2LTRA

Solution structure of rde-4(32-136)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
NRTDLEMFLKKTPLMVLEEAAKAVYQKTPTWGTVELPEGFEMTLILNEITVKGQATSKKAARQKAAVEYLRKVVEKGKHEIFFIPGTTKEEALSNIDQISDKAEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of RDE-4 dsRBDs and mutational studies provide insights into dsRNA recognition in the Caenorhabditis elegans RNAi pathway.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Rna binding protein
molecule keywords Protein RDE-4
total genus 29
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2012-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ltrA00
2LUQA 2NUEA 4NXNE 1YZ9A 1HR0E 2UXBE 2HHHE 2DIXA 5LMUE 2IHR1 2UUBE 2RS7A 4WFTA 4OX9E 1IBKE 4DV2E 4OOGC 1IBLE 1IBME 2L3CA 2UXDE 1T4OA 2B7VA 2DMYA 3VYYA 1T4LB 4LF8E 2ZM6E 4LFAE 2NUFA 1FJGE 4DV1E 4JI5E 4DR2E 4JI1E 4M2ZA 3T1YE 2JY9A 1RQ0A 4M30A 4DR6E 4DR3E 4DUZE 3P1XA 4LF7E 3C4TA 4JI3E 1DI2A 4JYAE 4LF6E 2L2MA 1XNRE 4B3RE 1PKPA 2KHXA 1N33E 2RSMA 4X65E 2UU9E 1FKAE 4DV4E 4DR5E 3C4BA 1UHZA 4DR4E 2N3GA 4LFCE 1QU6A 2LBSB 3VYXA 4DV3E 1GQEA 1YYOA 4X62E 4LFBE 4JV5E 2LJHA 1HNZE 1YYKA 4DV6E 5IWAE 4JI6E 4LF4E 1O0WA 2RS6A 4DKKA 4DR7E 2VQEE 2UXCE 3ADIA 1XMQE 4GKJE 4B3SE 1XMOE 1T4NA 4X64E 4B3TE 1N36E 1HNWE 3ADJA 1EKZA 5BR8E 2E5LE 1RC7A 3OTOE 4AQYE 4DV0E 1I94E 1X47A 2YT4A 4JI8E 1WHQA 3ADGA 2UUCE 4KHPE 4WYQB 1J26A 2N3HA 1WHNA 2JVAA 4JI7E 4B3ME 4DV5E 4K0KE 1HNXE 4YY3E 1XNQE 1STUA 4YHHE 5LMNE 2LUPB 1J5EE 4DUYE 2F4VE 2B7TA 4JI2E 2NA2A 5CFFE 4GKKE 4DV7E 2UUAE 3LLHA 2EZ6A 2L2KB 2LRSA 1X48A 2LTRA 2L3JA 2DB2A 1N34E 1UILA 4LF5E 3HTXA 2LTSA 4JI0E 2MDRA 1N32E 2RTXA 2VQFE 3ADLA 4NXME 2L2NA 4DR1E 4JI4E 2B3TB 4X8WA 2CPNA 3J7Yp 3T1HE 4X66E 2L33A 1YYWA 2NUGA 1ZBTA 4LF9E 1X49A
chains in the Genus database with same CATH superfamily
1A1FA 2BBGA 2CTDA 2V87A 2RQLA 2YTPA 3BGHA 4TUIA 5LLQA 2YWQA 5LMUE 1NCSA 2EN8A 2UUBE 4R03A 4WFTA 2BB8A 2EOJA 4OX9E 2EOQA 5IV8B 4P78A 1IBLE 1IBME 2EN4A 5A69A 1A1GA 2B7VA 4WSPA 2DLKA 4O24A 1DQ3A 4MLVA 1RMDA 4R2DA 1T39A 5A6BD 2DRPA 2YSOA 4DV1E 3HPZA 3T1YE 2EOYA 2VRDA 2ODRC 1RQ0A 2LJUA 4DR3E 2LVHA 4LF7E 1A1HA 2L2MA 1XNRE 4B3RE 2EOHA 2EL4A 2KHXA 4MLQA 2RSMA 