2LTRA

Solution structure of rde-4(32-136)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
NRTDLEMFLKKTPLMVLEEAAKAVYQKTPTWGTVELPEGFEMTLILNEITVKGQATSKKAARQKAAVEYLRKVVEKGKHEIFFIPGTTKEEALSNIDQISDKAEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Protein RDE-4
publication title Structure of RDE-4 dsRBDs and mutational studies provide insights into dsRNA recognition in the Caenorhabditis elegans RNAi pathway.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 29
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2012-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ltrA00
2N3HA 2RS7A 2LUQA 5LMNE 1N33E 4LFCE 1PKPA 2ZM6E 2LRSA 4B3SE 4M30A 2CPNA 4JYAE 2UU9E 4OX9E 2B7VA 4JV5E 1N36E 4DV7E 4LF5E 1IBLE 2L3CA 3C4BA 2IHR1 2YT4A 4JI8E 1IBME 4YY3E 1YYKA 2LTSA 4B3RE 1QU6A 4DR5E 4LF4E 3C4TA 4DUYE 2L2NA 4X62E 4M2ZA 1X48A 5CFFE 4DV4E 4OOGC 3P1XA 5LMUE 2L3JA 4LF8E 1N32E 2RTXA 1XNQE 3ADIA 4DR2E 1UILA 1X47A 4WYQB 2L2KB 3OTOE 4JI1E 2VQFE 1YYWA 4GKJE 4LFAE 1N34E 1HNWE 3ADJA 4X8WA 4JI7E 1XMOE 2LUPB 1STUA 3T1YE 1T4OA 4DV6E 4DKKA 4LFBE 3ADGA 2UXBE 4DR7E 2B3TB 5IWAE 4K0KE 4LF7E 2L2MA 4JI0E 2RS6A 2LTRA 2DB2A 4WFTA 3J7Yp 1HNXE 1HNZE 2DIXA 2EZ6A 2RSMA 4DR1E 2MDRA 1I94E 2JVAA 4LF6E 2UXCE 4B3TE 2UUAE 2E5LE 2VQEE 4NXNE 5BR8E 2L33A 4YHHE 4GKKE 4JI5E 2LJHA 1XNRE 4X64E 1ZBTA 3LLHA 1RC7A 4NXME 4X66E 4JI6E 3VYXA 4X65E 1GQEA 1RQ0A 2UUCE 4DV5E 4DR3E 1DI2A 4AQYE 4DR6E 2KHXA 2HHHE 1WHQA 1YZ9A 1XMQE 4B3ME 4LF9E 2NUFA 1FJGE 3VYYA 1J26A 2B7TA 1HR0E 2UXDE 3HTXA 1O0WA 1UHZA 4KHPE 4DUZE 4DV3E 4DV2E 1T4LB 1FKAE 2JY9A 2N3GA 4JI3E 2NUGA 1J5EE 1EKZA 3ADLA 4JI4E 4DV0E 4JI2E 1WHNA 1X49A 2NA2A 2UUBE 2NUEA 1IBKE 4DV1E 2DMYA 1T4NA 2F4VE 3T1HE 1YYOA 4DR4E 2LBSB
chains in the Genus database with same CATH superfamily
2RS7A 2LUQA 3THNA 2EN4A 2EOEA 3LMLA 5AE3A 5KL5A 1IMUA 2LT7A 2LV2A 2UU9E 4OX9E 4F9CB 4R8OA 1N36E 5AASA 2EL6A 1SR9A 1L4SA 2LMZA 2BBGA 3IWDA 3C4BA 4R2CA 2EPRA 4JI8E 1G2DC 2LO3A 4YY3E 5KL7A 1WRJA 3MHHC 4X62E 3HQ1A 3KZYA 1PJQA 2WCC3 2EWLA 4DV4E 2EM4A 3AUZA 1X3CA 3J7AG 2EMAA 1N32E 2RTXA 1EH7A 1RMDA 1UILA 4WYQB 3OTOE 2JP9A 2JWOA 1N34E 1HNWE 3ADJA 4X8WA 1XMOE 2EPNA 3T1YE 1IQSA 