A 3NJRA 5E8JA 5GM1A 2Z6QA 1VIDA 3UJAA 2AOWA 4C06A 2PJDA 3FPEA 1QYRA 3UBTA 4PIPA 1JSXA 4M7RA 4EKIA 3G8BA 4GBED 4ISCA 3JWHA 3P9IA 5EIWA 4KRGA 5LQCA 2WA1A 3C3YA 5H02A 2ZZMA 1YUBA 1RJDA 3P9CA 2HNKA 1WY7A 2BM9A 1EQAA 5CVJA 2GAFA 3EGEA 4MHTA 3BWCA 4E31A 3BGDA 2IH4A 3P71T 5K0EA 3G7UA 3VYWA 3SMQA 1QANA 5CIYA 1JG3A 5EPEA 1QZZA 3AWIA 5E2AA 1RJFA 4R6XA 5DX1A 2AN5A 4RSRA 4FT4A 3UJ7A 3R24A 3HVHA 1D2CA 3HVIA 5K0JA 3ID6C 2YXLA 2A14A 3DXYA 4MIKA 4CTJA 3F4KA 2E5WA 3KKZA 3AXTA 3S68A 3VC1A 4Y30A 1RJEA 4E30A 3UA4A 4OA5A 2G72A 4YV0A 4C05A 4CXMA 2I6GA 3LL7A 4GC9A 5EHIA 5LQAA 2C7RA 1XTPA 5E1OA 4GF5A 4R6WA 4KVZA 5FHQA 4A6EA 3KR1A 4QTUB 5BW4A 5GIPE 3OPNA 2H11A 3P2KA 1VE3A 5GP1A 3ER8A 3TOSA 3DMGA 5CVUA 1L1EA 3CGGA 1NW3A 5FCDA 2QYOA 2CKDA 4UOEA 3TM4A 3ELUA 5KS2A 2PV0A 2O57A 2PWYA 2O0LA 3H2BA 2PT9A 3BGIA 2IDJA 4P58A 4DKJA 1M6EX 3CJQA 1YZHA 3B3GA 5CM2Z 5E9QA 2AVDA 4PYIA 4DQ0A 4BP1A 4PYQA 5GINE 2B2CA 1F38A 2EJTA 5BXYA 2Y1XA 5E8RA 4EVIA 3P9KA 4HTFB 3DXXA 3LSTA 5EZSA 2IH2A 3HCDA 3PX2A 3EVEA 5LQNA 2UYCA 3OZTA 5HIJA 3PLAE 4CKBA 1HNNA 1P39A 2ZLBA 4RVFA 3OZRA 4CKCA 3MAGA 4IWNA 5IH3A 2PX2A 3DXZA 1R18A 3SM3A 4IKPA 1KYWA 4U7TB 4FP9A 1Q0TA 2ONZA 4PYOA 2AOTA 4POOA 1L3IA 3OU6A 4V0RA 2OYRA 4MWZA 1KPIA 2DPMA 4AZVA 3R0QA 5EMJA 4ATNA 3RIEA 2G70A 2EFJA 3DMFA 3HVKA 3SR4A 1KPHA 4E70A 5EGSA 3HCBA 2JHPA 3UJ9A 4HG2A 3GGDA 3LKDA 5EOVA 4ER3A 5CCBA 3CKKA 3KQSA 2G1PA 4H0NA 3ELDA 3GO4A 5KVAA 2PSSA 2C7PA 3B3JA 3NW9A 5DLYA 2ZBRA 3KQYA 3Q7EA 2ZIEA 2AOXA 3LHDA 2V7EA 2XVAA 2G71A 4FGZA 2GPYA 5T6BA 3LCVB 4P7GA 3FUUA 4GOND 2B25A 1F3LA 2QY6A 1NW8A 3FUTA 3VSEA 4O29A 2IH5A 4M37A 4R8RA 3KQVA 2IFTA 3TLJA 1D2HA 4FR0A 2AOVA 4XCXA 4ER6A 5P8WA 2HV9A 5LQJA 3KHKA 3R9XB 3O31A 2UZ4A 2BM8A 2ZZNA 1AF7A 2IBSA 2AZTA 1WXXA 2R3SA 4EK9A 2NXNA 5D1HA 3OZSA 3I58A 3KQMA 5LR6A 2EX4A 3UJ6A 5K0FA 1BHJA 4E32A 4PCLA 1EJ0A 5FQOA 3LDGA 1XCJA 2PVCA 3NDJA 3OCJA 2PLWA 3BT7A 4AX8A 4YUWA 4HSGA 4HRAA 4PYKA 2BR4A 3UJ8A 5GWXA 1INLA 3A7DA 4WXHA 5CUQA 1SVUA 3I64A 1SUSA 1MHTA 1EJ6A 5DM4A 2FYTA 4Z2YA 3D2LA 4LECA 4M38A 3T7RA 5DRYA 4C04A 3EMBA 3FTEA 1XDUA 3TRKA 3GRRA 4L7VA 3GIWA 1SG9A 4F84A 2HR1A 1TW3A 4PYNA 2XYQA 1NW7A 3FRIA 4RX1A 5E1MA 4FSXA 3GRYA 5CVVA 1KHHA 3BUSA 4P7FA 4QDJA 2CL5A 1NBIA 5EZQA 2PX5A 3PS9A 1UWVA 5HZMA 1I4WA 4QTTB 4BLVA 3ELYA 2GS9A 2JH9A 3E23A 4K6MA 3RODA 2PX8A 1QAOA 1ZGAA 2OY0A 5DM0A 5G02A 2NXCA 4RTSA 10MHA 1YFLA 3A27A 3G89A 4RTRA 1PJTA 4JXJA 3ER9A 1G6Q1 2P1DA 3C3PA 5DTMA 5EKUA 1NV8A 2P40A 5GM2A 3T0IA 3MHTA 4BLUA 1G60A 5U4XA 1KP9A 5ICCA 4GQBA 3EGVA 3CCFA 4P7KA 2FRXA 3ELWA 5ICFA 3THRA 1YFJA 1FBNA 1KXZA 1KPGA 4KWCA 3MTEA 5EC8A 5MHTA 4YMHA 2JHAA 1NV9A 1M0EA 4IV0A 4ZTBA 4RVGA 5E9WA 1O9HA 1RJGA 1VL5A 2ZULA 5EHGA 4GOOD 2PXCA 1ORIA 3RW9A 3PTAA 4CKEA 1V39A 3KQWA 4LWPA 4WVLA 4GOLD 1JQDA 2FK7A 3FTDA 5E2BA 1T43A 3V97A 4GC5A 2PGXA 1H1DA 1R8YA 1L3CA 2NXEA 1IY9A 1N2XA 1NT2A 1TPYA 1X1AA 2G8NA 3FPJA 1RI1A 3FUWA 1HMYA 3P2EA 4QPNA 2XVMA 1I9GA 2FPOA 4A6DA 4HTFA 3M6XA 2GH1A 8MHTA 5K0NA 3FPFA 4Y2HA 4PIMA 3HCFA 5DM2A 4GUAA 5DXJA 4AZTA 2FK8A 2PY6A 5FADA 2YTZA 2IIPA 4X41A 1O9GA 4BP3A 5K0LA 3VC2A 1XJ5A 1RI2A 1ORHA 2WA2A 5FWDA 4QDKA 4PYMA 4ER0A 2B9EA 3EEYA 3K6RA 2PWPA 2P41A 3M33A 3EVCA 2NNWB 3LDFA 5FUBA 5T64A 2ZW9A 4X1OA 4PNEA 3UZUA 1NKVA 1NBHA 1X1CA 2V74B 4KDRA 3OE5A 2JJQA 2H1RA 3ORHA 4E2WA 2HMYB 4DMGA 4C08A 3G5TA 3LPMA 4BLWA 1U2ZA 3C6MA 1WS6A 1JR4A 2JHCA 4EMSA 4YMGA 3FTFA 1DCTA 2NYUA 5EMKA 4E33A 5CCXA 1WZNA 4DZRA 2ZTHA 4NECA 3L8DA 4KW7A 2IPXA 3HA5A 5FA5A 3AXSA 5T67A 3NWEA 5JUWA 1VLMA 3G2OA 3P2IA 4KIGA 4PGHA 2OB2A 5LQKA 3THSA 2ZSUA 3FUVA 2AN3A 2C7QA 1NE2A 3KR0A 4M36A 5DTRA 5HIKA 4KDCA 3MERA 3DH0A 3GRUA 2CWWA 3B7PA 5FHRA 3DR5A 3JWJA 3EVDA 3PT9A 3SSNA 1Y8CA 5K01A 3I53A 1DUSA 4OQDA 5DSTA 2OO3A 3MB5A 4RTNA 3K0BA 4FS8A 4YUXA 3JWIA 3NWBA 3SXJA 1Q0SA 3FYCA 1UFKA 2YUIA 2ZBPA 3DTNA 3B3FA 4RV9A 4RYLA 1YB2A 2ZWAA 2XBMA 2P3QA 5KYGA 4R8SA 5E9JA 4PGGA 5FULA 2HTEA 5HFJA 5K8VA 2YR0A 4BY9E 3HEMA 4LWOA 4DF3A 4OQEA 2OB1A 2YX1A 3A4TA 5EMLA 3GDHA
chains in the Genus database with same CATH superfamily