1N33E 2HC5A 2KONA 4DR5E 2EOEA 1KYQA 4X9JA 3C4BA 3EPLA 4DR4E 2JWOA 4KWYA 1ZAAC 4LFCE 3JU0A 1QU6A 3VYXA 2EM8A 2LO3A 4DV3E 2M9AA 1ZU1A 2M4IA 2EOXA 2EPXA 4R2QA 4ZYGA 2LJHA 1SFEA 4DV6E 4HEIA 2EMGA 4GEQB 1EH8A 3JAMC 2K4VA 1AAYA 1PJSA 2LV2A 2YTNA 2YU5A 3F6HA 1GTKA 4GKJE 5BR8E 5KL6A 1LLMC 2WCC3 1RC7A 4F6MA 4R8OA 2L8TA 3OTOE 4AQYE 2YT4A 4J8ZA 2GPIA 4R2CA 3FIGA 4KHPE 1TF6A 2EN7A 2N3HA 2JVAA 2YTDA 4DV5E 1HNXE 2JP9A 4ZYDA 2LUPB 2F4VE 1A1KA 2EPCA 2EZ6A 5LL6R 1WRJA 1EH6A 2DB2A 1N34E 1UILA 2A25A 4F9BB 4JI0E 2MDRA 4WX9A 3ADLA 4RH8A 2B3TB 4X8WA 2YPNA 3HQ1A 3MHSC 2L33A 1YPNA 1ZBTA 4NZVA 2CT1A 1WXRA 2GLIA 2I9IA 2IHR1 1UN6B 5AE3A 4NHRA 2FGGA 3JTZA 5A2QC 1T38A 1G2FC 2E72A 4BHCA 2UXDE 2YTJA 4ZYEA 3VYYA 1T4LB 2EOIA 4LFAE 1X6FA 2NUFA 2EPLX 1KJKA 1YUIA 2EWLA 1GZ6A 4M30A 5IT9C 1DI2A 2ENCA 1B69A 3IWDA 5AC5A 1UBDC 2N3GA 1PJQA 4L8NA 1IQSA 2LBSB 2EQ0A 1GQEA 2V8QB 4RHBB 3QG5C 4X62E 5A6KA 1YYKA 4JI6E 2EPPA 3EPHA 2YTOA 1O0WA 2VQEE 3ADIA 4LTYA 2WZOA 5AASA 5TSEA 1YFHA 2EN3A 1XMOE 2YRMA 4X64E 4B3TE 4BC7A 1BBGA 1N36E 2MDGA 3KZZA 4N4RB 1X47A 2UUCE 2JOBA 5KL2A 2V89A 2YRKA 2EQ1A 1WHNA 4JI7E 2JOXA 5KL3A 2DGCA 1F2IG 2WBUA 2HGHA 5DNYA 2EM9A 4YHHE 1Z1BA 1J5EE 5A6BA 4P7DA 2F8BA 2NA2A 4WXDA 4R2AA 4JI2E 3BF2A 4DV7E 2EL5A 4FK5C 3BIDA 3H09A 2LRSA 3AUZA 2YU8A 2V83A 3VK6A 2EMFA 3C6KA 3HTXA 2EPOA 2DMIA 2G7HA 2WBTA 2LTSA 1N3GA 1JK1A 1IMUA 4NXME 2L2NA 4DR1E 2MC5A 4DMIA 2V85A 1QNTA 2ELZA 4X66E 2L6MA 2NUGA 3J81C 1BB8A 2EM5A 2KOUA 3EPKA 4LF9E 5ADZA 2LUQA 2EPMX 2EN1A 2UXBE 2HHHE 2DIXA 2MKNA 3KZYA 2EMKA 2EPAA 3C6MA 2EQ3A 2EM7A 2JYAA 1JK2A 2FTXB 1BBOA 4DV2E 4F9CB 2L3CA 2LCEA 1T4OA 2Q8UA 2EM2A 4GZNC 2ZM6E 2EL6A 2EOFA 1FJGE 4JI5E 4JI1E 2L92A 2EMLA 4BBYA 4DUZE 5AC4A 3C4TA 4JI3E 2EJ4A 4JYAE 4F6NA 2EOZA 1PKPA 2K7IA 2UU9E 4X65E 1FKAE 4DV4E 1TF3A 1UHZA 4IJDA 2N8XA 3TQMA 2DLQA 2PRTA 5F3WA 5T6JA 1YYOA 2EE8A 4Q35B 4R2PA 1HNZE 2J7JA 5IWAE 1G2DC 4LF4E 1NEIA 2RS6A 4DKKA 3F6GA 5KL7A 1TN9A 4WPYA 1YUJA 2UXCE 2VE7C 4BCAA 2EPKX 3MHHC 1XMQE 5A6JA 4B3SE 2DSYA 1T4NA 2ADRA 1HNWE 2LMZA 3KWRA 1MEYC 2YTIA 1EKZA 2YTFA 4LU9A 1I94E 4M9VC 1WHQA 3ADGA 2EOOA 4O43A 4WYQB 2ODRD 2HJJA 1J26A 1X5WA 2CSHA 4YY3E 2YTGA 2B7TA 5CFFE 4HTGA 4GKKE 