2LTRA

Solution structure of rde-4(32-136)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
NRTDLEMFLKKTPLMVLEEAAKAVYQKTPTWGTVELPEGFEMTLILNEITVKGQATSKKAARQKAAVEYLRKVVEKGKHEIFFIPGTTKEEALSNIDQISDKAEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RDE-4
publication title Structure of RDE-4 dsRBDs and mutational studies provide insights into dsRNA recognition in the Caenorhabditis elegans RNAi pathway.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Rna binding protein
total genus 29
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2012-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ltrA00
4B3RE 2LTRA 3ADGA 1T4LB 4AQYE 1N36E 2YT4A 2E5LE 4DR6E 1RQ0A 3ADLA 2RS7A 1X47A 3T1YE 3T1HE 1IBLE 3LLHA 3VYYA 1PKPA 2L2KB 4JI5E 2RSMA 3VYXA 1T4OA 4JI3E 2L3JA 2LRSA 2UUCE 4YHHE 2L3CA 4LF6E 4M30A 2UUBE 1HNWE 2UXBE 2RTXA 4DV6E 4NXNE 4NXME 4X8WA 2LUPB 1YYOA 1N32E 4OOGC 2VQEE 1N34E 4DR4E 4X66E 1WHQA 4GKKE 4DR1E 2NUEA 4B3ME 4DR5E 2CPNA 5CFFE 4LF7E 5BR8E 1XMOE 2NA2A 2B7TA 2L2MA 2UUAE 2RS6A 4M2ZA 1N33E 4X64E 2MDRA 4DV4E 2NUFA 2L2NA 4JI6E 4DV1E 2UU9E 1YYKA 2EZ6A 2N3HA 4DV3E 1QU6A 1IBKE 4DUZE 1XMQE 1DI2A 1RC7A 2JVAA 1GQEA 4DR3E 2UXDE 2LUQA 4WFTA 4LF9E 4X62E 4K0KE 1HNZE 1UILA 4JI0E 1J5EE 2HHHE 4LF5E 1J26A 4DKKA 4LFBE 5IWAE 2JY9A 4DR7E 2ZM6E 4JYAE 3J7Yp 4DR2E 3C4BA 2F4VE 4JV5E 1FKAE 4B3SE 1XNRE 1FJGE 4YY3E 4LFCE 4JI7E 2LBSB 4LF4E 4DV5E 1YZ9A 2LTSA 5LMUE 1HNXE 1EKZA 4JI2E 2L33A 4JI1E 3C4TA 2LJHA 1T4NA 3ADJA 1I94E 3HTXA 2UXCE 4DV0E 5LMNE 4B3TE 2DB2A 4X65E 4LF8E 1X49A 2DMYA 2DIXA 1O0WA 2B7VA 4JI8E 4LFAE 4JI4E 3OTOE 2VQFE 4DV7E 4GKJE 1WHNA 4DUYE 4WYQB 4KHPE 2IHR1 2KHXA 1XNQE 3ADIA 1ZBTA 1UHZA 4OX9E 4DV2E 1STUA 1IBME 2NUGA 2B3TB 1X48A 1YYWA 1HR0E 2N3GA 3P1XA
chains in the Genus database with same CATH superfamily
3QG5C 4B3RE 2YTPA 1N36E 4AQYE 4R2EA 2EPUA 4DR6E 2FGGA 3AV0A 2EMAA 2R1FA 3T1HE 2CT1A 3VYYA 2M9AA 2L2KB 4GEQB 2RSMA 4LTYA 3EPKA 2EM5A 1A1HA 2L3JA 2JPAA 1BB8A 4LF6E 2UUBE 2H36X 4NXME 5IV8B 3J7AG 2RSIA 1YYOA 4OOGC 2CTDA 2EPRA 4NHRA 4HTGA 2EMFA 4DR4E 4GKKE 4O43A 2G7HA 4B3ME 2A25A 2CPNA 5CFFE 2EM2A 2EQ1A 1XMOE 2L2MA 2EN2A 1T38A 2RS6A 2EOHA 4M2ZA 1N33E 1ZAAC 