1X7ZB 2V9ZA 5EP3A 5CH5A 3EWAA 1QGUB 2VHXA 1GZ7A 1TA9A 4CCYA 1ZVJA 4MHSA 1L7RA 3E7XA 4B85A 3WYBA 2FG7C 4LJKA 4OP3A 3T7IA 4CKWB 1EFAA 1KI9A 3HJUA 3SVZA 3W77A 5JARA 3E5HA 4Q3AA 3KEFA 5L95A 3VKGA 2QAGB 2ZRJA 1N6KA 1N1DA 3KQHA 3B36A 3W05A 1B6RA 1RYFA 4NLLA 3EA4A 3OJ0A 4RVDA 1RHUA 4AECA 3IIKA 5AXDA 2GCGA 4NV1A 1J9EA 1Y1KE 3L01A 2HPZA 3PPYA 2Z8YM 2GLUA 2X7HA 4MSUA 2YWDA 4GI7A 1VGVA 2GK6A 4FWBA 2RHCA 1KJ8A 1OT5A 4Z4CA 1NKSA 1ZVVA 3QFHA 1J0EA 3QPCA 4P08A 1YKSA 1WUHS 1JFVA 1Z7BA 4RWZA 1GP2A 3VJLA 4DCGA 3OIVA 2CYBA 2VXCA 3AJ8A 4JWTA 4EEZA 3C7KA 1HYGA 2EQAA 1EM8B 2GEVA 2I2CA 5TGZA 3T7SA 2I6TA 4BEJA 1PVOA 4B8YA 4TGLA 5GONF 3PXGA 2ZWMA 4AKTA 3HB4X 2JFBA 3SQLA 3IHTA 2AA3A 3OJFA 3UWOA 1O0SA 3K5WA 2Q4BA 4R54A 4BFLA 2W4MA 1JHQA 4AMZA 3FTCA 3KYJB 3PP8A 3QJYA 4MGIR 1C9KA 4WCFB 4EZEA 5DU2A 1EG7A 1JL3A 1QH0A 3TCNA 3U40A 4KQEA 3T4PA 2LZ0A 4HY3A 4JKOA 3LBNA 3U49A 4CMAA 4RDXA 2H06A 1TK2A 1RRGA 3IKTA 2CNKA 2IDKA 3F98A 2JS7A 5DGCA 3FMVA 2IPLA 3L1VA 3PUYA 3VDQA 1U7TA 4U8GA 1WXIA 1LVUA 2WD8A 1IIRA 5DN9A 4KIFA 3F74A 4JASB 1RAIA 1Q16A 2JP9A 3NTRA 3OHMA 1AV7A 3JYHA 4FFRA 5B7PA 3HU2A 1JBQA 4YJ3A 2BR3A 3MRSA 5EHNA 4F9CB 3I0MA 3U7IA 1TKAA 3R09A 5J58A 2HUPA 5FQNA 3BZBA 1R74A 1YZFA 3C15C 3DSRA 4GHWA 3STWA 5AJUA 2WP8J 3BFPA 4A82A 1TUBA 4URXR 3USES 1QDUA 4JDUA 2ZB7A 1CUEA 2UV8A 1DXHA 4KVFA 4Q3BA 3U0VA 3U4DA 4HJRA 5L3QA 2E7ZA 4M0CA 4B3RE 1TFRA 2ZTLA 3C3WA 4XLZA 4QREA 3SC4A 1QTQA 5H4GA 5C5EA 3R3VA 4C6TA 1A2QA 2UUOA 3AESB 2YIMA 1J1IA 4FK8A 5TJHA 5BP7A 4JI1E 2QKYA 5DSXA 3D59A 3BJIC 2ZYUX 2UXDB 1AKEA 5CXQA 4BCBA 4NBRA 5FOVA 4TMXA 1DAPA 4ZCQA 1LB1B 3BKWA 3OZGA 1V47A 5EIXA 1YWGO 5B1YA 1NX6A 2BZGA 1DKUA 2I67A 2V98A 5LCXA 1AHHA 1Z3CA 3C0KA 1JFFB 1P1JA 4YALA 3ZIUA 1SM4A 1DELA 3H2YA 4ZC1A 5ICGA 2CVPA 4P84A 1YNSA 4QEZA 1SEPA 3OF5A 4G0UA 5HM8A 2PXXA 2M4IA 2C2XA 5C0OE 3V33A 5KVCA 3W5AA 4LVCA 5HQJA 1FP7A 3GI1A 3QW2A 4JB3A 3GR6A 2PKWA 4YV1A 2WSSA 1A9RA 5KZMB 1R4MA 2VDUE 5CFMA 1O7JA 1RI3A 3QKIA 2CSHA 4B4OA 3CE6A 1L8QA 2BMWA 1ZGHA 2PUVA 3KXKA 4J7UA 4U6NA 2YN0A 1GUYA 1YHNA 4D4JA 3DOHA 1IQSA 4A8JA 3CH5A 3KDAA 1DFGA 4NMHA 2VPQA 3LVBA 1AT1A 1JDNA 1TDJA 2JVJA 2P91A 1G4UR 3T3DA 1YQQA 3DUWA 4BIMA 5F7ZA 4QT4A 1J97A 3DAPA 3QPAA 3HCPA 1YK1A 1GTG1 4RW0A 3K6KA 3V1YA 5K0GA 5CNKA 1OAAA 2Q1WA 3AI7A 2IY7A 1DTWB 2BGRA 1ZVMA 4NJOA 4MLPA 1F2UB 2OXIA 1H3EA 2BJWA 1UQUA 3CM0A 3OHPA 3ASZA 1GGVA 2XUKA 2D06A 2ZDGA 1XROA 3L6RA 3R41A 3TRDA 2ZSAA 4DLTA 1XNQB 1D9XA 3EXFB 4HVLA 1GPWB 1GKUB 1M1YE 4CN9A 3H8VA 2C2OA 3J80A 4PWZA 1KBOA 3AHFA 3ADGA 3ICOA 1K3TA 3ZE8A 2C7OA 3Q0EA 1GPH1 2HLDD 4TVKA 4DY4A 5HHTA 2QXUA 2X14A 7MDHA 1NJ8A 3V4PB 1WEKA 2AFIB 1Y3FE 4WSPA 1SUIA 2C5SA 1DQPA 2OV8A 2WJGA 4DCNA 4UVHA 1IBME 1W29A 2FY8A 4KMSA 1HTTA 4LRQA 2PNJA 3UCXA 3IAFA 1LRJA 1OSNA 2D8AA 1EIZA 2JI6A 3N28A 4MR7B 4Q34A 5AHWA 3ZE2B 2XXAA 2QJOA 1D0VA 1GL3A 3D6JA 3QSGA 4EW6A 3PCXA 3TRIA 2NU9B 1GCAA 3SG0A 5LL6R 4FYIA 2C9CA 4H7KA 4LF4E 4KJZA 3BWMA 3KPUA 3PHHA 3B89A 2VNSA 3TTTA 1J09A 1NC1A 2AMFA 3K2BA 3EULA 3OPQA 4P5PA 1TFUA 3OLCX 3UV7A 1VFNA 3WGLA 2OO7A 3IR6A 3ZG6A 1J21A 2EFHB 4IP0A 1DAIA 3UHPA 4AZWA 3VJRA 3BIJA 1TVCA 2ZPAA 3DBOB 3N8KA 4HMPA 1WW3A 4D9CA 4F6NA 3Q3CA 3WMRA 4EW2A 3ILHA 3NOOA 4RANA 4O59O 2G0NA 4XQ9A 4L5JA 4F5YA 1MLDA 1DTEA 1AO0A 1BOOA 3LNCA 1H5NA 3PUKA 2ZJZA 3VR5D 3TW8B 3MCAA 4HT3B 2PL5A 2Z2JA 1FBTA 4OXNA 4AY6A 3W79A 3TD9A 3WSTA 3QEJA 4BL5A 5CA1F 1A1IA 2ZTUA 3KQPA 3PB3A 1T8SA 4BVFA 1J8FA 4OJQA 1B15A 2D5AA 1M6VB 3T1HB 1G0OA 4X97A 3OLYA 3WRXC 3L8FA 3WBKA 1R15A 3A1EA 1PRYA 3AOEC 5CVEA 2FJUA 5JCZA 3LF1A 4FOPA 2OESA 5J1SB 3IQGX 4K6OA 4LPSA 5DTIA 2NYRA 1JDZA 4ALJA 3IP3A 4LJ9A 4RM2A 4D6XA 5D3MB 4MEBA 4G25A 4QGFA 5EQDA 1CVRA 4ZYHA 1CQIA 2PGLA 4J0FA 4KRXA 3IIIA 1MOSA 4J1TA 4MQ5A 4WLEA 1NMSA 4J1QA 4ZQIA 2ZRBA 3NEJA 4A3SA 4DSUA 3T3NA 4DBZA 2QTWB 4TV8B 1T5SA 1WY7A 5ALEA 2OUKA 3CPSA 2XZDA 1ZD4A 1K66A 3TAXA 1QG4A 2CZQA 1E3JA 2GCOB 2L2QA 2JIQA 2JARA 2QVZX 3H42B 3KHTA 4FFWA 1PX0A 2JW5A 4PV7A 3Q98A 2MSWA 2P4HX 1VBNA 3LV8A 3R0VA 4BLOA 2HF7A 4DV7B 3L4KA 4JBYA 1UR5A 4M9UA 4NABA 3BHMA 4FT4A 3UJ7A 1EWVA 3V7YA 4DE5A 3USZA 1NDHA 3ZCQA 3EZFA 2AQKA 3D8UA 1C9YA 2IYZA 2OQIA 4XPIA 1QE0A 4JSTA 1EVZA 1TL7C 5B1DA 3PR2B 3DJWA 2VRBA 4KQ9A 3HWX1 1YDMA 4MUBA 1JQBA 3AI1A 1MEYC 4LXHA 4N8DA 1OAKA 1FTQA 3F6BX 3PNOA 4K26A 5JS8A 5JWRA 2NU8A 2J3MA 1HBJA 2FWBA 1UOPA 4JXXA 4G1UC 1JW9B 2JKZA 1IXSB 4E46A 2A59A 5GZ1A 3QEMA 4KPUB 1N2IA 1SJ9A 2XOKA 4L15A 4B3GA 1GEEA 1GTSA 4XGIA 4BO0A 4HVCA 3H5OA 3UB2A 1IBRA 3OCCA 3AP3A 5SZJA 4MV7A 1YAHA 4PY2A 3B6ZA 2C5EA 2F4NA 3H5LA 1ECCA 4UOEA 3SIRA 1XZGA 2O57A 1CY1A 2HNBA 4IJKA 3QQ5A 4AY4A 4E1BA 5BMVF 5A5EA 4CW7A 1YQ9A 4DKJA 2FMFA 5CM2Z 2WYVA 1A9TA 4ROSA 3IP5A 3EC2A 4K8RB 4B34A 4KRFA 1N8NA 3GUZA 3IUPA 4BTVA 4RLSA 1K7EB 1W19A 1MGTA 3P9KA 4N6GA 4V0OA 5DV9A 5T4FA 3ANTA 3CLTD 1CRPA 1THGA 4IJWA 4ZKDA 1Z6ZA 4BHTA 2FCRA 4KVGA 4AQYE 5IXMB 5F5LA 3RTEA 3CFYA 1S3GA 1YONA 3RSHA 2R2AA 5K3SA 2F3RA 4IRXA 1Z45A 4BV8A 4GYJA 3EQ8A 1Q0TA 1V8DA 3ZFUA 5KJFA 3MCVA 4RFLA 2PGJA 2G4CA 2EL7A 2Q46A 2VHUA 3A1WA 2O2IA 4U02A 3LLHA 3WB1A 4QYTA 4QYWA 3F6RA 1KJNA 2JLWA 1XNGA 3HVKA 3FVWA 3O4RA 5HWSA 2BKLA 2XCIA 2GZRA 3BL5A 4CM1A 4ECEA 4FFPA 4XSGA 1H3FA 