2I13A

Aart, a six finger zinc finger designed to recognize ann triplets
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
154
structure length
151
Chain Sequence
FSRSDHLAEHQRTHKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Aart, a Designed Six-finger Zinc Finger Peptide, Bound to DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*CP*AP*GP*AP*TP*GP*TP*AP*GP*GP*GP*AP*AP*AP*AP*GP*CP*CP*
total genus 45
structure length 151
sequence length 154
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2i13A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2i13A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2i13A03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2i13A04
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2i13A05
1Z1BA 1YUJA 2GLIA 4F6NA 2EMLA 5KL2A 2EN2A 2ENCA 2EOJA 2ELYA 2EM5A 1TF3A 2EM3A 2CSHA 3EPLA 2BB8A 2EN8A 2NABA 3MHHC 2EOXA 1RMDA 2ENAA 1NCSA 2EN7A 2RSIA 2YRKA 2YTQA 2EM7A 2WBSA 2EOHA 1A1IA 1DGCA 4F2JC 5KL7A 2EMFA 4IJDA 2YTGA 5KL5A 2DGCA 2EMXA 1MEYC 2M9AA 3EPJA 1B69A 2YU5A 2JP9A 2EL5A 2EMCA 2EPUA 2DLQA 1A1LA 4GZNC 2LV2A 2YSOA 2EM0A 2J7JA 2EMYA 4R2RA 2E72A 2EPXA 2DMIA 2EN4A 2EMAA 2HGHA 2EQ0A 1X5WA 2WBUA 4X9JA 3UK3C 1BBOA 2EMZA 2CTDA 1A1GA 2ENHA 1G2FC 2WCC3 1X6FA 2LVHA 1JK2A 2EQ3A 2DRPA 1X6EA 3EPKA 4R2PA 3MHSC 4F6MA 1UBDC 1TF6A 2R1FA 2YTFA 2EM6A 1KJKA 2EJ4A 2CT1A 2EOMA 1P47A 2EOFA 2YTEA 2LO3A 1F2IG 4FK5C 5KL4A 1X3CA 2EN6A 2JPAA 2EOZA 1ZAAC 2MKDA 2EM8A 5KL3A 2ELZA 2YTIA 1TN9A 2EOOA 2YU8A 2D9HA 2EN1A 2WBTA 2EOQA 2EL4A 2EN3A 2YSPA 1A1FA 1AAYA 2VRDA 2EMWA 2EOSA 2EOYA 1UN6B 2EPPA 2EPAA 1ZU1A 2EE8A 4R2CA 1X6HA 2EOIA 2YTJA 2YTOA 4R2DA 2A25A 5KL6A 1YSAC 2EM2A 1LLMC 2I13A 2EMIA 4R2SA 4R2QA 1G2DC 2EPCA 2YRMA 2YTDA 4R2AA 2YTNA 4WSGA 1YUIA 2EMGA 2EMHA 2EM9A 2EPRA 2ADRA 1ZR9A 1BB8A 2EOEA 1A1JA 2YTPA 2EM4A 2RPCA 4M9VC 3VHTB 2LCEA 2EMKA 2EMBA 1A1HA 1WJPA 4R2EA 2LT7A 2GHFA 2YRHA 1JK1A 3M99B 4IS1C 2EL6A 2DLKA 3EPHA 2EQ1A 1A1KA 2EPZA 2EP3A 2MDGA 2PRTA 2EORA 2MKNA
chains in the Genus database with same CATH superfamily
