2I13A

Aart, a six finger zinc finger designed to recognize ann triplets
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
154
structure length
151
Chain Sequence
b'FSRSDHLAEHQRTHKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*AP*GP*AP*TP*GP*TP*AP*GP*GP*GP*AP*AP*AP*AP*GP*CP*CP*
publication title Structure of Aart, a Designed Six-finger Zinc Finger Peptide, Bound to DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein/dna
total genus 45
structure length 151
sequence length 154
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2i13A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2i13A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2i13A03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2i13A04
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2i13A05
2EM9A 4R2SA 2WBUA 2BB8A 2EM4A 4X9JA 2DGCA 2EORA 1X6HA 1ZU1A 2ENAA 2DLQA 2EMLA 2WBSA 2EOQA 2EMYA 2EMWA 5KL2A 1WJPA 2EOJA 1A1GA 2EN2A 4M9VC 2EN1A 2NABA 2EOEA 2YTEA 2YTQA 2ELYA 2YTGA 2YTOA 2MDGA 3MHSC 2MKDA 2EPCA 2EM3A 5KL4A 2EJ4A 2EPAA 2EPUA 2YTFA 4IJDA 1AAYA 2EPRA 2GHFA 3MHHC 2EM6A 2DLKA 2YTIA 1ZAAC 1A1JA 2EMFA 1JK2A 2EQ1A 4GZNC 2EMBA 1TF6A 2EE8A 2RPCA 2A25A 5KL3A 2ENHA 2YSOA 1DGCA 2EN8A 1TF3A 2EL5A 2EN3A 4R2QA 2EM5A 2EN6A 2DRPA 2EL4A 4F6MA 2YSPA 1G2FC 2EMZA 1P47A 2YU5A 2DMIA 2EQ0A 1X6FA 2CTDA 2EN7A 3UK3C 2EP3A 2E72A 2EOIA 2CT1A 2YU8A 2YTPA 3EPJA 2EMKA 2EMCA 1YUIA 4R2CA 2EMHA 2EMIA 1JK1A 1A1IA 2ADRA 1RMDA 2LV2A 1LLMC 2YRKA 3M99B 2EOSA 1X6EA 1X5WA 1G2DC 2EM2A 2M9AA 2EOFA 3EPLA 2GLIA 2EMGA 2JPAA 4F6NA 2ELZA 2EN4A 2I13A 2YTNA 5KL5A 1A1HA 4F2JC 2LT7A 3VHTB 2MKNA 1ZR9A 1MEYC 1UBDC 1YSAC 2LVHA 2PRTA 2RSIA 2WBTA 4R2DA 4FK5C 2EOMA 2EM8A 1B69A 2EM7A 2CSHA 2EPPA 2LCEA 2VRDA 2JP9A 1YUJA 1UN6B 4R2RA 4IS1C 2EOYA 2EPXA 4R2AA 4WSGA 2EMXA 2EOZA 2R1FA 1A1KA 1F2IG 2EM0A 1BBOA 2J7JA 2YRMA 5KL6A 2EQ3A 2YRHA 2WCC3 1A1LA 2ENCA 3EPHA 2EMAA 2EOOA 2HGHA 2EL6A 2EOXA 4R2PA 2YTJA 1TN9A 4R2EA 1NCSA 1Z1BA 2D9HA 2EOHA 1BB8A 1KJKA 1X3CA 3EPKA 2LO3A 2YTDA 5KL7A 1A1FA 2EPZA