4M53A 2QIPA 1Y7TA 4I4CA 5JEDA 1K98A 4CTNA 3KSZO 4F1KA 2WKSA 4GM1A 4OJKA 3BXZA 4FGZA 4GWGA 4GXTA 3A0RB 3PNPA 2FWPA 5FOSA 3ADCA 2I6FA 2AX3A 2QLNA 4OO3A 5EJ7A 1QTNA 2FR0A 1BCSB 1NYRA 2HH9A 3C8MA 2R76A 4JC5A 4F6CA 3B1WA 3NBMA 1U5BB 2CHUA 1HSOA 1XXHA 1IHUA 1WSDA 1YH3A 4K6FA 3D64A 1QHXA 2AI3A 2VI5A 2X7JA 3EFOB 3W78A 4DIBA 1DKMA 1PLKA 3Q7QA 4QD3A 5I6DA 2XY4A 1JDVA 1GIAA 4KGZA 5EIBC 3U3XA 5FXMA 3LSYA 4DCPA 1G17A 4R2QA 2A9VA 4JVLA 4LHWA 3F9CA 4ZDIA 1S2OA 2EEPA 2V5UA 4FR5A 4ZAWA 5IUKC 1W2GA 1QNTA 1U8CB 4DRXA 1RYHA 2JC3A 1WXFA 3THXA 2ETVA 4QYIA 1FDTA 2FZVA 3PSHA 1B3RA 4OJYA 4PQGA 1U3FA 5TVKA 5CFPA 4LRXA 1GRCA 5CFOA 2HJSA 4XH9B 1QG0A 2CL6X 2X2PA 3HY6A 1FNMA 3ECAA 3P0IA 4S0ZA 4RHBB 4WKGA 4XYGA 2X4IA 4G36A 3UG6A 3H9UA 2AV6A 3UF0A 4H7HA 1QF6A 1CYEA 3IKLA 3O1IC 2BBSA 3GJTA 5H7XA 4PSDA 5DM4A 6ADHA 1X70A 1U28C 2QTMA 4QASA 2VP4A 3LDHA 3OE1A 4R8VA 3CXRA 1NEIA 1RLUA 1U2GC 4LRTB 2JD2A 2YBEA 4RPLA 3QEMB 4Q9IA 4B0PA 3PI6A 4FR2A 1BWPA 1WSWA 2B8WA 2CNNA 3UYLA 1E1RA 3EDYA 4D9GA 1QIGA 1SUFA 2VQSA 4IZOA 1UKZA 4BO9A 2CGEA 3ZTTA 1U1CA 2WYHA 3UATA 3X1WA 1ZCJA 3NHPA 4K88A 1IN4A 4RZQA 1Q0QA 2PX5A 4TTTS 2WJZB 2H2IA 3VNQA 3QNUA 2UVDA 4BLVA 1WB4A 4NCAA 3CNBA 1ZGAA 1V2GA 1CERA 1CJTC 2FPPA 2NXCA 3B3QA 3M5PA 4GPIB 4LZNA 4B35A 1ZJYA 1QRRA 3VOSA 4CIXA 3UBMA 1IEQA 1EGHA 4DR1E 4YRMA 4JXJA 5DI3B 3F1KA 1FZTA 3MRTA 1M2FA 3RK4A 3R1IA 1LC3A 1NHWA 4QTZA 3OT1B 1P7WA 4I8XA 4QTYA 5B57C 1T0IA 3QX8A 1AUPA 1O4VA 3SC6A 2QBYB 4KN8A 2DE0X 4LW8A 3PUJA 3RS5A 1BAPA 2FW0A 2EAUA 4LVUA 2G40A 2CBGA 1NV9A 3Q6NA 1OTHA 3U13A 1IQOA 4UHCA 2WJWA 5DBGA 2ZULA 1J00A 5KYTA 2QRJA 2ACWA 2OMEA 1QHYA 4FGKA 3GH1A 2OZKA 4IFBA 2GM5A 4WNYA 5AHKA 3ZKWB 1AK1A 3FHTA 1M2VA 1C7QA 1PSWA 3CWCA 1ATZA 1UKBA 2OD9A 2YZTA 3FUWA 5ANRB 5B58T 3C39A 4UZEA 3BEDA 1MIOB 4AY5A 2DHQA 3BFXA 2EM7A 2P4SA 2EG9A 3A3OA 3HMQA 3L1IA 4A6DA 1OAOA 3ZCPA 1RZUA 4MV9A 3AR9A 1NASA 4PIMA 1V7PC 1V1JA 1RRMA 3BC1A 3IP1A 4GUAA 3GJ4A 2C29D 2HXGA 3MEQA 1TM5E 1ZD2P 3AZOA 3PXEA 5H9VA 4PW0A 2WVAA 2YTZA 4N0PA 4LSGA 3TGLA 3FNGA 4LDNA 1RI2A 1ZLYA 4N5MA 4OHRA 3L82B 3VR6H 2PYZA 1RRFA 4H17A 2V88A 2WDZA 1ICIA 4FQ5A 4RPJA 4Q24A 1JQKA 1XTJA 3RS9A 3KSBC 3WK6A 5FUBA 2JXPA 1WDWB 2AHOA 1S4QA 2YWHA 4H4EA 4RC9A 3D0RA 5CDUA 1P6QA 1NKVA 1MA3A 2A92A 2YHIB 1NVWQ 1E79A 2CLEB 2FX5A 3B9QA 3EEIA 4KDRA 4F2PA 1LI7A 1NR5A 1USWA 4E2WA 4QZVA 1U3UA 4JHXA 4LJLA 1ZC4A 3JY6A 2WW8A 1KIMA 5I7SA 3IQFA 1LX7A 2BSAA 1R66A 2EFEB 3HZOA 3IAS6 3LO5A 3ONVA 1C0PA 4MI9A 4WW0A 3VZCA 4OFBA 2A0XA 1FNDA 1UBRS 4E33A 4NXMB 1L4EA 4CIAA 2QVYX 2PR2A 2ZSJA 3TB6A 3OEWA 3NDPA 3OIGA 1MH1A 3PVSA 2HQOA 1FVHA 4GP6A 5AXCA 3SYLA 3Q41A 4KBFA 3UTCA 3ZTYA 5HP4A 1Q0LA 2ADRA 2P9BA 4U9IS 4EFDA 1FXSA 2I66A 2YV3A 2HB6A 3LY9A 2EMFA 1J8YF 3NXKA 4BX9A 4EB0A 5J5VA 4NFSA 3T94A 4TWBA 3DTVD 3EXG2 2XDYA 3QBJA 1F2UA 1F2TA 4E2FA 2XKKA 1PZMA 5BNFA 5U4QA 3MB5A 2FETA 4YP1A 3OTOE 4DUGD 1XQVA 1LDYA 2QPTA 2ZJBA 5FOXA 2VP2A 1DBRA 3F6HA 1BXGB 3C87A 1E7RA 2DJ5A 1U2SA 2H1IA 1AC5A 1JIIA 3FI0A 3QSYA 4GL2A 2EX0A 1Q74A 2AW3A 1RABA 2RS6A 3M9WA 1XMJA 4OQEA 1YR6A 3KU4A 2R1FA 1XLUA 3LUHA 4M4SA 3ZEIA 4WOJA 1Z29A 2PYIA 2VDWA 4A8JB 3EXHA 1JBKA 4FQ8A 4HDMB 5AVRA 4MJXA 5LL6P 1JFSA 1YJBA 3EWNA 4IIVA 2EN2A 1NW6A 2YXDA 3OFVA 4CF6A 3NANA 4ZVUA 1YO6A 2Z2KA 3PK0A 4KQ2A 4MYSA 2PV7A 2YVLA 1TTHA 3HA7A 1XFAA 3QUQA 4H7EA 3ZOKA 3O74A 2F3TA 4B46A 3JQDA 4TXJA 4ND4A 4PGAA 2O20A 3U7JA 4P34A 3TLEA 2HBQA 2X1VA 1Q2UA 3A4IA 2DR2A 1EXWA 2J9FB 5AJYA 1DX4A 2PT6A 3OKFA 5BMVA 4E51A 4EHHA 4RA6A 1A8UA 2Q1XA 2BB8A 1TA4A 4TTSA 5K6AC 3JQ9C 1GDHA 3VU1A 1LV7A 3O4HA 3KJGA 4LJ7A 4V2UA 4ZYLA 4PR3A 2JCSA 3VU3A 1ZHHA 1W46A 1SGWA 3C7CB 4HDRA 4N9WA 1QZ3A 2GJAA 3MFDA 4DA7A 1UDXA 1G7SA 4GEQB 4CL3A 4C6TB 5AVVA 5K09A 2FZWA 4X60A 4XX0A 4S3MA 1T5BA 3UAXA 5JSFA 4GEGA 3VBEA 2C0CA 2GRAA 4FPXA 4OOEA 3GLHB 3O8BA 4N0DA 5E95A 2AS0A 3OZXA 1JMKC 3V34A 1CC1S 4I5EA 4P35A 2EN1A 5C8XA 5EE0A 2WF9A 4QPDA 3W1EA 3K0FB 1DBWA 2OBBA 4MUNA 4AICA 5DGIA 1TCBA 5HJ2A 4D8XA 4P9NA 2YXPX 1ZCZA 2XQJA 2C54A 1D1PA 2NABA 4RZUA 2AK2A 4FJ0A 2NOAA 4JEIA 3LG2A 3TZHA 1GG8A 2ZR7A 1C4WA 4XIJA 2XCSB 1LI4A 1N7HA 1NAIA 1Z22A 3QUAA 1PTJC 3VTFA 2Q5CA 2ODTX 2QG4A 1SBQA 3AOEA 5BSFA 4QM7A 2IITA 4J7XA 2E48A 1JKIA 3T1QA 4CNBA 1PZGA 1XL0A 3DP7A 3CTMA 4LIPD 4YYEA 4XIFA 5BWBA 4EVRA 1I2BA 1WVGA 3LP5A 3VGJA 2QDXA 2YIVX 4EJSB 3LTNC 4BJHB 1XZ8A 1JILA 3E3MA 1G38A 1MJFA 4L6IA 3U3JA 2ZYGA 3V4LA 2AJLI 5HKAA 9MHTA 3LBFA 4MWDA 1JSCA 2LCIA 4U9UA 2OYCA 1OLUB 1HY3A 4IV8A 1AM4D 4NNPA 4HDRB 3UJCA 3DPUA 4QFBA 4AFNA 4BPRA 4MTCA 3PQ5A 3A1UA 4P80A 4EJ0A 1CJKC 4G65A 1B93A 1JZTA 4HNHA 4BDSA 4QBIA 2OQRA 1VP3A 3QRWA 2BFFB 4ZAFA 3KB8A 