3THNA 2NUFA 2L8TA 2DLKA 2VE7C 4O24A 1XMQE 4Q35B 1X6HA 2K4VA 3TQMA 3RMPA 4N4RB 1RC7A 1GQEA 3C6KA 4DR3E 4R2SA 2YTQA 3UK3C 3BF2A 2LUQA 2HC5A 4P7DA 2N8XA 1A1FA 1KYQA 4X62E 1YFHA 1UILA 1J5EE 4DMIA 2ELYA 4FK5C 2JY9A 2EL4A 1AH5A 4X9JA 4DR2E 2F4VE 1FKAE 4B3SE 5T6JA 1BBGA 4KWYA 3FIGA 4GZNC 3BIDA 1GZ6A 2EMKA 2J7JA 4WSPA 2LTSA 5A6BD 2LMZA 3IWDA 2EPCA 1EKZA 4JI1E 4R2QA 2YU8A 3C4TA 1T4NA 1EH7A 4LF8E 2DIXA 4F9AB 1O0WA 1PJQA 2EOIA 2V86A 3OTOE 3JAMC 2VQFE 1LLMC 5LL6R 2EOXA 3HPSA 3ADIA 3AUZA 2LO3A 4OX9E 1STUA 1IBME 1X48A 2YZTA 2JOXA 4F9BB 1HR0E 2WZOA 4RH8A 1PJTA 2LTRA 3ADGA 2YT4A 1RQ0A 1SR9A 2YTGA 1A1JA 4IJDA 2YWQA 1G2FC 1PKPA 2MDGA 4JI5E 2YTNA 2KOUA 2LRSA 1DGCA 5A6BA 5ADZA 2ENAA 4F2JC 1TN9A 2EMGA 5LLQA 2NABA 4X8WA 3JTZA 2E1MA 2EMCA 1N34E 3IWBA 2KONA 4R2DA 1JK2A 1X5WA 5FLXC 4WPYA 4LF7E 5BR8E 1X6EA 2R76A 4R2PA 2PRTA 2EOJA 2FV4B 2EPNA 3DJWA 2MDRA 1DQ3A 2EMHA 4DV4E 5AE2A 3C6MA 1T39A 2UU9E 1YYKA 2EZ6A 4DV3E 2LT7A 1QU6A 2EMBA 1IQOA 4DUZE 1WXRA 2EPZA 3KZZA 1DI2A 2EOQA 1UN6B 4LF9E 3EPLA 1A1IA 4L5NC 1HNZE 4MLQA 3IWCA 4JI0E 4LF5E 2HHHE 1A1LA 1PJSA 2JR1A 3F6GA 4BC7A 2EOMA 2EOOA 5DNYA 3J7Yp 3C4BA 3VHTB 1ZU1A 2EM8A 2MKDA 2EQ0A 2JYAA 4JI7E 4LU9A 2B9DA 1SFEA 4LF4E 1YZ9A 1IMUA 2EOEA 2L92A 4R2CA 5LMUE 3ZOQB 2EOSA 4JI2E 3VK6A 2M7QA 4M0VA 1P47A 1I94E 2WBSA 1TF3A 4X65E 1X49A 2EMZA 2DMYA 2GHFA 1B69A 2YTIA 2YSOA 3EPHA 3H09A 4DV7E 2EM7A 4GKJE 1Z1BA 2EN8A 1NCSA 2K7IA 4WYQB 4KHPE 4BMJA 1UBDC 1UHZA 2EN3A 2DSYA 1QNTA 2EM3A 1F2IG 2GPIA 2YTJA 3EQ1A 4F6MA 2JWOA 2E5LE 3ADLA 2RS7A 5KL3A 1IBLE 3J80C 5KL5A 3LLHA 2EM9A 3K6QA 2HJJA 3MHSC 1T4OA 3VYXA 3BGHA 2VRDA 4BHCA 1HNWE 3KZYA 2RTXA 4ZYDA 4DV6E 4NXNE 1A1KA 2V88A 4TUIA 4O4KA 1N32E 4WXCA 2BBGA 1WHQA 1ZBQA 4KZSA 2EMIA 4NZVA 2EPPA 4DR1E 2YTEA 5KL2A 2EN6A 1G2DC 4IS1C 2JOBA 5AC5A 2ODRC 4WSGA 4P78A 2UUAE 4ZYHA 3OMLA 3EPJA 4DV1E 2CSHA 1BBOA 1AAYA 2N3HA 3THOB 5KL4A 2LJUA 2EL5A 1MGTA 4F54A 2HGHA 2JVAA 2JXPA 5F3WA 2ADRA 2WCC3 1GTKA 4R8OA 2UXDE 4WFTA 5IT9C 4K0KE 1A1GA 2M1SA 2YTOA 1PDAA 2BB8A 2ODRD 1J26A 5A69A 1N3GA 4LFBE 5IWAE 2DLQA 4DR7E 2ZM6E 2M4IA 2V8QB 4WX9A 4F9CB 4JV5E 1WJPA 1XNRE 5A6AA 4YY3E 2EPMX 2YRHA 2EOFA 2EM4A 1WRJA 2YTFA 1HNXE 2Q8UA 2LJHA 