2LTRA

Solution structure of rde-4(32-136)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
NRTDLEMFLKKTPLMVLEEAAKAVYQKTPTWGTVELPEGFEMTLILNEITVKGQATSKKAARQKAAVEYLRKVVEKGKHEIFFIPGTTKEEALSNIDQISDKAEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of RDE-4 dsRBDs and mutational studies provide insights into dsRNA recognition in the Caenorhabditis elegans RNAi pathway.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Rna binding protein
molecule keywords Protein RDE-4
total genus 29
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2012-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ltrA00
4JYAE 4LF9E 4WFTA 2B3TB 3LLHA 4B3ME 1STUA 4X65E 1XMQE 1T4LB 1T4NA 2NUFA 4OOGC 1DI2A 2DMYA 4JI5E 3VYYA 2UXBE 1HR0E 4LF8E 4OX9E 4DUYE 4B3SE 2VQFE 1XNQE 4NXME 4LF7E 2VQEE 4DR4E 1N36E 1IBME 1EKZA 1GQEA 2L3JA 2L33A 2UUAE 4JI2E 4DV7E 2EZ6A 4DV1E 2CPNA 4DR1E 1I94E 1UHZA 2LTRA 1PKPA 4DR2E 2LBSB 2NUGA 4YY3E 4LF5E 4JI6E 2JVAA 1T4OA 3P1XA 2JY9A 1QU6A 2F4VE 4GKKE 2UXDE 3VYXA 2UUCE 2DIXA 2B7TA 2N3HA 3ADGA 1FKAE 2DB2A 4X8WA 2L2KB 4JI4E 4DV6E 1N34E 4DV4E 1RC7A 4B3TE 4DR6E 1RQ0A 3C4TA 5BR8E 2RS6A 5CFFE 2RTXA 4DKKA 4JI7E 2UXCE 5LMUE 1N32E 1HNXE 4WYQB 1ZBTA 3T1YE 4X66E 4DV0E 1HNZE 4JI1E 2UUBE 2L2MA 1UILA 2ZM6E 5LMNE 1XMOE 1WHNA 4JI8E 1XNRE 1YZ9A 3OTOE 2IHR1 1X48A 4AQYE 4DV2E 4LFAE 4M2ZA 4LFCE 4M30A 4X64E 1YYOA 1J26A 4DUZE 2HHHE 2YT4A 2NA2A 4DV3E 1X47A 3ADLA 3J7Yp 3ADIA 1J5EE 2MDRA 1IBLE 2E5LE 3T1HE 4KHPE 1YYKA 2UU9E 1YYWA 4JI0E 4DR3E 3C4BA 4B3RE 4DR7E 1HNWE 4JV5E 4LFBE 2RSMA 4DV5E 4DR5E 4X62E 4K0KE 2LUQA 2LTSA 1X49A 2L2NA 4NXNE 5IWAE 2LRSA 4YHHE 4JI3E 4LF4E 1N33E 2B7VA 2N3GA 3HTXA 4LF6E 2NUEA 2RS7A 3ADJA 2L3CA 1O0WA 2LUPB 1IBKE 4GKJE 1FJGE 1WHQA 2KHXA 2LJHA
chains in the Genus database with same CATH superfamily
1B69A 2HC5A 2G7HA 2B3TB 2JWOA 1F2IG 4R03A 2CTDA 2ENHA 4BC7A 4X65E 3ECRA 5T6JA 1T4LB 3J7AG 1GTKA 3VYYA 4DUYE 4F6MA 4B3SE 1TF6A 2EM9A 5A6BD 2L6MA 4DR4E 1IBME 1SR9A 5KL4A 1GZ6A 4BCAA 1YUJA 2EMFA 2K7IA 2UUAE 4DV1E 5IV8B 4DR1E 1I94E 1UHZA 2LBSB 2YTOA 3ZOQB 2EL5A 2EPPA 2JVAA 5KL2A 1AAYA 2JYAA 1UN6B 4GKKE 3VYXA 3ADGA 2LT7A 2MC6A 4P78A 5AASA 4JI4E 1JK1A 1EH7A 