2I13A

Aart, a six finger zinc finger designed to recognize ann triplets
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
154
structure length
151
Chain Sequence
FSRSDHLAEHQRTHKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*CP*AP*GP*AP*TP*GP*TP*AP*GP*GP*GP*AP*AP*AP*AP*GP*CP*CP*
publication title Structure of Aart, a Designed Six-finger Zinc Finger Peptide, Bound to DNA.
pubmed doi rcsb
source organism Mus musculus
total genus 45
structure length 151
sequence length 154
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2i13A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2i13A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2i13A03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2i13A04
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2i13A05
1B69A 2YTQA 1X6FA 2EOEA 2MKNA 4FK5C 1A1FA 2YTOA 3M99B 2YTPA 4X9JA 2I13A 2WBTA 2YTJA 2EN1A 2EOQA 2MKDA 2VRDA 1TF3A 2EM7A 2EMBA 4F2JC 1LLMC 2ENHA 1X5WA 2J7JA 3VHTB 2WBUA 2LCEA 2WCC3 3EPLA 2ENAA 2EPUA 1AAYA 1X6HA 2EOZA 4F6MA 2DLKA 2EP3A 2EQ0A 2NABA 2EMFA 5KL7A 2EM0A 1UN6B 2LV2A 2EM2A 2EOOA 2EMWA 5KL3A 2EJ4A 4R2SA 2EPCA 2EQ3A 2EPRA 1G2FC 2CT1A 2EMIA 2DGCA 2EORA 2DLQA 2EL4A 2EN6A 2DMIA 2YU8A 4WSGA 2JPAA 1ZU1A 4IS1C 1YUJA 1Z1BA 2YTNA 2ENCA 2EPZA 2EOXA 2HGHA 2EM4A 1BB8A 2YTFA 1X3CA 2EL6A 2YTEA 1ZAAC 2EN7A 1ZR9A 1A1JA 2GLIA 4GZNC 1G2DC 1X6EA 2EPPA 4R2DA 1RMDA 2YTIA 3EPHA 2EMHA 5KL6A 2RSIA 2EN4A 2EM9A 3EPKA 1JK2A 2YSOA 2EM5A 4R2CA 2EMLA 1YSAC 1UBDC 4IJDA 2EM8A 4R2EA 2LO3A 1A1KA 2EE8A 2ADRA 4M9VC 2JP9A 2CTDA 2D9HA 5KL5A 2BB8A 1A1IA 1YUIA 1WJPA 2EM3A 2EN8A 1F2IG 1TF6A 5KL2A 1MEYC 1TN9A 2EMZA 2GHFA 2YSPA 3UK3C 2YTGA 3EPJA 2EL5A 2RPCA 1P47A 1KJKA 2DRPA 2MDGA 4R2AA 2ELZA 2EMYA 2YRKA 1A1GA 2YTDA 1NCSA 2EMKA 1A1HA 2EOMA 2A25A 2EOHA 5KL4A 2ELYA 2EMAA 2EN2A 2EMGA 3MHHC 2LVHA 2EQ1A 4R2QA 2EMCA 2EOYA 2E72A 2YRHA 3MHSC 4R2PA 4F6NA 2EOIA 2EM6A 2EPXA 2EOFA 2EPAA 2YRMA 1A1LA 2CSHA 2R1FA 2EOSA 2M9AA 2EOJA 2WBSA 2PRTA 1JK1A 1DGCA 2EN3A 4R2RA 1BBOA 2EMXA 2LT7A 2YU5A