3ADJA 3HTXA 4WXDA 4M9VC 1L4SA 2LE2A 1YPNA 4BBYA 1MEYC 2EOZA 3HPZA 2MKNA 1KJKA 2VF1A 5A2QC 2EPKX 2I9IA 4BS9A 4JI8E 1TF6A 1RMDA 1WHNA 4DUYE 1EH6A 2EMYA 1YUJA 2IHR1 2KHXA 2EN7A 1XNQE 2JP9A 2EN4A 2EM6A 2NUGA 2V89A 2B3TB 1YYWA 2EE8A 3JU0A 2EQ3A 4HEIA 1T4LB 2YRKA 2WBTA 1X47A 3T1YE 4TUGA 2RPCA 3HXLA 4JI3E 2LVHA 4R2RA 2UUCE 5IXMB 4R03A 4YHHE 2LV2A 3M99B 5KL6A 2L3CA 2EOYA 1NEIA 4M30A 4BHBA 2EORA 5AC4A 2UXBE 2LUPB 2VQEE 2EP3A 4X66E 5AE1A 2EM0A 2EPAA 4RHBB 2I13A 2NUEA 2EMWA 2F8BA 4DR5E 4MLVA 2DRPA 5A6KA 2V83A 2NA2A 4ZYEA 2B7TA 5AASA 2EPOA 2ENCA 5A6JA 1JK1A 4X64E 3HQ1A 4ZYGA 2L2NA 4JI6E 2YRMA 4F6NA 2DGCA 1IQSA 1EH8A 2DMIA 1IBKE 3F6HA 3LMLA 2V85A 4O5GA 2GLIA 2EMLA 4R2AA 2EWLA 4BCAA 2L6MA 2D9HA 4DKKA 3ECRA 4JYAE 2MC6A 4I8OA 4Q28A 3DF6A 2YTDA 2EN1A 2RQLA 1FJGE 3BBGA 2EPXA 4BC9A 2EL6A 4L8NA 4LFCE 2LBSB 4J8ZA 2YSPA 2FTXB 4DV5E 2ELZA 2EPLX 2L33A 2YU5A 2UXCE 2YPNA 4DV0E 5LMNE 4B3TE 2DB2A 1ZR9A 3MHHC 3J81C 2MC5A 1X6FA 2E72A 1YUIA 2WBUA 2B7VA 4LFAE 3KWRA 2EMXA 2EJ4A 1X3CA 4JI4E 2LCEA 3MSWA 5AE3A 5KL7A 1YSAC 3L00A 1ZBTA 2V87A 4DV2E 5TSEA 2N3GA 2ENHA 3P1XA
chains in the Genus database with same CATH topology
4B3RE 2LTRA 3ADGA 1T4LB 4AQYE 1N36E 2JWOA 2YT4A 2E5LE 4DR6E 1RQ0A 1SR9A 2FGGA 3AV0A 3ADLA 2RS7A 1X47A 3T1YE 3T1HE 1IBLE 3J80C 4TUGA 3HXLA 3LLHA 1PKPA 2L2KB 3VYYA 4GEQB 4JI5E 3K6QA 2RSMA 4LTYA 1T4OA 3VYXA 2KOUA 2L3JA 2LRSA 4JI3E 2UUCE 4R03A 4YHHE 2L3CA 4LF6E 4M30A 5ADZA 2UUBE 1HNWE 2RTXA 2UXBE 2H36X 4DV6E 4NXNE 4NXME 3J7AG 2V88A 4X8WA 4TUIA 2LUPB 1YYOA 3JTZA 4OOGC 2VQEE 2E1MA 1N32E 1N34E 3IWBA 2KONA 4DR4E 4X66E 1WHQA 1ZBQA 4KZSA 5AE1A 4GKKE 4DR1E 2G7HA 2NUEA 4B3ME 2F8BA 4DR5E 5FLXC 2CPNA 5CFFE 4WPYA 4LF7E 5BR8E 2JOBA 2ODRC 2V83A 1XMOE 2NA2A 2B7TA 2L2MA 5AASA 4P78A 2UUAE 2FV4B 2RS6A 4M2ZA 1N33E 3DJWA 4X64E 2MDRA 1DQ3A 4DV4E 5AE2A 3HQ1A 2L8TA 2L2NA 2NUFA 4JI6E 3OMLA 4DV1E 2UU9E 1YYKA 2EZ6A 2N3HA 2VE7C 4DV3E 1QU6A 1IBKE 4DUZE 1XMQE 1WXRA 3F6HA 3LMLA 2K4VA 3RMPA 4F54A 1DI2A 1RC7A 2JVAA 1GQEA 2V85A 4DR3E 5F3WA 2UXDE 4R8OA 2LUQA 4P7DA 4WFTA 5IT9C 4LF9E 4X62E 4K0KE 4L5NC 1HNZE 3IWCA 1UILA 4JI0E 1J5EE 2HHHE 2M1SA 4DMIA 4LF5E 2EWLA 2ODRD 4BCAA 2JR1A 2L6MA 3F6GA 4BC7A 4DKKA 