2VF1A 4TUIA 4DV5E 1YYOA 2NUFA 2ODRD 1UILA 2EOJA 2JYAA 4WPYA 1ZBTA 1TF3A 3KWRA 2KHXA 1T4OA 5LL6R 1FJGE 4DKKA 1FKAE 2JWOA 3MHHC 1UHZA 1HNWE 3AUZA 5TSEA 1RQ0A 2EN7A 2EM7A 5AE2A 4OX9E 4JYAE 2EOHA 1PKPA 1A1IA 5LLQA 1DGCA 4GEQB 4F2JC 1WHNA 1J5EE 5KL7A 2YTGA 4M2ZA 4O5GA 2EMXA 2L8TA 4DR4E 5A6BD 3EPJA 4JI6E 2YU5A 4P7DA 4DV1E 2J7JA 2V88A 4R2RA 4TUGA 4LF8E 2EQ0A 3JAMC 4LFBE 5A6BA 4X9JA 5CFFE 1BBOA 2JR1A 2HHHE 2CTDA 5A69A 2WCC3 4JI0E 1JK2A 4DR6E 3MHSC 4F6MA 1UBDC 1SR9A 2R1FA 2EM6A 5A2QC 2CT1A 2EPLX 2H36X 2G7HA 4F9CB 2LJUA 5AC5A 1X3CA 2MC5A 2LTSA 2EN6A 3ADJA 2NUEA 3T1HE 3LMLA 1X48A 1EH6A 3FIGA 1TN9A 4X66E 2UUBE 2EN3A 2YSPA 3VYYA 4B3TE 2EOYA 1UN6B 3J7AG 2Q8UA 2EE8A 1X6HA 2EOIA 2A25A 2EM2A 2NA2A 1LLMC 4BS9A 1G2DC 3K6QA 5ADZA 2YRMA 4WXCA 4JI8E 3IWCA 1YUIA 4BHCA 2EMHA 2ODRC 2YTPA 1MGTA 2UUAE 4NXNE 3VHTB 1A1HA 3QG5C 2LT7A 3ADLA 4MLVA 1T4LB 3M99B 1X47A 4JI3E 1STUA 4IS1C 2EPKX 5AASA 5BR8E 2LRSA 2EQ1A 3BGHA 4BMJA 2EORA 4LFCE 1KYQA 1AH5A 2VE7C 3J81C 1EKZA 2ELYA 2LBSB 2EM5A 4WX9A 4ZYDA 2RTXA 3VYXA 2EN8A 1XNRE 1YYKA 1RMDA 4BHBA 4K0KE 2RSIA 2YRKA 2E5LE 1BBGA 4GKKE 3IWDA 5AC4A 2EMFA 1XMQE 1MEYC 1B69A 2RSMA 2EMCA 4L5NC 2MDRA 2BBGA 2LJHA 4NZVA 4DUYE 4N4RB 2EZ6A 2YZTA 2JVAA 2EM0A 2L3JA 2DMIA 2FTXB 2N3GA 4LTYA 2M1SA 2WBUA 4DV2E 1X6FA 2HC5A 2R76A 2DRPA 1IQSA 3BIDA 1IBME 1TF6A 2YTFA 4R03A 4KWYA 1P47A 3TQMA 2L6MA 1N36E 4WFTA 3IWBA 1F2IG 4FK5C 5KL4A 1N32E 1PJTA 2KONA 4ZYGA 2EOZA 1GQEA 1RC7A 3F6HA 4ZYHA 2HJJA 2ELZA 2UUCE 2EOOA 2JOXA 2YU8A 4WXDA 4ZYEA 4JV5E 2VRDA 2UXDE 2FGGA 4LF7E 3H09A 4R2DA 4O43A 1YSAC 2EPCA 2V86A 3F6GA 2DSYA 2F8BA 5AE1A 2EMGA 2EPRA 4YY3E 2MC6A 4Q28A 2FV4B 2LCEA 3HQ1A 2E1MA 1WJPA 2GHFA 1JK1A 4X65E 2V8QB 2EL6A 2LE2A 2V89A 1A1KA 2PRTA 1YFHA 1YUJA 3J80C 2YPNA 4LU9A 1QNTA 3LLHA 1QU6A 3JU0A 2CSHA 3EPLA 2NABA 2EOXA 2N8XA 3DF6A 3ECRA 4DV6E 1NCSA 1XMOE 4JI4E 3C6KA 1YPNA 2YWQA 1PJQA 1N34E 3C4BA 4DR7E 4LFAE 3KZYA 2GPIA 4JI5E 3THNA 2EWLA 5KL5A 2DGCA 3KZZA 2RQLA 2EL5A 2EPUA 1N3GA 1X49A 1T4NA 3OMLA 3J7Yp 2YSOA 2L92A 