chains in the Genus database with same CATH superfamily
2YTQA 1X6FA 2JYAA 2MKNA 3ADIA 1WHQA 1XNRE 4HTGA 4M2ZA 3F6HA 3DJWA 2EOQA 3HXLA 4ZYHA 5A69A 4B3RE 4LU9A 2L3CA 1X5WA 3LMLA 3VHTB 2WCC3 3EPLA 4GKJE 2ENAA 2V8QB 3KWRA 1X6HA 2EOZA 2EQ0A 2EM0A 4K0KE 4ZYDA 4KZSA 2NUFA 4R2SA 2EQ3A 2EPRA 2L92A 2EMIA 2JOBA 1SFEA 2EL4A 2L2MA 1QNTA 2DMIA 3IWDA 4WSGA 4DV2E 4DUZE 3ECRA 1YUJA 1Z1BA 4LF5E 4X65E 2HGHA 2YTFA 1X3CA 3C6MA 2YTEA 2MC6A 1IQSA 2WZOA 5AC4A 4R2DA 3J81C 2NUEA 1YFHA 4NXNE 5KL6A 2EN4A 2V85A 2M4IA 3J7AG 2DMYA 4DV0E 4BC7A 1UBDC 1YSAC 3TQMA 4WXCA 4IJDA 5LMNE 1ZBQA 2LUPB 4M9VC 3AUZA 4JI2E 3C4BA 4B3ME 2UXCE 1HNWE 1YUIA 1TF6A 2E5LE 1MEYC 3BF2A 2EZ6A 4OX9E 3EPJA 5LMUE 2UXDE 1P47A 2DRPA 2MDGA 2CPNA 2L3JA 2H36X 4DV1E 1A1GA 2LE2A 4DV3E 2EOMA 2EN2A 2EMGA 3ADGA 3HPSA 2EMCA 2I9IA 4LFBE 2EOIA 4B3TE 4LF9E 4L5NC 2R1FA 4NZVA 2M9AA 2N3GA 1JK1A 2PRTA 1N34E 2VQEE 2GLIA 2LT7A 1T4NA 2UUAE 2FTXB 2YU5A 1B69A 4GEQB 2EOEA 2JWOA 4FK5C 4BMJA 4X66E 3JU0A 4X9JA 2WBTA 2YTJA 4JI3E 2VRDA 1GQEA 2MDRA 2LTSA 1AH5A 1QU6A 4RH8A 5LLQA 3BBGA 1IBKE 2YZTA 1AAYA 4JV5E 2DLKA 2FGGA 2NABA 4JYAE 2EPLX 2HC5A 1XMQE 2EPKX 2EJ4A 5AE3A 1PJTA 4MLQA 2EPCA 3T1YE 1GTKA 4F54A 1I94E 2B9DA 1N32E 1FKAE 4DR6E 2EN6A 2E1MA 2VF1A 2YU8A 3IWCA 1HNXE 4WPYA 1X48A 3VYYA 4LF7E 3HTXA 2EPOA 2RTXA 2V89A 2HJJA 1PDAA 3OMLA 1PJQA 4AQYE 3T1HE 2B7VA 1ZAAC 4I8OA 1A1JA 2LRSA 4BBYA 1X6EA 2L2NA 1PJSA 1RMDA 3LLHA 2N3HA 5FLXC 1IBLE 2RSIA 4R8OA 3J80C 1X49A 4WYQB 3QG5C 3JAMC 5F3WA 3EPKA 5IT9C 1JK2A 1X47A 2EM5A 1UILA 1IQOA 1T4OA 4JI5E 2EMLA 2RQLA 2Q8UA 4DR3E 4LTYA 2RSMA 2D9HA 4X8WA 5A6AA 1SR9A 2EMZA 2UUCE 2YTGA 3MSWA 4O5GA 4N4RB 2EL5A 2L8TA 1KJKA 5A6BA 1XMOE 2YRKA 2EMYA 4JI8E 2F4VE 2YTDA 4BHBA 1YYKA 2ODRD 2A25A 1N36E 4DR2E 2LVHA 2EOYA 2YRHA 3C4TA 2G7HA 4O24A 5IV8B 2YRMA 5AE1A 4JI6E 2EOSA 2WBSA 4R2RA 1BBOA 4DV7E 2M1SA 5ADZA 4JI4E 2DIXA 1BB8A 3J7Yp 2NA2A 2UXBE 1A1FA 3F6GA 3M99B 2YTPA 1IMUA 4LF6E 2EN1A 5AC5A 5A2QC 2EM7A 2LUQA 3ZOQB 1LLMC 2ENHA 2GPIA 4TUGA 2WBUA 1EH6A 2EP3A 1T4LB 4TUIA 2L33A 4OOGC 1UN6B 2LV2A 2YWQA 2B3TB 