1J26A 4LFBE 5IWAE 2JY9A 4DR7E 2ZM6E 5DNYA 4JYAE 3J7Yp 2M4IA 2MC6A 3C4BA 4DR2E 2V8QB 2F4VE 4I8OA 4Q28A 3DF6A 4F9CB 1FKAE 4B3SE 5T6JA 1FJGE 1XNRE 4JV5E 3FIGA 4BC9A 4L8NA 4YY3E 4JI7E 2LBSB 4LFCE 4J8ZA 4LU9A 1GZ6A 2B9DA 2FTXB 4LF4E 4WSPA 4DV5E 2LTSA 2L92A 5LMUE 1YZ9A 3ZOQB 2LMZA 3IWDA 1HNXE 1EKZA 4JI2E 2L33A 4JI1E 3VK6A 2M7QA 3C4TA 4M0VA 2LJHA 1T4NA 3ADJA 1I94E 3HTXA 2UXCE 4DV0E 5LMNE 4B3TE 2DB2A 4X65E 2NUGA 3J81C 2MC5A 2LE2A 4BBYA 4LF8E 1X49A 3HPZA 2DMYA 2DIXA 2VF1A 4F9AB 5A2QC 1O0WA 2B7VA 4BS9A 3H09A 4JI8E 3KWRA 4LFAE 2V86A 3OTOE 3JAMC 2VQFE 4DV7E 4JI4E 3JU0A 4GKJE 1WHNA 3MSWA 4DUYE 5AE3A 5LL6R 4WYQB 4KHPE 2IHR1 3HPSA 2KHXA 4BMJA 1XNQE 3ADIA 1ZBTA 2V87A 3AUZA 1UHZA 4OX9E 4DV2E 1STUA 1IBME 2V89A 2B3TB 1X48A 2YZTA 2JOXA 4F9BB 2DSYA 1HR0E 2WZOA 1YYWA 2N3GA 3P1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R E;  2LTR A;  3ADG A;  1T4L B;  4AQY E;  1N36 E;  2YT4 A;  2E5L E;  4DR6 E;  1RQ0 A;  3ADL A;  2RS7 A;  1X47 A;  3T1Y E;  3T1H E;  1IBL E;  3LLH A;  3VYY A;  1PKP A;  2L2K B;  4JI5 E;  2RSM A;  3VYX A;  1T4O A;  4JI3 E;  2L3J A;  2LRS A;  2UUC E;  4YHH E;  2L3C A;  4LF6 E;  4M30 A;  2UUB E;  1HNW E;  2UXB E;  2RTX A;  4DV6 E;  4NXN E;  4NXM E;  4X8W A;  2LUP B;  1YYO A;  1N32 E;  4OOG C;  2VQE E;  1N34 E;  4DR4 E;  4X66 E;  1WHQ A;  4GKK E;  4DR1 E;  2NUE A;  4B3M E;  4DR5 E;  2CPN A;  5CFF E;  4LF7 E;  5BR8 E;  1XMO E;  2NA2 A;  2B7T A;  2L2M A;  2UUA E;  2RS6 A;  4M2Z A;  1N33 E;  4X64 E;  2MDR A;  4DV4 E;  2NUF A;  2L2N A;  4JI6 E;  4DV1 E;  2UU9 E;  1YYK A;  2EZ6 A;  2N3H A;  4DV3 E;  1QU6 A;  1IBK E;  4DUZ E;  1XMQ E;  1DI2 A;  1RC7 A;  2JVA A;  1GQE A;  4DR3 E;  2UXD E;  2LUQ A;  4WFT A;  4LF9 E;  4X62 E;  4K0K E;  1HNZ E;  1UIL A;  4JI0 E;  1J5E E;  2HHH E;  4LF5 E;  1J26 A;  4DKK A;  4LFB E;  5IWA E;  2JY9 A;  4DR7 E;  2ZM6 E;  4JYA E;  3J7Y p;  4DR2 E;  3C4B A;  2F4V E;  4JV5 E;  1FKA E;  4B3S E;  1XNR E;  1FJG E;  4YY3 E;  4LFC E;  4JI7 E;  2LBS B;  4LF4 E;  4DV5 E;  1YZ9 A;  2LTS A;  5LMU E;  1HNX E;  1EKZ A;  4JI2 E;  2L33 A;  4JI1 E;  3C4T A;  2LJH A;  1T4N A;  3ADJ A;  1I94 E;  3HTX A;  2UXC E;  4DV0 E;  5LMN E;  4B3T E;  2DB2 