chains in the Genus database with same CATH superfamily
1X47A 1UILA 2WBUA 2NA2A 1IQSA 4K0KE 2JWOA 1PKPA 4NZVA 1O0WA 2GPIA 3BGHA 5AC4A 2EZ6A 2LMZA 1FJGE 1WHNA 1SFEA 1YPNA 1A1GA 4M9VC 2L8TA 4LF9E 2M1SA 3BBGA 4P7DA 2JXPA 3MHSC 5A6JA 2EM3A 4JI1E 3MHHC 1NEIA 2GHFA 2YWQA 4DV6E 4GKJE 2LJUA 4LF8E 2L92A 4DKKA 1TF6A 2EE8A 5IT9C 2EN8A 2EL5A 1YZ9A 2EN6A 2IHR1 4Q28A 4DMIA 2DRPA 4JV5E 2H36X 4RHBB 1HNWE 2YU5A 2E72A 5LLQA 1IBLE 1IBME 1RC7A 3ECRA 4M0VA 3MSWA 1A1IA 4B3SE 3FIGA 4N4RB 1BBGA 3KZYA 1EH7A 2EM2A 4DR2E 2EOFA 2GLIA 2YPNA 4DR5E 2EN4A 2B7TA 3BF2A 4L8NA 1IBKE 4DUZE 4F2JC 2LT7A 2KHXA 2V8QB 2VF1A 2RSIA 2UUBE 4FK5C 2L3CA 2EPKX 2EM8A 2V83A 1B69A 4R03A 1N3GA 3HTXA 4R2RA 4DR6E 2L2MA 3H09A 2EOYA 2LUQA 4WSGA 4WPYA 2EOZA 2K4VA 2Q8UA 4BMJA 2N3GA 3IWCA 1F2IG 5AE1A 2YRHA 4WXCA 3ZOQB 1A1LA 1HNZE 1STUA 4KZSA 2DMYA 2EMAA 3THNA 2UUAE 2EOXA 3AV0A 2R76A 4KHPE 3VYXA 3ADGA 1X3CA 3JTZA 4OX9E 4BHBA 2DIXA 2UU9E 2LO3A 2EPLX 2EPZA 2EM9A 3C4TA 1N33E 4NXNE 3IWDA 3JAMC 3K6QA 2DGCA 3LLHA 2JOXA 1T39A 5A6KA 1ZU1A 1KYQA 2EMLA 2WBSA 2L2NA 2VQFE 4BC9A 2EOQA 4JI7E 2EMWA 2DSYA 4WYQB 1WJPA 2EOJA 4MLVA 4MLQA 3C6KA 3TQMA 2MC6A 2RS6A 3L00A 2G7HA 4RH8A 5LMUE 3LMLA 5F3WA 4JI8E 4TUIA 2JOBA 3THOB 1YFHA 2L33A 1QU6A 2MKDA 4DR4E 1SR9A 5A2QC 2EJ4A 5DNYA 4JI3E 2UXBE 2EPAA 2EPUA 2YTFA 4X8WA 3J7Yp 2EPRA 2EM6A 1HR0E 4LF5E 5LL6R 1ZAAC 3RMPA 1T38A 4GZNC 5KL3A 4M30A 2ENHA 2UXCE 4R2QA 2EM5A 1P47A 4GEQB 5CFFE 2BBGA 2CTDA 5AE3A 2EP3A 2YU8A 2CT1A 3VK6A 4X65E 3C6MA 4BS9A 2EMKA 1YUIA 1EH8A 4R2CA 3T1HE 2EMHA 5IWAE 2VQEE 2ADRA 2UXDE 2JY9A 1GZ6A 1X5WA 2VE7C 2M7QA 2EMGA 4F6NA 2ELZA 5A6AA 5IV8B 1N36E 1YYWA 5KL5A 2E5LE 4DR3E 1A1HA 3F6HA 4Q35B 2F8BA 1YSAC 4L5NC 3JU0A 5FLXC 4R2DA 1DI2A 1X49A 4JYAE 2JVAA 2EPPA 2LCEA 2B9DA 2N3HA 4YY3E 3F6GA 4IS1C 1EKZA 4R2AA 4DV4E 2EMXA 2EM0A 2J7JA 2YRMA 5KL6A 4DV1E 4HTGA 4B3RE 2B7VA 2RSMA 2HGHA 1QNTA 2EL6A 4LU9A 4JI2E 4R2PA 3KWRA 1NCSA 4NHRA 1EH6A 1J5EE 4LF4E 5KL7A 2WCC3 4B3ME 2KONA 2BB8A 3HXLA 4AQYE 2LE2A 5T6JA 2MC5A 4O4KA 1X6HA 2B3TB 4O43A 3T1YE 1PJTA 1FKAE 