3VK6A 5KL3A 4X62E 4LF4E 2DB2A 1WHNA 1G2FC 2CT1A 3ADLA 4DV5E 2DLQA 2VE7C 4M30A 3THOB 2JPAA 1ZU1A 4YY3E 2YTNA 2ENCA 1FJGE 2V83A 2EPZA 2ZM6E 3THNA 2EM4A 2K4VA 4BS9A 1MGTA 4DUYE 4DR1E 2ODRC 1G2DC 3FIGA 3K6QA 4WSPA 4JI0E 2YTIA 3EPHA 4R03A 2RS6A 2EMHA 5AASA 2UU9E 1WRJA 1N3GA 2M7QA 2EM8A 2LO3A 1A1KA 1J5EE 4WX9A 5KL5A 2VQFE 2BB8A 2EPNA 1F2IG 5KL2A 1TN9A 1T38A 2YSPA 3UK3C 3RMPA 4M0VA 2RPCA 1YPNA 4R2AA 2ELZA 4ZYEA 4WFTA 2EMKA 3P1XA 1A1HA 1GZ6A 4LFCE 1PKPA 5KL4A 2ELYA 1WXRA 1EH8A 2EQ1A 2L6MA 5IXMB 4R2QA 4R2PA 3MHSC 2E72A 2EPXA 2EM6A 5A6KA 3KZZA 2EOFA 4O43A 2EPAA 1A1LA 4NXME 4B3SE 2JXPA 2YT4A 3IWBA 5A6BD 2RS7A 2EN3A 3H09A 2HHHE 4BCAA 2EMXA 2L2KB 2N8XA 1YYWA 4F9BB 5AE2A 2V86A 3BIDA 3L00A 5BR8E 2YTOA 4DV4E 2FV4B 3ADJA 1T39A 2I13A 4DR7E 2MKDA 1TF3A 2UUBE 2EMBA 4F2JC 2J7JA 2LCEA 1N33E 5TSEA 2EPUA 4ZYGA 4X64E 3C6KA 3OTOE 4F6MA 4JI1E 2V87A 4F9AB 2EMFA 2B7TA 5KL7A 3VYXA 1EH7A 2KONA 1L4SA 2EM2A 2EPMX 5A6JA 2EOOA 2EMWA 5LL6R 1HNZE 4DKKA 2LJUA 2DGCA 1UHZA 2EORA 1J26A 4DR4E 4NHRA 5T6JA 2JY9A 2LMZA 4IS1C 2KOUA 1O0WA 2R76A 4YHHE 2EOXA 2LBSB 4P7DA 2EL6A 4DMIA 2LJHA 4KWYA 1RQ0A 2EN7A 2NUGA 1ZR9A 4O4KA 4GZNC 2EWLA 2EPPA 2IHR1 3KZYA 5IWAE 2JVAA 4WXDA 1XNQE 3DF6A 2EM9A 1DI2A 4BC9A 2YSOA 5DNYA 4BHCA 2KHXA 2DSYA 4DV6E 4R2CA 4HEIA 4Q28A 4P78A 4R2EA 1EKZA 2EE8A 2ADRA 4Q35B 2LTRA 2JP9A 2CTDA 4KHPE 3HQ1A 4L8NA 1A1IA 1WJPA 2EM3A 2EN8A 2JR1A 1KYQA 2GHFA 5CFFE 4LFAE 2K7IA 2F8BA 1RC7A 3BGHA 1ZBTA 4LF8E 1BBGA 1NCSA 1YZ9A 4RHBB 2MC5A 2EOHA 2EMAA 4MLVA 3EQ1A 3MHHC 1STUA 4F9CB 4F6NA 3HPZA 4DR5E 3AV0A 4GKKE 1YYOA 2BBGA 4J8ZA 4JI7E 3JTZA 2CSHA 1DQ3A 1HR0E 1IBME 2EOJA 2V88A 1DGCA 1NEIA 2YPNA 2JOXA
chains in the Genus database with same CATH topology
1B69A 2YTQA 1X6FA 2EOEA 2MKNA 4FK5C 1A1FA 2YTOA 3M99B 2YTPA 4X9JA 2I13A 2WBTA 2YTJA 2EN1A 2EOQA 2MKDA 2VRDA 1TF3A 2EM7A 2EMBA 4F2JC 1LLMC 2ENHA 1X5WA 2J7JA 3VHTB 2WBUA 2LCEA 2WCC3 3EPLA 2ENAA 2EPUA 1AAYA 1X6HA 2EOZA 4F6MA 2DLKA 2EP3A 2EQ0A 2NABA 2EMFA 5KL7A 2EM0A 1UN6B 2LV2A 2EM2A 2EOOA 2EMWA 5KL3A 2EJ4A 4R2SA 2EPCA 