3CW8X 3H0CA 5JBIA 4G5RA 4ECAA 3N2KA 5I51A 2VHVA 3BK7A 2A25A 3OIUA 2XTJA 4G86A 2QU8A 2R7AA 4E11A 5JZVA 1NMYA 5FA6A 4DAOA 5LJIA 3R9XA 1Z4MA 2RKBA 1OLSB 2PUBA 2I8AA 1XB2A 2YQ5A 2AC2A 5LWHA 4GWLA 3GWZA 5E4FA 1G42A 2FE1A 2R1TB 1FFHA 2QMYA 1EFPA 2YJGA 1ZH0A 3RVPA 5EXPA 3EZ9A 3NVMB 1PD0A 1RJ9B 4JJ7A 3F47A 1JLHA 4QU5A 3KE8A 1ZM4A 1DIHA 2WWWA 4WXPA 2MSCB 3D7KA 5AOBA 5K0SA 1ZYUA 3BBGA 4C7OA 2Q5QA 3IVRA 3OCVA 5JD6A 1XPRA 3KEOA 4HDMA 1RWBA 4ZRDA 3R5JA 4NH0A 3KSRA 4TUIA 2NXJA 1JSZA 4GR9A 2LWIA 2VSFA 3RSQA 1I3OA 2ZFUA 4C78A 5CA1B 2G77B 4ZO4A 4E2XA 4ETNA 1ODTC 5DTQA 4UNNA 2IOHA 1XVAA 3IAEA 3UKJA 3AG5A 2ZIWB 3F5DA 3NHUA 1I5OA 1JR3D 1XZNA 1YIDA 2WOOA 3EFBA 1IFXA 4R9NA 1PK7A 3OOYA 4DDMA 2SBTA 4H31A 3HL4A 2QWXA 2PA0A 4A0GA 5JJBA 2FPIA 2Q62A 1NVFA 3OSUA 4JQSA 4EB6A 4G9GA 1X7YB 5EUQB 2R85A 5IJXA 4QECA 1JK1A 3T5BA 5GJCA 1NU8A 5IAKA 1EESA 2FZ5A 1NTOA 3R6WA 4IEIA 1Z88A 4KPFC 1X6FA 2DHEA 2O2EA 2PCLA 5I48A 4RTPA 1OGJA 1T4BA 2HA5A 1L4HA 3QLVC 1XD9A 3EZ6A 4C5CA 3HRIA 1AKYA 2JAWA 1KFKB 3HR7A 1RPZA 5BV7A 2JGRA 2XEDA 2ZVPX 4RDIA 2GEUA 2HX1A 4C05A 1QQ6A 4R8MA 4LF9B 3CF4A 2D4AA 2GBGA 4KYVA 3U7GA 5FV7A 4EG8A 1E0SA 2ZIFA 3I37X 1FXWA 2VK2A 3EFEA 1X3SA 4JY7A 4P5DA 4EGAA 3GNLA 1AVTA 3RVMA 3ZPXA 3I4CA 3F6GA 1EBBA 5LP6C 4MW7A 3OQ1A 3UWMA 1SOVA 5FDFA 3RC8A 4ZC8A 3TXXA 3ANXA 5AIAA 4QGBA 2XYGA 1KSFX 3BSFA 2V6JA 4I1RA 4LFAB 3DVAB 3GCWA 3QY9A 2FG5A 3V1NA 1RS0A 2IYNA 3E03A 3VNUA 4JI7B 3G3EA 2HU2A 3H2ZA 1FMCA 2N1BA 2VBIA 1Y7PA 2EBHX 4B45A 4PAQA 2YTFA 4QOEA 3NLLA 3RWOA 2MHCA 3MNFA 1NZJA 2O2ZA 1EVKA 3ZD7A 4AMUA 3UMGA 2VJMA 3PV0A 4QJBA 3ECSA 4IO0A 2P6UA 1O77A 4KN6A 1W44A 4PO9A 4IGKA 4UNPA 2JLUA 2EWWA 1JAIA 4DA0A 2B9DA 3K0AA 4TTQA 4EMUA 4F3YA 1SBYA 1TD1A 1XWWA 1Y3CE 3FCEA 1U0JA 5LU8A 3TZLA 1EP3B 4P81A 3I42A 2OGTA 5LP6A 2ZP1A 3BIOA 3CRRA 3V6MA 3N6VA 1TQ6A 2PUDA 1QX3A 2QW0X 3UHFA 4DANA 1JG7A 3E35A 1ZUWA 1I0ZA 5EWLB 1EUCA 1GTRA 3LW7A 3MJ4A 1ATIA 5JAQA 1CQWA 1KQ3A 2EIXA 1Z2CA 1OBVA 3QF7A 1RWKA 1WDTA 1PGPA 1KTVA 2IHVA 3AV0A 1WTAA 3IMCA 2FZ4A 3J7TA 3FDZA 1NVDA 4OYRA 1OFVA 4Z4QA 1OGYA 1EI9A 2Q21A 4YT8A 2WWIA 1RRVA 5C4GB 1B0ZA 1ISHA 4KIWA 2NN3C 2QEQA 3FSGD 1PNVA 3H87A 4RF4A 1DC5A 3SMQA 2P2CA 4Q3DA 2AMVA 1UJ5A 2YY6A 2BFMA 2EMYA 4L0CA 1ZC3A 4RVCA 2OGWA 3WOHA 5BW6B 2DR3A 4HPJB 2C96A 2A8YA 5ALQA 4G0ZA 2J9GA 3H3JA 1AS3A 4D8UA 3HU1A 2EOYA 5I3CA 1QIDA 3L7OA 4YDSA 4ASUD 3ZH2A 4MZDA 3WWEA 2IE0A 1G21E 1W0KA 3CSUA 3ID6C 2XDQA 1A9SA 2BWJA 3BMOA 5CLFA 4M0UA 3C43A 5K8CA 3CGWA 5IYZF 3BTVA 1G3UA 2QOEA 2HYIC 1ZSNA 1A9YA 2CLOB 1NQTA 1X94A 4Q4JA 4YV0A 1NJGA 1S2NA 3CEMA 4BQFA 4RGVA 3FPSA 3HCRA 4OXRA 2AEEA 2HBYA 3O03A 1RXIA 1I7PA 2FWMX 2VQ6A 4TWZA 4UBKA 2Q1TA 1EAYA 3KCQA 3PQ8A 3AQ4A 3RUCA 3RSOA 2X8BA 3AW8A 2PRSA 2D0PB 4HXEB 4QU9A 3MQ4A 1PJBA 5LZ7A 4ENRA 1YVRA 1WUTA 2QL5A 3W5JA 1KI1A 4EDFA 4FXPA 4ZQEA 5JXJA 1NXVA 3TM4A 4XR9A 2AR7A 2HREA 2UDPA 2LE2A 1L8XA 3AQIA 1FYWA 1GR1A 2I6SA 3QUBA 1UM9B 1Y1QA 1QYIA 3SVLA 2HWXA 4XIYA 4KUHA 1O0WA 5ALJA 4YQZA 2CSUA 2F9LA 3ONEA 5EE5B 2R25B 3BIXA 1L5MA 1K63A 2BGIA 1ECPA 1NI3A 1RAGA 1HE4A 1VKJA 1EUZA 2IUSA 2O48X 3QUCA 4TSRA 5AW3A 3E58A 3EVEA 1OI4A 5E2IA 3FIGA 5AE3A 3OZTA 1BFDA 3GGSA 1H0KA 2ADFA 3KB6A 3L9WA 3SKVA 2B8TA 1WOYA 3ND9A 3AK4A 5EXDA 5F23A 4GMFA 4ZYYA 3V1KA 3GMSA 3ZGNA 1MO2A 4PPQA 5CA0A 2EIHA 4TLMB 1X1RA 2QI9C 4NONA 2P9EA 4V0SA 2ZRLA 3UXEA 1A2BA 4DLBA 5AW2A 3H2KA 3HSYA 5IH7A 2WIFA 2JBHA 2R6R1 1CG6A 3I8OA 4BNGA 1XCMA 3S44A 1A9XB 4OFXA 3GGDA 3LKDA 4IGFA 4KN5A 2WYIA 2X1HA 3UPUA 1YA8A 2J3HA 3Q7EA 2WIGA 4J0HA 2VKQA 1X9IA 4GRDA 2YKGA 4R3WA 1DS6A 1EH8A 4LDJA 4P7GA 2E4UA 3HVUA 4B40A 1VCMA 1ECJA 4L4XA 3AUSA 1R27A 2GQ0A 2Q9BA 4X94A 4JFAA 4FOTA 3TGWA 3TTYA 4GDFA 4LF5E 2HZ7A 4TMTA 3GQBA 1BMFD 1GITA 4GE3A 4NE2A 4QGGA 4TUYA 4K81B 5DW0A 1HNWB 2Y0PA 1PQYA 1AUVA 1Z37A 4ALIA 1WMSA 4H9GA 4UMEA 1I3NA 3N39C 3BA6A 5D1HA 1VIVA 4R1QA 2GKOA 2H0RA 4FONA 4E13A 2IHNA 1HETA 4KH1A 1X48A 4UUPA 1QGOA 1AK9A 5F21A 3HU3A 2PUCA 4JLOA 4C4XA 3OCJA 3BDVA 3JZMA 4JFRA 1WNFA 2GN1A 2BR4A 2EKPA 4RAOA 1Y6FA 3O6VA 1TIPA 3GXBA 2YV4A 2HO5A 1QWOA 3QVVA 4MUKA 4W82A 1YU6A 5IKOA 3BD9A 2YMQA 3B78A 2FYTA 1BU8A 4C04A 3WICA 3L40A 1YB1A 5IG2A 1M34B 3OZUA 2XNSA 1D5WA 1M83A 3CEAA 4JUFA 4E88A 1NONA 1LNQA 4IZHA 1X86B 4JVOA 2AXPA 4NIMA 4U6SA 4D41A 1IVNA 4JJ8A 4B1FA 2MSKA 3DFUA 2IXAA 3P9XA 3BFJA 5JYDA 1J2RA 1OREA 2D13A 2Z95A 1OQAA 1FS6A 4XB6B 2EPOA 5HCNA 1YUIA 1N92A 3HDTA 3AOGA 2OHJA 2X58A 3EIFA 1IHDA 4F8YA 1UADA 4FLFA 3RODA 5ALVA 4JI0B 1E1LA 4JZKA 1Q17A 3ZNNA 4KPYA 1E7SA 4FHFA 2PYDA 2VLBA 5T4HA 1EUQA 3HO1A 4NU6A 1Z12A 4TYNA 4KO1S 2ZG6A 4INZA 2QJFA 1QSGA 2ZSKA 3KUXA 3TNDA 1YTUA 3ESCA 2XGGA 