A;  4X65 E;  4LF8 E;  1X49 A;  2DMY A;  2DIX A;  1O0W A;  2B7V A;  4JI8 E;  4LFA E;  4JI4 E;  3OTO E;  2VQF E;  4DV7 E;  4GKJ E;  1WHN A;  4DUY E;  4WYQ B;  4KHP E;  2IHR 1;  2KHX A;  1XNQ E;  3ADI A;  1ZBT A;  1UHZ A;  4OX9 E;  4DV2 E;  1STU A;  1IBM E;  2NUG A;  2B3T B;  1X48 A;  1YYW A;  1HR0 E;  2N3G A;  3P1X A; 
#chains in the Genus database with same CATH topology
 3QG5 C;  4B3R E;  2YTP A;  1N36 E;  4AQY E;  4R2E A;  2EPU A;  4DR6 E;  2FGG A;  3AV0 A;  2EMA A;  2R1F A;  3T1H E;  2CT1 A;  3VYY A;  2M9A A;  2L2K B;  4GEQ B;  2RSM A;  4LTY A;  3EPK A;  2EM5 A;  1A1H A;  2L3J A;  2JPA A;  1BB8 A;  4LF6 E;  2UUB E;  2H36 X;  4NXM E;  5IV8 B;  3J7A G;  2RSI A;  1YYO A;  4OOG C;  2CTD A;  2EPR A;  4NHR A;  4HTG A;  2EMF A;  4DR4 E;  4GKK E;  4O43 A;  2G7H A;  4B3M E;  2A25 A;  2CPN A;  5CFF E;  2EM2 A;  2EQ1 A;  1XMO E;  2L2M A;  2EN2 A;  1T38 A;  2RS6 A;  2EOH A;  4M2Z A;  1N33 E;  1ZAA C;  3THN A;  2NUF A;  2L8T A;  2DLK A;  2VE7 C;  4O24 A;  1XMQ E;  4Q35 B;  1X6H A;  2K4V A;  3TQM A;  3RMP A;  4N4R B;  1RC7 A;  1GQE A;  3C6K A;  4DR3 E;  4R2S A;  2YTQ A;  3UK3 C;  3BF2 A;  2LUQ A;  2HC5 A;  4P7D A;  2N8X A;  1A1F A;  1KYQ A;  4X62 E;  1YFH A;  1UIL A;  1J5E E;  4DMI A;  2ELY A;  4FK5 C;  2JY9 A;  2EL4 A;  1AH5 A;  4X9J A;  4DR2 E;  2F4V E;  1FKA E;  4B3S E;  5T6J A;  1BBG A;  4KWY A;  3FIG A;  4GZN C;  3BID A;  1GZ6 A;  2EMK A;  2J7J A;  4WSP A;  2LTS A;  5A6B D;  2LMZ A;  3IWD A;  2EPC A;  1EKZ A;  4JI1 E;  4R2Q A;  2YU8 A;  3C4T A;  1T4N A;  1EH7 A;  4LF8 E;  2DIX A;  4F9A B;  1O0W A;  1PJQ A;  2EOI A;  2V86 A;  3OTO E;  3JAM C;  2VQF E;  1LLM C;  5LL6 R;  2EOX A;  3HPS A;  3ADI A;  3AUZ A;  2LO3 A;  4OX9 E;  1STU A;  1IBM E;  1X48 A;  2YZT A;  2JOX A;  4F9B B;  1HR0 E;  2WZO A;  4RH8 A;  1PJT A;  2LTR A;  3ADG A;  2YT4 A;  1RQ0 A;  1SR9 A;  2YTG A;  1A1J A;  4IJD A;  2YWQ A;  1G2F C;  1PKP A;  2MDG A;  4JI5 E;  2YTN A;  2KOU A;  2LRS A;  1DGC A;  5A6B A;  5ADZ A;  2ENA A;  4F2J C;  1TN9 A;  2EMG A;  5LLQ A;  2NAB A;  4X8W A;  3JTZ A;  2E1M A;  2EMC A;  1N34 E;  3IWB A;  2KON A;  4R2D A;  1JK2 A;  1X5W A;  5FLX C;  4WPY A;  4LF7 E;  5BR8 