2UUAE 3J80C 3BBGA 2L2KB 2MC6A 2EMAA 3THNA 4R2SA 1X48A 2LTRA 4LF5E 1EH7A 2I13A 4BS9A 1N32E 2VQFE 3IWCA 2EMHA 4JI4E 2H36X 2CPNA 4Q28A 3J7Yp 3T1HE 4R2RA 1A1JA 4ZYHA 1X49A 1DGCA 4O5GA 4R2EA 4F54A 2WBSA 2NUEA 4NXNE 2YTQA 1YZ9A 2EPUA 1HR0E 2VF1A 2EM6A 3DF6A 2EP3A 2EM4A 2EN6A 2ENAA 3UK3C 1PJTA 2RS7A 2M1SA 2NABA 1IBKE 2M7QA 4OOGC 2EMXA 2JR1A 1X6EA 2V86A 4O4KA 2DMYA 2JPAA 4LF8E 2EORA 3IWBA 1ZBQA 2MKDA 1PDAA 4I8OA 4DR2E 4TUGA 4WSGA 5A6AA 2JY9A 1A1LA 4M2ZA 5FLXC 1X3CA 4DR6E 2R1FA 3P1XA 3DJWA 3EPJA 4LF6E 2EMWA 2EMBA 3ECRA 2ENHA 2LE2A 1A1IA 2RSIA 4L5NC 3ZOQB 4M0VA 5KL4A 2YTEA 1WJPA 5AE2A 2FV4B 2EPNA 2YZTA 2EMIA 4KZSA 2R76A 1AH5A 3J7AG 3M99B 4LFBE 4JV5E 4DR7E 3K6QA 1SR9A 3L00A 1L4SA 2YRHA 3LMLA 2B9DA 4F9AB 1YSAC 3ADJA 3VHTB 5KL5A 4BHBA 3HPSA 2E5LE 2JXPA 2GHFA 4DV0E 4BC9A 4JI8E 3THOB 5IXMB 3RMPA 2EM0A 4B3ME 5AE1A 1IQOA 2EPZA 4K0KE 2EOSA 1XNQE 1STUA 1MGTA 2EM3A 5LMNE 2EMCA 2EN2A 2V88A 4DUYE 3MSWA 2ELYA 3EQ1A 2EOMA 3LLHA 2LT7A 1ZR9A 4F2JC 3AV0A 3HXLA 2YSPA 2L3JA 4BMJA 2D9HA 2RPCA 4WXCA 3OMLA 2EMZA 2RTXA 4IS1C 1X6HA 2EMYA 1YYWA 2EPRA 1P47A 2E1MA
chains in the Genus database with same CATH topology
5ADZA 4F54A 2V87A 2LUQA 2NUEA 4NXNE 1YZ9A 1HR0E 1WXRA 2VF1A 2UXBE 3DF6A 4TUIA 2HHHE 2DIXA 5LMUE 2IHR1 2UUBE 5AE3A 4R03A 2RS7A 2FGGA 2M1SA 4WFTA 4OX9E 3JTZA 5A2QC 2M7QA 2FTXB 1IBKE 4DV2E 4P78A 4OOGC 1IBLE 1IBME 4F9CB 2L3CA 2JR1A 2UXDE 1T4OA 2V86A 2B7VA 2DMYA 4WSPA 3VYYA 1T4LB 4LF8E 1DQ3A 3IWBA 1ZBQA 2ZM6E 4LFAE 2NUFA 1FJGE 4DV1E 4JI5E 4I8OA 4DR2E 4TUGA 3HPZA 2L92A 2JY9A 4BBYA 3T1YE 2ODRC 2EWLA 1GZ6A 1RQ0A 4M30A 5FLXC 4DR6E 4DR3E 5IT9C 4DUZE 3P1XA 4LF7E 3C4TA 3DJWA 4JI3E 1DI2A 4JYAE 4LF6E 2L2MA 1XNRE 4B3RE 1PKPA 2KHXA 1N33E 2RSMA 4X65E 2UU9E 2KONA 1FKAE 4DV4E 3IWDA 4DR5E 3C4BA 1UHZA 4LF9E 2JWOA 2LE2A 4DR4E 2N3GA 4L5NC 4L8NA 3ZOQB 4LFCE 4M0VA 3JU0A 1QU6A 2LBSB 3VYXA 5F3WA 4DV3E 1GQEA 2V8QB 5T6JA 5AE2A 2FV4B 1YYOA 2YZTA 4KZSA 2M4IA 4X62E 3J7AG 4LFBE 4JV5E 2LJHA 1HNZE 1YYKA 4DV6E 5IWAE 4GEQB 4JI6E 4LF4E 1O0WA 2RS6A 4DKKA 3F6GA 4DR7E 3JAMC 3K6QA 4WPYA 2VQEE 1SR9A 2K4VA 2UXCE 2VE7C 4BCAA 4LTYA 3ADIA 3LMLA 2WZOA 5AASA 3F6HA 2B9DA 1XMQE 4B3SE 2DSYA 4GKJE 1XMOE 4F9AB 1T4NA 