4BMJA 3AUZA 1P47A 4L5NC 4B3TE 1RQ0A 3C4TA 2RS6A 2RTXA 4JI7E 2MKNA 1LLMC 2RPCA 3EQ1A 3T1YE 2EE8A 3TQMA 1ZAAC 2L2MA 1WRJA 1X6HA 4Q35B 5LMNE 1XMOE 1QNTA 2B9DA 2YTEA 1EH8A 3OTOE 3JAMC 4HTGA 2YTQA 1G2FC 2ENAA 4M2ZA 2YTNA 2YSOA 4BC9A 1YYOA 5LLQA 4RHBB 2EPRA 4IS1C 3IWBA 4O5GA 2EOIA 3KZZA 2EMAA 1WXRA 1YYKA 2EN2A 4O24A 2LE2A 1Z1BA 2EQ3A 2NABA 2PRTA 4B3RE 2EM4A 4N4RB 4LFBE 5KL7A 5ADZA 4DV5E 4F9CB 4O43A 2MDGA 2EOHA 2LTSA 2V87A 3UK3C 3IWCA 4P7DA 2YWQA 2LRSA 4R2AA 4LF4E 4HEIA 2B7VA 2N3GA 5A2QC 4GKJE 1UBDC 1MEYC 5FLXC 4BHCA 4F9BB 2FTXB 3HPZA 2V88A 2EOQA 4WX9A 4B3ME 2LV2A 1L4SA 1STUA 2EPOA 3BF2A 3M99B 4X9JA 2JPAA 4OOGC 2A25A 1DI2A 4JI5E 2EN1A 2LCEA 2CSHA 2EMKA 2EMWA 1HR0E 2EPCA 4I8OA 1A1GA 3EPHA 2VQFE 1XNQE 2EOFA 2E72A 4WXCA 2EPUA 1GQEA 1T39A 4R2DA 2EQ0A 4JI2E 1PDAA 2LO3A 3LMLA 2EZ6A 3JTZA 2LTRA 1PKPA 5KL3A 2J7JA 1DQ3A 2EMLA 2LMZA 4DR2E 2NUGA 4F9AB 4YY3E 5IXMB 2ODRC 4FK5C 2F4VE 2UXDE 2MC5A 1A1JA 2B7TA 2N3HA 1FKAE 4R2QA 1A1HA 2EN3A 2EP3A 1ZR9A 3HQ1A 3JU0A 2EM7A 2EPXA 2L8TA 2VRDA 4WSPA 2WZOA 2EWLA 2VE7C 3MHSC 2JOXA 1HNXE 1ZBTA 3MSWA 4X66E 3VHTB 1G2DC 2EMGA 3H09A 2M9AA 3OMLA 2UUBE 2F8BA 2JOBA 2K4VA 5AE3A 1IMUA 1EH6A 2YTDA 4NZVA 1YUIA 2V86A 2EMHA 4F6NA 2V8QB 1PJTA 1T38A 2IHR1 4AQYE 2DMIA 4R2RA 4LFCE 4TUGA 2EOOA 2EM8A 1X47A 3VK6A 5F3WA 4R2CA 1SFEA 2MDRA 2EPMX 2E5LE 3T1HE 2YU8A 2LVHA 1X6EA 2UU9E 1YYWA 2L92A 4DR3E 4JV5E 3BGHA 4X62E 3J81C 2N8XA 3AV0A 4M9VC 2EMZA 2EL6A 1PJQA 1N33E 5AE1A 2DSYA 4LF6E 2KHXA 5TSEA 4LF9E 1WJPA 2YTFA 2EL4A 4R2PA 1JK2A 5KL5A 2KONA 2EN6A 2EOXA 3LLHA 4L8NA 2KOUA 2M1SA 1XMQE 3EPJA 1T4NA 2NUFA 2WBUA 2DMYA 2Q8UA 2ELZA 4OX9E 3DJWA 2EMYA 5KL6A 1BBOA 4F2JC 3BBGA 4NXME 1TN9A 2I13A 2M7QA 1N36E 4BBYA 4BHBA 2L33A 2ADRA 4DV7E 3K6QA 2YSPA 4ZYDA 2YRHA 4J8ZA 2YTIA 3C6MA 4LF5E 3THOB 2JY9A 1QU6A 5AC5A 2UUCE 2DIXA 1A1IA 2DB2A 4NHRA 3HPSA 5A6KA 4DV6E 2EM5A 2EOJA 1N34E 1RC7A 4DR6E 5BR8E 2RQLA 4DKKA 2UXCE 4MLQA 4WYQB 1ZU1A 1HNZE 1NEIA 2EPZA 4JI1E 2ZM6E 4GZNC 4JI8E 5LL6R 1XNRE 1YZ9A 4Q28A 2H36X 2EM3A 4IJDA 2WCC3 4DV2E 4LFAE 4LTYA 4M30A 5DNYA 4X64E 2EOYA 3THNA 3J80C 1J26A 2EORA 4DUZE 2HHHE 2YRMA 2YT4A 2EM2A 4DMIA 5A69A 2VF1A 2EJ4A 2YRKA 3J7Yp 3IWDA 3ADIA 1NCSA 1IBLE 