2EQ3A 2EPRA 1G2FC 2CT1A 2EMIA 2DGCA 2EORA 2DLQA 2EL4A 2EN6A 2DMIA 2YU8A 4WSGA 2JPAA 1ZU1A 4IS1C 1YUJA 1Z1BA 2YTNA 2ENCA 2EPZA 2EOXA 2HGHA 2EM4A 1BB8A 2YTFA 1X3CA 2EL6A 2YTEA 1ZAAC 2EN7A 1ZR9A 1A1JA 2GLIA 4GZNC 1G2DC 1X6EA 2EPPA 4R2DA 1RMDA 2YTIA 3EPHA 2EMHA 5KL6A 2RSIA 2EN4A 2EM9A 3EPKA 1JK2A 2YSOA 2EM5A 4R2CA 2EMLA 1YSAC 1UBDC 4IJDA 2EM8A 4R2EA 2LO3A 1A1KA 2EE8A 2ADRA 4M9VC 2JP9A 2CTDA 2D9HA 5KL5A 2BB8A 1A1IA 1YUIA 1WJPA 2EM3A 2EN8A 1F2IG 1TF6A 5KL2A 1MEYC 1TN9A 2EMZA 2GHFA 2YSPA 3UK3C 2YTGA 3EPJA 2EL5A 2RPCA 1P47A 1KJKA 2DRPA 2MDGA 4R2AA 2ELZA 2EMYA 2YRKA 1A1GA 2YTDA 1NCSA 2EMKA 1A1HA 2EOMA 2A25A 2EOHA 5KL4A 2ELYA 2EMAA 2EN2A 2EMGA 3MHHC 2LVHA 2EQ1A 4R2QA 2EMCA 2EOYA 2E72A 2YRHA 3MHSC 4R2PA 4F6NA 2EOIA 2EM6A 2EPXA 2EOFA 2EPAA 2YRMA 1A1LA 2CSHA 2R1FA 2EOSA 2M9AA 2EOJA 2WBSA 2PRTA 1JK1A 1DGCA 2EN3A 4R2RA 1BBOA 2EMXA 2LT7A 2YU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B69 A;  2YTQ A;  1X6F A;  2EOE A;  2MKN A;  4FK5 C;  1A1F A;  2YTO A;  3M99 B;  2YTP A;  4X9J A;  2I13 A;  2WBT A;  2YTJ A;  2EN1 A;  2EOQ A;  2MKD A;  2VRD A;  1TF3 A;  2EM7 A;  2EMB A;  4F2J C;  1LLM C;  2ENH A;  1X5W A;  2J7J A;  3VHT B;  2WBU A;  2LCE A;  2WCC 3;  3EPL A;  2ENA A;  2EPU A;  1AAY A;  1X6H A;  2EOZ A;  4F6M A;  2DLK A;  2EP3 A;  2EQ0 A;  2NAB A;  2EMF A;  5KL7 A;  2EM0 A;  1UN6 B;  2LV2 A;  2EM2 A;  2EOO A;  2EMW A;  5KL3 A;  2EJ4 A;  4R2S A;  2EPC A;  2EQ3 A;  2EPR A;  1G2F C;  2CT1 A;  2EMI A;  2DGC A;  2EOR A;  2DLQ A;  2EL4 A;  2EN6 A;  2DMI A;  2YU8 A;  4WSG A;  2JPA A;  1ZU1 A;  4IS1 C;  1YUJ A;  1Z1B A;  2YTN A;  2ENC A;  2EPZ A;  2EOX A;  2HGH A;  2EM4 A;  1BB8 A;  2YTF A;  1X3C A;  2EL6 A;  2YTE A;  1ZAA C;  2EN7 A;  1ZR9 A;  1A1J A;  2GLI A;  4GZN C;  1G2D C;  1X6E A;  2EPP A;  4R2D A;  1RMD A;  2YTI A;  3EPH A;  2EMH A;  5KL6 A;  2RSI A;  2EN4 A;  2EM9 A;  3EPK A;  1JK2 A;  2YSO A;  2EM5 A;  4R2C A;  2EML A;  1YSA C;  1UBD C;  4IJD A;  2EM8 A;  4R2E A;  2LO3 A;  1A1K A;  2EE8 A;  2ADR A;  4M9V C;  2JP9 A;  2CTD