4X64E 4BC7A 4B3TE 1N36E 1HNWE 2LMZA 3ADJA 3KWRA 1EKZA 5BR8E 3HPSA 2E5LE 1RC7A 4R8OA 2L8TA 3OTOE 4DV0E 4BC9A 4LU9A 4AQYE 1X47A 1I94E 2YT4A 4JI8E 4J8ZA 1WHQA 3ADGA 2UUCE 3FIGA 2JOBA 4KHPE 2V89A 4WYQB 3RMPA 2ODRD 2N3HA 1J26A 1WHNA 2JOXA 2JVAA 4JI7E 4B3ME 5AE1A 4DV5E 4K0KE 1HNXE 4YY3E 5DNYA 1STUA 4YHHE 1XNQE 5LMNE 2LUPB 2V88A 1J5EE 4P7DA 4DUYE 2F4VE 2B7TA 3MSWA 2F8BA 2NA2A 5CFFE 4JI2E 4GKKE 4DV7E 2UUAE 3LLHA 3J80C 2EZ6A 2L2KB 5LL6R 3H09A 2LRSA 2MC6A 3AUZA 3AV0A 2V83A 3HXLA 3VK6A 1X48A 2LTRA 2L3JA 2DB2A 4BMJA 1UILA 1N34E 2G7HA 4LF5E 3HTXA 4JI1E 4F9BB 2LTSA 4JI0E 2MDRA 3OMLA 4BS9A 1N32E 2RTXA 2VQFE 3IWCA 3ADLA 4NXME 4M2ZA 2L2NA 4DR1E 2MC5A 4JI4E 4DMIA 2H36X 2B3TB 4X8WA 2CPNA 4Q28A 3J7Yp 2V85A 3T1HE 3HQ1A 4X66E 2L33A 2L6MA 1YYWA 3J81C 2NUGA 1ZBTA 2KOUA 1X49A 2E1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUQ A;  2NUE A;  4NXN E;  1YZ9 A;  1HR0 E;  2UXB E;  2HHH E;  2DIX A;  5LMU E;  2IHR 1;  2UUB E;  2RS7 A;  4WFT A;  4OX9 E;  1IBK E;  4DV2 E;  4OOG C;  1IBL E;  1IBM E;  2L3C A;  2UXD E;  1T4O A;  2B7V A;  2DMY A;  3VYY A;  1T4L B;  4LF8 E;  2ZM6 E;  4LFA E;  2NUF A;  1FJG E;  4DV1 E;  4JI5 E;  4DR2 E;  4JI1 E;  4M2Z A;  3T1Y E;  2JY9 A;  1RQ0 A;  4M30 A;  4DR6 E;  4DR3 E;  4DUZ E;  3P1X A;  4LF7 E;  3C4T A;  4JI3 E;  1DI2 A;  4JYA E;  4LF6 E;  2L2M A;  1XNR E;  4B3R E;  1PKP A;  2KHX A;  1N33 E;  2RSM A;  4X65 E;  2UU9 E;  1FKA E;  4DV4 E;  4DR5 E;  3C4B A;  1UHZ A;  4DR4 E;  2N3G A;  4LFC E;  1QU6 A;  2LBS B;  3VYX A;  4DV3 E;  1GQE A;  1YYO A;  4X62 E;  4LFB E;  4JV5 E;  2LJH A;  1HNZ E;  1YYK A;  4DV6 E;  5IWA E;  4JI6 E;  4LF4 E;  1O0W A;  2RS6 A;  4DKK A;  4DR7 E;  2VQE E;  2UXC E;  3ADI A;  1XMQ E;  4GKJ E;  4B3S E;  1XMO E;  1T4N A;  4X64 E;  4B3T E;  1N36 E;  1HNW E;  3ADJ A;  1EKZ A;  5BR8 E;  2E5L E;  1RC7 A;  3OTO E;  4AQY E;  4DV0 E;  1I94 E;  1X47 A;  2YT4 A;  4JI8 E;  1WHQ A;  3ADG A;  2UUC E;  4KHP E;  4WYQ B;  1J26 A;  2N3H A;  1WHN A;  2JVA A;  4JI7 E;  4B3M E;  4DV5 E;  4K0K E;  1HNX E;  4YY3 E;  1XNQ E;  1STU A;  4YHH E;  5LMN E;  2LUP B;  1J5E E;  4DUY E;  2F4V E;  2B7T A;  4JI2 E;  2NA2 A;  5CFF E;  4GKK E;  4DV7 E;  2UUA