4KHPE 2YTJA 3HXLA 2DGCA 2RSMA 2FGGA 4MLVA 2LUQA 2L2NA 2MKDA 2LJUA 1DGCA 3C6KA 4WXDA 2RS7A 4GEQB 3ADJA 4RH8A 1O0WA 2LUPB 1PJSA 1ZBQA 2HJJA 1WHQA 2EPNA 3L00A 4M0VA 2DRPA 4O4KA 2LJHA 1TF3A 3HTXA 1X3CA 3EPLA 4JYAE 2EOEA 4WFTA 1X6FA 3KWRA 1KJKA 1A1KA 1N3GA 2WBSA 4R2EA 4ZYGA 2JR1A 2E1MA 2EN8A 4KWYA 2GHFA 2GLIA 2YU5A 3QG5C 2EMBA 2UXBE 4LF8E 4LF7E 5A6AA 5A6JA 3RMPA 4F54A 2VQEE 1YSAC 1EKZA 2YTGA 2L3JA 4WPYA 2D9HA 2CPNA 4ZYEA 5IT9C 2HGHA 3KZYA 2EM6A 2EOMA 4JI6E 2EMIA 3P1XA 2R76A 2V85A 4WSGA 4KZSA 4X8WA 2L2KB 2JXPA 2DLQA 2EPKX 2EQ1A 2I9IA 1BB8A 3EPKA 5AC4A 2V89A 4DV4E 4BS9A 3F6GA 5CFFE 2EOZA 5LMUE 1A1LA 1N32E 2EPLX 2EM0A 2YTPA 2DLKA 4DV0E 2R1FA 3FIGA 2ELYA 1UILA 2JP9A 1WHNA 2EOSA 2V83A 2EMCA 3DF6A 2ODRD 1YPNA 1X48A 2WBTA 4LU9A 4R2SA 1RMDA 2BB8A 5A6BA 2EN4A 5AE2A 2NA2A 1MGTA 4DV3E 2CT1A 2RSIA 3ADLA 2GPIA 2YPNA 4TUIA 1A1FA 1J5EE 1KYQA 3F6HA 4ZYHA 4JI0E 2BBGA 2EPAA 2EMXA 3C4BA 4DR7E 1HNWE 4DR5E 4K0KE 2YZTA 1X49A 3MHHC 1YFHA 1BBGA 4NXNE 5IWAE 2FV4B 1X5WA 3BIDA 4R8OA 4YHHE 4JI3E 1IQOA 1AH5A 1IQSA 2EN7A 2ENCA 2NUEA 2M4IA 2L3CA 1IBKE 1FJGE 1T4OA
chains in the Genus database with same CATH topology
4JYAE 4LF9E 5FLXC 4WFTA 2G7HA 3KWRA 4F9BB 2B3TB 2FTXB 2JWOA 2KONA 3HPZA 2V88A 4R03A 2JR1A 3LLHA 2E1MA 4B3ME 4L8NA 1STUA 4BC7A 4X65E 2KOUA 2M1SA 1XMQE 5T6JA 1T4LB 3J7AG 1T4NA 2NUFA 4OOGC 1DI2A 2DMYA 4JI5E 3VYYA 2UXBE 1HR0E 4LF8E 4OX9E 4DUYE 4I8OA 3DJWA 4B3SE 2VQFE 1XNQE 4NXME 4LF7E 3RMPA 2M7QA 2L6MA 4F54A 2VQEE 4DR4E 1N36E 1IBME 1SR9A 4BBYA 1EKZA 1GQEA 1GZ6A 4BCAA 2L33A 2L3JA 2UUAE 4JI2E 4WPYA 3LMLA 4DV1E 3JTZA 2CPNA 4DV7E 4DR1E 2EZ6A 1I94E 1UHZA 2LTRA 1PKPA 3K6QA 5IT9C 1DQ3A 4DR2E 2LMZA 2LBSB 4J8ZA 2NUGA 4F9AB 4YY3E 3ZOQB 4LF5E 4JI6E 2JVAA 1T4OA 2ODRC 3P1XA 2JY9A 1QU6A 2F4VE 2V85A 4GKKE 2UXDE 2MC5A 2UUCE 3VYXA 2DIXA 2B7TA 2N3HA 3ADGA 1FKAE 2MC6A 4KZSA 2DB2A 4X8WA 2L2KB 4P78A 5AASA 4JI4E 3HQ1A 2L8TA 3HPSA 3JU0A 4DV6E 4BMJA 1N34E 4WSPA 2WZOA 2EWLA 2V89A 3AUZA 2VE7C 4L5NC 4BS9A 4DV4E 1RC7A 4B3TE 1RQ0A 3F6GA 4DR6E 3C4TA 5BR8E 2RS6A 2JOXA 5CFFE 2RTXA 4DKKA 4JI7E 2UXCE 5LMUE 1N32E 1HNXE 4WYQB 1ZBTA 3MSWA 3T1YE 4X66E 4DV0E 1HNZE 3H09A 4JI1E 3OMLA 3FIGA 2UUBE 2L2MA 1UILA 