E;  1X6E A;  2R76 A;  4R2P A;  2PRT A;  2EOJ A;  2FV4 B;  2EPN A;  3DJW A;  2MDR A;  1DQ3 A;  2EMH A;  4DV4 E;  5AE2 A;  3C6M A;  1T39 A;  2UU9 E;  1YYK A;  2EZ6 A;  4DV3 E;  2LT7 A;  1QU6 A;  2EMB A;  1IQO A;  4DUZ E;  1WXR A;  2EPZ A;  3KZZ A;  1DI2 A;  2EOQ A;  1UN6 B;  4LF9 E;  3EPL A;  1A1I A;  4L5N C;  1HNZ E;  4MLQ A;  3IWC A;  4JI0 E;  4LF5 E;  2HHH E;  1A1L A;  1PJS A;  2JR1 A;  3F6G A;  4BC7 A;  2EOM A;  2EOO A;  5DNY A;  3J7Y p;  3C4B A;  3VHT B;  1ZU1 A;  2EM8 A;  2MKD A;  2EQ0 A;  2JYA A;  4JI7 E;  4LU9 A;  2B9D A;  1SFE A;  4LF4 E;  1YZ9 A;  1IMU A;  2EOE A;  2L92 A;  4R2C A;  5LMU E;  3ZOQ B;  2EOS A;  4JI2 E;  3VK6 A;  2M7Q A;  4M0V A;  1P47 A;  1I94 E;  2WBS A;  1TF3 A;  4X65 E;  1X49 A;  2EMZ A;  2DMY A;  2GHF A;  1B69 A;  2YTI A;  2YSO A;  3EPH A;  3H09 A;  4DV7 E;  2EM7 A;  4GKJ E;  1Z1B A;  2EN8 A;  1NCS A;  2K7I A;  4WYQ B;  4KHP E;  4BMJ A;  1UBD C;  1UHZ A;  2EN3 A;  2DSY A;  1QNT A;  2EM3 A;  1F2I G;  2GPI A;  2YTJ A;  3EQ1 A;  4F6M A;  2JWO A;  2E5L E;  3ADL A;  2RS7 A;  5KL3 A;  1IBL E;  3J80 C;  5KL5 A;  3LLH A;  2EM9 A;  3K6Q A;  2HJJ A;  3MHS C;  1T4O A;  3VYX A;  3BGH A;  2VRD A;  4BHC A;  1HNW E;  3KZY A;  2RTX A;  4ZYD A;  4DV6 E;  4NXN E;  1A1K A;  2V88 A;  4TUI A;  4O4K A;  1N32 E;  4WXC A;  2BBG A;  1WHQ A;  1ZBQ A;  4KZS A;  2EMI A;  4NZV A;  2EPP A;  4DR1 E;  2YTE A;  5KL2 A;  2EN6 A;  1G2D C;  4IS1 C;  2JOB A;  5AC5 A;  2ODR C;  4WSG A;  4P78 A;  2UUA E;  4ZYH A;  3OML A;  3EPJ A;  4DV1 E;  2CSH A;  1BBO A;  1AAY A;  2N3H A;  3THO B;  5KL4 A;  2LJU A;  2EL5 A;  1MGT A;  4F54 A;  2HGH A;  2JVA A;  2JXP A;  5F3W A;  2ADR A;  2WCC 3;  1GTK A;  4R8O A;  2UXD E;  4WFT A;  5IT9 C;  4K0K E;  1A1G A;  2M1S A;  2YTO A;  1PDA A;  2BB8 A;  2ODR D;  1J26 A;  5A69 A;  1N3G A;  4LFB E;  5IWA E;  2DLQ A;  4DR7 E;  2ZM6 E;  2M4I A;  2V8Q B;  4WX9 A;  4F9C B;  4JV5 E;  1WJP A;  1XNR E;  5A6A A;  4YY3 E;  2EPM X;  2YRH A;  2EOF A;  2EM4 A;  1WRJ A;  2YTF A;  1HNX E;  2Q8U A;  2LJH A;  3ADJ A;  3HTX A;  4WXD A;  4M9V C;  1L4S A;  2LE2 A;  1YPN A;  4BBY A;  1MEY C;  2EOZ A;  3HPZ A;  2MKN A;  1KJK A;  2VF1 A;  5A2Q C;  2EPK