4P78A 3ZOQB 4P7DA 4R2DA 3BBGA 2B3TB 5IWAE 2L2MA 2K7IA 2LTRA 2DB2A 4WFTA 1HNXE 1KJKA 2EL4A 2I9IA 2EMBA 1X6HA 2EOZA 4LF6E 4J8ZA 3F6GA 2CSHA 2EMKA 3IWCA 2VQEE 2EMCA 1KYQA 1PJSA 2ADRA 3DF6A 3EPHA 2JPAA 2RSIA 1YPNA 1XNRE 2EM6A 1ZBTA 3LLHA 4F9BB 4WXCA 4ZYGA 1WJPA 3VYXA 4BHCA 4X65E 1RQ0A 2H36X 5T6JA 3L00A 3EPKA 2EPZA 2VE7C 3RMPA 1TF3A 1XMQE 1BBOA 5TSEA 3FIGA 2EPMX 3MHSC 2I13A 5LL6R 2YPNA 1J26A 2EM0A 2D9HA 2DLQA 5IT9C 2UXDE 2EOJA 4O5GA 1O0WA 1DGCA 2EE8A 5F3WA 1A1KA 2RPCA 2JXPA 2EM7A 1J5EE 2EMHA 3HPSA 1EKZA 1YSAC 4R2AA 1X6FA 1ZR9A 5IXMB 3BF2A 2JYAA 1WHNA 4LTYA 2MKNA 1T4NA 5IV8B 3T1HE 2WBSA 2YTGA 4LF9E 5KL2A 4TUIA 1MEYC 1PKPA 2ZM6E 4B3SE 2HJJA 2CPNA 4JV5E 2YRMA 3BGHA 2EMZA 4WXDA 1A1LA 2ENCA 3AV0A 2ENAA 3J80C 2YT4A 4GZNC 2WBTA 1AAYA 1IBME 2MC6A 2BB8A 2YTIA 4B3RE 3C4TA 3DJWA 4M2ZA 2EPAA 5CFFE 2YTFA 3P1XA 3BIDA 2L3JA 5A6BA 1XNQE 2RQLA 2L2KB 3QG5C 4LFAE 2EOFA 5DNYA 1T4OA 2K4VA 4DV6E 2GPIA 3EQ1A 2B9DA 1PJTA 2ELYA 2EN8A 2RS6A 5A6KA 2EP3A 4DR1E 4IJDA 2MDRA 1I94E 3VHTB 2EMGA 2EPCA 2EPLX 2UXCE 4WPYA 2M4IA 4NXNE 4R2PA 5AC5A 2R1FA 2V8QB 4X64E 1F2IG 1LLMC 2HGHA 2ELZA 2UUCE 3OMLA 4NHRA 4DV5E 4DR3E 1PDAA 1WHQA 4R2QA 2JR1A 2LCEA 2EQ0A 3THOB 2EM3A 1GZ6A 2YRHA 1JK1A 3MSWA 1HR0E 1A1GA 2HC5A 4DV3E 2ODRD 3H09A 1FKAE 5FLXC 1YUJA 2LVHA 2NUGA 1WXRA 2YSPA 1X6EA 4HTGA 2DMIA 4BBYA 3ADLA 4JI2E 2EOSA 2L6MA 2NUEA 1YFHA 2YTEA 2DMYA 3JU0A 4F6MA 2Q8UA 1UBDC 2EJ4A 4DR4E 4R2EA 4BC7A 5LMNE 3C6MA 1T38A 1N33E 2LRSA 4M30A 1X5WA 2EOXA 2MC5A 4I8OA 2EOIA 4FK5C 4BHBA 2YTNA 2YWQA 2GLIA 2KONA 4LF5E 4O43A 1IBLE 1ZU1A 2IHR1 2LTSA 2EMFA 4WX9A 1QU6A 4DR5E 2EPUA 3K6QA 4LF4E 2YSOA 1A1IA 4OOGC 3HXLA 5A2QC 1B69A 5LMUE 2EN6A 2EQ3A 1EH8A 3JTZA 2YTPA 2VQFE 4GKJE 1NEIA 4NZVA 1STUA 2EOQA 4DKKA 4LFBE 3ADGA 2UXBE 4DR7E 2EOHA 1ZAAC 4K0KE 2M9AA 4ZYHA 4JI0E 3J7Yp 2EPKX 2M7QA 2DIXA 4BCAA 2PRTA 2EZ6A 3VK6A 2RSMA 4IS1C 2EMLA 4KWYA 1SFEA 4M9VC 2UUAE 2E5LE 4BC9A 2L33A 4TUGA 2G7HA 2L8TA 3UK3C 2YU8A 2EM8A 4GEQB 4DMIA 2VF1A 1QNTA 1AH5A 2FV4B 4Q28A 4NXME 4X66E 4JI6E 5AE1A 2V85A 1GQEA 4ZYDA 4HEIA 2EPOA 4AQYE 2EM5A 2KHXA 2HHHE 2V88A 2E72A 5A6AA 2ENHA 1YZ9A 3ECRA 2CT1A 1T39A 1BB8A 2YRKA 2EOYA 2EOOA 4B3ME 2WZOA 2V87A 5LLQA 