1XNQE 4WXDA 4OOGC 1PJQA 2ZM6E 4JI5E 4JI6E 4DUYE 2EMYA 4P78A 2EN2A 4LF6E 2EN1A 2EOEA 2YTEA 2RQLA 2YTQA 4WX9A 4YHHE 2YTGA 4X64E 2YTOA 2MDGA 2L2KB 2EPCA 5KL4A 3HPZA 2ODRD 1YYKA 4IJDA 1AAYA 3J81C 4TUGA 4F9CB 1N34E 2YT4A 2V85A 3KZZA 2DLKA 4BC7A 1ZBQA 3VYYA 2EMFA 4JI0E 5A69A 2A25A 2YSOA 1TF3A 2HJJA 4DV5E 2V87A 2EL4A 3C4BA 1WHQA 4BHCA 4GKKE 2I9IA 3ADLA 2DMIA 1X6FA 2HHHE 4LFCE 3UK3C 3OTOE 2YTPA 3EPJA 2MDRA 4ZYEA 2LUPB 2EPNA 1JK1A 1LLMC 3M99B 2EOSA 2EPOA 2UUCE 3QG5C 4JI4E 4NXME 3EPLA 2JPAA 2N8XA 4F9BB 1RQ0A 4DV0E 1MEYC 1UHZA 1UBDC 2LVHA 4I8OA 5BR8E 3AUZA 5A6BA 2PRTA 4M2ZA 4WFTA 1WRJA 4LTYA 2K7IA 2JP9A 1YUJA 2V88A 4BBYA 4BCAA 1A1KA 1BBOA 1N32E 1WXRA 2F4VE 3EPHA 2RS7A 2EOOA 1TN9A 4DR7E 1Z1BA 2E1MA 2D9HA 2EOHA 1BB8A 1KJKA 5A6BD 4WSPA 1A1FA 2ODRC 2RTXA 1PJSA 4R2SA 3IWBA 4O24A 5ADZA 2EM4A 4X9JA 2FGGA 4ZYGA 2M4IA 1GQEA 2EORA 2ENAA 2L6MA 2JYAA 2DLQA 5LMNE 1X48A 3BIDA 5KL2A 3OMLA 4ZYDA 4LFBE 5IXMB 1PDAA 1HNXE 2NABA 1YYOA 2LTSA 2ELYA 3HQ1A 3DJWA 2V89A 2DB2A 4J8ZA 1XNRE 4DV2E 2FTXB 4X62E 2YTIA 1A1JA 1JK2A 2EQ1A 4KWYA 4R8OA 1GTKA 2EMBA 5AE2A 2RPCA 3J80C 1DGCA 1IMUA 2EN3A 2NUFA 2JR1A 2V86A 1T4NA 4F6MA 4X66E 2YSPA 1G2FC 2EMZA 1MGTA 4HEIA 2LRSA 2EQ0A 1L4SA 1XMQE 1J26A 2EN7A 2EOIA 3ADJA 2HC5A 2WZOA 5AC5A 2EMCA 5TSEA 2EMIA 1RMDA 2LV2A 2YRKA 2L3JA 1X6EA 1G2DC 1XMOE 2M9AA 1I94E 2LTRA 4DR1E 2I13A 2YTNA 3J7AG 4DV7E 3HPSA 2NUEA 1DQ3A 3VHTB 2MKNA 1ZR9A 4ZYHA 4F54A 2WBTA 2EOMA 1T4OA 2EPMX 4DV3E 1T4LB 2CSHA 2EM7A 2CPNA 1AH5A 5AASA 2VRDA 2LBSB 1UN6B 2EPXA 4F9AB 2EWLA 2R1FA 4O5GA 2EQ3A 1IQOA 4LFAE 2NUGA 2ENCA 2YZTA 2LJHA 2YTJA 2FV4B 4LF7E 4R2EA 2KOUA 3P1XA 4B3TE 3ADIA 3EQ1A 3EPKA 2YTDA 3DF6A 1ZBTA
chains in the Genus database with same CATH topology
2EM9A 4R2SA 2WBUA 2BB8A 2EM4A 4X9JA 2DGCA 2EORA 1X6HA 1ZU1A 2ENAA 2DLQA 2EMLA 2WBSA 2EOQA 2EMYA 2EMWA 5KL2A 1WJPA 2EOJA 1A1GA 2EN2A 4M9VC 2EN1A 2NABA 2EOEA 2YTEA 2YTQA 2ELYA 2YTGA 2YTOA 2MDGA 3MHSC 2MKDA 2EPCA 2EM3A 5KL4A 2EJ4A 2EPAA 2EPUA 2YTFA 4IJDA 1AAYA 2EPRA 2GHFA 3MHHC 2EM6A 2DLKA 2YTIA 1ZAAC 1A1JA 2EMFA 