A;  2D9H A;  5KL5 A;  2BB8 A;  1A1I A;  1YUI A;  1WJP A;  2EM3 A;  2EN8 A;  1F2I G;  1TF6 A;  5KL2 A;  1MEY C;  1TN9 A;  2EMZ A;  2GHF A;  2YSP A;  3UK3 C;  2YTG A;  3EPJ A;  2EL5 A;  2RPC A;  1P47 A;  1KJK A;  2DRP A;  2MDG A;  4R2A A;  2ELZ A;  2EMY A;  2YRK A;  1A1G A;  2YTD A;  1NCS A;  2EMK A;  1A1H A;  2EOM A;  2A25 A;  2EOH A;  5KL4 A;  2ELY A;  2EMA A;  2EN2 A;  2EMG A;  3MHH C;  2LVH A;  2EQ1 A;  4R2Q A;  2EMC A;  2EOY A;  2E72 A;  2YRH A;  3MHS C;  4R2P A;  4F6N A;  2EOI A;  2EM6 A;  2EPX A;  2EOF A;  2EPA A;  2YRM A;  1A1L A;  2CSH A;  2R1F A;  2EOS A;  2M9A A;  2EOJ A;  2WBS A;  2PRT A;  1JK1 A;  1DGC A;  2EN3 A;  4R2R A;  1BBO A;  2EMX A;  2LT7 A;  2YU5 A; 
#chains in the Genus database with same CATH topology
 2YTQ A;  1X6F A;  2JYA A;  2MKN A;  3ADI A;  1WHQ A;  1XNR E;  4HTG A;  4M2Z A;  3F6H A;  3DJW A;  2EOQ A;  3HXL A;  4ZYH A;  5A69 A;  4B3R E;  4LU9 A;  2L3C A;  1X5W A;  3LML A;  3VHT B;  2WCC 3;  3EPL A;  4GKJ E;  2ENA A;  2V8Q B;  3KWR A;  1X6H A;  2EOZ A;  2EQ0 A;  2EM0 A;  4K0K E;  4ZYD A;  4KZS A;  2NUF A;  4R2S A;  2EQ3 A;  2EPR A;  2L92 A;  2EMI A;  2JOB A;  1SFE A;  2EL4 A;  2L2M A;  1QNT A;  2DMI A;  3IWD A;  4WSG A;  4DV2 E;  4DUZ E;  3ECR A;  1YUJ A;  1Z1B A;  4LF5 E;  4X65 E;  2HGH A;  2YTF A;  1X3C A;  3C6M A;  2YTE A;  2MC6 A;  1IQS A;  2WZO A;  5AC4 A;  4R2D A;  3J81 C;  2NUE A;  1YFH A;  4NXN E;  5KL6 A;  2EN4 A;  2V85 A;  2M4I A;  3J7A G;  2DMY A;  4DV0 E;  4BC7 A;  1UBD C;  1YSA C;  3TQM A;  4WXC A;  4IJD A;  5LMN E;  1ZBQ A;  2LUP B;  4M9V C;  3AUZ A;  4JI2 E;  3C4B A;  4B3M E;  2UXC E;  1HNW E;  1YUI A;  1TF6 A;  2E5L E;  1MEY C;  3BF2 A;  2EZ6 A;  4OX9 E;  3EPJ A;  5LMU E;  2UXD E;  1P47 A;  2DRP A;  2MDG A;  2CPN A;  2L3J A;  2H36 X;  4DV1 E;  1A1G A;  2LE2 A;  4DV3 E;  2EOM A;  2EN2 A;  2EMG A;  3ADG A;  3HPS A;  2EMC A;  2I9I A;  4LFB E;  2EOI A;  4B3T E;  4LF9 E;  4L5N C;  2R1F A;  4NZV A;  2M9A A;  2N3G A;  1JK1 A;  2PRT A;  1N34 E;  2VQE E;  2GLI A;  2LT7 A;  1T4N A;  