2NUFA 4F2JC 5KL6A 1IQOA 4M0VA 4R03A 2LJUA 2EQ1A 5A69A 1P47A 3HTXA 1UHZA 1TN9A 4KHPE 1G2FC 4DUZE 1T4LB 2EM2A 4O24A 2N3GA 1YUIA 4MLQA 4Q35B 4N4RB 1TF6A 3J81C 1N3GA 2A25A 2EMXA 4JI4E 2EN3A 2NA2A 1X49A 2UUBE 1IBKE 4DV1E 2F4VE 2LE2A 2EORA 2YTOA 2EMYA 2EM9A 1YYOA 2LBSB 2N3HA 4LFCE 2V89A 1DQ3A 1A1FA 4JYAE 2B7VA 1ZBQA 4DV7E 3F6HA 4RHBB 2L3CA 2DRPA 4X9JA 2EN7A 2WBUA 1YYKA 2KOUA 2DLKA 2DGCA 2GHFA 3C6KA 4DUYE 3TQMA 2L2NA 3JAMC 1X48A 4RH8A 2YZTA 4LF8E 3EPJA 4F54A 5AE2A 1A1HA 1MGTA 3ADIA 2FTXB 4DR2E 1X47A 4JI1E 1YYWA 2JOXA 1JK2A 5KL4A 4L5NC 4JI7E 4F9AB 2LUPB 4WSPA 4MLVA 4LU9A 2EL5A 2YTDA 4LF7E 4KZSA 4BS9A 1HNZE 2F8BA 2YTQA 2R76A 2JVAA 3KWRA 1EH6A 4B3TE 2CTDA 2L92A 3EPLA 2NABA 5BR8E 4YHHE 4BMJA 4GKKE 2EPXA 4JI5E 2LJHA 1RC7A 2DSYA 2EPPA 2EN1A 2V83A 2M1SA 2FGGA 2MKDA 5A6JA 1DI2A 4DR6E 5KL3A 3KZZA 2YU5A 5ADZA 2E1MA 4R2SA 1NCSA 1A1JA 5AC4A 2ODRC 1FJGE 3VYYA 2B7TA 2EMIA 2N8XA 4F6NA 2EMWA 1Z1BA 2EOMA 4DV2E 3M99B 2JY9A 2V86A 4JI3E 1UN6B 3IWBA 4L8NA 2YTJA 1BBGA 5A6BD 3HPZA 2MDGA 2J7JA 2EN2A 2JOBA 4ZYEA 4O4KA 4WSGA 4DV0E 2VRDA 4R2RA 1GTKA
chains in the Genus database with same CATH topology
2N3HA 2RS7A 2LUQA 4BC7A 5LMNE 1N33E 5AE3A 3LMLA 4LFCE 1PKPA 2V89A 1DQ3A 2LRSA 2ZM6E 4B3SE 4M30A 2MC5A 4I8OA 2CPNA 4JYAE 2UU9E 4OX9E 2B7VA 4F9CB 4JV5E 4R8OA 1ZBQA 1N36E 5AASA 4DV7E 3F6HA 2KONA 1SR9A 4LF5E 1IBLE 2LMZA 3IWDA 3AV0A 2L3CA 3J80C 3C4BA 2IHR1 2YT4A 4JI8E 1IBME 4YY3E 2KOUA 1YYKA 2MC6A 2LTSA 4B3RE 1QU6A 4DR5E 3K6QA 3C4TA 3DJWA 4DUYE 2L2NA 4X62E 4LF4E 3HQ1A 4M2ZA 3JAMC 1X48A 2EWLA 5CFFE 4DV4E 4OOGC 3AUZA 3HXLA 5A2QC 2YZTA 3P1XA 5LMUE 3J7AG 2L3JA 4LF8E 1N32E 4F54A 5AE2A 2RTXA 3JTZA 1XNQE 2FTXB 4DR2E 3ADIA 1UILA 1X47A 4WYQB 2L2KB 3OTOE 4JI1E 2VQFE 1YYWA 4GKJE 4LFAE 2JWOA 2JOXA 1N34E 1HNWE 3ADJA 5DNYA 4X8WA 4L5NC 4JI7E 1XMOE 4F9AB 1STUA 4WSPA 2LUPB 3T1YE 1T4OA 2K4VA 4DV6E 4P78A 3ZOQB 4DKKA 4LU9A 3ADGA 4LFBE 4P7DA 2UXBE 4DR7E 2B3TB 5IWAE 4K0KE 2B9DA 4LF7E 2L2MA 4JI0E 2RS6A 2LTRA 2DB2A 4KZSA 2F8BA 4WFTA 2M7QA 2DIXA 4BCAA 4BS9A 3J7Yp 3VK6A 2LBSB 2RSMA 4DR1E 2EZ6A 2MDRA 1I94E 2JVAA 3KWRA 4LF6E 2UXCE 4B3TE 4WPYA 4J8ZA 3F6GA 2UUAE 2L92A 2E5LE 2M4IA 3IWCA 2VQEE 4NXNE 4BC9A 5BR8E 2L33A 