4MUIA 3TZEA 3W5BA 4UEQA 3BTUA 4ZOLA 2DHRA 2X3FA 5G1OA 1L1RA 1O95C 2BGUA 1CQZA 1KJWA 3REFA 1Z36A 3ZWWA 3JVIA 4CEHA 2JIMA 5LXTA 2CJWB 2JH3A 3HKDA 2H7CA 5BYBA 3ZE0B 1RZRA 3N6RA 5EC8A 2I4LA 4XQCA 3Q5GA 3DOEA 2EN7A 1IRIA 2VF1A 2DUNA 4Y67A 3ZGOA 5MN4A 1P61B 4IV0A 2GOYA 2OOKA 4O5GA 1HV8A 3SVTA 8ADHA 3WDLA 4ADSG 4NOLA 1UIMA 2JAOA 2FRVA 5ALMA 5EHGA 3NIGB 5C53B 4GOOD 1Y1PA 1VE5A 2V03A 4GYKA 4B6SA 1PTJA 2FK7A 4Q7EA 2HSZA 4GC5A 2OM2A 3N74A 2DKOA 3NHFA 1JMYA 3LBHA 1WZCA 2QLTA 3AKYA 3AERB 3AI2A 3P2EA 4M22A 5HOEA 4RTOA 4DV2B 1RWWA 3IA7A 4C01A 4XR4A 3CPEA 4X3OA 5ITZA 3AV0B 4CIVA 1F7VA 2FGKA 3KWFA 3VR2D 2IEBA 1NVMB 3M4YA 5FWYA 2D8MA 4LYYA 4DPMA 5FUMA 2EPRA 4R3UC 2Y93A 3VNAA 5FADA 5EI5A 1NP6A 1YRQA 2ATVA 5EJ6A 1ZK3A 2POCA 1ZNYA 1C2TA 221PA 2VDPB 1NN3A 3DPIA 5HXAA 3T3OA 4FW8A 2QMHA 3BVPA 4BE7B 4CM5A 3CNNA 4MYRA 1WAMA 4HTAA 4EW3A 1U8YA 4FI3F 4Q3EA 4IUBS 1VPDA 1XJ0A 5A1JA 5BN1A 4KO2S 3UZUA 4K6KA 2CNBA 3OF3A 2HA3A 2R97A 5FB3A 1YR2A 1P73A 2H1RA 2IHJA 3M6IA 2NVUB 1MC1A 1RZVA 1U2QA 2K6GA 3BE8A 1Z8FA 3NV9A 1NBME 1UF9A 2E21A 4MRMB 3NR2A 1DZIA 3QXHA 4YMGA 1OFIA 5IHPA 3UUWA 2LTSA 4M98A 4CR7A 1FYDA 4DZRA 4BC7A 1Z39A 5AH0A 4QARA 3OJEA 1U80A 3ZBTA 4YEDA 4R1LA 1O08A 4NG4A 4RM3A 2PXHA 4CLOB 1EDEA 3M8KA 3DVSX 1WHQA 4I4TA 2N8XA 5ERXA 2A0UA 3K92A 4LC0A 2N3ZA 5CMLA 2FR1A 4H9JA 1GRRA 5KJEA 2YTQA 4CI9A 3IMKA 3VBCA 4KDCA 3MERA 3GRUA 5IFLA 2FW8A 4E5PA 1GKYA 2LPMA 4OQDA 1ZU1A 4FS8A 4ID3A 1EGQA 3CU5A 2FUCA 4JKYA 3DTNA 3V5NA 1RADA 1XKQA 2KYRA 3PDJA 3DFZA 2OAEA 3TX2A 1CP2A 1KFCB 3CW2A 1TQHA 3ESYA 2XD9A 3HRKA 3MWFA 3O0DA 1JALA 1UBDC 4RHCA 2YX1A 2X0RA 1AUOA 3N87A 1XT6A 2EC5A 3PXCX 3UMRA 4CT5A 3NUGA 4E5SA 1ESEA 1N2SA 3EMDA 4FIZA 4RQUA 1ZK4A 3ZOZA 1ZRHA 3LVFO 1H93A 5DJ5A 1F6BA 2ZS8A 2RSIA 3U4QA 3P9QA 1IQUA 3EDOA 1OWOA 3CH4B 4G1MB 4HAVA 1Q22A 2NLOA 3RAEC 5AQ1A 1N5JA 4PAMA 3NOVA 2QAIA 4B74A 4EB6B 2GAOA 2A35A 1T2UA 3GUCA 4AJJA 2EJVA 1NLZA 3GDOA 4ZOCA 5TSDA 5JQWA 1PZEA 2E4YA 2YTJA 3ZWKA 5JS7A 1G9TA 3IPYA 3KVNA 5GGXA 3LBYA 4E2YA 4G9BA 2P2SA 2VS1A 5KU1A 2XB2A 3ZFOA 4GECA 4O5AA 3N59A 5FNVB 4ZO7A 1C7EA 4WKCA 5KBYA 1BQEA 4G09A 5JJ5A 2X0KA 2PXAA 3KEMA 1K97A 3TLCA 3PPIA 3I5XA 2GTHA 1VJGA 3DZIA 2VXOA 5DKFA 4Z9BA 1LLUA 1QR2A 3PVZA 5GV7A 1YQDA 2C20A 1CR2A 2YNMD 3K73O 3GLFA 4U2GA 1H05A 5L3VA 4DABA 4LBYA 3VAYA 1UEIA 1I7LA 2GLXA 1FQJA 3Q3VA 6REQA 3DTTA 3HCEA 4DM4A 3GJ6A 4QUHA 2MMGA 1NG1A 3EN0A 1LF0A 4ICIA 3KOMA 3SICE 1OZAA 1SG6A 4KXWA 3BORA 4R98A 4RZIA 4F5WA 2XX3A 1YOBA 1VSQA 5KWEA 4LYFA 1EX9A 1Y0BA 1I6KA 3QFSA 1M2OA 2IE8A 2GN6A 5BR7A 1PE0A 3HUNA 2NV0A 3FCXA 4U7PB 2HK6A 3JRXA 2OHVA 1Q7EA 3K8QA 5LBTA 2XNDD 2W2OA 3E8SA 3GEIA 2H54A 2H92A 3E0QA 3MRXA 1YZTA 1Z83A 3F2IA 3RLIA 2BE9A 1CLUA 3KKOA 1PU2A 4HXGA 3IYLW 1HKHA 1Z2EA 4PRYA 5H16A 4OD0A 5DHRA 1FW8A 2LJUA 2DJIA 1U3GA 2HK7A 1FLAA 4MP8A 4NV0A 5EFZA 4EKDA 3CB2A 1XOIA 4EELA 4YMUA 2HI0A 5KQLA 4MJ3A 5JDCC 1HA3A 4M1KA 4EJ2A 1KVRA 2ROQA 2XMRA 1G3RA 3GQBB 3JWPA 2HO4A 5LC1A 1BJRE 2IYOA 2ZREA 1EKXA 1G55A 1ONBA 3BA1A 3M34A 4I2NA 4UXHA 4GKKB 3HWSA 2P75A 3MMPA 4QUDA 1G4HA 3KUDA 5L3SB 3DEYX 1YE5A 3GN2A 2QRZA 2Q3EA 1OYYA 1HLDA 3I2GA 1SUAA 3EOBI 5AVJA 2GEBA 2H00A 5EINA 1LLDA 5DBEX 1HT3A 4RVHA 1J8VA 5HKBA 3AVTA 3DV2A 3OEEA 3B6JA 3ZWCA 2W2QA 3DD1A 2I7VA 3ZI0A 5T4EA 1T2DA 2I4TA 5JZMA 5FWAA 2W6MA 3EYWA 3RB8A 4NK5A 1J2EA 5AJZA 1OCEA 1TO6A 3OEED 1JTVA 1PT5A 1R6BX 3DZKA 4CT0A 3C6XA 5CIWA 3NBAA 4WNAB 2YV2A 5KSPA 5KJCA 3ZWXA 2BTEA 3TQCA 4WJZA 4NEQA 1Q7RA 4WFTA 2JJ1A 2J5QA 4ODIA 4CFYA 1F1BA 3AM4A 1Z5WA 1DI2A 1N5OX 2ZRIA 3EPLA 3O4VA 2A3RA 4PS1A 5FF9A 2EZUA 1HXHA 3CZPA 2VG8A 4KFUA 3NVAA 1FJ2A 3DDOA 4F21A 4UTNA 3ET5A 4H6VA 3PFFA 2B7CA 1UJMA 1G8SA 3I9V1 3O38A 3EG5A 1M6WA 4ZYXA 2I03A 1GG9A 2ORED 1KL7A 4F5ZA 2M32A 3TQSA 4LHVA 3W3ZB 3VR1A 1HDGO 2E4XA 2XNHA 2ON6A 3HB9A 3BZWA 4IYRA 2P4QA 2FSSA 4PQFA 4RA6B 4PG5A 5JDIC 2GPWA 3K1YA 5IWAE 1EVEA 1XU4A 1YMQA 2M2IA 4NSNA 2J9FA 2R47A 3ZQ6A 3CR8A 1SXIA 1J0AA 4ZK6A 5AVTA 1XMSA 3LAWA 1X3CA 2VOEA 2R65A 1L7XA 3FUXA 4CKBB 1STOA 2HCFA 1R2QA 2LCQA 3RASA 1ECGA 1V2HE 5L40A 1BG6A 1QFXA 3KKNA 4J1NA 3PXDA 2VWGA 3IEIA 4X54A 5K8UA 1RVDA 2AG1A 5A1TA 4MV5A 2QS9A 5F1KA 3HYSA 1UJ2A 3F97A 3GD7A 3HFRA 3KL2A 3VR4D 1S8FA 3BAFA 1SUPA 2Q0SA 3AL3A 4DGQA 4X6YA 3HO8A 1IXKA 2PGDA 4ZGGA 2IPNA 3M6LA 2QR5A 3E9CA 2ZKLA 1VHQA 3WQSB 3MSCA 4AURA 3JYQA 5EZYB 5HQ3A 2GO7A 1V3QE 3K9NA 1JSRA 4Q16A 2XDQB 3ETLA 1MB9A 1E3QA 2XE8A 1NDQA 1P9OA 3OFND 4II7A 5DRTA 4BWGA 1AQJA 5JRZA 4TQGA 2PCJA 4BB0A 3DUFA 3D31A 1AXGA 2A9PA 4LOJA 1WO8A 3QWBA 4N3CA 1QXSA 3W8EA 2ZB3A 1AHNA 2JDID 3E2MA 3UW1A 3KZXA 4OYYA 5ILQA 3VO8A 4DIEA 4AG3A 1XMQE 1PLLA 2VHJA 