X;  2I9I A;  4BS9 A;  4JI8 E;  1TF6 A;  1RMD A;  1WHN A;  4DUY E;  1EH6 A;  2EMY A;  1YUJ A;  2IHR 1;  2KHX A;  2EN7 A;  1XNQ E;  2JP9 A;  2EN4 A;  2EM6 A;  2NUG A;  2V89 A;  2B3T B;  1YYW A;  2EE8 A;  3JU0 A;  2EQ3 A;  4HEI A;  1T4L B;  2YRK A;  2WBT A;  1X47 A;  3T1Y E;  4TUG A;  2RPC A;  3HXL A;  4JI3 E;  2LVH A;  4R2R A;  2UUC E;  5IXM B;  4R03 A;  4YHH E;  2LV2 A;  3M99 B;  5KL6 A;  2L3C A;  2EOY A;  1NEI A;  4M30 A;  4BHB A;  2EOR A;  5AC4 A;  2UXB E;  2LUP B;  2VQE E;  2EP3 A;  4X66 E;  5AE1 A;  2EM0 A;  2EPA A;  4RHB B;  2I13 A;  2NUE A;  2EMW A;  2F8B A;  4DR5 E;  4MLV A;  2DRP A;  5A6K A;  2V83 A;  2NA2 A;  4ZYE A;  2B7T A;  5AAS A;  2EPO A;  2ENC A;  5A6J A;  1JK1 A;  4X64 E;  3HQ1 A;  4ZYG A;  2L2N A;  4JI6 E;  2YRM A;  4F6N A;  2DGC A;  1IQS A;  1EH8 A;  2DMI A;  1IBK E;  3F6H A;  3LML A;  2V85 A;  4O5G A;  2GLI A;  2EML A;  4R2A A;  2EWL A;  4BCA A;  2L6M A;  2D9H A;  4DKK A;  3ECR A;  4JYA E;  2MC6 A;  4I8O A;  4Q28 A;  3DF6 A;  2YTD A;  2EN1 A;  2RQL A;  1FJG E;  3BBG A;  2EPX A;  4BC9 A;  2EL6 A;  4L8N A;  4LFC E;  2LBS B;  4J8Z A;  2YSP A;  2FTX B;  4DV5 E;  2ELZ A;  2EPL X;  2L33 A;  2YU5 A;  2UXC E;  2YPN A;  4DV0 E;  5LMN E;  4B3T E;  2DB2 A;  1ZR9 A;  3MHH C;  3J81 C;  2MC5 A;  1X6F A;  2E72 A;  1YUI A;  2WBU A;  2B7V A;  4LFA E;  3KWR A;  2EMX A;  2EJ4 A;  1X3C A;  4JI4 E;  2LCE A;  3MSW A;  5AE3 A;  5KL7 A;  1YSA C;  3L00 A;  1ZBT A;  2V87 A;  4DV2 E;  5TSE A;  2N3G A;  2ENH A;  3P1X A; 
#chains in the Genus database with same CATH homology
 4B3R E;  2LTR A;  3ADG A;  1T4L B;  4AQY E;  1N36 E;  2JWO A;  2YT4 A;  2E5L E;  4DR6 E;  1RQ0 A;  1SR9 A;  2FGG A;  3AV0 A;  3ADL A;  2RS7 A;  1X47 A;  3T1Y E;  3T1H E;  1IBL E;  3J80 C;  4TUG A;  3HXL A;  3LLH A;  1PKP A;  2L2K B;  3VYY A;  4GEQ B;  4JI5 E;  3K6Q A;  2RSM A;  4LTY A;  1T4O A;  3VYX A;  2KOU A;  2L3J A;  2LRS A;  4JI3 E;  2UUC E;  4R03 A;  4YHH E;  2L3C A;  4LF6 E;  4M30 A;  5ADZ A;  2UUB E;  1HNW E;  2RTX A;  2UXB E;  2H36 X;  4DV6 E;  4NXN E;  4NXM E;  3J7A G;  2V88 A;  4X8W A;  4TUI A;  2LUP B;  1YYO A;  3JTZ A;  4OOG C;  2VQE E;  2E1M A;  1N32 E;  1N34 E;  3IWB