2I13A

Aart, a six finger zinc finger designed to recognize ann triplets
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
154
structure length
151
Chain Sequence
FSRSDHLAEHQRTHKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*AP*GP*AP*TP*GP*TP*AP*GP*GP*GP*AP*AP*AP*AP*GP*CP*CP*
publication title Structure of Aart, a Designed Six-finger Zinc Finger Peptide, Bound to DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein/dna
total genus 45
structure length 151
sequence length 154
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2i13A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2i13A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2i13A03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2i13A04
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2i13A05
2EJ4A 1TF6A 2EPCA 2EOHA 5KL7A 1DGCA 1YUIA 2EMBA 5KL4A 4F6MA 2LCEA 1A1JA 1X5WA 1WJPA 2EOXA 2EPRA 1YSAC 3EPHA 2EPUA 2EP3A 2VRDA 1G2DC 2EMLA 2YTGA 2EMHA 2YTPA 2EPZA 2LVHA 3M99B 3MHSC 2CT1A 2NABA 1G2FC 2EN2A 2DGCA 1JK1A 2EOQA 2EMKA 1TF3A 2RPCA 5KL2A 3UK3C 2YU8A 1BBOA 1B69A 2EMZA 3VHTB 1MEYC 2YTFA 2GHFA 2YTNA 4IS1C 2EMYA 3EPKA 2EN7A 2EQ0A 4F2JC 5KL3A 2WCC3 4M9VC 4R2QA 1A1KA 2DRPA 2EPXA 2RSIA 2EOSA 2JP9A 2EOMA 5KL5A 2WBUA 2YSPA 4F6NA 2MKDA 2ENHA 2EMAA 1KJKA 2EMIA 2EMGA 2HGHA 1AAYA 2EOIA 2A25A 2JPAA 4R2CA 4IJDA 1Z1BA 1F2IG 2DMIA 2BB8A 2EM3A 3MHHC 2EM0A 2EL4A 2ENAA 5KL6A 1BB8A 1P47A 1NCSA 2YRKA 2R1FA 2EOEA 2EM9A 2J7JA 4R2PA 2EMFA 2EN4A 3EPLA 2WBTA 4X9JA 2D9HA 1A1LA 2YRHA 2EN1A 4WSGA 2EL6A 2EMWA 2YTQA 2EE8A 2I13A 2EOYA 2LV2A 2EM7A 2EMCA 2MDGA 1ZAAC 2LT7A 2EN3A 2YSOA 2EM4A 2YTOA 1LLMC 2EOFA 2EQ3A 2EPAA 2E72A 4R2RA 2YRMA 2CSHA 2DLQA 2M9AA 2PRTA 2YTJA 1A1HA 2EMXA 4R2EA 2LO3A 2WBSA 2ELZA 2MKNA 1X6EA 4GZNC 2EN6A 1JK2A 2EPPA 1ZR9A 2EM2A 2EORA 1UN6B 2YU5A 1A1IA 1ZU1A 2EOOA 2DLKA 1A1GA 2YTIA 1TN9A 1X6FA 2EQ1A 1A1FA 1X3CA 3EPJA 2CTDA 2EL5A 2YTDA 2EM5A 2YTEA 4R2DA 1UBDC 2EN8A 2ADRA 2ENCA 2EOJA 4FK5C 1RMDA 1YUJA 2EOZA 1X6HA 2EM8A 2GLIA 4R2AA 2ELYA 4R2SA 2EM6A
chains in the Genus database with same CATH superfamily