2UUA E;  2FTX B;  2YU5 A;  1B69 A;  4GEQ B;  2EOE A;  2JWO A;  4FK5 C;  4BMJ A;  4X66 E;  3JU0 A;  4X9J A;  2WBT A;  2YTJ A;  4JI3 E;  2VRD A;  1GQE A;  2MDR A;  2LTS A;  1AH5 A;  1QU6 A;  4RH8 A;  5LLQ A;  3BBG A;  1IBK E;  2YZT A;  1AAY A;  4JV5 E;  2DLK A;  2FGG A;  2NAB A;  4JYA E;  2EPL X;  2HC5 A;  1XMQ E;  2EPK X;  2EJ4 A;  5AE3 A;  1PJT A;  4MLQ A;  2EPC A;  3T1Y E;  1GTK A;  4F54 A;  1I94 E;  2B9D A;  1N32 E;  1FKA E;  4DR6 E;  2EN6 A;  2E1M A;  2VF1 A;  2YU8 A;  3IWC A;  1HNX E;  4WPY A;  1X48 A;  3VYY A;  4LF7 E;  3HTX A;  2EPO A;  2RTX A;  2V89 A;  2HJJ A;  1PDA A;  3OML A;  1PJQ A;  4AQY E;  3T1H E;  2B7V A;  1ZAA C;  4I8O A;  1A1J A;  2LRS A;  4BBY A;  1X6E A;  2L2N A;  1PJS A;  1RMD A;  3LLH A;  2N3H A;  5FLX C;  1IBL E;  2RSI A;  4R8O A;  3J80 C;  1X49 A;  4WYQ B;  3QG5 C;  3JAM C;  5F3W A;  3EPK A;  5IT9 C;  1JK2 A;  1X47 A;  2EM5 A;  1UIL A;  1IQO A;  1T4O A;  4JI5 E;  2EML A;  2RQL A;  2Q8U A;  4DR3 E;  4LTY A;  2RSM A;  2D9H A;  4X8W A;  5A6A A;  1SR9 A;  2EMZ A;  2UUC E;  2YTG A;  3MSW A;  4O5G A;  4N4R B;  2EL5 A;  2L8T A;  1KJK A;  5A6B A;  1XMO E;  2YRK A;  2EMY A;  4JI8 E;  2F4V E;  2YTD A;  4BHB A;  1YYK A;  2ODR D;  2A25 A;  1N36 E;  4DR2 E;  2LVH A;  2EOY A;  2YRH A;  3C4T A;  2G7H A;  4O24 A;  5IV8 B;  2YRM A;  5AE1 A;  4JI6 E;  2EOS A;  2WBS A;  4R2R A;  1BBO A;  4DV7 E;  2M1S A;  5ADZ A;  4JI4 E;  2DIX A;  1BB8 A;  3J7Y p;  2NA2 A;  2UXB E;  1A1F A;  3F6G A;  3M99 B;  2YTP A;  1IMU A;  4LF6 E;  2EN1 A;  5AC5 A;  5A2Q C;  2EM7 A;  2LUQ A;  3ZOQ B;  1LLM C;  2ENH A;  2GPI A;  4TUG A;  2WBU A;  1EH6 A;  2EP3 A;  1T4L B;  4TUI A;  2L33 A;  4OOG C;  1UN6 B;  2LV2 A;  2YWQ A;  2B3T B;  3VK6 A;  5KL3 A;  4X62 E;  4LF4 E;  2DB2 A;  1WHN A;  1G2F C;  2CT1 A;  3ADL A;  4DV5 E;  2DLQ A;  2VE7 C;  4M30 A;  3THO B;  2JPA A;  1ZU1 A;  4YY3 E;  2YTN A;  2ENC A;  1FJG E;  2V83 A;  2EPZ A;  2ZM6 E;  3THN A;  2EM4 A;  2K4V A;  4BS9 A;  1MGT A;  4DUY E;  4DR1 E;  2ODR C;  1G2D C;  3FIG A;  3K6Q A;  4WSP