2L2KB 4OOGC 4B3RE 2EPXA 2EN4A 2HGHA 3HPSA 1X5WA 4J8ZA 5IWAE 5FLXC 2L33A 2EMZA 3THOB 4X62E 2LVHA 1GTKA 4X64E 1HNZE 4JI2E 2UXCE 2EQ3A 1X6EA 3EPKA 2N3HA 4M30A 2JY9A 4P78A 2LTRA 4DV3E 2UXBE 4KHPE 5DNYA 1KJKA 2L2MA 2EOMA 2EOFA 1PJSA 1PDAA 4LF4E 1YYWA 1T38A 2LO3A 4O4KA 4F9AB 2B3TB 2EPMX 3HPZA 2MKDA 1DQ3A 4X8WA 2NUGA 4WSPA 1IQOA 3EQ1A 2UU9E 3HTXA 4AQYE 1A1FA 2KOUA 2EMWA 2EOSA 2L2NA 1GZ6A 3P1XA 2EPPA 4JI7E 2EPAA 3VK6A 4R2CA 2YTJA 3L00A 1NEIA 2IHR1 4LF6E 2I13A 2EMIA 4R2QA 3OTOE 2CPNA 4LF9E 2YTDA 2YTNA 1N33E 2DB2A 2ADRA 1BB8A 4M0VA 1A1JA 2V85A 1HR0E 4I8OA 4NHRA 5AE3A 1WXRA 4B3ME 4RH8A 2B7VA 2EMBA 5IT9C 4R2EA 4HEIA 2YRHA 5T6JA 1O0WA 2LMZA 4R8OA 2RS6A 3BF2A 3EPHA 4O24A 4GKJE 2GLIA 2V83A 2MKNA 4KZSA 1Z1BA 4HTGA 3HXLA 4F6NA 2EMLA 2RS7A 5KL2A 2EN2A 2ENCA 2V87A 5F3WA 4B3SE 3C4TA 5A6KA 2EM3A 4DMIA 2BB8A 4DV0E 4BBYA 2YT4A 4MLQA 4DV4E 5LMUE 2ENAA 2YTQA 2K4VA 2WBSA 3T1YE 3BBGA 2VQFE 4IJDA 1T39A 2M9AA 4BC7A 2JP9A 2K7IA 2DLQA 1A1LA 4RHBB 4GZNC 3C6MA 2B7TA 2LV2A 1XNQE 2EMYA 1SFEA 4DV7E 2E72A 4NXME 2EMAA 2DMYA 2DIXA 4YHHE 4F9BB 3JTZA 3ADIA 2I9IA 1IBLE 3UK3C 1A1GA 2ENHA 1G2FC 1L4SA 1IMUA 1J26A 2M7QA 4R2PA 3MSWA 4WYQB 4DR5E 1EH8A 2EPOA 4Q35B 2EJ4A 1YZ9A 2B9DA 2YTEA 5IXMB 2JOBA 2EPNA 1EH7A 2JPAA 4DR2E 1ZAAC 2LUPB 2M4IA 2EM8A 5KL3A 4LF5E 5A6JA 2YTIA 2WZOA 2D9HA 2EN1A 2WBTA 2EOQA 2EL4A 2L3CA 1IBKE 1ZBQA 4DR3E 1AAYA 3ZOQB 4F54A 1HNXE 4BCAA 2F4VE 1ZU1A 2VQEE 2YTOA 5KL6A 5A6AA 3ADGA 5IV8B 4R2SA 5LMNE 1WHQA 4R2AA 4WSGA 4BC9A 2JXPA 2EM9A 1ZR9A 1DI2A 2EOEA 3AV0A 4JI1E 2LUQA 3RMPA 2EM4A 2RPCA 4M9VC 2EMKA 1WRJA 4DUZE 2ZM6E 4DR1E 3DJWA 4L8NA 2DLKA 2EPZA 2EP3A 2MDGA 1I94E
chains in the Genus database with same CATH topology
1Z1BA 1YUJA 2GLIA 4F6NA 2EMLA 5KL2A 2EN2A 2ENCA 2EOJA 2ELYA 2EM5A 1TF3A 2EM3A 2CSHA 3EPLA 2BB8A 2EN8A 2NABA 3MHHC 2EOXA 1RMDA 2ENAA 1NCSA 2EN7A 2RSIA 2YRKA 2YTQA 2EM7A 2WBSA 2EOHA 1A1IA 1DGCA 4F2JC 5KL7A 2EMFA 4IJDA 2YTGA 5KL5A 2DGCA 2EMXA 1MEYC 2M9AA 3EPJA 1B69A 2YU5A 2JP9A 2EL5A 2EMCA 2EPUA 2DLQA 1A1LA 4GZNC 2LV2A 2YSOA 2EM0A 