E;  3LLH A;  2EZ6 A;  2L2K B;  2LRS A;  1X48 A;  2LTR A;  2L3J A;  2DB2 A;  1N34 E;  1UIL A;  4LF5 E;  3HTX A;  2LTS A;  4JI0 E;  2MDR A;  1N32 E;  2RTX A;  2VQF E;  3ADL A;  4NXM E;  2L2N A;  4DR1 E;  4JI4 E;  2B3T B;  4X8W A;  2CPN A;  3J7Y p;  3T1H E;  4X66 E;  2L33 A;  1YYW A;  2NUG A;  1ZBT A;  4LF9 E;  1X49 A; 
#chains in the Genus database with same CATH topology
 1A1F A;  2BBG A;  2CTD A;  2V87 A;  2RQL A;  2YTP A;  3BGH A;  4TUI A;  5LLQ A;  2YWQ A;  5LMU E;  1NCS A;  2EN8 A;  2UUB E;  4R03 A;  4WFT A;  2BB8 A;  2EOJ A;  4OX9 E;  2EOQ A;  5IV8 B;  4P78 A;  1IBL E;  1IBM E;  2EN4 A;  5A69 A;  1A1G A;  2B7V A;  4WSP A;  2DLK A;  4O24 A;  1DQ3 A;  4MLV A;  1RMD A;  4R2D A;  1T39 A;  5A6B D;  2DRP A;  2YSO A;  4DV1 E;  3HPZ A;  3T1Y E;  2EOY A;  2VRD A;  2ODR C;  1RQ0 A;  2LJU A;  4DR3 E;  2LVH A;  4LF7 E;  1A1H A;  2L2M A;  1XNR E;  4B3R E;  2EOH A;  2EL4 A;  2KHX A;  4MLQ A;  2RSM A;  1N33 E;  2HC5 A;  2KON A;  4DR5 E;  2EOE A;  1KYQ A;  4X9J A;  3C4B A;  3EPL A;  4DR4 E;  2JWO A;  4KWY A;  1ZAA C;  4LFC E;  3JU0 A;  1QU6 A;  3VYX A;  2EM8 A;  2LO3 A;  4DV3 E;  2M9A A;  1ZU1 A;  2M4I A;  2EOX A;  2EPX A;  4R2Q A;  4ZYG A;  2LJH A;  1SFE A;  4DV6 E;  4HEI A;  2EMG A;  4GEQ B;  1EH8 A;  3JAM C;  2K4V A;  1AAY A;  1PJS A;  2LV2 A;  2YTN A;  2YU5 A;  3F6H A;  1GTK A;  4GKJ E;  5BR8 E;  5KL6 A;  1LLM C;  2WCC 3;  1RC7 A;  4F6M A;  4R8O A;  2L8T A;  3OTO E;  4AQY E;  2YT4 A;  4J8Z A;  2GPI A;  4R2C A;  3FIG A;  4KHP E;  1TF6 A;  2EN7 A;  2N3H A;  2JVA A;  2YTD A;  4DV5 E;  1HNX E;  2JP9 A;  4ZYD A;  2LUP B;  2F4V E;  1A1K A;  2EPC A;  2EZ6 A;  5LL6 R;  1WRJ A;  1EH6 A;  2DB2 A;  1N34 E;  1UIL A;  2A25 A;  4F9B B;  4JI0 E;  2MDR A;  4WX9 A;  3ADL A;  4RH8 A;  2B3T B;  4X8W A;  2YPN A;  3HQ1 A;  3MHS C;  2L33 A;  1YPN A;  1ZBT A;  4NZV A;  2CT1 A;  1WXR A;  2GLI A;  2I9I A;  2IHR 1;  1UN6 B;  5AE3 A;  4NHR A;  2FGG A;  3JTZ A;  5A2Q C;  1T38 A;  1G2F C;  2E72 A;  4BHC A;  2UXD E;  2YTJ A;  4ZYE A;  3VYY A;  1T4L B;  2EOI A;  4LFA E;  1X6F A;  2NUF A;  2EPL X;  1KJK A;  1YUI A;  2EWL A;  1GZ6 A;  4M30 A;  5IT9 C;  1DI2 A;  2ENC A;  1B69 A;  3IWD