A;  4JI0 E;  2YTI A;  3EPH A;  4R03 A;  2RS6 A;  2EMH A;  5AAS A;  2UU9 E;  1WRJ A;  1N3G A;  2M7Q A;  2EM8 A;  2LO3 A;  1A1K A;  1J5E E;  4WX9 A;  5KL5 A;  2VQF E;  2BB8 A;  2EPN A;  1F2I G;  5KL2 A;  1TN9 A;  1T38 A;  2YSP A;  3UK3 C;  3RMP A;  4M0V A;  2RPC A;  1YPN A;  4R2A A;  2ELZ A;  4ZYE A;  4WFT A;  2EMK A;  3P1X A;  1A1H A;  1GZ6 A;  4LFC E;  1PKP A;  5KL4 A;  2ELY A;  1WXR A;  1EH8 A;  2EQ1 A;  2L6M A;  5IXM B;  4R2Q A;  4R2P A;  3MHS C;  2E72 A;  2EPX A;  2EM6 A;  5A6K A;  3KZZ A;  2EOF A;  4O43 A;  2EPA A;  1A1L A;  4NXM E;  4B3S E;  2JXP A;  2YT4 A;  3IWB A;  5A6B D;  2RS7 A;  2EN3 A;  3H09 A;  2HHH E;  4BCA A;  2EMX A;  2L2K B;  2N8X A;  1YYW A;  4F9B B;  5AE2 A;  2V86 A;  3BID A;  3L00 A;  5BR8 E;  2YTO A;  4DV4 E;  2FV4 B;  3ADJ A;  1T39 A;  2I13 A;  4DR7 E;  2MKD A;  1TF3 A;  2UUB E;  2EMB A;  4F2J C;  2J7J A;  2LCE A;  1N33 E;  5TSE A;  2EPU A;  4ZYG A;  4X64 E;  3C6K A;  3OTO E;  4F6M A;  4JI1 E;  2V87 A;  4F9A B;  2EMF A;  2B7T A;  5KL7 A;  3VYX A;  1EH7 A;  2KON A;  1L4S A;  2EM2 A;  2EPM X;  5A6J A;  2EOO A;  2EMW A;  5LL6 R;  1HNZ E;  4DKK A;  2LJU A;  2DGC A;  1UHZ A;  2EOR A;  1J26 A;  4DR4 E;  4NHR A;  5T6J A;  2JY9 A;  2LMZ A;  4IS1 C;  2KOU A;  1O0W A;  2R76 A;  4YHH E;  2EOX A;  2LBS B;  4P7D A;  2EL6 A;  4DMI A;  2LJH A;  4KWY A;  1RQ0 A;  2EN7 A;  2NUG A;  1ZR9 A;  4O4K A;  4GZN C;  2EWL A;  2EPP A;  2IHR 1;  3KZY A;  5IWA E;  2JVA A;  4WXD A;  1XNQ E;  3DF6 A;  2EM9 A;  1DI2 A;  4BC9 A;  2YSO A;  5DNY A;  4BHC A;  2KHX A;  2DSY A;  4DV6 E;  4R2C A;  4HEI A;  4Q28 A;  4P78 A;  4R2E A;  1EKZ A;  2EE8 A;  2ADR A;  4Q35 B;  2LTR A;  2JP9 A;  2CTD A;  4KHP E;  3HQ1 A;  4L8N A;  1A1I A;  1WJP A;  2EM3 A;  2EN8 A;  2JR1 A;  1KYQ A;  2GHF A;  5CFF E;  4LFA E;  2K7I A;  2F8B A;  1RC7 A;  3BGH A;  1ZBT A;  4LF8 E;  1BBG A;  1NCS A;  1YZ9 A;  4RHB B;  2MC5 A;  2EOH A;  2EMA A;  4MLV A;  3EQ1 A;  3MHH C;  1STU A;  4F9C B;  4F6N A;  3HPZ A;  4DR5 E;  3AV0 A;  4GKK E;  1YYO A;  2BBG A;  4J8Z A;  4JI7 E;  3JTZ A;  2CSH A;  1DQ3 A;  1HR0 E;  1IBM E;  2EOJ A;  2V88 A;  1DGC A;  1NEI A;  2YPN A;  2JOX A; 