2J7JA 2EMYA 4R2RA 2E72A 2EPXA 2DMIA 2EN4A 2EMAA 2HGHA 2EQ0A 1X5WA 2WBUA 4X9JA 3UK3C 1BBOA 2EMZA 2CTDA 1A1GA 2ENHA 1G2FC 2WCC3 1X6FA 2LVHA 1JK2A 2EQ3A 2DRPA 1X6EA 3EPKA 4R2PA 3MHSC 4F6MA 1UBDC 1TF6A 2R1FA 2YTFA 2EM6A 1KJKA 2EJ4A 2CT1A 2EOMA 1P47A 2EOFA 2YTEA 2LO3A 1F2IG 4FK5C 5KL4A 1X3CA 2EN6A 2JPAA 2EOZA 1ZAAC 2MKDA 2EM8A 5KL3A 2ELZA 2YTIA 1TN9A 2EOOA 2YU8A 2D9HA 2EN1A 2WBTA 2EOQA 2EL4A 2EN3A 2YSPA 1A1FA 1AAYA 2VRDA 2EMWA 2EOSA 2EOYA 1UN6B 2EPPA 2EPAA 1ZU1A 2EE8A 4R2CA 1X6HA 2EOIA 2YTJA 2YTOA 4R2DA 2A25A 5KL6A 1YSAC 2EM2A 1LLMC 2I13A 2EMIA 4R2SA 4R2QA 1G2DC 2EPCA 2YRMA 2YTDA 4R2AA 2YTNA 4WSGA 1YUIA 2EMGA 2EMHA 2EM9A 2EPRA 2ADRA 1ZR9A 1BB8A 2EOEA 1A1JA 2YTPA 2EM4A 2RPCA 4M9VC 3VHTB 2LCEA 2EMKA 2EMBA 1A1HA 1WJPA 4R2EA 2LT7A 2GHFA 2YRHA 1JK1A 3M99B 4IS1C 2EL6A 2DLKA 3EPHA 2EQ1A 1A1KA 2EPZA 2EP3A 2MDGA 2PRTA 2EORA 2MKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z1B A;  1YUJ A;  2GLI A;  4F6N A;  2EML A;  5KL2 A;  2EN2 A;  2ENC A;  2EOJ A;  2ELY A;  2EM5 A;  1TF3 A;  2EM3 A;  2CSH A;  3EPL A;  2BB8 A;  2EN8 A;  2NAB A;  3MHH C;  2EOX A;  1RMD A;  2ENA A;  1NCS A;  2EN7 A;  2RSI A;  2YRK A;  2YTQ A;  2EM7 A;  2WBS A;  2EOH A;  1A1I A;  1DGC A;  4F2J C;  5KL7 A;  2EMF A;  4IJD A;  2YTG A;  5KL5 A;  2DGC A;  2EMX A;  1MEY C;  2M9A A;  3EPJ A;  1B69 A;  2YU5 A;  2JP9 A;  2EL5 A;  2EMC A;  2EPU A;  2DLQ A;  1A1L A;  4GZN C;  2LV2 A;  2YSO A;  2EM0 A;  2J7J A;  2EMY A;  4R2R A;  2E72 A;  2EPX A;  2DMI A;  2EN4 A;  2EMA A;  2HGH A;  2EQ0 A;  1X5W A;  2WBU A;  4X9J A;  3UK3 C;  1BBO A;  2EMZ A;  2CTD A;  1A1G A;  2ENH A;  1G2F C;  2WCC 3;  1X6F A;  2LVH A;  1JK2 A;  2EQ3 A;  2DRP A;  1X6E A;  3EPK A;  4R2P A;  3MHS C;  4F6M A;  1UBD C;  1TF6 A;  2R1F A;  2YTF A;  2EM6 A;  1KJK A;  2EJ4 A;  2CT1 A;  2EOM A;  1P47 A;  2EOF A;  2YTE A;  2LO3 A;  1F2I G;  4FK5 C;  5KL4 A;  1X3C A;  2EN6 A;  2JPA A;  2EOZ A;  1ZAA C;  2MKD A;  2EM8 A;  5KL3 A;  2ELZ A;  2YTI A;  1TN9 A;  2EOO A;  2YU8 A;  2D9H A;  2EN1 A;  2WBT A;  2EOQ A;  