4BMJA 4YHHE 4TUGA 3DF6A 2G7HA 2L8TA 4GKKE 1HNXE 4JI5E 4GEQB 2V8QB 2LJHA 2VF1A 4DMIA 1XNRE 4X64E 2FV4B 4Q28A 1ZBTA 3LLHA 4F9BB 2DSYA 1RC7A 4NXME 4X66E 4JI6E 2V83A 3VYXA 2M1SA 5AE1A 2V85A 1GQEA 1RQ0A 2FGGA 2H36X 3OMLA 5T6JA 4X65E 4DV5E 4DR3E 1DI2A 4AQYE 4DR6E 2KHXA 2HHHE 1WHQA 2V88A 1YZ9A 2VE7C 3RMPA 1XMQE 2JR1A 4B3ME 5ADZA 2E1MA 3FIGA 4LF9E 2WZOA 2V87A 2NUFA 2ODRC 1FJGE 4M0VA 5LL6R 4R03A 1GZ6A 3VYYA 1J26A 2B7TA 5IT9C 3MSWA 1HR0E 2UXDE 3HTXA 1O0WA 1UHZA 4KHPE 4DUZE 4DV3E 5F3WA 2ODRD 4DV2E 3H09A 1T4LB 2JY9A 1FKAE 2N3GA 2V86A 4JI3E 3IWBA 4L8NA 5FLXC 2NUGA 1J5EE 1WXRA 3HPSA 1HNZE 3HPZA 3J81C 1EKZA 2JOBA 4BBYA 3ADLA 4JI4E 4DV0E 2UUCE 4JI2E 2L6MA 4LTYA 1WHNA 1X49A 2NA2A 2UUBE 2NUEA 1IBKE 4DV1E 2DMYA 1T4NA 2F4VE 3JU0A 2LE2A 3T1HE 1YYOA 4DR4E 4TUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N3H A;  2RS7 A;  2LUQ A;  5LMN E;  1N33 E;  4LFC E;  1PKP A;  2ZM6 E;  2LRS A;  4B3S E;  4M30 A;  2CPN A;  4JYA E;  2UU9 E;  4OX9 E;  2B7V A;  4JV5 E;  1N36 E;  4DV7 E;  4LF5 E;  1IBL E;  2L3C A;  3C4B A;  2IHR 1;  2YT4 A;  4JI8 E;  1IBM E;  4YY3 E;  1YYK A;  2LTS A;  4B3R E;  1QU6 A;  4DR5 E;  4LF4 E;  3C4T A;  4DUY E;  2L2N A;  4X62 E;  4M2Z A;  1X48 A;  5CFF E;  4DV4 E;  4OOG C;  3P1X A;  5LMU E;  2L3J A;  4LF8 E;  1N32 E;  2RTX A;  1XNQ E;  3ADI A;  4DR2 E;  1UIL A;  1X47 A;  4WYQ B;  2L2K B;  3OTO E;  4JI1 E;  2VQF E;  1YYW A;  4GKJ E;  4LFA E;  1N34 E;  1HNW E;  3ADJ A;  4X8W A;  4JI7 E;  1XMO E;  2LUP B;  1STU A;  3T1Y E;  1T4O A;  4DV6 E;  4DKK A;  4LFB E;  3ADG A;  2UXB E;  4DR7 E;  2B3T B;  5IWA E;  4K0K E;  4LF7 E;  2L2M A;  4JI0 E;  2RS6 A;  2LTR A;  2DB2 A;  4WFT A;  3J7Y p;  1HNX E;  1HNZ E;  2DIX A;  2EZ6 A;  2RSM A;  4DR1 E;  2MDR A;  1I94 E;  2JVA A;  4LF6 E;  2UXC E;  4B3T E;  2UUA E;  2E5L E;  2VQE E;  4NXN E;  5BR8 E;  2L33 A;  4YHH E;  4GKK E;  4JI5 E;  2LJH A;  1XNR E;  4X64 E;  1ZBT A;  3LLH A;  1RC7 A;  4NXM E;  4X66 E;  4JI6 E;  3VYX A;  4X65 E;  1GQE A;  1RQ0 A;  2UUC E;  4DV5 E;  4DR3 E;  1DI2 A;  4AQY E;  4DR6 E;  2KHX A;  2HHH E;  1WHQ A;  1YZ9 A;  1XMQ E;  4B3M E;  4LF9 E;  2NUF A;  1FJG E;  3VYY A;  1J26 A;  2B7T A;  1HR0 E;  2UXD E;  3HTX A;  1O0W A;  1UHZ A;  4KHP E;  4DUZ E;  4DV3 E;  4DV2 E;  1T4L B;  1FKA E;  2JY9 A;  2N3G A;  4JI3 E;  2NUG A;  1J5E E;  1EKZ A;  3ADL A;  4JI4 E;  4DV0 E;  4JI2 E;  1WHN A;  1X49 A;  2NA2 A;  2UUB E;  2NUE A;  1IBK E;  4DV1 E;  2DMY A;  1T4N A;  2F4V E;  3T1H E;  1YYO A;  4DR4 E;  2LBS B; 