A;  5AC5 A;  1UBD C;  2N3G A;  1PJQ A;  4L8N A;  1IQS A;  2LBS B;  2EQ0 A;  1GQE A;  2V8Q B;  4RHB B;  3QG5 C;  4X62 E;  5A6K A;  1YYK A;  4JI6 E;  2EPP A;  3EPH A;  2YTO A;  1O0W A;  2VQE E;  3ADI A;  4LTY A;  2WZO A;  5AAS A;  5TSE A;  1YFH A;  2EN3 A;  1XMO E;  2YRM A;  4X64 E;  4B3T E;  4BC7 A;  1BBG A;  1N36 E;  2MDG A;  3KZZ A;  4N4R B;  1X47 A;  2UUC E;  2JOB A;  5KL2 A;  2V89 A;  2YRK A;  2EQ1 A;  1WHN A;  4JI7 E;  2JOX A;  5KL3 A;  2DGC A;  1F2I G;  2WBU A;  2HGH A;  5DNY A;  2EM9 A;  4YHH E;  1Z1B A;  1J5E E;  5A6B A;  4P7D A;  2F8B A;  2NA2 A;  4WXD A;  4R2A A;  4JI2 E;  3BF2 A;  4DV7 E;  2EL5 A;  4FK5 C;  3BID A;  3H09 A;  2LRS A;  3AUZ A;  2YU8 A;  2V83 A;  3VK6 A;  2EMF A;  3C6K A;  3HTX A;  2EPO A;  2DMI A;  2G7H A;  2WBT A;  2LTS A;  1N3G A;  1JK1 A;  1IMU A;  4NXM E;  2L2N A;  4DR1 E;  2MC5 A;  4DMI A;  2V85 A;  1QNT A;  2ELZ A;  4X66 E;  2L6M A;  2NUG A;  3J81 C;  1BB8 A;  2EM5 A;  2KOU A;  3EPK A;  4LF9 E;  5ADZ A;  2LUQ A;  2EPM X;  2EN1 A;  2UXB E;  2HHH E;  2DIX A;  2MKN A;  3KZY A;  2EMK A;  2EPA A;  3C6M A;  2EQ3 A;  2EM7 A;  2JYA A;  1JK2 A;  2FTX B;  1BBO A;  4DV2 E;  4F9C B;  2L3C A;  2LCE A;  1T4O A;  2Q8U A;  2EM2 A;  4GZN C;  2ZM6 E;  2EL6 A;  2EOF A;  1FJG E;  4JI5 E;  4JI1 E;  2L92 A;  2EML A;  4BBY A;  4DUZ E;  5AC4 A;  3C4T A;  4JI3 E;  2EJ4 A;  4JYA E;  4F6N A;  2EOZ A;  1PKP A;  2K7I A;  2UU9 E;  4X65 E;  1FKA E;  4DV4 E;  1TF3 A;  1UHZ A;  4IJD A;  2N8X A;  3TQM A;  2DLQ A;  2PRT A;  5F3W A;  5T6J A;  1YYO A;  2EE8 A;  4Q35 B;  4R2P A;  1HNZ E;  2J7J A;  5IWA E;  1G2D C;  4LF4 E;  1NEI A;  2RS6 A;  4DKK A;  3F6G A;  5KL7 A;  1TN9 A;  4WPY A;  1YUJ A;  2UXC E;  2VE7 C;  4BCA A;  2EPK X;  3MHH C;  1XMQ E;  5A6J A;  4B3S E;  2DSY A;  1T4N A;  2ADR A;  1HNW E;  2LMZ A;  3KWR A;  1MEY C;  2YTI A;  1EKZ A;  2YTF A;  4LU9 A;  1I94 E;  4M9V C;  1WHQ A;  3ADG A;  2EOO A;  4O43 A;  4WYQ B;  2ODR D;  2HJJ A;  1J26 A;  1X5W A;  2CSH A;  4YY3 E;  2YTG A;  2B7T A;  5CFF E;  4HTG A;  4GKK E;  2UUA E;  3J80 C;  3BBG A;  2L2K B;  2MC6 A;  2EMA A;  3THN A;  4R2S A;  1X48 A;  2LTR A;  4LF5 E;  1EH7 A;  2I13 A;  4BS9 A;  1N32 