2F8BA 2ZM6E 5LMNE 1XMOE 2JOBA 2B9DA 1WHNA 2K4VA 5LL6R 2V83A 4JI8E 5AE3A 1XNRE 3DF6A 1YZ9A 2V86A 2ODRD 2V8QB 3OTOE 4Q28A 2IHR1 3JAMC 1X48A 2H36X 4AQYE 4LU9A 4DV2E 4LFAE 4M2ZA 4LTYA 4LFCE 4M30A 5DNYA 4BC9A 4X64E 1YYOA 5AE2A 3J80C 1J26A 4TUGA 4DUZE 2HHHE 2YT4A 2NA2A 3IWBA 4DV3E 1X47A 3VK6A 4DMIA 5F3WA 3ADLA 2VF1A 3J7Yp 1WXRA 3IWDA 4TUIA 3ADIA 1J5EE 2MDRA 1IBLE 2E5LE 3T1HE 3F6HA 4KHPE 1YYKA 2LE2A 2UU9E 3HXLA 1YYWA 2L92A 4JI0E 4DR3E 3C4BA 4B3RE 4DR7E 1HNWE 4JV5E 4LFBE 2RSMA 5ADZA 4DV5E 4F9CB 2FGGA 4X62E 4DR5E 4K0KE 3J81C 2LUQA 2LTSA 2V87A 1X49A 2L2NA 2YZTA 4NXNE 3IWCA 4P7DA 2FV4B 3AV0A 5IWAE 4R8OA 2LRSA 4YHHE 4JI3E 4LF4E 1N33E 5AE1A 2B7VA 2DSYA 2N3GA 5A2QC 3HTXA 4LF6E 2NUEA 2M4IA 2RS7A 4GEQB 3ADJA 2L3CA 1O0WA 2LUPB 1IBKE 1ZBQA 4M0VA 1FJGE 1WHQA 2KHXA 4GKJE 2LJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYA E;  4LF9 E;  4WFT A;  2B3T B;  3LLH A;  4B3M E;  1STU A;  4X65 E;  1XMQ E;  1T4L B;  1T4N A;  2NUF A;  4OOG C;  1DI2 A;  2DMY A;  4JI5 E;  3VYY A;  2UXB E;  1HR0 E;  4LF8 E;  4OX9 E;  4DUY E;  4B3S E;  2VQF E;  1XNQ E;  4NXM E;  4LF7 E;  2VQE E;  4DR4 E;  1N36 E;  1IBM E;  1EKZ A;  1GQE A;  2L3J A;  2L33 A;  2UUA E;  4JI2 E;  4DV7 E;  2EZ6 A;  4DV1 E;  2CPN A;  4DR1 E;  1I94 E;  1UHZ A;  2LTR A;  1PKP A;  4DR2 E;  2LBS B;  2NUG A;  4YY3 E;  4LF5 E;  4JI6 E;  2JVA A;  1T4O A;  3P1X A;  2JY9 A;  1QU6 A;  2F4V E;  4GKK E;  2UXD E;  3VYX A;  2UUC E;  2DIX A;  2B7T A;  2N3H A;  3ADG A;  1FKA E;  2DB2 A;  4X8W A;  2L2K B;  4JI4 E;  4DV6 E;  1N34 E;  4DV4 E;  1RC7 A;  4B3T E;  4DR6 E;  1RQ0 A;  3C4T A;  5BR8 E;  2RS6 A;  5CFF E;  2RTX A;  4DKK A;  4JI7 E;  2UXC E;  5LMU E;  1N32 E;  1HNX E;  4WYQ B;  1ZBT A;  3T1Y E;  4X66 E;  4DV0 E;  1HNZ E;  4JI1 E;  2UUB E;  2L2M A;  1UIL A;  2ZM6 E;  5LMN E;  1XMO E;  1WHN A;  4JI8 E;  1XNR E;  1YZ9 A;  3OTO E;  2IHR 1;  1X48 A;  4AQY E;  4DV2 E;  4LFA E;  4M2Z A;  4LFC E;  4M30 A;  4X64 E;  1YYO A;  1J26 A;  4DUZ E;  2HHH E;  2YT4 A;  2NA2 A;  4DV3 E;  1X47 A;  3ADL A;  3J7Y p;  3ADI A;  1J5E E;  2MDR A;  1IBL E;  2E5L E;  3T1H E;  4KHP E;  1YYK A;  2UU9 E;  1YYW A;  4JI0 E;  4DR3 E;  3C4B A;  4B3R E;  4DR7 