#chains in the Genus database with same CATH topology
 2RS7 A;  2LUQ A;  3THN A;  2EN4 A;  2EOE A;  3LML A;  5AE3 A;  5KL5 A;  1IMU A;  2LT7 A;  2LV2 A;  2UU9 E;  4OX9 E;  4F9C B;  4R8O A;  1N36 E;  5AAS A;  2EL6 A;  1SR9 A;  1L4S A;  2LMZ A;  2BBG A;  3IWD A;  3C4B A;  4R2C A;  2EPR A;  4JI8 E;  1G2D C;  2LO3 A;  4YY3 E;  5KL7 A;  1WRJ A;  3MHH C;  4X62 E;  3HQ1 A;  3KZY A;  1PJQ A;  2WCC 3;  2EWL A;  4DV4 E;  2EM4 A;  3AUZ A;  1X3C A;  3J7A G;  2EMA A;  1N32 E;  2RTX A;  1EH7 A;  1RMD A;  1UIL A;  4WYQ B;  3OTO E;  2JP9 A;  2JWO A;  1N34 E;  1HNW E;  3ADJ A;  4X8W A;  1XMO E;  2EPN A;  3T1Y E;  1IQS A;  4P78 A;  3ZOQ B;  4P7D A;  4R2D A;  3BBG A;  2B3T B;  5IWA E;  2L2M A;  2K7I A;  2LTR A;  2DB2 A;  4WFT A;  1HNX E;  1KJK A;  2EL4 A;  2I9I A;  2EMB A;  1X6H A;  2EOZ A;  4LF6 E;  4J8Z A;  3F6G A;  2CSH A;  2EMK A;  3IWC A;  2VQE E;  2EMC A;  1KYQ A;  1PJS A;  2ADR A;  3DF6 A;  3EPH A;  2JPA A;  2RSI A;  1YPN A;  1XNR E;  2EM6 A;  1ZBT A;  3LLH A;  4F9B B;  4WXC A;  4ZYG A;  1WJP A;  3VYX A;  4BHC A;  4X65 E;  1RQ0 A;  2H36 X;  5T6J A;  3L00 A;  3EPK A;  2EPZ A;  2VE7 C;  3RMP A;  1TF3 A;  1XMQ E;  1BBO A;  5TSE A;  3FIG A;  2EPM X;  3MHS C;  2I13 A;  5LL6 R;  2YPN A;  1J26 A;  2EM0 A;  2D9H A;  2DLQ A;  5IT9 C;  2UXD E;  2EOJ A;  4O5G A;  1O0W A;  1DGC A;  2EE8 A;  5F3W A;  1A1K A;  2RPC A;  2JXP A;  2EM7 A;  1J5E E;  2EMH A;  3HPS A;  1EKZ A;  1YSA C;  4R2A A;  1X6F A;  1ZR9 A;  5IXM B;  3BF2 A;  2JYA A;  1WHN A;  4LTY A;  2MKN A;  1T4N A;  5IV8 B;  3T1H E;  2WBS A;  2YTG A;  4LF9 E;  5KL2 A;  4TUI A;  1MEY C;  1PKP A;  2ZM6 E;  4B3S E;  2HJJ A;  2CPN A;  4JV5 E;  2YRM A;  3BGH A;  2EMZ A;  4WXD A;  1A1L A;  2ENC A;  3AV0 A;  2ENA A;  3J80 C;  2YT4 A;  4GZN C;  2WBT A;  1AAY A;  1IBM E;  2MC6 A;  2BB8 A;  2YTI A;  4B3R E;  3C4T A;  3DJW