A;  2KON A;  4DR4 E;  4X66 E;  1WHQ A;  1ZBQ A;  4KZS A;  5AE1 A;  4GKK E;  4DR1 E;  2G7H A;  2NUE A;  4B3M E;  2F8B A;  4DR5 E;  5FLX C;  2CPN A;  5CFF E;  4WPY A;  4LF7 E;  5BR8 E;  2JOB A;  2ODR C;  2V83 A;  1XMO E;  2NA2 A;  2B7T A;  2L2M A;  5AAS A;  4P78 A;  2UUA E;  2FV4 B;  2RS6 A;  4M2Z A;  1N33 E;  3DJW A;  4X64 E;  2MDR A;  1DQ3 A;  4DV4 E;  5AE2 A;  3HQ1 A;  2L8T A;  2L2N A;  2NUF A;  4JI6 E;  3OML A;  4DV1 E;  2UU9 E;  1YYK A;  2EZ6 A;  2N3H A;  2VE7 C;  4DV3 E;  1QU6 A;  1IBK E;  4DUZ E;  1XMQ E;  1WXR A;  3F6H A;  3LML A;  2K4V A;  3RMP A;  4F54 A;  1DI2 A;  1RC7 A;  2JVA A;  1GQE A;  2V85 A;  4DR3 E;  5F3W A;  2UXD E;  4R8O A;  2LUQ A;  4P7D A;  4WFT A;  5IT9 C;  4LF9 E;  4X62 E;  4K0K E;  4L5N C;  1HNZ E;  3IWC A;  1UIL A;  4JI0 E;  1J5E E;  2HHH E;  2M1S A;  4DMI A;  4LF5 E;  2EWL A;  2ODR D;  4BCA A;  2JR1 A;  2L6M A;  3F6G A;  4BC7 A;  4DKK A;  1J26 A;  4LFB E;  5IWA E;  2JY9 A;  4DR7 E;  2ZM6 E;  5DNY A;  4JYA E;  3J7Y p;  2M4I A;  2MC6 A;  3C4B A;  4DR2 E;  2V8Q B;  2F4V E;  4I8O A;  4Q28 A;  3DF6 A;  4F9C B;  1FKA E;  4B3S E;  5T6J A;  1FJG E;  1XNR E;  4JV5 E;  3FIG A;  4BC9 A;  4L8N A;  4YY3 E;  4JI7 E;  2LBS B;  4LFC E;  4J8Z A;  4LU9 A;  1GZ6 A;  2B9D A;  2FTX B;  4LF4 E;  4WSP A;  4DV5 E;  2LTS A;  2L92 A;  5LMU E;  1YZ9 A;  3ZOQ B;  2LMZ A;  3IWD A;  1HNX E;  1EKZ A;  4JI2 E;  2L33 A;  4JI1 E;  3VK6 A;  2M7Q A;  3C4T A;  4M0V A;  2LJH A;  1T4N A;  3ADJ A;  1I94 E;  3HTX A;  2UXC E;  4DV0 E;  5LMN E;  4B3T E;  2DB2 A;  4X65 E;  2NUG A;  3J81 C;  2MC5 A;  2LE2 A;  4BBY A;  4LF8 E;  1X49 A;  3HPZ A;  2DMY A;  2DIX A;  2VF1 A;  4F9A B;  5A2Q C;  1O0W A;  2B7V A;  4BS9 A;  3H09 A;  4JI8 E;  3KWR A;  4LFA E;  2V86 A;  3OTO E;  3JAM C;  2VQF E;  4DV7 E;  4JI4 E;  3JU0 A;  4GKJ E;  1WHN A;  3MSW A;  4DUY E;  5AE3 A;  5LL6 R;  4WYQ B;  4KHP E;  2IHR 1;  3HPS A;  2KHX A;  4BMJ A;  1XNQ E;  3ADI A;  1ZBT A;  2V87 A;  3AUZ A;  1UHZ A;  4OX9 E;  4DV2 E;  1STU A;  1IBM E;  2V89 A;  2B3T B;  1X48 A;  2YZT A;  2JOX A;  4F9B B;  2DSY A;  1HR0 E;  2WZO A;  1YYW A;  2N3G A;  3P1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...