E;  1HNW E;  4JV5 E;  4LFB E;  2RSM A;  4DV5 E;  4DR5 E;  4X62 E;  4K0K E;  2LUQ A;  2LTS A;  1X49 A;  2L2N A;  4NXN E;  5IWA E;  2LRS A;  4YHH E;  4JI3 E;  4LF4 E;  1N33 E;  2B7V A;  2N3G A;  3HTX A;  4LF6 E;  2NUE A;  2RS7 A;  3ADJ A;  2L3C A;  1O0W A;  2LUP B;  1IBK E;  4GKJ E;  1FJG E;  1WHQ A;  2KHX A;  2LJH A; 
#chains in the Genus database with same CATH topology
 1B69 A;  2HC5 A;  2G7H A;  2B3T B;  2JWO A;  1F2I G;  4R03 A;  2CTD A;  2ENH A;  4BC7 A;  4X65 E;  3ECR A;  5T6J A;  1T4L B;  3J7A G;  1GTK A;  3VYY A;  4DUY E;  4F6M A;  4B3S E;  1TF6 A;  2EM9 A;  5A6B D;  2L6M A;  4DR4 E;  1IBM E;  1SR9 A;  5KL4 A;  1GZ6 A;  4BCA A;  1YUJ A;  2EMF A;  2K7I A;  2UUA E;  4DV1 E;  5IV8 B;  4DR1 E;  1I94 E;  1UHZ A;  2LBS B;  2YTO A;  3ZOQ B;  2EL5 A;  2EPP A;  2JVA A;  5KL2 A;  1AAY A;  2JYA A;  1UN6 B;  4GKK E;  3VYX A;  3ADG A;  2LT7 A;  2MC6 A;  4P78 A;  5AAS A;  4JI4 E;  1JK1 A;  1EH7 A;  4BMJ A;  3AUZ A;  1P47 A;  4L5N C;  4B3T E;  1RQ0 A;  3C4T A;  2RS6 A;  2RTX A;  4JI7 E;  2MKN A;  1LLM C;  2RPC A;  3EQ1 A;  3T1Y E;  2EE8 A;  3TQM A;  1ZAA C;  2L2M A;  1WRJ A;  1X6H A;  4Q35 B;  5LMN E;  1XMO E;  1QNT A;  2B9D A;  2YTE A;  1EH8 A;  3OTO E;  3JAM C;  4HTG A;  2YTQ A;  1G2F C;  2ENA A;  4M2Z A;  2YTN A;  2YSO A;  4BC9 A;  1YYO A;  5LLQ A;  4RHB B;  2EPR A;  4IS1 C;  3IWB A;  4O5G A;  2EOI A;  3KZZ A;  2EMA A;  1WXR A;  1YYK A;  2EN2 A;  4O24 A;  2LE2 A;  1Z1B A;  2EQ3 A;  2NAB A;  2PRT A;  4B3R E;  2EM4 A;  4N4R B;  4LFB E;  5KL7 A;  5ADZ A;  4DV5 E;  4F9C B;  4O43 A;  2MDG A;  2EOH A;  2LTS A;  2V87 A;  3UK3 C;  3IWC A;  4P7D A;  2YWQ A;  2LRS A;  4R2A A;  4LF4 E;  4HEI A;  2B7V A;  2N3G A;  5A2Q C;  4GKJ E;  1UBD C;  1MEY C;  5FLX C;  4BHC A;  4F9B B;  2FTX B;  3HPZ A;  2V88 A;  2EOQ A;  4WX9 A;  4B3M E;  2LV2 A;  1L4S A;  1STU A;  2EPO A;  3BF2 A;  3M99 B;  4X9J A;  2JPA A;  4OOG C;  2A25 A;  1DI2 A;  4JI5 E;  2EN1 A;  2LCE A;  2CSH A;  2EMK A;  2EMW A;  1HR0 E;  2EPC A;  4I8O A;  1A1G A;  3EPH A;  2VQF E;  1XNQ E;  2EOF A;  2E72 A;  4WXC A;  2EPU A;  1GQE A;  1T39 A;  4R2D A;  2EQ0 A;  4JI2 E;  1PDA A;  2LO3 A;  3LML A;  2EZ6 A;  3JTZ A;  2LTR A;  1PKP A;  5KL3 A;  2J7J A;  1DQ3 A;  2EML A;  2LMZ A;  4DR2 E;  2NUG A;  4F9A B;  4YY3 E;  5IXM B;  2ODR C;  4FK5 C;  2F4V E;  2UXD E;  2MC5 A;  1A1J A;  2B7T A;  2N3H A;  1FKA E;  4R2Q A;  1A1H A;  2EN3 A;  2EP3 A;  1ZR9 A;  3HQ1 A;  3JU0 A;  2EM7 A;  2EPX A;  2L8T A;  2VRD A;  4WSP A;  2WZO A;  2EWL A;  2VE7 C;  3MHS C;  2JOX A;  1HNX E;  1ZBT A;  3MSW A;  4X66 E;  3VHT B;  1G2D C;  2EMG A;  3H09 A;  2M9A A;  3OML A;  2UUB E;  2F8B A;  2JOB A;  2K4V A;  5AE3 A;  1IMU A;  1EH6 A;  2YTD A;  4NZV A;  1YUI A;  2V86 A;  2EMH A;  4F6N A;  2V8Q B;  1PJT A;  1T38 A;  2IHR 1;  4AQY E;  2DMI A;  4R2R A;  4LFC E;  4TUG A;  2EOO A;  2EM8 A;  1X47 A;  3VK6 A;  5F3W A;  4R2C A;  1SFE A;  2MDR A;  2EPM X;  2E5L E;  3T1H E;  2YU8 A;  2LVH A;  1X6E A;  2UU9 E;  1YYW A;  2L92 A;  4DR3 E;  4JV5 E;  3BGH A;  4X62 E;  3J81 C;  2N8X A;  3AV0 A;  4M9V C;  2EMZ A;  2EL6 A;  1PJQ A;  1N33 E;  5AE1 A;  2DSY A;  4LF6 E;  2KHX A;  5TSE A;  4LF9 E;  1WJP A;  2YTF A;  2EL4 A;  4R2P A;  1JK2 A;  5KL5 A;  2KON A;  2EN6 A;  2EOX A;  3LLH A;  4L8N A;  2KOU A;  2M1S A;  1XMQ E;  3EPJ A;  1T4N A;  2NUF A;  2WBU A;  2DMY A;  2Q8U A;  2ELZ A;  4OX9 E;  3DJW A;  2EMY A;  5KL6 A;  1BBO A;  4F2J C;  3BBG A;  4NXM E;  1TN9 A;  2I13 A;  2M7Q A;  1N36 E;  4BBY A;  4BHB A;  2L33 A;  2ADR A;  4DV7 E;  3K6Q A;  2YSP A;  4ZYD A;  2YRH A;  4J8Z A;  2YTI A;  3C6M A;  4LF5 E;  3THO B;  2JY9 A;  1QU6 A;  5AC5 A;  2UUC E;  2DIX A;  1A1I A;  2DB2 A;  4NHR A;  3HPS A;  5A6K A;  4DV6 E;  2EM5 A;  2EOJ A;  1N34 E;  1RC7 A;  4DR6 E;  5BR8 E;  2RQL A;  4DKK A;  2UXC E;  4MLQ A;  4WYQ B;  1ZU1 A;  1HNZ E;  1NEI A;  2EPZ A;  4JI1 E;  2ZM6 E;  4GZN C;  4JI8 E;  5LL6 R;  1XNR E;  1YZ9 A;  4Q28 A;  2H36 X;  2EM3 A;  4IJD A;  2WCC 3;  4DV2 E;  4LFA E;  4LTY A;  4M30 A;  5DNY A;  4X64 E;  2EOY A;  3THN A;  3J80 C;  1J26 A;  2EOR A;  4DUZ E;  2HHH E;  2YRM A;  2YT4 A;  2EM2 A;  4DMI A;  5A69 A;  2VF1 A;  2EJ4 A;  2YRK A;  3J7Y p;  3IWD A;  3ADI A;  1NCS A;  1IBL E;  4KHP E;  2YTJ A;  3HXL A;  2DGC A;  2RSM A;  2FGG A;  4MLV A;  2LUQ A;  2L2N A;  2MKD A;  2LJU A;  1DGC A;  3C6K A;  4WXD A;  2RS7 A;  4GEQ B;  3ADJ A;  4RH8 A;  1O0W A;  2LUP B;  1PJS A;  1ZBQ A;  2HJJ A;  1WHQ A;  2EPN A;  3L00 A;  4M0V A;  2DRP A;  4O4K A;  2LJH A;  1TF3 A;  3HTX A;  1X3C A;  3EPL A;  4JYA E;  2EOE A;  4WFT A;  1X6F A;  3KWR A;  1KJK A;  1A1K A;  1N3G A;  2WBS A;  4R2E A;  4ZYG A;  2JR1 A;  2E1M A;  2EN8 A;  4KWY A;  2GHF A;  2GLI A;  2YU5 A;  3QG5 C;  2EMB A;  2UXB E;  4LF8 E;  4LF7 E;  5A6A A;  5A6J A;  3RMP A;  4F54 A;  2VQE E;  1YSA C;  1EKZ A;  2YTG A;  2L3J A;  4WPY A;  2D9H A;  2CPN A;  4ZYE A;  5IT9 C;  2HGH A;  3KZY A;  2EM6 A;  2EOM A;  4JI6 E;  2EMI A;  3P1X A;  2R76 A;  2V85 A;  4WSG A;  4KZS A;  4X8W A;  2L2K B;  2JXP A;  2DLQ A;  2EPK X;  2EQ1 A;  2I9I A;  1BB8 A;  3EPK A;  5AC4 A;  2V89 A;  4DV4 E;  4BS9 A;  3F6G A;  5CFF E;  2EOZ A;  5LMU E;  1A1L A;  1N32 E;  2EPL X;  2EM0 A;  2YTP A;  2DLK A;  4DV0 E;  2R1F A;  3FIG A;  2ELY A;  1UIL A;  2JP9 A;  1WHN A;  2EOS A;  2V83 A;  2EMC A;  3DF6 A;  2ODR D;  1YPN A;  1X48 A;  2WBT A;  4LU9 A;  4R2S A;  1RMD A;  2BB8 A;  5A6B A;  2EN4 A;  5AE2 A;  2NA2 A;  1MGT A;  4DV3 E;  2CT1 A;  2RSI A;  3ADL A;  2GPI A;  2YPN A;  4TUI A;  1A1F A;  1J5E E;  1KYQ A;  3F6H A;  4ZYH A;  4JI0 E;  2BBG A;  2EPA A;  2EMX A;  3C4B A;  4DR7 E;  1HNW E;  4DR5 E;  4K0K E;  2YZT A;  1X49 A;  3MHH C;  1YFH A;  1BBG A;  4NXN E;  5IWA E;  2FV4 B;  1X5W A;  3BID A;  4R8O A;  4YHH E;  4JI3 E;  1IQO A;  1AH5 A;  1IQS A;  2EN7 A;  2ENC A;  2NUE A;  2M4I A;  2L3C A;  1IBK E;  1FJG E;  1T4O A; 
#chains in the Genus database with same CATH homology
 4JYA E;  4LF9 E;  5FLX C;  4WFT A;  2G7H A;  3KWR A;  4F9B B;  2B3T B;  2FTX B;  2JWO A;  2KON A;  3HPZ A;  2V88 A;  4R03 A;  2JR1 A;  3LLH A;  2E1M A;  4B3M E;  4L8N A;  1STU A;  4BC7 A;  4X65 E;  2KOU A;  2M1S A;  1XMQ E;  5T6J A;  1T4L B;  3J7A G;  1T4N A;  2NUF A;  4OOG C;  1DI2 A;  2DMY A;  4JI5 E;  3VYY A;  2UXB E;  1HR0 E;  4LF8 E;  4OX9 E;  4DUY E;  4I8O A;  3DJW A;  4B3S E;  2VQF E;  1XNQ E;  4NXM E;  4LF7 E;  3RMP A;  2M7Q A;  2L6M A;  4F54 A;  2VQE E;  4DR4 E;  1N36 E;  1IBM E;  1SR9 A;  4BBY A;  1EKZ A;  1GQE A;  1GZ6 A;  4BCA A;  2L33 A;  2L3J A;  2UUA E;  4JI2 E;  4WPY