A;  4M2Z A;  2EPA A;  5CFF E;  2YTF A;  3P1X A;  3BID A;  2L3J A;  5A6B A;  1XNQ E;  2RQL A;  2L2K B;  3QG5 C;  4LFA E;  2EOF A;  5DNY A;  1T4O A;  2K4V A;  4DV6 E;  2GPI A;  3EQ1 A;  2B9D A;  1PJT A;  2ELY A;  2EN8 A;  2RS6 A;  5A6K A;  2EP3 A;  4DR1 E;  4IJD A;  2MDR A;  1I94 E;  3VHT B;  2EMG A;  2EPC A;  2EPL X;  2UXC E;  4WPY A;  2M4I A;  4NXN E;  4R2P A;  5AC5 A;  2R1F A;  2V8Q B;  4X64 E;  1F2I G;  1LLM C;  2HGH A;  2ELZ A;  2UUC E;  3OML A;  4NHR A;  4DV5 E;  4DR3 E;  1PDA A;  1WHQ A;  4R2Q A;  2JR1 A;  2LCE A;  2EQ0 A;  3THO B;  2EM3 A;  1GZ6 A;  2YRH A;  1JK1 A;  3MSW A;  1HR0 E;  1A1G A;  2HC5 A;  4DV3 E;  2ODR D;  3H09 A;  1FKA E;  5FLX C;  1YUJ A;  2LVH A;  2NUG A;  1WXR A;  2YSP A;  1X6E A;  4HTG A;  2DMI A;  4BBY A;  3ADL A;  4JI2 E;  2EOS A;  2L6M A;  2NUE A;  1YFH A;  2YTE A;  2DMY A;  3JU0 A;  4F6M A;  2Q8U A;  1UBD C;  2EJ4 A;  4DR4 E;  4R2E A;  4BC7 A;  5LMN E;  3C6M A;  1T38 A;  1N33 E;  2LRS A;  4M30 A;  1X5W A;  2EOX A;  2MC5 A;  4I8O A;  2EOI A;  4FK5 C;  4BHB A;  2YTN A;  2YWQ A;  2GLI A;  2KON A;  4LF5 E;  4O43 A;  1IBL E;  1ZU1 A;  2IHR 1;  2LTS A;  2EMF A;  4WX9 A;  1QU6 A;  4DR5 E;  2EPU A;  3K6Q A;  4LF4 E;  2YSO A;  1A1I A;  4OOG C;  3HXL A;  5A2Q C;  1B69 A;  5LMU E;  2EN6 A;  2EQ3 A;  1EH8 A;  3JTZ A;  2YTP A;  2VQF E;  4GKJ E;  1NEI A;  4NZV A;  1STU A;  2EOQ A;  4DKK A;  4LFB E;  3ADG A;  2UXB E;  4DR7 E;  2EOH A;  1ZAA C;  4K0K E;  2M9A A;  4ZYH A;  4JI0 E;  3J7Y p;  2EPK X;  2M7Q A;  2DIX A;  4BCA A;  2PRT A;  2EZ6 A;  3VK6 A;  2RSM A;  4IS1 C;  2EML A;  4KWY A;  1SFE A;  4M9V C;  2UUA E;  2E5L E;  4BC9 A;  2L33 A;  4TUG A;  2G7H A;  2L8T A;  3UK3 C;  2YU8 A;  2EM8 A;  4GEQ B;  4DMI A;  2VF1 A;  1QNT A;  1AH5 A;  2FV4 B;  4Q28 A;  4NXM E;  4X66 E;  4JI6 E;  5AE1 A;  2V85 A;  1GQE A;  4ZYD A;  4HEI A;  2EPO A;  4AQY E;  2EM5 A;  2KHX A;  2HHH E;  2V88 A;  2E72 A;  5A6A A;  2ENH A;  1YZ9 A;  3ECR A;  2CT1 A;  1T39 A;  1BB8 A;  2YRK A;  2EOY A;  2EOO A;  4B3M E;  2WZO A;  2V87 A;  5LLQ A;  2NUF A;  4F2J C;  5KL6 A;  1IQO A;  4M0V A;  4R03 A;  2LJU A;  2EQ1 A;  5A69 A;  1P47 A;  3HTX A;  1UHZ A;  1TN9 A;  