4DMKA 4AG5A 2QVLA 4AROA 1G8PA 4GBMA 4MWOA 4D4LA 2L69A 2VJLA 1K4YA 4HUJA 1GKKA 4X92A 3HPQA 5HK8A 1L5LA 3TXAA 2DC1A 3BXGA 1WBBA 3M1YA 1KMMA 3WIBA 5KQSA 1C2YA 1G20A 1SUEA 4U7JA 3MA0A 1RACA 1JH8A 3GCDA 2O52A 3KZ1E 1PWYE 3LPNA 2A5GA 1I4LD 1NIJA 1NXSA 2ZBQA 5A2QA 4YK7A 3PTLA 2QVXX 3DCJA 3QU9A 2QGNA 3M70A 4IQ4A 3NS7A 4JQCA 4ZOBA 5KMGA 3Q3IA 1E1QA 3C3MA 1YSAC 1DAGA 5M7EA 1Z0UA 1GL6A 2FMXA 2HGSA 3L0DA 1SXQA 1QNFA 2YXEA 2WCC3 1AA9A 3C5EA 3VR5A 4ARSA 2AEFA 4CI0B 4C9BA 3L4BA 2H7YA 4H59A 3SCZA 3FZGA 3HDHA 3OJWA 1SB8A 2M7QA 3FPEA 4CN8A 3WYGA 2GUGA 1XQ1A 1P47A 4NYIQ 3WLIA 1ZP6A 1ZLXA 1IK4A 3JWHA 2NAPA 4QWWA 2ZZMA 1E6KA 4KRYA 1HG1A 1YUBA 4KLAA 4B6EA 4WXYB 3ONFA 3CRVA 3R6GA 4JUAA 4R0NA 5F1PA 3TLYA 4F92B 1ZGZA 4MQEB 2YOHA 1PUIA 3PU6A 2Q8NA 4L51A 1ENOA 1QCZA 1GKLA 3ENKA 3KYIB 1H5UA 1PQWA 4RJ2A 1KZ6A 3ZLBA 5EPEA 5E2AA 3N8NA 3E9QA 5DX1A 3NNSA 2BFEA 1HZJA 3HUUA 2B4AA 2JPAA 5JZSA 4C2UA 2R87A 5KMGB 3J81C 1IY8A 1F8UA 1UOOA 1C30A 4OF4A 2EOIA 5IBPA 1YRYE 2V8OA 2H7VA 4ZMRA 2CMDA 3THNA 2E5WA 1W2HA 2V7UA 2XE4A 4UHFA 4ZV9A 1BEEA 4S1WA 1VJ1A 4AJEA 3BL8A 1Q50A 1E9RA 4ML3A 4ANFA 3P1XA 3B20A 4JBWA 4UCQA 1GWNA 2ECFA 1SRRA 4NCXA 2X0IA 2BHLA 4Y6LA 5LB4A 3K1TA 4N7RA 5E1OA 3ABRB 1OU0A 4J07A 5G3ZA 2YHSA 3CNEA 3ABIA 4A6EA 3KR1A 3FWYA 1WV0A 3JD3A 3ZUGA 2K87A 1XMOE 2O14A 2HAEA 3CNOA 3TOSA 2Z83A 2EP8A 4B2PA 1T9GR 1VYHA 2UZ1A 3TOVA 1YD7A 2FPIB 4EY6A 2BMEA 3OAAD 4XCVA 5FAKA 2BM1A 3OFSA 2LUOA 2CB0A 2WG2A 4NCKA 2N0SA 3PDWA 4Z0TA 5JS6A 1T6YA 4TLLB 3AH8A 1VIMA 4ZI5A 4D4KA 3TQTA 4K0KE 2I33A 3CBQA 4MS3B 1L4LA 2AG8A 3O2NA 4LNUA 2IHR1 1WX1A 4ETIA 1G7CA 5DTJA 3RC2A 1U3DA 1T5IA 3THWA 4FW9A 4HL6A 1T4GA 3D3KA 3PX2A 1V48A 1ZM3A 3L02A 5G4LA 3LC1O 1PGOA 3WJ1A 1KETA 1LQUA 3V2UA 3AY6A 4B83A 3B48A 3VDXA 4CKCA 2HJJA 2PKQO 3KJHA 2R5FA 5FO0A 3WQBA 1HE2A 1SXJC 3GP5A 4FP9A 3G9ZA 2DFTA 4RY8A 1HG0A 1L5OA 3JR3A 2V7WA 5DHTA 2PL3A 1WSAA 4BFZA 4JLDA 1CR6A 3RRNA 1KR2A 3RUAA 5JNUA 3KWJA 3KIPA 4I1UA 1UBCA 1IPEA 2WE8A 1I51A 2EYUA 3INGA 3MK31 3O73A 1STUA 1SD1A 2IF0A 4TKLA 2LUPB 1ML3A 3H4TA 5EGSA 2QPOA 2QN1A 2GETA 3IR7A 4EL5A 4H7JA 4D99A 3NW9A 1QV6A 5K3OA 2VNAA 3B6EA 4L4SA 4JSRA 4CEJB 1O6FA 4DWJA 5CH3A 5BWCA 1T34A 3PGKA 4O29A 5DCYA 1PL8A 1LCIA 3W1WA 1MTZA 1NVEA 3R7WB 3BE5A 4JXZA 4ZYDA 2UZ4A 1WCIB 3NV7A 4Y1EA 2XZOA 2C2YA 1BN6A 2FEMA 3ZVLA 3IE1A 3CRZA 4LI3X 4RV4A 4A7PA 4B84A 4CV2A 3BB1A 5CK4A 1UAYA 4R2WA 1HLGA 4P93A 5AC4A 3OECA 4LFCB 2DBQA 2GD1O 2EFYA 3ICEA 4JJ6A 1JWBB 1GG5A 2NUPA 1XCJA 2PVCA 3PFCA 3BN3A 3WG9A 1N75A 2QVBA 1WW2A 3BWEA 4EM6A 4AKHA 4HRAA 3FJOA 1UJ4A 1ULTA 2OGZA 3QXSA 2QVGA 1T39A 3MW8A 2RE8A 1H66A 2ZI5A 1JPUA 1SPXA 3FAKA 3V1UA 3GA5A 4RKRA 1YACA 2QLBA 4II2A 3FKJA 5J63A 1OI2A 2QA5A 1FFXA 4HFNA 3TB4A 3IQZA 1V6AA 4NV3A 2P9GA 1H2WA 1EH6A 5K3DA 4Q37A 1F3OA 4R2KA 3OQMA 1W8DA 1J6UA 2FMKA 2A5DA 5KTNA 4LCJA 2XSZD 5C5DA 1H6BA 3I2IA 3K09A 3IPAA 1JU9A 1ESNA 2BGLA 1J2UA 2VP0A 1P33A 4YCSA 2J6HA 2VUIB 5JDCA 2F1JA 2OFWA 3I5AA 1V7ZA 3O8NA 2W00A 2JH9A 4MDHA 2H4WA 4GZ3A 1RMQA 4DQVA 4LFBE 1MZVA 4V3BA 4BBZA 3OICA 3HACA 3VQTA 1S1CA 1W5SA 3G89A 3NFYA 4LOHA 1IY2A 4N54A 1B76A 5E6SA 2H17A 3HYNA 4O4HB 1S8AA 2C4TA 3F6SA 4PZCA 4DRYA 4DT1B 4AJIA 3R0JA 1EDDA 4I99A 4MYHA 3OQPA 4WINA 5HMMA 4BLUA 4BRZA 5ICFA 2G5TA 3LBAA 2FRXA 4O25A 1QQTA 1II8A 2NACA 3IJPA 4PEVA 4DTCA 2CL0X 3V7UA 2EZ6A 4Z7OB 4ERNA 1NQXA 4YH1A 1NWCA 4H7FA 1IHPA 4YMHA 3HDGA 4FYYA 2IPMA 2IHZA 3MOSA 3H16A 5ALRA 4RJTA 2Z4TA 4NKRA 4AVYA 4S0XA 1Y63A 2OD2A 2NTYC 3WGQA 1EWKA 3X43A 2FSVA 4DLRA 4KR6A 1NUSA 2ODRC 1XKTA 3AEYA 3BF7A 4YROA 4TZTA 3VZDA 1K7FB 5DHFA 4BMDA 4JI6E 1QGAA 4TRNA 1XAJA 3KFLA 2HBZA 5JHGB 4IF4A 2PGXA 5FTMA 4NFYA 1SU7A 2NXEA 3SKYA 4QPNA 2RARA 1DPFA 4O24A 1KGDA 4FEEA 4RGQA 2WWVD 3ZHRA 2QRUA 3LJKA 1ABBA 3A28A 1E2EA 3RS4A 1M6HA 2VNKA 2GHIA 3LCRA 3BSYA 4ENUA 2N46A 3T0FA 5I7UA 4JLKA 3QEOA 2JGIA 3PC3A 3RIMA 3ZFRA 2K2QB 2ATIA 1AKRA 3DT8A 5A6SA 5IPFA 3A8TA 4QE3A 4KCGA 3HBMA 3H99A 4L8VA 4DV5B 4L0MA 1GL7A 1NXXA 4YGYA 4C0KA 4D1YA 1DXYA 3F6YA 1RTKA 2HIMA 1LFDB 3C48A 4JP1A 4REMA 3ZV5A 3CVXA 1JEAA 1LY1A 2PUJA 2WT4A 4K9SA 4QOFA 3EEYA 5HKKD 3PQ3A 2OZEA 2ACEA 2WSMA 3BRSA 1FNSA 2JIBA 2OCGA 2PGOA 4K6CA 3LDFA 3AVQA 4RJLA 5SZHB 4DJEC 2ZW9A 1U1EA 3KLPX 1SD5A 5BY2A 4BV9A 1LBEA 3LUCA 1SK8A 3HK2A 3PWSA 1MOPA 1SUBA 4TOIA 1KMIY 4EA6A 5IT0A 2C1ZA 1T2VA 5AJVB 1K4MA 1DJQA 3WK7A 3KWMA 3FLBA 4KIUA 4M21A 1ZWKA 3WGHA 2WHQA 5E9AA 2IYTA 3FXAA 1DCTA 1I10A 2IKQA 2VJQA 2ENHA 2XADA 4AG6A 5CCXA 2QTVB 3IQDB 2CUNA 1MP0A 2BEVA 3DF9A 4OIFA 3VZPA 1UEJA 3I1IA 4EYKA 1L5VA 1I01A 1R10A 1L4NA 3IBCA 3Q11A 4KB5A 3C3EA 2H8GA 1NNUA 4B09A 2GLIA 3IT0A 1DB3A 3UYKA 3W9UA 4E07A 