A;  3LML A;  4DV1 E;  3JTZ A;  2CPN A;  4DV7 E;  4DR1 E;  2EZ6 A;  1I94 E;  1UHZ A;  2LTR A;  1PKP A;  3K6Q A;  5IT9 C;  1DQ3 A;  4DR2 E;  2LMZ A;  2LBS B;  4J8Z A;  2NUG A;  4F9A B;  4YY3 E;  3ZOQ B;  4LF5 E;  4JI6 E;  2JVA A;  1T4O A;  2ODR C;  3P1X A;  2JY9 A;  1QU6 A;  2F4V E;  2V85 A;  4GKK E;  2UXD E;  2MC5 A;  2UUC E;  3VYX A;  2DIX A;  2B7T A;  2N3H A;  3ADG A;  1FKA E;  2MC6 A;  4KZS A;  2DB2 A;  4X8W A;  2L2K B;  4P78 A;  5AAS A;  4JI4 E;  3HQ1 A;  2L8T A;  3HPS A;  3JU0 A;  4DV6 E;  4BMJ A;  1N34 E;  4WSP A;  2WZO A;  2EWL A;  2V89 A;  3AUZ A;  2VE7 C;  4L5N C;  4BS9 A;  4DV4 E;  1RC7 A;  4B3T E;  1RQ0 A;  3F6G A;  4DR6 E;  3C4T A;  5BR8 E;  2RS6 A;  2JOX A;  5CFF E;  2RTX A;  4DKK A;  4JI7 E;  2UXC E;  5LMU E;  1N32 E;  1HNX E;  4WYQ B;  1ZBT A;  3MSW A;  3T1Y E;  4X66 E;  4DV0 E;  1HNZ E;  3H09 A;  4JI1 E;  3OML A;  3FIG A;  2UUB E;  2L2M A;  1UIL A;  2F8B A;  2ZM6 E;  5LMN E;  1XMO E;  2JOB A;  2B9D A;  1WHN A;  2K4V A;  5LL6 R;  2V83 A;  4JI8 E;  5AE3 A;  1XNR E;  3DF6 A;  1YZ9 A;  2V86 A;  2ODR D;  2V8Q B;  3OTO E;  4Q28 A;  2IHR 1;  3JAM C;  1X48 A;  2H36 X;  4AQY E;  4LU9 A;  4DV2 E;  4LFA E;  4M2Z A;  4LTY A;  4LFC E;  4M30 A;  5DNY A;  4BC9 A;  4X64 E;  1YYO A;  5AE2 A;  3J80 C;  1J26 A;  4TUG A;  4DUZ E;  2HHH E;  2YT4 A;  2NA2 A;  3IWB A;  4DV3 E;  1X47 A;  3VK6 A;  4DMI A;  5F3W A;  3ADL A;  2VF1 A;  3J7Y p;  1WXR A;  3IWD A;  4TUI A;  3ADI A;  1J5E E;  2MDR A;  1IBL E;  2E5L E;  3T1H E;  3F6H A;  4KHP E;  1YYK A;  2LE2 A;  2UU9 E;  3HXL A;  1YYW A;  2L92 A;  4JI0 E;  4DR3 E;  3C4B A;  4B3R E;  4DR7 E;  1HNW E;  4JV5 E;  4LFB E;  2RSM A;  5ADZ A;  4DV5 E;  4F9C B;  2FGG A;  4X62 E;  4DR5 E;  4K0K E;  3J81 C;  2LUQ A;  2LTS A;  2V87 A;  1X49 A;  2L2N A;  2YZT A;  4NXN E;  3IWC A;  4P7D A;  2FV4 B;  3AV0 A;  5IWA E;  4R8O A;  2LRS A;  4YHH E;  4JI3 E;  4LF4 E;  1N33 E;  5AE1 A;  2B7V A;  2DSY A;  2N3G A;  5A2Q C;  3HTX A;  4LF6 E;  2NUE A;  2M4I A;  2RS7 A;  4GEQ B;  3ADJ A;  2L3C A;  1O0W A;  2LUP B;  1IBK E;  1ZBQ A;  4M0V A;  1FJG E;  1WHQ A;  2KHX A;  4GKJ E;  2LJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...