#chains in the Genus database with same CATH homology
 1B69 A;  2YTQ A;  1X6F A;  2EOE A;  2MKN A;  4FK5 C;  1A1F A;  2YTO A;  3M99 B;  2YTP A;  4X9J A;  2I13 A;  2WBT A;  2YTJ A;  2EN1 A;  2EOQ A;  2MKD A;  2VRD A;  1TF3 A;  2EM7 A;  2EMB A;  4F2J C;  1LLM C;  2ENH A;  1X5W A;  2J7J A;  3VHT B;  2WBU A;  2LCE A;  2WCC 3;  3EPL A;  2ENA A;  2EPU A;  1AAY A;  1X6H A;  2EOZ A;  4F6M A;  2DLK A;  2EP3 A;  2EQ0 A;  2NAB A;  2EMF A;  5KL7 A;  2EM0 A;  1UN6 B;  2LV2 A;  2EM2 A;  2EOO A;  2EMW A;  5KL3 A;  2EJ4 A;  4R2S A;  2EPC A;  2EQ3 A;  2EPR A;  1G2F C;  2CT1 A;  2EMI A;  2DGC A;  2EOR A;  2DLQ A;  2EL4 A;  2EN6 A;  2DMI A;  2YU8 A;  4WSG A;  2JPA A;  1ZU1 A;  4IS1 C;  1YUJ A;  1Z1B A;  2YTN A;  2ENC A;  2EPZ A;  2EOX A;  2HGH A;  2EM4 A;  1BB8 A;  2YTF A;  1X3C A;  2EL6 A;  2YTE A;  1ZAA C;  2EN7 A;  1ZR9 A;  1A1J A;  2GLI A;  4GZN C;  1G2D C;  1X6E A;  2EPP A;  4R2D A;  1RMD A;  2YTI A;  3EPH A;  2EMH A;  5KL6 A;  2RSI A;  2EN4 A;  2EM9 A;  3EPK A;  1JK2 A;  2YSO A;  2EM5 A;  4R2C A;  2EML A;  1YSA C;  1UBD C;  4IJD A;  2EM8 A;  4R2E A;  2LO3 A;  1A1K A;  2EE8 A;  2ADR A;  4M9V C;  2JP9 A;  2CTD A;  2D9H A;  5KL5 A;  2BB8 A;  1A1I A;  1YUI A;  1WJP A;  2EM3 A;  2EN8 A;  1F2I G;  1TF6 A;  5KL2 A;  1MEY C;  1TN9 A;  2EMZ A;  2GHF A;  2YSP A;  3UK3 C;  2YTG A;  3EPJ A;  2EL5 A;  2RPC A;  1P47 A;  1KJK A;  2DRP A;  2MDG A;  4R2A A;  2ELZ A;  2EMY A;  2YRK A;  1A1G A;  2YTD A;  1NCS A;  2EMK A;  1A1H A;  2EOM A;  2A25 A;  2EOH A;  5KL4 A;  2ELY A;  2EMA A;  2EN2 A;  2EMG A;  3MHH C;  2LVH A;  2EQ1 A;  4R2Q A;  2EMC A;  2EOY A;  2E72 A;  2YRH A;  3MHS C;  4R2P A;  4F6N A;  2EOI A;  2EM6 A;  2EPX A;  2EOF A;  2EPA A;  2YRM A;  1A1L A;  2CSH A;  2R1F A;  2EOS A;  2M9A A;  2EOJ A;  2WBS A;  2PRT A;  1JK1 A;  1DGC A;  2EN3 A;  4R2R A;  1BBO A;  2EMX A;  2LT7 A;  2YU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...