2EL4 A;  2EN3 A;  2YSP A;  1A1F A;  1AAY A;  2VRD A;  2EMW A;  2EOS A;  2EOY A;  1UN6 B;  2EPP A;  2EPA A;  1ZU1 A;  2EE8 A;  4R2C A;  1X6H A;  2EOI A;  2YTJ A;  2YTO A;  4R2D A;  2A25 A;  5KL6 A;  1YSA C;  2EM2 A;  1LLM C;  2I13 A;  2EMI A;  4R2S A;  4R2Q A;  1G2D C;  2EPC A;  2YRM A;  2YTD A;  4R2A A;  2YTN A;  4WSG A;  1YUI A;  2EMG A;  2EMH A;  2EM9 A;  2EPR A;  2ADR A;  1ZR9 A;  1BB8 A;  2EOE A;  1A1J A;  2YTP A;  2EM4 A;  2RPC A;  4M9V C;  3VHT B;  2LCE A;  2EMK A;  2EMB A;  1A1H A;  1WJP A;  4R2E A;  2LT7 A;  2GHF A;  2YRH A;  1JK1 A;  3M99 B;  4IS1 C;  2EL6 A;  2DLK A;  3EPH A;  2EQ1 A;  1A1K A;  2EPZ A;  2EP3 A;  2MDG A;  2PRT A;  2EOR A;  2MKN A; 
#chains in the Genus database with same CATH topology
 2VF1 A;  4TUI A;  4DV5 E;  1YYO A;  2NUF A;  2ODR D;  1UIL A;  2EOJ A;  2JYA A;  4WPY A;  1ZBT A;  1TF3 A;  3KWR A;  2KHX A;  1T4O A;  5LL6 R;  1FJG E;  4DKK A;  1FKA E;  2JWO A;  3MHH C;  1UHZ A;  1HNW E;  3AUZ A;  5TSE A;  1RQ0 A;  2EN7 A;  2EM7 A;  5AE2 A;  4OX9 E;  4JYA E;  2EOH A;  1PKP A;  1A1I A;  5LLQ A;  1DGC A;  4GEQ B;  4F2J C;  1WHN A;  1J5E E;  5KL7 A;  2YTG A;  4M2Z A;  4O5G A;  2EMX A;  2L8T A;  4DR4 E;  5A6B D;  3EPJ A;  4JI6 E;  2YU5 A;  4P7D A;  4DV1 E;  2J7J A;  2V88 A;  4R2R A;  4TUG A;  4LF8 E;  2EQ0 A;  3JAM C;  4LFB E;  5A6B A;  4X9J A;  5CFF E;  1BBO A;  2JR1 A;  2HHH E;  2CTD A;  5A69 A;  2WCC 3;  4JI0 E;  1JK2 A;  4DR6 E;  3MHS C;  4F6M A;  1UBD C;  1SR9 A;  2R1F A;  2EM6 A;  5A2Q C;  2CT1 A;  2EPL X;  2H36 X;  2G7H A;  4F9C B;  2LJU A;  5AC5 A;  1X3C A;  2MC5 A;  2LTS A;  2EN6 A;  3ADJ A;  2NUE A;  3T1H E;  3LML A;  1X48 A;  1EH6 A;  3FIG A;  1TN9 A;  4X66 E;  2UUB E;  2EN3 A;  2YSP A;  3VYY A;  4B3T E;  2EOY A;  1UN6 B;  3J7A G;  2Q8U A;  2EE8 A;  1X6H A;  2EOI A;  2A25 A;  2EM2 A;  2NA2 A;  1LLM C;  4BS9 A;  1G2D C;  3K6Q A;  5ADZ A;  2YRM A;  4WXC A;  4JI8 E;  3IWC A;  1YUI A;  4BHC A;  2EMH A;  2ODR C;  2YTP A;  1MGT A;  2UUA E;  4NXN E;  3VHT B;  1A1H A;  3QG5 C;  2LT7 A;  3ADL A;  4MLV A;  1T4L B;  3M99 B;  1X47 A;  4JI3 E;  1STU A;  4IS1 C;  2EPK X;  5AAS A;  5BR8 E;  2LRS A;  2EQ1 A;  3BGH A;  4BMJ A;  2EOR A;  4LFC E;  1KYQ A;  1AH5 A;  2VE7 C;  3J81 C;  1EKZ A;  2ELY A;  2LBS B;  2EM5 A;  4WX9 A;  4ZYD A;  2RTX A;  3VYX A;  2EN8 A;  1XNR E;  1YYK A;  1RMD A;  4BHB A;  4K0K E;  2RSI A;  2YRK A;  2E5L E;  1BBG A;  4GKK E;  3IWD A;  5AC4 A;  2EMF A;  1XMQ E;  1MEY C;  1B69 A;  2RSM A;  2EMC A;  4L5N C;  2MDR A;  2BBG A;  2LJH A;  4NZV A;  4DUY E;  4N4R B;  2EZ6 A;  2YZT A;  2JVA A;  2EM0 A;  2L3J A;  2DMI A;  2FTX B;  2N3G A;  4LTY A;  2M1S A;  2WBU A;  4DV2 E;  1X6F A;  2HC5 A;  2R76 A;  2DRP A;  1IQS A;  3BID A;  1IBM E;  1TF6 A;  2YTF A;  4R03 A;  4KWY A;  1P47 A;  3TQM A;  2L6M A;  1N36 E;  4WFT A;  3IWB A;  1F2I G;  4FK5 C;  5KL4 A;  1N32 E;  1PJT A;  2KON A;  4ZYG A;  2EOZ A;  1GQE A;  1RC7 A;  3F6H A;  4ZYH A;  2HJJ A;  2ELZ A;  2UUC E;  2EOO A;  2JOX A;  2YU8 A;  4WXD A;  4ZYE A;  4JV5 E;  2VRD A;  2UXD E;  2FGG A;  4LF7 E;  3H09 A;  4R2D A;  4O43 A;  1YSA C;  2EPC A;  2V86 A;  3F6G A;  2DSY A;  2F8B A;  5AE1 A;  2EMG A;  2EPR A;  4YY3 E;  2MC6 A;  4Q28 A;  2FV4 B;  2LCE A;  3HQ1 A;  2E1M A;  1WJP A;  2GHF A;  1JK1 A;  4X65 E;  2V8Q B;  2EL6 A;  2LE2 A;  2V89 A;  1A1K A;  2PRT A;  1YFH A;  1YUJ A;  3J80 C;  2YPN A;  4LU9 A;  1QNT A;  3LLH A;  1QU6 A;  3JU0 A;  2CSH A;  3EPL A;  2NAB A;  2EOX A;  2N8X A;  3DF6 A;  3ECR A;  4DV6 E;  1NCS A;  1XMO E;  4JI4 E;  3C6K A;  1YPN A;  2YWQ A;  1PJQ A;  1N34 E;  3C4B A;  4DR7 E;  4LFA E;  3KZY A;  2GPI A;  4JI5 E;  3THN A;  2EWL A;  5KL5 A;  2DGC A;  3KZZ A;  2RQL A;  2EL5 A;  2EPU A;  1N3G A;  1X49 A;  1T4N A;  3OML A;  3J7Y p;  2YSO A;  2L92 A;  2L2K B;  4OOG C;  4B3R E;  2EPX A;  2EN4 A;  2HGH A;  3HPS A;  1X5W A;  4J8Z A;  5IWA E;  5FLX C;  2L33 A;  2EMZ A;  3THO B;  4X62 E;  2LVH A;  1GTK A;  4X64 E;  1HNZ E;  4JI2 E;  2UXC E;  2EQ3 A;  1X6E A;  3EPK A;  2N3H A;  4M30 A;  2JY9 A;  4P78 A;  2LTR A;  4DV3 E;  2UXB E;  4KHP E;  5DNY