1JK2A 2EQ1A 4GZNC 2EMBA 1TF6A 2EE8A 2RPCA 2A25A 5KL3A 2ENHA 2YSOA 1DGCA 2EN8A 1TF3A 2EL5A 2EN3A 4R2QA 2EM5A 2EN6A 2DRPA 2EL4A 4F6MA 2YSPA 1G2FC 2EMZA 1P47A 2YU5A 2DMIA 2EQ0A 1X6FA 2CTDA 2EN7A 3UK3C 2EP3A 2E72A 2EOIA 2CT1A 2YU8A 2YTPA 3EPJA 2EMKA 2EMCA 1YUIA 4R2CA 2EMHA 2EMIA 1JK1A 1A1IA 2ADRA 1RMDA 2LV2A 1LLMC 2YRKA 3M99B 2EOSA 1X6EA 1X5WA 1G2DC 2EM2A 2M9AA 2EOFA 3EPLA 2GLIA 2EMGA 2JPAA 4F6NA 2ELZA 2EN4A 2I13A 2YTNA 5KL5A 1A1HA 4F2JC 2LT7A 3VHTB 2MKNA 1ZR9A 1MEYC 1UBDC 1YSAC 2LVHA 2PRTA 2RSIA 2WBTA 4R2DA 4FK5C 2EOMA 2EM8A 1B69A 2EM7A 2CSHA 2EPPA 2LCEA 2VRDA 2JP9A 1YUJA 1UN6B 4R2RA 4IS1C 2EOYA 2EPXA 4R2AA 4WSGA 2EMXA 2EOZA 2R1FA 1A1KA 1F2IG 2EM0A 1BBOA 2J7JA 2YRMA 5KL6A 2EQ3A 2YRHA 2WCC3 1A1LA 2ENCA 3EPHA 2EMAA 2EOOA 2HGHA 2EL6A 2EOXA 4R2PA 2YTJA 1TN9A 4R2EA 1NCSA 1Z1BA 2D9HA 2EOHA 1BB8A 1KJKA 1X3CA 3EPKA 2LO3A 2YTDA 5KL7A 1A1FA 2EPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EM9 A;  4R2S A;  2WBU A;  2BB8 A;  2EM4 A;  4X9J A;  2DGC A;  2EOR A;  1X6H A;  1ZU1 A;  2ENA A;  2DLQ A;  2EML A;  2WBS A;  2EOQ A;  2EMY A;  2EMW A;  5KL2 A;  1WJP A;  2EOJ A;  1A1G A;  2EN2 A;  4M9V C;  2EN1 A;  2NAB A;  2EOE A;  2YTE A;  2YTQ A;  2ELY A;  2YTG A;  2YTO A;  2MDG A;  3MHS C;  2MKD A;  2EPC A;  2EM3 A;  5KL4 A;  2EJ4 A;  2EPA A;  2EPU A;  2YTF A;  4IJD A;  1AAY A;  2EPR A;  2GHF A;  3MHH C;  2EM6 A;  2DLK A;  2YTI A;  1ZAA C;  1A1J A;  2EMF A;  1JK2 A;  2EQ1 A;  4GZN C;  2EMB A;  1TF6 A;  2EE8 A;  2RPC A;  2A25 A;  5KL3 A;  2ENH A;  2YSO A;  1DGC A;  2EN8 A;  1TF3 A;  2EL5 A;  2EN3 A;  4R2Q A;  2EM5 A;  2EN6 A;  2DRP A;  2EL4 A;  4F6M A;  2YSP A;  1G2F C;  2EMZ A;  1P47 A;  2YU5 A;  2DMI A;  2EQ0 A;  1X6F A;  2CTD A;  2EN7 A;  3UK3 C;  2EP3 A;  2E72 A;  2EOI A;  2CT1 A;  2YU8 A;  2YTP A;  3EPJ A;  2EMK A;  2EMC A;  1YUI A;  4R2C A;  2EMH A;  2EMI A;  1JK1 A;  1A1I A;  2ADR A;  1RMD A;  2LV2 A;  1LLM C;  2YRK A;  3M99 B;  2EOS A;  1X6E A;  1X5W A;  1G2D C;  2EM2 A;  2M9A A;  2EOF A;  3EPL A;  2GLI A;  2EMG A;  2JPA A;  