4KHP E;  1G2F C;  4DUZ E;  1T4L B;  2EM2 A;  4O24 A;  2N3G A;  1YUI A;  4MLQ A;  4Q35 B;  4N4R B;  1TF6 A;  3J81 C;  1N3G A;  2A25 A;  2EMX A;  4JI4 E;  2EN3 A;  2NA2 A;  1X49 A;  2UUB E;  1IBK E;  4DV1 E;  2F4V E;  2LE2 A;  2EOR A;  2YTO A;  2EMY A;  2EM9 A;  1YYO A;  2LBS B;  2N3H A;  4LFC E;  2V89 A;  1DQ3 A;  1A1F A;  4JYA E;  2B7V A;  1ZBQ A;  4DV7 E;  3F6H A;  4RHB B;  2L3C A;  2DRP A;  4X9J A;  2EN7 A;  2WBU A;  1YYK A;  2KOU A;  2DLK A;  2DGC A;  2GHF A;  3C6K A;  4DUY E;  3TQM A;  2L2N A;  3JAM C;  1X48 A;  4RH8 A;  2YZT A;  4LF8 E;  3EPJ A;  4F54 A;  5AE2 A;  1A1H A;  1MGT A;  3ADI A;  2FTX B;  4DR2 E;  1X47 A;  4JI1 E;  1YYW A;  2JOX A;  1JK2 A;  5KL4 A;  4L5N C;  4JI7 E;  4F9A B;  2LUP B;  4WSP A;  4MLV A;  4LU9 A;  2EL5 A;  2YTD A;  4LF7 E;  4KZS A;  4BS9 A;  1HNZ E;  2F8B A;  2YTQ A;  2R76 A;  2JVA A;  3KWR A;  1EH6 A;  4B3T E;  2CTD A;  2L92 A;  3EPL A;  2NAB A;  5BR8 E;  4YHH E;  4BMJ A;  4GKK E;  2EPX A;  4JI5 E;  2LJH A;  1RC7 A;  2DSY A;  2EPP A;  2EN1 A;  2V83 A;  2M1S A;  2FGG A;  2MKD A;  5A6J A;  1DI2 A;  4DR6 E;  5KL3 A;  3KZZ A;  2YU5 A;  5ADZ A;  2E1M A;  4R2S A;  1NCS A;  1A1J A;  5AC4 A;  2ODR C;  1FJG E;  3VYY A;  2B7T A;  2EMI A;  2N8X A;  4F6N A;  2EMW A;  1Z1B A;  2EOM A;  4DV2 E;  3M99 B;  2JY9 A;  2V86 A;  4JI3 E;  1UN6 B;  3IWB A;  4L8N A;  2YTJ A;  1BBG A;  5A6B D;  3HPZ A;  2MDG A;  2J7J A;  2EN2 A;  2JOB A;  4ZYE A;  4O4K A;  4WSG A;  4DV0 E;  2VRD A;  4R2R A;  1GTK A; 
#chains in the Genus database with same CATH homology
 2N3H A;  2RS7 A;  2LUQ A;  4BC7 A;  5LMN E;  1N33 E;  5AE3 A;  3LML A;  4LFC E;  1PKP A;  2V89 A;  1DQ3 A;  2LRS A;  2ZM6 E;  4B3S E;  4M30 A;  2MC5 A;  4I8O A;  2CPN A;  4JYA E;  2UU9 E;  4OX9 E;  2B7V A;  4F9C B;  4JV5 E;  4R8O A;  1ZBQ A;  1N36 E;  5AAS A;  4DV7 E;  3F6H A;  2KON A;  1SR9 A;  4LF5 E;  1IBL E;  2LMZ A;  3IWD A;  3AV0 A;  2L3C A;  3J80 C;  3C4B A;  2IHR 1;  2YT4 A;  4JI8 E;  1IBM E;  4YY3 E;  2KOU A;  1YYK A;  2MC6 A;  2LTS A;  4B3R E;  1QU6 A;  4DR5 E;  3K6Q A;  3C4T A;  3DJW A;  4DUY E;  2L2N A;  4X62 E;  4LF4 E;  3HQ1 A;  4M2Z A;  3JAM C;  1X48 A;  2EWL A;  5CFF E;  