A;  1KJK A;  2L2M A;  2EOM A;  2EOF A;  1PJS A;  1PDA A;  4LF4 E;  1YYW A;  1T38 A;  2LO3 A;  4O4K A;  4F9A B;  2B3T B;  2EPM X;  3HPZ A;  2MKD A;  1DQ3 A;  4X8W A;  2NUG A;  4WSP A;  1IQO A;  3EQ1 A;  2UU9 E;  3HTX A;  4AQY E;  1A1F A;  2KOU A;  2EMW A;  2EOS A;  2L2N A;  1GZ6 A;  3P1X A;  2EPP A;  4JI7 E;  2EPA A;  3VK6 A;  4R2C A;  2YTJ A;  3L00 A;  1NEI A;  2IHR 1;  4LF6 E;  2I13 A;  2EMI A;  4R2Q A;  3OTO E;  2CPN A;  4LF9 E;  2YTD A;  2YTN A;  1N33 E;  2DB2 A;  2ADR A;  1BB8 A;  4M0V A;  1A1J A;  2V85 A;  1HR0 E;  4I8O A;  4NHR A;  5AE3 A;  1WXR A;  4B3M E;  4RH8 A;  2B7V A;  2EMB A;  5IT9 C;  4R2E A;  4HEI A;  2YRH A;  5T6J A;  1O0W A;  2LMZ A;  4R8O A;  2RS6 A;  3BF2 A;  3EPH A;  4O24 A;  4GKJ E;  2GLI A;  2V83 A;  2MKN A;  4KZS A;  1Z1B A;  4HTG A;  3HXL A;  4F6N A;  2EML A;  2RS7 A;  5KL2 A;  2EN2 A;  2ENC A;  2V87 A;  5F3W A;  4B3S E;  3C4T A;  5A6K A;  2EM3 A;  4DMI A;  2BB8 A;  4DV0 E;  4BBY A;  2YT4 A;  4MLQ A;  4DV4 E;  5LMU E;  2ENA A;  2YTQ A;  2K4V A;  2WBS A;  3T1Y E;  3BBG A;  2VQF E;  4IJD A;  1T39 A;  2M9A A;  4BC7 A;  2JP9 A;  2K7I A;  2DLQ A;  1A1L A;  4RHB B;  4GZN C;  3C6M A;  2B7T A;  2LV2 A;  1XNQ E;  2EMY A;  1SFE A;  4DV7 E;  2E72 A;  4NXM E;  2EMA A;  2DMY A;  2DIX A;  4YHH E;  4F9B B;  3JTZ A;  3ADI A;  2I9I A;  1IBL E;  3UK3 C;  1A1G A;  2ENH A;  1G2F C;  1L4S A;  1IMU A;  1J26 A;  2M7Q A;  4R2P A;  3MSW A;  4WYQ B;  4DR5 E;  1EH8 A;  2EPO A;  4Q35 B;  2EJ4 A;  1YZ9 A;  2B9D A;  2YTE A;  5IXM B;  2JOB A;  2EPN A;  1EH7 A;  2JPA A;  4DR2 E;  1ZAA C;  2LUP B;  2M4I A;  2EM8 A;  5KL3 A;  4LF5 E;  5A6J A;  2YTI A;  2WZO A;  2D9H A;  2EN1 A;  2WBT A;  2EOQ A;  2EL4 A;  2L3C A;  1IBK E;  1ZBQ A;  4DR3 E;  1AAY A;  3ZOQ B;  4F54 A;  1HNX E;  4BCA A;  2F4V E;  1ZU1 A;  2VQE E;  2YTO A;  5KL6 A;  5A6A A;  3ADG A;  5IV8 B;  4R2S A;  5LMN E;  1WHQ A;  4R2A A;  4WSG A;  4BC9 A;  2JXP A;  2EM9 A;  1ZR9 A;  1DI2 A;  2EOE A;  3AV0 A;  4JI1 E;  2LUQ A;  3RMP A;  2EM4 A;  2RPC A;  4M9V C;  2EMK A;  1WRJ A;  4DUZ E;  2ZM6 E;  4DR1 E;  3DJW A;  4L8N A;  2DLK A;  2EPZ A;  2EP3 A;  2MDG A;  1I94 E; 