2EPCA 4F6MA 1T4LB 1X5WA 2EOXA 5A6AA 1YSAC 4DV1E 2UUBE 3THOB 2H36X 4LF9E 4JI1E 2EMLA 1FJGE 1X47A 4JI6E 4LF8E 1G2FC 3THNA 1STUA 2L2NA 2EN2A 2DGCA 1JK1A 4GKJE 2E5LE 2RPCA 3UK3C 4O43A 1GQEA 3DF6A 1BBOA 4JI3E 4JI0E 2EMZA 4DV5E 1X48A 4DR3E 4DV4E 4ZYDA 1X49A 4X64E 4IS1C 2JVAA 3C4TA 1N3GA 2JY9A 1IBME 4DUYE 4M9VC 2F4VE 4LF7E 2EPXA 5KL5A 2V89A 2YSPA 1J26A 2MKDA 2ENHA 2DSYA 3HQ1A 1EKZA 2JXPA 2B9DA 3T1HE 4WSPA 3JAMC 4X8WA 2EOIA 2JYAA 4IJDA 2RS7A 4AQYE 2EM3A 4KWYA 3C6KA 5A69A 2EM0A 2EL4A 1P47A 3BIDA 4O4KA 4RHBB 3MSWA 2HJJA 1SR9A 1QNTA 1A1LA 4WSGA 2EL6A 2EMWA 4BCAA 2B3TB 4DKKA 4LF6E 1KYQA 2EM7A 2EMCA 2MDGA 3IWCA 1T38A 1IQSA 1RQ0A 3T1YE 2EOFA 5IT9C 4R2RA 1EH8A 2M9AA 2PRTA 2YTJA 1A1HA 3C6MA 2WBSA 4DR2E 2LBSB 4B3SE 2L33A 2UUCE 4ZYHA 2N3GA 1A1IA 2V88A 1WHNA 2UXDE 5TSEA 5IXMB 1X6FA 2I9IA 2K7IA 2YTDA 4DUZE 4R2DA 3L00A 2NUEA 5LLQA 2EOJA 4I8OA 1RMDA 2F8BA 2EOZA 4LTYA 3ADJA 5FLXC 3HPZA 2V83A 2ELYA 5LL6R 4R2SA 1DGCA 1N33E 4TUIA 4JYAE 1UILA 2EPKX 1HNXE 3KWRA 3BGHA 3EPHA 4LFBE 2KONA 4WXDA 2EP3A 2VRDA 1YYOA 2E1MA 2EMHA 1YFHA 1J5EE 2EPZA 2LVHA 3M99B 1SFEA 2NABA 4LF5E 2FGGA 4L8NA 2YPNA 3VK6A 3EQ1A 1WRJA 4BC7A 1AH5A 2VF1A 1B69A 4TUGA 4BC9A 2FV4B 2ODRD 1MEYC 2GHFA 2EMYA 2N8XA 2EN7A 2WCC3 3AV0A 4R2QA 1A1KA 2DRPA 2JP9A 4F6NA 4GKKE 4MLQA 1N36E 2EMAA 2UU9E 1HR0E 2EWLA 1NEIA 4DMIA 1KJKA 2EMIA 2EMGA 2HGHA 2L8TA 3J7Yp 4OX9E 1AAYA 4KZSA 2A25A 2JPAA 2EPLX 2G7HA 1Z1BA 1YYKA 1WHQA 2DIXA 3MHHC 5DNYA 2L92A 3BBGA 4P78A 4B3TE 1NCSA 2YRKA 1PJSA 2EPNA 2R1FA 2EN4A 1XMQE 5ADZA 1PJQA 5AE1A 3HPSA 4MLVA 2JWOA 2RS6A 3BF2A 2YTQA 4L5NC 4WXCA 2LJHA 4J8ZA 2I13A 2EOYA 3C4BA 4DV6E 4JI5E 4B3ME 2YSOA 4LU9A 4DV3E 2LTRA 2EQ3A 4F54A 2YRMA 2CSHA 2DLQA 2HC5A 3K6QA 4ZYEA 1XNRE 1EH6A 2YWQA 1PJTA 3F6HA 5T6JA 2VQFE 1X6EA 4DR6E 2EN6A 1XMOE 2EORA 2NUGA 3VYYA 2YU5A 1ZU1A 1FKAE 1A1GA 2YTIA 1TN9A 3ADGA 1YPNA 3EPJA 1DI2A 2EL5A 4N4RB 2ADRA 4FK5C 2KOUA 4P7DA 4Q35B 1YUJA 4DR4E 1X6HA 3ADIA 2EM8A 4O24A 1PKPA 2GLIA 4NHRA 4WYQB 1MGTA 1TF6A 5KL7A 5KL4A 3LLHA 2V87A 2WZOA 2LMZA 2ODRC 1ZBTA 2YTPA 2UXCE 2RQLA 2B7TA 2GPIA 3MHSC 2CT1A 2EMKA 1TF3A 4BHCA 2YU8A 4GEQB 1RC7A 2NUFA 3VHTB 3RMPA 4DR5E 2YTNA 4YY3E 2JOXA 1YZ9A 3EPKA 2EQ0A 4F2JC 5KL3A 3ECRA 1T39A 5A6BA 2EOSA 3P1XA 4B3RE 4BBYA 3DJWA 5A6KA 2LJUA 2JR1A 2YT4A 4JV5E 4YHHE 3IWBA 2UXBE 2YZTA 2DMIA 1XNQE 2BB8A 2L3CA 