4DV4 E;  4OOG C;  3AUZ A;  3HXL A;  5A2Q C;  2YZT A;  3P1X A;  5LMU E;  3J7A G;  2L3J A;  4LF8 E;  1N32 E;  4F54 A;  5AE2 A;  2RTX A;  3JTZ A;  1XNQ E;  2FTX B;  4DR2 E;  3ADI A;  1UIL A;  1X47 A;  4WYQ B;  2L2K B;  3OTO E;  4JI1 E;  2VQF E;  1YYW A;  4GKJ E;  4LFA E;  2JWO A;  2JOX A;  1N34 E;  1HNW E;  3ADJ A;  5DNY A;  4X8W A;  4L5N C;  4JI7 E;  1XMO E;  4F9A B;  1STU A;  4WSP A;  2LUP B;  3T1Y E;  1T4O A;  2K4V A;  4DV6 E;  4P78 A;  3ZOQ B;  4DKK A;  4LU9 A;  3ADG A;  4LFB E;  4P7D A;  2UXB E;  4DR7 E;  2B3T B;  5IWA E;  4K0K E;  2B9D A;  4LF7 E;  2L2M A;  4JI0 E;  2RS6 A;  2LTR A;  2DB2 A;  4KZS A;  2F8B A;  4WFT A;  2M7Q A;  2DIX A;  4BCA A;  4BS9 A;  3J7Y p;  3VK6 A;  2LBS B;  2RSM A;  4DR1 E;  2EZ6 A;  2MDR A;  1I94 E;  2JVA A;  3KWR A;  4LF6 E;  2UXC E;  4B3T E;  4WPY A;  4J8Z A;  3F6G A;  2UUA E;  2L92 A;  2E5L E;  2M4I A;  3IWC A;  2VQE E;  4NXN E;  4BC9 A;  5BR8 E;  2L33 A;  4BMJ A;  4YHH E;  4TUG A;  3DF6 A;  2G7H A;  2L8T A;  4GKK E;  1HNX E;  4JI5 E;  4GEQ B;  2V8Q B;  2LJH A;  2VF1 A;  4DMI A;  1XNR E;  4X64 E;  2FV4 B;  4Q28 A;  1ZBT A;  3LLH A;  4F9B B;  2DSY A;  1RC7 A;  4NXM E;  4X66 E;  4JI6 E;  2V83 A;  3VYX A;  2M1S A;  5AE1 A;  2V85 A;  1GQE A;  1RQ0 A;  2FGG A;  2H36 X;  3OML A;  5T6J A;  4X65 E;  4DV5 E;  4DR3 E;  1DI2 A;  4AQY E;  4DR6 E;  2KHX A;  2HHH E;  1WHQ A;  2V88 A;  1YZ9 A;  2VE7 C;  3RMP A;  1XMQ E;  2JR1 A;  4B3M E;  5ADZ A;  2E1M A;  3FIG A;  4LF9 E;  2WZO A;  2V87 A;  2NUF A;  2ODR C;  1FJG E;  4M0V A;  5LL6 R;  4R03 A;  1GZ6 A;  3VYY A;  1J26 A;  2B7T A;  5IT9 C;  3MSW A;  1HR0 E;  2UXD E;  3HTX A;  1O0W A;  1UHZ A;  4KHP E;  4DUZ E;  4DV3 E;  5F3W A;  2ODR D;  4DV2 E;  3H09 A;  1T4L B;  2JY9 A;  1FKA E;  2N3G A;  2V86 A;  4JI3 E;  3IWB A;  4L8N A;  5FLX C;  2NUG A;  1J5E E;  1WXR A;  3HPS A;  1HNZ E;  3HPZ A;  3J81 C;  1EKZ A;  2JOB A;  4BBY A;  3ADL A;  4JI4 E;  4DV0 E;  2UUC E;  4JI2 E;  2L6M A;  4LTY A;  1WHN A;  1X49 A;  2NA2 A;  2UUB E;  2NUE A;  1IBK E;  4DV1 E;  2DMY A;  1T4N A;  2F4V E;  3JU0 A;  2LE2 A;  3T1H E;  1YYO A;  4DR4 E;  4TUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...