4F6N A;  2ELZ A;  2EN4 A;  2I13 A;  2YTN A;  5KL5 A;  1A1H A;  4F2J C;  2LT7 A;  3VHT B;  2MKN A;  1ZR9 A;  1MEY C;  1UBD C;  1YSA C;  2LVH A;  2PRT A;  2RSI A;  2WBT A;  4R2D A;  4FK5 C;  2EOM A;  2EM8 A;  1B69 A;  2EM7 A;  2CSH A;  2EPP A;  2LCE A;  2VRD A;  2JP9 A;  1YUJ A;  1UN6 B;  4R2R A;  4IS1 C;  2EOY A;  2EPX A;  4R2A A;  4WSG A;  2EMX A;  2EOZ A;  2R1F A;  1A1K A;  1F2I G;  2EM0 A;  1BBO A;  2J7J A;  2YRM A;  5KL6 A;  2EQ3 A;  2YRH A;  2WCC 3;  1A1L A;  2ENC A;  3EPH A;  2EMA A;  2EOO A;  2HGH A;  2EL6 A;  2EOX A;  4R2P A;  2YTJ A;  1TN9 A;  4R2E A;  1NCS A;  1Z1B A;  2D9H A;  2EOH A;  1BB8 A;  1KJK A;  1X3C A;  3EPK A;  2LO3 A;  2YTD A;  5KL7 A;  1A1F A;  2EPZ A; 
#chains in the Genus database with same CATH topology
 1X47 A;  1UIL A;  2WBU A;  2NA2 A;  1IQS A;  4K0K E;  2JWO A;  1PKP A;  4NZV A;  1O0W A;  2GPI A;  3BGH A;  5AC4 A;  2EZ6 A;  2LMZ A;  1FJG E;  1WHN A;  1SFE A;  1YPN A;  1A1G A;  4M9V C;  2L8T A;  4LF9 E;  2M1S A;  3BBG A;  4P7D A;  2JXP A;  3MHS C;  5A6J A;  2EM3 A;  4JI1 E;  3MHH C;  1NEI A;  2GHF A;  2YWQ A;  4DV6 E;  4GKJ E;  2LJU A;  4LF8 E;  2L92 A;  4DKK A;  1TF6 A;  2EE8 A;  5IT9 C;  2EN8 A;  2EL5 A;  1YZ9 A;  2EN6 A;  2IHR 1;  4Q28 A;  4DMI A;  2DRP A;  4JV5 E;  2H36 X;  4RHB B;  1HNW E;  2YU5 A;  2E72 A;  5LLQ A;  1IBL E;  1IBM E;  1RC7 A;  3ECR A;  4M0V A;  3MSW A;  1A1I A;  4B3S E;  3FIG A;  4N4R B;  1BBG A;  3KZY A;  1EH7 A;  2EM2 A;  4DR2 E;  2EOF A;  2GLI A;  2YPN A;  4DR5 E;  2EN4 A;  2B7T A;  3BF2 A;  4L8N A;  1IBK E;  4DUZ E;  4F2J C;  2LT7 A;  2KHX A;  2V8Q B;  2VF1 A;  2RSI A;  2UUB E;  4FK5 C;  2L3C A;  2EPK X;  2EM8 A;  2V83 A;  1B69 A;  4R03 A;  1N3G A;  3HTX A;  4R2R A;  4DR6 E;  2L2M A;  3H09 A;  2EOY A;  2LUQ A;  4WSG A;  4WPY A;  2EOZ A;  2K4V A;  2Q8U A;  4BMJ A;  2N3G A;  3IWC A;  1F2I G;  5AE1 A;  2YRH A;  4WXC A;  3ZOQ B;  1A1L A;  1HNZ E;  1STU A;  4KZS A;  2DMY A;  2EMA A;  3THN A;  2UUA E;  2EOX A;  3AV0 A;  2R76 A;  4KHP E;  3VYX A;  3ADG A;  1X3C A;  3JTZ A;  4OX9 E;  4BHB A;  2DIX A;  2UU9 E;  2LO3 A;  2EPL X;  2EPZ A;  2EM9 A;  3C4T A;  1N33 E;  4NXN E;  3IWD A;  3JAM C;  3K6Q A;  2DGC A;  3LLH A;  2JOX A;  1T39 A;  5A6K A;  1ZU1 A;  1KYQ A;  2EML A;  2WBS A;  2L2N A;  2VQF E;  4BC9 A;  2EOQ A;  4JI7 E;  2EMW A;  2DSY A;  4WYQ B;  1WJP A;  2EOJ A;  4MLV A;  4MLQ A;  3C6K A;  3TQM A;  2MC6 A;  2RS6 A;  3L00 A;  2G7H A;  4RH8 A;  5LMU E;  3LML A;  5F3W A;  4JI8 E;  4TUI A;  2JOB A;  3THO B;  1YFH A;  2L33 A;  1QU6 A;  2MKD A;  4DR4 E;  1SR9 A;  5A2Q C;  2EJ4 A;  5DNY A;  4JI3 E;  2UXB E;  2EPA A;  2EPU A;  2YTF A;  4X8W A;  3J7Y p;  2EPR A;  2EM6 A;  1HR0 E;  4LF5 E;  5LL6 R;  1ZAA C;  3RMP A;  1T38 A;  4GZN C;  5KL3 A;  4M30 A;  2ENH A;  2UXC E;  4R2Q A;  2EM5 A;  1P47 A;  4GEQ B;  5CFF E;  2BBG A;  2CTD A;  5AE3 A;  2EP3 A;  2YU8 A;  2CT1 A;  3VK6 A;  4X65 E;  3C6M A;  4BS9 A;  2EMK A;  1YUI A;  1EH8 A;  4R2C A;  3T1H E;  2EMH A;  5IWA E;  2VQE E;  2ADR A;  2UXD E;  2JY9 A;  1GZ6 A;  1X5W A;  2VE7 C;  2M7Q A;  2EMG A;  4F6N A;  2ELZ A;  5A6A A;  5IV8 B;  1N36 E;  1YYW A;  5KL5 A;  2E5L E;  4DR3 E;  1A1H A;  3F6H A;  4Q35 B;  2F8B A;  1YSA C;  4L5N C;  3JU0 A;  5FLX C;  4R2D A;  1DI2 A;  1X49 A;  4JYA E;  2JVA A;  2EPP A;  2LCE A;  2B9D A;  2N3H A;  4YY3 E;  3F6G A;  4IS1 C;  1EKZ A;  4R2A A;  4DV4 E;  2EMX A;  2EM0 A;  2J7J A;  2YRM A;  5KL6 A;  4DV1 E;  4HTG A;  4B3R E;  2B7V A;  2RSM A;  2HGH A;  1QNT A;  2EL6 A;  4LU9 A;  4JI2 E;  4R2P A;  3KWR A;  1NCS A;  4NHR A;  1EH6 A;  1J5E E;  4LF4 E;  5KL7 A;  2WCC 3;  4B3M E;  2KON A;  2BB8 A;  3HXL A;  4AQY E;  2LE2 A;  5T6J A;  2MC5 A;  4O4K A;  1X6H A;  2B3T B;  4O43 A;  3T1Y E;  1PJT A;  1FKA E;  1XNQ E;  4WXD A;  4OOG C;  1PJQ A;  2ZM6 E;  4JI5 E;  4JI6 E;  4DUY E;  2EMY A;  4P78 A;  2EN2 A;  4LF6 E;  2EN1 A;  2EOE A;  2YTE A;  2RQL A;  2YTQ A;  4WX9 A;  4YHH E;  2YTG A;  4X64 E;  2YTO A;  2MDG A;  2L2K B;  2EPC A;  5KL4 A;  3HPZ A;  2ODR D;  1YYK A;  4IJD A;  1AAY A;  3J81 C;  4TUG A;  4F9C B;  1N34 E;  2YT4 A;  