4NH4A 1F5NA 1HNXB 3PIIA 3NGXA 2IPAB 3OJOA 4NAHA 4DMCA 4N49A 3ETHA 3MRVA 3OFNA 5LVAA 1DUSA 2Z0MA 3GB9A 3G2IA 4M0MA 2QGFA 4BKQA 1NBWB 3RROA 1D0SA 3TLBA 5DW3A 2MTBA 3ZVMA 3IELA 4HJXA 1UFKA 4JXKA 4IEEA 5IZ4A 1II9A 2UXBB 1UCFA 1GY8A 4BHCA 2BKUA 2PD6A 1G5IA 4EI9A 3CX3A 1P4SA 2PH7A 2G07A 5KAMA 4EX7A 4RD0A 3TOZA 4ZI7F 4KMMA 5L6MB 2PD4A 1KO7A 3GDHA 2BZSA 4QQFA 1UZMA 1Z0SA 3OZEA 5C4MA 1G6HA 1P4HA 4FINA 4B4VA 4R9RA 1YF3A 4YV2A 5IK2D 2VZLA 3N8HA 5J5CA 1GNPA 1HL7A 2B5OA 3UGKA 3AF5A 3PPVA 1XQ6A 3EVTA 5FUXA 2BFCB 3AJRA 2O0KA 3T6KA 2BJHA 1NVKA 2EJUA 4LGCA 1U63A 1L4MA 4QODA 4W7IA 4JI1B 3R7AA 1HRKA 1MVOA 5LWQA 2W2MA 4O4HF 4ZGBA 3TKYA 4PLWA 4FUQA 4IIEA 1CUZA 1RPAA 1YK0A 4HVTA 1ZBQA 3AERA 3BCUA 2V3WA 2OCKA 3B6IA 1REQA 3RU9A 3I39X 2AZXA 3RO7A 1BZYA 4KQJA 3CURA 3AU8A 2F8LA 1JIXA 3FZQA 3EG9B 4OBWA 2QRHA 2H4ZA 2NU6B 1KK0A 1QV9A 5AVKA 5A3RA 3F6PA 4JI7E 4UMVA 5B2EA 3U7HB 2SKCA 3M4JA 4HBGA 1V8FA 2Q5LA 3AUAA 1LKZA 1G16A 1HLFA 4Y1RA 1G8AA 5CFQA 1L4SA 1YAJA 1U8FO 1R9GA 1KIAA 4AUEA 4PVCA 4IZIA 3AVYA 2PRJA 4LTNA 3ZV3A 1KEKA 1UOQA 2X0NA 3FB4A 3GW8A 2WSIA 4WFKA 2CYAA 3W3AA 1AMUA 1YZKA 2O6HA 1OFTA 1LSSA 2PKEA 4M7OA 4X1YA 1YIOA 1VDMA 2FFQA 5LD2C 5A7GA 3DFKA 3IOBA 4JBLA 3G2QA 1UJCA 3RHFA 1HYHA 3QKRA 4PHGA 2K7IA 1F2DA 2CZGA 2BV3A 5BNIA 1XTUA 3BJRA 3VPDA 4X20A 4REOA 3LHIA 4QLOA 4TPKA 1DC8A 5ER6A 3NHSA 4TSFD 4ESEA 1SKUA 1VHTA 2YZMA 3A6JA 5AHRA 4KQHA 1N2BA 2DMRA 4RLHA 1VPVA 1DL5A 4U3JA 4DR4B 2CMGA 1S8NA 1T0UA 4ZARA 5F51A 1BXKA 1ORDA 1RI5A 4A5SA 4DRXB 1ZGJA 4EYEA 3TUJC 3NBUA 2FP3A 4GOXA 4Q3CA 2J6CA 3NONA 2AMYA 3A9RA 3JD0A 4NVRA 4ENWA 3SFVA 2UVQA 2WILA 1LX6A 1I94B 3L0PA 2XZPA 4NR0A 2ZRGA 4XA8A 2FWAA 3WL3A 3TQMA 1M33A 2O0HA 4ZZ0A 1LSUA 3TE7A 1F17A 1EE2A 1CD5A 4ITVA 4UEKA 1SHJA 1YE3A 5EKXA 4YT4A 2M1SA 1EVLA 3BXOA 5HG0A 1MTOA 4O2AB 2OHXA 1XGKA 2ZJ8A 1YC5A 4B7CA 2POQX 5GIOE 4LWQA 3TTUA 4P0QB 3L8CA 2K7ZA 3F5FA 1FFAA 4XZ3A 5KAPA 3UENA 3MQFA 4UQOA 4KITB 4ZN6A 3OE7D 1OE0A 1E2HA 1Z16A 5I5GA 2ZDQA 3UCEA 4ZICA 3C4JA 3I23A 3Q15C 2NYVA 1CFJA 2NUTB 4C3UA 4CUZA 4F71A 1JDUA 2WSBA 1CS0B 3E81A 4ZU3A 3ZJUA 2ZYVX 2R9VA 4LGYA 1R50A 4MAMA 4PFQA 5I9NA 1SD2A 3G0OA 4WCFA 6AT1A 2YWJA 2D54A 4RNDB 3V8MA 4DB2A 5H3HA 4KNYA 3PWTA 3F78A 2P27A 5HBRA 2IU0A 1N3BA 4YY3E 1ZJ6A 3NDRA 4QUAA 4M1EA 1H94A 1QPBA 3KOWA 3IV6A 2QQ0A 2OYSA 3QXJA 2YHUA 1KY3A 2I7CA 1NYLA 4PSKA 4EKGA 4CEJA 3LKZA 5D3QA 2F3SA 3NRBA 4DEXA 1Y6JA 1E2PA 2ERCA 5JSUA 3DBVO 3K1AA 1NBMD 3NO4A 1GPUA 2EWMA 4MQFA 4RELA 3L8EA 4IJMA 4RKYA 2FSHA 2ZYHA 3GF4A 4Q9HA 5LP1A 1SHTX 1DI0A 2B92A 3NATA 3MT8A 1DKRA 1U31A 3O9VA 4H4DA 1KDYA 2P6PA 3Q12A 1OR8A 3OUTA 1FYEA 2OFXA 2UYOA 4PRLA 5F7JA 4ABYA 1R8JA 3SX0A 3BGVA 1BQ4A 2FEPA 4EA9A 1ECFA 1J49A 3GLVA 3OD1A 1PZXA 1TB4A 3AEQA 3AIOA 3H11B 3P8ZA 4INJA 4HWOA 3SZGA 3VPFA 4BLQA 4BAUA 2QUZA 4A2CA 3FW1A 5LSAA 2YJ4A 4J2OA 1UXOA 3TYXA 1XC7A 4LTYA 4ZZ1A 3COJA 1ZD8A 3G9UA 1N4DA 5HSGA 5H80A 3LUGA 1BRMA 4FD2A 1Z8DA 1KAHA 2F48A 3C2QA 3P5BA 1XPUA 4GPD1 1XZAA 1LTHR 2HHHB 3OESA 3T7DA 1T1IA 3VHRA 5BUZA 1OASA 4G0PA 2JHFA 3PSAA 3OEHD 1ST3A 4KMOA 3CVOA 3IVAA 3IKVA 4W63A 4MJ7A 5D6OA 3U3DA 4HHEA 4JI3E 4UOZA 5IX8A 3HUDA 2DUWA 4NK4A 4JX8A 5AK3A 2VTKA 2YMMA 5BT8A 5DBFA 3TBKA 1IUKA 3E1SA 1I6LA 4TQUS 5JNSA 5JWOA 4M76B 2FW7A 5J2UB 1UP7A 2WM9B 1N9KA 1NJ6A 1LTQA 1J70A 2WINI 2ZJYA 3FBWA 3OLQA 1VLJA 2P2LA 2JGMA 4Y2UA 1QGYA 3EVGA 5DM1A 1YDWA 4L8YA 1DC7A 3F67A 2GKSA 2H36X 3H2SA 3A1SA 3TM5A 5C8YF 3A1NA 1LBIA 1SO8A 2QN3A 3AB3A 4HX5A 1J9GA 1SCNE 4Z9YA 4OX9B 3BMOB 4DSOA 3QVKA 3TD6A 2BFOA 3FPHA 4RKWA 3SHOA 3U4HA 2ZCJA 2BLLA 2PUTA 4PZAA 3IODA 3WA6A 4BGVA 1XPOA 1WUYA 4B76A 1HX7A 4DV4B 3L46A 1X9HA 3A3KA 1KI3A 3K9CA 4LA4A 1IM2A 4EHFA 5HX7A 1SHZA 4BO1A 4TTJA 5D8DA 4FX2A 4X62E 1O0BA 1GZ6A 4UBMA 2DZDA 2C59A 4R5MA 2H1LA 4JQZA 2V6GA 3V55A 1HI9A 5EUBA 4UUAA 4MPDA 4B6QA 3QWAA 1MX9A 4IRMA 4ID9A 1WXEA 4FCWA 3IQHX 1Q77A 1KBQA 4GBED 3VO9A 3QUSA 3HR4A 4ZVTA 1JMVA 1MAUA 5ENVA 1CQXA 1M6NA 2GAFA 3EGEA 5I01A 4AC9A 4W6QA 3NBZC 2J9ZB 5K8JB 1G5QA 1H69A 1QANA 2N1MA 1PGNA 2IYWA 4GT1A 4W5QA 2WAOA 4FWTA 4UNQA 3ZYZA 1T24A 2VJKA 3L0YA 4MDEA 1AOXA 1XQ9A 1YCHA 1ZNZA 2RH4A 3I6IA 3KHUA 3LWBA 4F11A 3EPJA 2CVFA 2V5AA 3G7SA 4OGWA 5DYWA 2FN4A 4H9KA 1Q7BA 4MUYA 2R6CA 3DXYA 4KN9S 4DDWA 2OQVA 3CA8A 2ZBUA 1I7DA 4GGOA 3U31A 4OHFA 5LNK1 1SH7A 3PQ2A 2VF4X 4GI2A 2IU3A 1RD4A 4YJ2B 4B3FX 4UAVA 2H52A 3QA3E 3PKJA 3QPUA 3UA4A 1L7NA 1T36A 4A2PA 1E6CA 1UN6B 4R2HA 4BCCA 2V4ZA 2QAJA 1EDOA 2VAMA 3GLGA 4I36A 4EMBA 2VRCA 5IUJC 3EZYA 1I8TA 2BI4A 3I9LA 4TKVB 4G5QA 3CKMA 2CFIA 3DUFB 1IXRC 3B1ZA 2A5FA 2HLNA 3GPCA 1G6KA 4HZUB 4UUNA 3L7NA 1GSOA 4OI1A 4ENPA 4YCCA 1ZBDA 4PSAA 