E;  2VQF E;  3IWC A;  2EMH A;  4JI4 E;  2H36 X;  2CPN A;  4Q28 A;  3J7Y p;  3T1H E;  4R2R A;  1A1J A;  4ZYH A;  1X49 A;  1DGC A;  4O5G A;  4R2E A;  4F54 A;  2WBS A;  2NUE A;  4NXN E;  2YTQ A;  1YZ9 A;  2EPU A;  1HR0 E;  2VF1 A;  2EM6 A;  3DF6 A;  2EP3 A;  2EM4 A;  2EN6 A;  2ENA A;  3UK3 C;  1PJT A;  2RS7 A;  2M1S A;  2NAB A;  1IBK E;  2M7Q A;  4OOG C;  2EMX A;  2JR1 A;  1X6E A;  2V86 A;  4O4K A;  2DMY A;  2JPA A;  4LF8 E;  2EOR A;  3IWB A;  1ZBQ A;  2MKD A;  1PDA A;  4I8O A;  4DR2 E;  4TUG A;  4WSG A;  5A6A A;  2JY9 A;  1A1L A;  4M2Z A;  5FLX C;  1X3C A;  4DR6 E;  2R1F A;  3P1X A;  3DJW A;  3EPJ A;  4LF6 E;  2EMW A;  2EMB A;  3ECR A;  2ENH A;  2LE2 A;  1A1I A;  2RSI A;  4L5N C;  3ZOQ B;  4M0V A;  5KL4 A;  2YTE A;  1WJP A;  5AE2 A;  2FV4 B;  2EPN A;  2YZT A;  2EMI A;  4KZS A;  2R76 A;  1AH5 A;  3J7A G;  3M99 B;  4LFB E;  4JV5 E;  4DR7 E;  3K6Q A;  1SR9 A;  3L00 A;  1L4S A;  2YRH A;  3LML A;  2B9D A;  4F9A B;  1YSA C;  3ADJ A;  3VHT B;  5KL5 A;  4BHB A;  3HPS A;  2E5L E;  2JXP A;  2GHF A;  4DV0 E;  4BC9 A;  4JI8 E;  3THO B;  5IXM B;  3RMP A;  2EM0 A;  4B3M E;  5AE1 A;  1IQO A;  2EPZ A;  4K0K E;  2EOS A;  1XNQ E;  1STU A;  1MGT A;  2EM3 A;  5LMN E;  2EMC A;  2EN2 A;  2V88 A;  4DUY E;  3MSW A;  2ELY A;  3EQ1 A;  2EOM A;  3LLH A;  2LT7 A;  1ZR9 A;  4F2J C;  3AV0 A;  3HXL A;  2YSP A;  2L3J A;  4BMJ A;  2D9H A;  2RPC A;  4WXC A;  3OML A;  2EMZ A;  2RTX A;  4IS1 C;  1X6H A;  2EMY A;  1YYW A;  2EPR A;  1P47 A;  2E1M A; 
#chains in the Genus database with same CATH homology
 5ADZ A;  4F54 A;  2V87 A;  2LUQ A;  2NUE A;  4NXN E;  1YZ9 A;  1HR0 E;  1WXR A;  2VF1 A;  2UXB E;  3DF6 A;  4TUI A;  2HHH E;  2DIX A;  5LMU E;  2IHR 1;  2UUB E;  5AE3 A;  4R03 A;  2RS7 A;  2FGG A;  2M1S A;  4WFT A;  4OX9 E;  3JTZ A;  5A2Q C;  2M7Q A;  2FTX B;  1IBK E;  4DV2 E;  4P78 A;  4OOG C;  1IBL E;  1IBM E;  4F9C B;  2L3C A;  2JR1 A;  2UXD E;  1T4O A;  2V86 A;  2B7V A;  2DMY A;  4WSP A;  3VYY A;  1T4L B;  4LF8 E;  1DQ3 A;  3IWB A;  1ZBQ A;  2ZM6 E;  4LFA E;  2NUF A;  1FJG E;  4DV1 E;  4JI5 E;  4I8O A;  4DR2 E;  4TUG A;  3HPZ A;  2L92 A;  2JY9 A;  4BBY A;  3T1Y E;  2ODR C;  2EWL