5KL6A 5A6BD 5IWAE 2LUQA 3QG5C 4JI2E 2EOEA 2EM9A 2J7JA 4R2PA 4WPYA 2EMFA 5F3WA 3EPLA 2WBTA 4X9JA 2EPMX 3AUZA 3J7AG 3VYXA 4O5GA 2HHHE 2EE8A 4R03A 1YYWA 1ZAAC 4X65E 2EN3A 1PDAA 2YTOA 1LLMC 4JI4E 2EPAA 2E72A 2FTXB 2EMXA 3H09A 4R2EA 2LTSA 2ELZA 4X62E 4K0KE 2M4IA 1T4NA 5AE2A 2LRSA 2EM2A 4F9AB 1WXRA 2BBGA 4X66E 1UN6B 2EZ6A 2EOOA 1EH7A 5AE3A 1DQ3A 5A6JA 1A1FA 1X3CA 4M2ZA 3KZZA 1QU6A 4DR1E 2YTEA 4DR7E 1UBDC 4OOGC 2EN8A 1IMUA 1BBGA 2LUPB 2VQEE 2L2KB 1N32E 3ZOQB 4F9BB 1N34E 2B7VA 4F9CB 4R2AA 2MC6A 2YRHA 2EM6A 2MDRA 2EJ4A 1YUIA 2EOHA 3IWDA 2EMBA 2LCEA 1A1JA 1WJPA 2EPRA 3HXLA 2EPUA 2LE2A 1G2DC 1HNWE 4BS9A 2VE7C 4RH8A 2UUAE 2YTGA 2DMYA 2V8QB 3JTZA 1GZ6A 2EOQA 4NXME 5KL2A 3OMLA 3J81C 4DV2E 2ZM6E 3TQMA 4NXNE 1I94E 1ZBQA 2RSMA 2YTFA 4DV7E 4ZYGA 3ADLA 2RSIA 3KZYA 3OTOE 2EOMA 4M30A 2WBUA 5LMNE 5AASA 3HTXA 2KHXA 1O0WA 2RTXA 2M7QA 2JOBA 4LFAE 4JI8E 3FIGA 2EPOA 1L4SA 2M1SA 4BMJA 4R2CA 1F2IG 2MC5A 2NA2A 5IV8B 2ENAA 4DV0E 1BB8A 4LFCE 4WX9A 4WFTA 2Q8UA 2K4VA 1IBKE 5AC4A 2D9HA 2L2MA 4JI7E 5BR8E 2EN1A 1IBLE 4NZVA 5AC5A 4KHPE 4HEIA 3LMLA 1HNZE 2LV2A 3JU0A 1IQOA 2LT7A 5LMUE 2DB2A 2EM4A 5A2QC 2L6MA 2IHR1 2R76A 2N3HA 2V85A 2CPNA 2LO3A 2MKNA 4GZNC 1JK2A 4BHBA 2EPPA 1ZR9A 4Q28A 5CFFE 2L3JA 2DLKA 2V86A 4LF4E 4R8OA 4M0VA 2EQ1A 2CTDA 2EM5A 4HTGA 2ENCA 1T4OA 3F6GA 3J80C 1UHZA 1GTKA
chains in the Genus database with same CATH topology
2EJ4A 1TF6A 2EPCA 2EOHA 5KL7A 1DGCA 1YUIA 2EMBA 5KL4A 4F6MA 2LCEA 1A1JA 1X5WA 1WJPA 2EOXA 2EPRA 1YSAC 3EPHA 2EPUA 2EP3A 2VRDA 1G2DC 2EMLA 2YTGA 2EMHA 2YTPA 2EPZA 2LVHA 3M99B 3MHSC 2CT1A 2NABA 1G2FC 2EN2A 2DGCA 1JK1A 2EOQA 2EMKA 1TF3A 2RPCA 5KL2A 3UK3C 2YU8A 1BBOA 1B69A 2EMZA 3VHTB 1MEYC 2YTFA 2GHFA 2YTNA 4IS1C 2EMYA 3EPKA 2EN7A 2EQ0A 4F2JC 5KL3A 2WCC3 4M9VC 4R2QA 1A1KA 2DRPA 2EPXA 2RSIA 2EOSA 2JP9A 2EOMA 5KL5A 2WBUA 2YSPA 4F6NA 2MKDA 2ENHA 2EMAA 1KJKA 2EMIA 2EMGA 2HGHA 1AAYA 2EOIA 2A25A 2JPAA 4R2CA 4IJDA 1Z1BA 1F2IG 2DMIA 2BB8A 2EM3A 3MHHC 2EM0A 2EL4A 2ENAA 5KL6A 1BB8A 1P47A 1NCSA 2YRKA 2R1FA 2EOEA 2EM9A 2J7JA 4R2PA 2EMFA 2EN4A 3EPLA 2WBTA 4X9JA 2D9HA 1A1LA 2YRHA 2EN1A 4WSGA 2EL6A 2EMWA 2YTQA 2EE8A 2I13A 2EOYA 2LV2A 2EM7A 2EMCA 2MDGA 1ZAAC 2LT7A 2EN3A 2YSOA 2EM4A 2YTOA 1LLMC 2EOFA 