3R76A 4IYJA 4Q3KA 4GVLA 1UT5A 2FZEA 2QYTA 4B48A 5JSZA 2J9YB 1NG9A 2PV0A 3QPWA 3RJ9A 3TL6A 1YS4A 4BO4A 2O0LA 1OT3A 1U0LA 1E3TA 2PZKA 1SG0A 1ML4A 1GPKA 5EHQA 3NM6B 1GUZA 4MKFA 3NTUA 1IULA 1VE1A 2GESA 2GK4A 4M1MA 3SXUB 4RJJA 1Y34E 2WNHA 2EOOA 3L7DA 1GZSA 2DQKA 2GSDA 2H16A 1T6BY 2X9LA 2XKAA 1JVBA 2FMUA 3NHWA 3WKAA 4EGFA 4YMTA 3ER8A 2OFFA 4YI5A 1OJLA 3T95A 5LQNA 2WVGA 3LA6A 3WJ2A 4DUZB 2FSGA 1T2NA 5JAZA 5EE1A 1H6DA 1PK8A 3PLAE 1R9MA 5AKGA 2ZLBA 4WOPA 5BO5A 3BULA 4M0VA 3ETEA 3I6ZA 4JL5A 1G8KA 3W2EA 3EXIB 1YJQA 1OLXA 1JJIA 2PBLA 2RGBA 1I2MA 4LZZA 5TQ2A 1XXHE 3BRCA 4IOJA 4LZLA 2GTIA 3FSGA 5KYUB 3JQPA 4WFIA 2F4VB 4J8ZA 3N0VA 2G0AA 1L3IA 1OC2A 2GXSA 2WABA 5AKLA 1KZHA 5ALOA 4Y2GA 2ZUTA 1DEAA 3WA7A 1Y5LA 2JL1A 1J2TA 1J99A 3P0RA 1EP9A 4DR6E 2G70A 2LDBA 3DMFA 3RREA 1FXUA 1NLMA 3DC2A 4JYPA 3F73A 2IC5A 5D01A 1Q83A 4Q4HA 2CK3D 3JVEA 3MHTA 5CB6A 1UFVA 4J94A 1A7AA 4YLEA 5BRJA 1ZX1A 3AESA 2OLJA 4C6HA 2MSEB 3B60A 4KU4A 1W48A 2H29A 4P33A 2H1CA 3QPBA 3UICA 4C7OB 2RI1A 1NF8A 2B25A 1UL1X 1TCAA 4IEFB 4OOFA 1H8HD 2TECE 3CHYA 2H2DA 4TL6A 1HPLA 4WAUA 1EFCA 2RI0A 3NT2A 5TPWA 3ZU2A 4DR7E 2XUAA 4XWGA 4IS2A 3EZ7A 4TRRA 4QUEA 1VBKA 1MR3F 4UMFA 1JNYA 3O31A 1JB1A 3Q10A 3O1HB 2IBSA 2DTDA 1RAEA 1AGXA 2GCIA 2G7HA 1O87A 3JRNA 2PD3A 4X1KB 4CDNA 3UUFA 1M7BA 1SY7A 4FQ7A 3WLTA 1PDAA 5LR6A 3H18A 2OQ2A 3MLAA 3CEHA 1RLOA 3R9KA 2O54A 4YECA 1G2PA 4MO9A 4F6MA 1Y8RB 3C45A 3FHJA 3DC7A 3SIWA 4TYMA 1QO9A 2EARA 3I9NA 5ES3A 3FKQA 2WRZA 3AO0B 1AG9A 1RLIA 2VR1A 1USVA 1QGDA 3DZ8A 2DQSA 4PZLA 1B26A 4HAWA 1OYWA 2NYAA 3QH4A 2RMKA 3D0QA 3H5TA 3KOXA 2Q6TA 4R8OA 4IHAA 2H5EA 4MW9A 5A4MS 4YCDA 5K99A 4J76A 1FW6A 1ODCA 1WZIA 3Q1KA 1WULS 4M88A 4D3ZA 4YR7A 2OG2A 5DCUA 3RRZA 1B74A 5PGMA 2NSLA 2YWXA 4L8LA 1UEXC 1VTKA 3BF8A 3V80A 2YICA 1FSSA 3GRYA 1GPLA 3Q7RA 4X71A 4JBHA 4NYMR 4ZVRA 4DLLA 721PA 2CL5A 4UTOA 3TJZA 3IL2A 1D4AA 1QH1A 2L17A 3E6AA 1UWVA 4X84A 3G0HA 4ZEXA 4AZ0B 4QDZA 1QAOA 3ENWA 3ITDA 1M2OB 1JYEA 5B4UA 1XZKA 3JU3A 4DFDA 1OC4A 1GZ5A 4W99A 4F8JA 1IJKA 2FP4B 3OOWA 4IGAA 4CIYA 5LLDA 4YP7A 4FILA 4ZJYA 2QN6A 3DHNA 3F46A 3GRCA 2PX0A 1NV8A 5DTMA 5IABA 5MDHA 2WSLA 4FDMA 1E8NA 1W35A 1CY8A 1BVYF 3ZQUA 3A1CA 4GDMA 4IPTA 1TJYA 1TZKA 1AH5A 1N57A 2C83A 1CZUA 2BP7B 2DAPA 2QAGA 1B41A 3ENVA 3THRA 4CIWA 3GLFB 2CV2A 4CKWA 2NA2A 1NC3A 5MHTA 3A4YA 4JQYA 3HXLA 1WXRA 1Z7YA 2ZQYA 4FGSA 3JASA 4UD2A 1CUHA 1QPGA 2F62A 5FBHA 4K9KA 1YRLA 3U1BA 2INGX 1P60A 1DBVO 1SIOA 2AKAB 3VU9B 4C0XA 4WVFA 4C6RA 3ZEAA 2C5GA 5CLLA 3ZZUA 3PTAA 3DCYA 2GGSA 1OA1A 4GOLD 3FTDA 5AASA 3U1TA 4JJGA 5FJJA 1JHUA 2Z5FA 3T1OA 4JL6A 1X1AA 1Z0IA 1N2XA 1QBGA 1NT2A 2JIRA 5HZHA 3GEMA 4X8MA 4TSKA 2VAPA 2XVMA 2WSYB 5B37A 5TMDA 4RA9B 2XECA 4F1WA 2MJLA 4QU0A 1T8PA 2AT1A 1YCGA 2VIIA 1RKUA 1EP1B 4IWXA 2JRCA 5DM2A 4EGSA 5DXJA 1G3MA 4PNPA 4AZTA 1GN9A 2PY6A 5TF0A 2Q0QA 4X41A 4UMDA 1HDOA 1HR0E 3V4RA 2CJPA 3BH6A 2WA2A 5M29A 3HGTA 2F8TA 5JY6A 2QRNA 4M86A 3N2YA 1P77A 2QM0A 3G6KA 3UMJA 1BHQ1 3M49A 2WE7A 3EFHA 1JEOA 2J5XA 3EDQA 1OU4A 1UBKS 1JAXA 3AFIA 3EA0A 1TJ3A 2LV2A 3I9JA 3U9TA 1IY0A 2ZT6A 1JHPA 2JJQA 1QU3A 4QELA 2EL4A 1EVYA 3G2JA 3GAMA 3OP1A 4DLUA 1U2ZA 4FYXA 2Y27A 3NHRA 1F14A 1T2EA 3PGJA 1XK7A 4PG7A 2V0CA 4B3CA 2E18A 2JHGA 4KW7A 4I4TF 3ZU6A 3UMYA 4DV6E 3R77A 1AGPA 1NLFA 1A04A 3AL0C 2RJ3A 3DDSA 1UDWA 1JLMA 2I22A 2QU7A 2X8JA 3R7NA 4ARBA 4RIGA 3THSA 5JMWA 1P1FA 3DQPA 2JA1A 1ZW6A 3KR0A 3GJXC 4ZA2A 2X0EA 2ZVQX 4KE8A 2NNLD 5FPTA 1IBMB 3E0XA 2VPPA 4J0CA 2ZTSA 4ZVVA 1T4OA 1RSZA 2C7GA 2RK3A 5K01A 4S05A 1IAQA 1J24A 1JLKA 5I5EA 5BYAA 1H23A 4QNMA 1MN6A 3F4LA 2JFHA 4DCMA 1C4OA 3I73A 3QX3A 4RYLA 1DT5A 4CMEA 2QLJA 4JBGA 3A4VA 4RMHA 2M98A 2YSPA 3AHGA 1XRQA 3DNPA 4R8SA 1WPGA 4M8IA 5KVVA 1U8XX 1UZAA 3HEMA 5C3UA 1M1NB 3OQ6A 2IZ1A 1DRWA 3P97A 3TTXA 3KSAC 1ST2A 2FFBA 3E48A 1VMEA 3ZHZA 3PNQA 1F5SA 5BUSA 2WT8A 4H77A 2P2ZA 1A0OA 4QGHA 2V7PA 5DBHX 5FTKA 1J22A 2PSHA 3CX8A 3UMBA 1LDEA 3UJDA 1OX6A 4I9NA 4KE7A 3EPPA 4EFLA 4X8HA 1QTRA 3FY4A 4MA4A 3EVFA 2HMVA 1M75A 2OAGA 2VP9A 4D57A 4ARIA 1Z8HA 4I50F 1EXDA 2DM6A 2WIAA 3S3TA 3WTBA 4XD7A 1T5OA 3GFOA 3H3FA 4RH3A 4WESA 1Y6ZA 2C42A 3PJGA 4OJTA 4F2GA 5IWAB 5I4BA 1UPAA 3WNVA 4ITRC 4R2IA 3JSAA 1ONPA 2HMAA 5ETJA 4F5DA 4PGMA 1YGYA 4D4MA 3ES9A 3P5SA 5I8WA 1CZNA 4FMDB 4WBNB 2B1IA 2I4RA 3SSMA 5JXIA 1ADGA 1UANA 3DMHA 3PXXA 4MRSA 3S27A 3WGGA 4AP5A 4KR2A 2RC6A 4KGDA 1ZM7A 1X77A 2RH9B 2YJTD 5F78A 1BNCA 2X23A 3HLKA 4YJ3F 3TIXB 1K6XA 1P1CA 4W4TA 4G63A 4ARAA 1YZYA 1H4VB 2VP3A 4XVUA 5AXBA 1SOAA 5E0KB 2BEKA 3AJ9A 3E22B 1PKEA 3CSDA 4C7KA 3V2HA 4X7MA 2QUJA 5M5BA 1HE1C 3OFKA 4OLJA 3RT9A 3MHHC 3T9FA 1RM3A 2HZBA 3C4TA 3G2MA 3INNA