2V85 A;  3KZZ A;  2DLK A;  4BC7 A;  1ZBQ A;  3VYY A;  2EMF A;  4JI0 E;  5A69 A;  2A25 A;  2YSO A;  1TF3 A;  2HJJ A;  4DV5 E;  2V87 A;  2EL4 A;  3C4B A;  1WHQ A;  4BHC A;  4GKK E;  2I9I A;  3ADL A;  2DMI A;  1X6F A;  2HHH E;  4LFC E;  3UK3 C;  3OTO E;  2YTP A;  3EPJ A;  2MDR A;  4ZYE A;  2LUP B;  2EPN A;  1JK1 A;  1LLM C;  3M99 B;  2EOS A;  2EPO A;  2UUC E;  3QG5 C;  4JI4 E;  4NXM E;  3EPL A;  2JPA A;  2N8X A;  4F9B B;  1RQ0 A;  4DV0 E;  1MEY C;  1UHZ A;  1UBD C;  2LVH A;  4I8O A;  5BR8 E;  3AUZ A;  5A6B A;  2PRT A;  4M2Z A;  4WFT A;  1WRJ A;  4LTY A;  2K7I A;  2JP9 A;  1YUJ A;  2V88 A;  4BBY A;  4BCA A;  1A1K A;  1BBO A;  1N32 E;  1WXR A;  2F4V E;  3EPH A;  2RS7 A;  2EOO A;  1TN9 A;  4DR7 E;  1Z1B A;  2E1M A;  2D9H A;  2EOH A;  1BB8 A;  1KJK A;  5A6B D;  4WSP A;  1A1F A;  2ODR C;  2RTX A;  1PJS A;  4R2S A;  3IWB A;  4O24 A;  5ADZ A;  2EM4 A;  4X9J A;  2FGG A;  4ZYG A;  2M4I A;  1GQE A;  2EOR A;  2ENA A;  2L6M A;  2JYA A;  2DLQ A;  5LMN E;  1X48 A;  3BID A;  5KL2 A;  3OML A;  4ZYD A;  4LFB E;  5IXM B;  1PDA A;  1HNX E;  2NAB A;  1YYO A;  2LTS A;  2ELY A;  3HQ1 A;  3DJW A;  2V89 A;  2DB2 A;  4J8Z A;  1XNR E;  4DV2 E;  2FTX B;  4X62 E;  2YTI A;  1A1J A;  1JK2 A;  2EQ1 A;  4KWY A;  4R8O A;  1GTK A;  2EMB A;  5AE2 A;  2RPC A;  3J80 C;  1DGC A;  1IMU A;  2EN3 A;  2NUF A;  2JR1 A;  2V86 A;  1T4N A;  4F6M A;  4X66 E;  2YSP A;  1G2F C;  2EMZ A;  1MGT A;  4HEI A;  2LRS A;  2EQ0 A;  1L4S A;  1XMQ E;  1J26 A;  2EN7 A;  2EOI A;  3ADJ A;  2HC5 A;  2WZO A;  5AC5 A;  2EMC A;  5TSE A;  2EMI A;  1RMD A;  2LV2 A;  2YRK A;  2L3J A;  1X6E A;  1G2D C;  1XMO E;  2M9A A;  1I94 E;  2LTR A;  4DR1 E;  2I13 A;  2YTN A;  3J7A G;  4DV7 E;  3HPS A;  2NUE A;  1DQ3 A;  3VHT B;  2MKN A;  1ZR9 A;  4ZYH A;  4F54 A;  2WBT A;  2EOM A;  1T4O A;  2EPM X;  4DV3 E;  1T4L B;  2CSH A;  2EM7 A;  2CPN A;  1AH5 A;  5AAS A;  2VRD A;  2LBS B;  1UN6 B;  2EPX A;  4F9A B;  2EWL A;  2R1F A;  4O5G A;  2EQ3 A;  1IQO A;  4LFA E;  2NUG A;  2ENC A;  2YZT A;  2LJH A;  2YTJ A;  2FV4 B;  4LF7 E;  4R2E A;  2KOU A;  3P1X A;  4B3T E;  3ADI A;  3EQ1 A;  3EPK A;  2YTD A;  3DF6 A;  1ZBT A; 