2EQ3A 2EPAA 2E72A 4R2RA 2YRMA 2CSHA 2DLQA 2M9AA 2PRTA 2YTJA 1A1HA 2EMXA 4R2EA 2LO3A 2WBSA 2ELZA 2MKNA 1X6EA 4GZNC 2EN6A 1JK2A 2EPPA 1ZR9A 2EM2A 2EORA 1UN6B 2YU5A 1A1IA 1ZU1A 2EOOA 2DLKA 1A1GA 2YTIA 1TN9A 1X6FA 2EQ1A 1A1FA 1X3CA 3EPJA 2CTDA 2EL5A 2YTDA 2EM5A 2YTEA 4R2DA 1UBDC 2EN8A 2ADRA 2ENCA 2EOJA 4FK5C 1RMDA 1YUJA 2EOZA 1X6HA 2EM8A 2GLIA 4R2AA 2ELYA 4R2SA 2EM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJ4 A;  1TF6 A;  2EPC A;  2EOH A;  5KL7 A;  1DGC A;  1YUI A;  2EMB A;  5KL4 A;  4F6M A;  2LCE A;  1A1J A;  1X5W A;  1WJP A;  2EOX A;  2EPR A;  1YSA C;  3EPH A;  2EPU A;  2EP3 A;  2VRD A;  1G2D C;  2EML A;  2YTG A;  2EMH A;  2YTP A;  2EPZ A;  2LVH A;  3M99 B;  3MHS C;  2CT1 A;  2NAB A;  1G2F C;  2EN2 A;  2DGC A;  1JK1 A;  2EOQ A;  2EMK A;  1TF3 A;  2RPC A;  5KL2 A;  3UK3 C;  2YU8 A;  1BBO A;  1B69 A;  2EMZ A;  3VHT B;  1MEY C;  2YTF A;  2GHF A;  2YTN A;  4IS1 C;  2EMY A;  3EPK A;  2EN7 A;  2EQ0 A;  4F2J C;  5KL3 A;  2WCC 3;  4M9V C;  4R2Q A;  1A1K A;  2DRP A;  2EPX A;  2RSI A;  2EOS A;  2JP9 A;  2EOM A;  5KL5 A;  2WBU A;  2YSP A;  4F6N A;  2MKD A;  2ENH A;  2EMA A;  1KJK A;  2EMI A;  2EMG A;  2HGH A;  1AAY A;  2EOI A;  2A25 A;  2JPA A;  4R2C A;  4IJD A;  1Z1B A;  1F2I G;  2DMI A;  2BB8 A;  2EM3 A;  3MHH C;  2EM0 A;  2EL4 A;  2ENA A;  5KL6 A;  1BB8 A;  1P47 A;  1NCS A;  2YRK A;  2R1F A;  2EOE A;  2EM9 A;  2J7J A;  4R2P A;  2EMF A;  2EN4 A;  3EPL A;  2WBT A;  4X9J A;  2D9H A;  1A1L A;  2YRH A;  2EN1 A;  4WSG A;  2EL6 A;  2EMW A;  2YTQ A;  2EE8 A;  2I13 A;  2EOY A;  2LV2 A;  2EM7 A;  2EMC A;  2MDG A;  1ZAA C;  2LT7 A;  2EN3 A;  2YSO A;  2EM4 A;  2YTO A;  1LLM C;  2EOF A;  2EQ3 A;  2EPA A;  2E72 A;  4R2R A;  2YRM A;  2CSH A;  2DLQ A;  2M9A A;  2PRT A;  2YTJ A;  1A1H A;  2EMX A;  4R2E A;  2LO3 A;  2WBS A;  2ELZ A;  2MKN A;  1X6E A;  4GZN C;  2EN6 A;  1JK2 A;  2EPP A;  1ZR9 A;  2EM2 A;  2EOR A;  1UN6 B;  2YU5 A;  1A1I A;  1ZU1 A;  2EOO A;  2DLK A;  1A1G A;  2YTI A;  1TN9 A;  1X6F A;  2EQ1 A;  1A1F A;  1X3C A;  3EPJ A;  2CTD A;  2EL5 A;  2YTD A;  2EM5 A;  2YTE A;  4R2D A;  1UBD C;  2EN8 A;  2ADR A;  2ENC A;  2EOJ A;  4FK5 C;  1RMD A;  1YUJ A;  2EOZ A;  1X6H A;  2EM8 A;  2GLI A;  4R2A A;  2ELY A;  4R2S A;  2EM6 A; 