#chains in the Genus database with same CATH homology
 1Z1B A;  1YUJ A;  2GLI A;  4F6N A;  2EML A;  5KL2 A;  2EN2 A;  2ENC A;  2EOJ A;  2ELY A;  2EM5 A;  1TF3 A;  2EM3 A;  2CSH A;  3EPL A;  2BB8 A;  2EN8 A;  2NAB A;  3MHH C;  2EOX A;  1RMD A;  2ENA A;  1NCS A;  2EN7 A;  2RSI A;  2YRK A;  2YTQ A;  2EM7 A;  2WBS A;  2EOH A;  1A1I A;  1DGC A;  4F2J C;  5KL7 A;  2EMF A;  4IJD A;  2YTG A;  5KL5 A;  2DGC A;  2EMX A;  1MEY C;  2M9A A;  3EPJ A;  1B69 A;  2YU5 A;  2JP9 A;  2EL5 A;  2EMC A;  2EPU A;  2DLQ A;  1A1L A;  4GZN C;  2LV2 A;  2YSO A;  2EM0 A;  2J7J A;  2EMY A;  4R2R A;  2E72 A;  2EPX A;  2DMI A;  2EN4 A;  2EMA A;  2HGH A;  2EQ0 A;  1X5W A;  2WBU A;  4X9J A;  3UK3 C;  1BBO A;  2EMZ A;  2CTD A;  1A1G A;  2ENH A;  1G2F C;  2WCC 3;  1X6F A;  2LVH A;  1JK2 A;  2EQ3 A;  2DRP A;  1X6E A;  3EPK A;  4R2P A;  3MHS C;  4F6M A;  1UBD C;  1TF6 A;  2R1F A;  2YTF A;  2EM6 A;  1KJK A;  2EJ4 A;  2CT1 A;  2EOM A;  1P47 A;  2EOF A;  2YTE A;  2LO3 A;  1F2I G;  4FK5 C;  5KL4 A;  1X3C A;  2EN6 A;  2JPA A;  2EOZ A;  1ZAA C;  2MKD A;  2EM8 A;  5KL3 A;  2ELZ A;  2YTI A;  1TN9 A;  2EOO A;  2YU8 A;  2D9H A;  2EN1 A;  2WBT A;  2EOQ A;  2EL4 A;  2EN3 A;  2YSP A;  1A1F A;  1AAY A;  2VRD A;  2EMW A;  2EOS A;  2EOY A;  1UN6 B;  2EPP A;  2EPA A;  1ZU1 A;  2EE8 A;  4R2C A;  1X6H A;  2EOI A;  2YTJ A;  2YTO A;  4R2D A;  2A25 A;  5KL6 A;  1YSA C;  2EM2 A;  1LLM C;  2I13 A;  2EMI A;  4R2S A;  4R2Q A;  1G2D C;  2EPC A;  2YRM A;  2YTD A;  4R2A A;  2YTN A;  4WSG A;  1YUI A;  2EMG A;  2EMH A;  2EM9 A;  2EPR A;  2ADR A;  1ZR9 A;  1BB8 A;  2EOE A;  1A1J A;  2YTP A;  2EM4 A;  2RPC A;  4M9V C;  3VHT B;  2LCE A;  2EMK A;  2EMB A;  1A1H A;  1WJP A;  4R2E A;  2LT7 A;  2GHF A;  2YRH A;  1JK1 A;  3M99 B;  4IS1 C;  2EL6 A;  2DLK A;  3EPH A;  2EQ1 A;  1A1K A;  2EPZ A;  2EP3 A;  2MDG A;  2PRT A;  2EOR A;  2MKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...