A;  1GZ6 A;  1RQ0 A;  4M30 A;  5FLX C;  4DR6 E;  4DR3 E;  5IT9 C;  4DUZ E;  3P1X A;  4LF7 E;  3C4T A;  3DJW A;  4JI3 E;  1DI2 A;  4JYA E;  4LF6 E;  2L2M A;  1XNR E;  4B3R E;  1PKP A;  2KHX A;  1N33 E;  2RSM A;  4X65 E;  2UU9 E;  2KON A;  1FKA E;  4DV4 E;  3IWD A;  4DR5 E;  3C4B A;  1UHZ A;  4LF9 E;  2JWO A;  2LE2 A;  4DR4 E;  2N3G A;  4L5N C;  4L8N A;  3ZOQ B;  4LFC E;  4M0V A;  3JU0 A;  1QU6 A;  2LBS B;  3VYX A;  5F3W A;  4DV3 E;  1GQE A;  2V8Q B;  5T6J A;  5AE2 A;  2FV4 B;  1YYO A;  2YZT A;  4KZS A;  2M4I A;  4X62 E;  3J7A G;  4LFB E;  4JV5 E;  2LJH A;  1HNZ E;  1YYK A;  4DV6 E;  5IWA E;  4GEQ B;  4JI6 E;  4LF4 E;  1O0W A;  2RS6 A;  4DKK A;  3F6G A;  4DR7 E;  3JAM C;  3K6Q A;  4WPY A;  2VQE E;  1SR9 A;  2K4V A;  2UXC E;  2VE7 C;  4BCA A;  4LTY A;  3ADI A;  3LML A;  2WZO A;  5AAS A;  3F6H A;  2B9D A;  1XMQ E;  4B3S E;  2DSY A;  4GKJ E;  1XMO E;  4F9A B;  1T4N A;  4X64 E;  4BC7 A;  4B3T E;  1N36 E;  1HNW E;  2LMZ A;  3ADJ A;  3KWR A;  1EKZ A;  5BR8 E;  3HPS A;  2E5L E;  1RC7 A;  4R8O A;  2L8T A;  3OTO E;  4DV0 E;  4BC9 A;  4LU9 A;  4AQY E;  1X47 A;  1I94 E;  2YT4 A;  4JI8 E;  4J8Z A;  1WHQ A;  3ADG A;  2UUC E;  3FIG A;  2JOB A;  4KHP E;  2V89 A;  4WYQ B;  3RMP A;  2ODR D;  2N3H A;  1J26 A;  1WHN A;  2JOX A;  2JVA A;  4JI7 E;  4B3M E;  5AE1 A;  4DV5 E;  4K0K E;  1HNX E;  4YY3 E;  5DNY A;  1STU A;  4YHH E;  1XNQ E;  5LMN E;  2LUP B;  2V88 A;  1J5E E;  4P7D A;  4DUY E;  2F4V E;  2B7T A;  3MSW A;  2F8B A;  2NA2 A;  5CFF E;  4JI2 E;  4GKK E;  4DV7 E;  2UUA E;  3LLH A;  3J80 C;  2EZ6 A;  2L2K B;  5LL6 R;  3H09 A;  2LRS A;  2MC6 A;  3AUZ A;  3AV0 A;  2V83 A;  3HXL A;  3VK6 A;  1X48 A;  2LTR A;  2L3J A;  2DB2 A;  4BMJ A;  1UIL A;  1N34 E;  2G7H A;  4LF5 E;  3HTX A;  4JI1 E;  4F9B B;  2LTS A;  4JI0 E;  2MDR A;  3OML A;  4BS9 A;  1N32 E;  2RTX A;  2VQF E;  3IWC A;  3ADL A;  4NXM E;  4M2Z A;  2L2N A;  4DR1 E;  2MC5 A;  4JI4 E;  4DMI A;  2H36 X;  2B3T B;  4X8W A;  2CPN A;  4Q28 A;  3J7Y p;  2V85 A;  3T1H E;  3HQ1 A;  4X66 E;  2L33 A;  2L6M A;  1YYW A;  3J81 C;  2NUG A;  1ZBT A;  2KOU A;  1X49 A;  2E1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...