#chains in the Genus database with same CATH homology
 2EM9 A;  4R2S A;  2WBU A;  2BB8 A;  2EM4 A;  4X9J A;  2DGC A;  2EOR A;  1X6H A;  1ZU1 A;  2ENA A;  2DLQ A;  2EML A;  2WBS A;  2EOQ A;  2EMY A;  2EMW A;  5KL2 A;  1WJP A;  2EOJ A;  1A1G A;  2EN2 A;  4M9V C;  2EN1 A;  2NAB A;  2EOE A;  2YTE A;  2YTQ A;  2ELY A;  2YTG A;  2YTO A;  2MDG A;  3MHS C;  2MKD A;  2EPC A;  2EM3 A;  5KL4 A;  2EJ4 A;  2EPA A;  2EPU A;  2YTF A;  4IJD A;  1AAY A;  2EPR A;  2GHF A;  3MHH C;  2EM6 A;  2DLK A;  2YTI A;  1ZAA C;  1A1J A;  2EMF A;  1JK2 A;  2EQ1 A;  4GZN C;  2EMB A;  1TF6 A;  2EE8 A;  2RPC A;  2A25 A;  5KL3 A;  2ENH A;  2YSO A;  1DGC A;  2EN8 A;  1TF3 A;  2EL5 A;  2EN3 A;  4R2Q A;  2EM5 A;  2EN6 A;  2DRP A;  2EL4 A;  4F6M A;  2YSP A;  1G2F C;  2EMZ A;  1P47 A;  2YU5 A;  2DMI A;  2EQ0 A;  1X6F A;  2CTD A;  2EN7 A;  3UK3 C;  2EP3 A;  2E72 A;  2EOI A;  2CT1 A;  2YU8 A;  2YTP A;  3EPJ A;  2EMK A;  2EMC A;  1YUI A;  4R2C A;  2EMH A;  2EMI A;  1JK1 A;  1A1I A;  2ADR A;  1RMD A;  2LV2 A;  1LLM C;  2YRK A;  3M99 B;  2EOS A;  1X6E A;  1X5W A;  1G2D C;  2EM2 A;  2M9A A;  2EOF A;  3EPL A;  2GLI A;  2EMG A;  2JPA A;  4F6N A;  2ELZ A;  2EN4 A;  2I13 A;  2YTN A;  5KL5 A;  1A1H A;  4F2J C;  2LT7 A;  3VHT B;  2MKN A;  1ZR9 A;  1MEY C;  1UBD C;  1YSA C;  2LVH A;  2PRT A;  2RSI A;  2WBT A;  4R2D A;  4FK5 C;  2EOM A;  2EM8 A;  1B69 A;  2EM7 A;  2CSH A;  2EPP A;  2LCE A;  2VRD A;  2JP9 A;  1YUJ A;  1UN6 B;  4R2R A;  4IS1 C;  2EOY A;  2EPX A;  4R2A A;  4WSG A;  2EMX A;  2EOZ A;  2R1F A;  1A1K A;  1F2I G;  2EM0 A;  1BBO A;  2J7J A;  2YRM A;  5KL6 A;  2EQ3 A;  2YRH A;  2WCC 3;  1A1L A;  2ENC A;  3EPH A;  2EMA A;  2EOO A;  2HGH A;  2EL6 A;  2EOX A;  4R2P A;  2YTJ A;  1TN9 A;  4R2E A;  1NCS A;  1Z1B A;  2D9H A;  2EOH A;  1BB8 A;  1KJK A;  1X3C A;  3EPK A;  2LO3 A;  2YTD A;  5KL7 A;  1A1F A;  2EPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...