#chains in the Genus database with same CATH topology
 2EPC A;  4F6M A;  1T4L B;  1X5W A;  2EOX A;  5A6A A;  1YSA C;  4DV1 E;  2UUB E;  3THO B;  2H36 X;  4LF9 E;  4JI1 E;  2EML A;  1FJG E;  1X47 A;  4JI6 E;  4LF8 E;  1G2F C;  3THN A;  1STU A;  2L2N A;  2EN2 A;  2DGC A;  1JK1 A;  4GKJ E;  2E5L E;  2RPC A;  3UK3 C;  4O43 A;  1GQE A;  3DF6 A;  1BBO A;  4JI3 E;  4JI0 E;  2EMZ A;  4DV5 E;  1X48 A;  4DR3 E;  4DV4 E;  4ZYD A;  1X49 A;  4X64 E;  4IS1 C;  2JVA A;  3C4T A;  1N3G A;  2JY9 A;  1IBM E;  4DUY E;  4M9V C;  2F4V E;  4LF7 E;  2EPX A;  5KL5 A;  2V89 A;  2YSP A;  1J26 A;  2MKD A;  2ENH A;  2DSY A;  3HQ1 A;  1EKZ A;  2JXP A;  2B9D A;  3T1H E;  4WSP A;  3JAM C;  4X8W A;  2EOI A;  2JYA A;  4IJD A;  2RS7 A;  4AQY E;  2EM3 A;  4KWY A;  3C6K A;  5A69 A;  2EM0 A;  2EL4 A;  1P47 A;  3BID A;  4O4K A;  4RHB B;  3MSW A;  2HJJ A;  1SR9 A;  1QNT A;  1A1L A;  4WSG A;  2EL6 A;  2EMW A;  4BCA A;  2B3T B;  4DKK A;  4LF6 E;  1KYQ A;  2EM7 A;  2EMC A;  2MDG A;  3IWC A;  1T38 A;  1IQS A;  1RQ0 A;  3T1Y E;  2EOF A;  5IT9 C;  4R2R A;  1EH8 A;  2M9A A;  2PRT A;  2YTJ A;  1A1H A;  3C6M A;  2WBS A;  4DR2 E;  2LBS B;  4B3S E;  2L33 A;  2UUC E;  4ZYH A;  2N3G A;  1A1I A;  2V88 A;  1WHN A;  2UXD E;  5TSE A;  5IXM B;  1X6F A;  2I9I A;  2K7I A;  2YTD A;  4DUZ E;  4R2D A;  3L00 A;  2NUE A;  5LLQ A;  2EOJ A;  4I8O A;  1RMD A;  2F8B A;  2EOZ A;  4LTY A;  3ADJ A;  5FLX C;  3HPZ A;  2V83 A;  2ELY A;  5LL6 R;  4R2S A;  1DGC A;  1N33 E;  4TUI A;  4JYA E;  1UIL A;  2EPK X;  1HNX E;  3KWR A;  3BGH A;  3EPH A;  4LFB E;  2KON A;  4WXD A;  2EP3 A;  2VRD A;  1YYO A;  2E1M A;  2EMH A;  1YFH A;  1J5E E;  2EPZ A;  2LVH A;  3M99 B;  1SFE A;  2NAB A;  4LF5 E;  2FGG A;  4L8N A;  2YPN A;  3VK6 A;  3EQ1 A;  1WRJ A;  4BC7 A;  1AH5 A;  2VF1 A;  1B69 A;  4TUG A;  4BC9 A;  2FV4 B;  2ODR D;  1MEY C;  2GHF A;  2EMY A;  2N8X A;  2EN7 A;  2WCC 3;  3AV0 A;  4R2Q A;  1A1K A;  2DRP A;  2JP9 A;  4F6N A;  4GKK E;  4MLQ A;  1N36 E;  2EMA A;  2UU9 E;  1HR0 E;  2EWL A;  1NEI A;  4DMI A;  1KJK A;  2EMI A;  2EMG A;  2HGH A;  2L8T A;  3J7Y p;  4OX9 E;  1AAY A;  4KZS A;  2A25 A;  2JPA A;  2EPL X;  2G7H A;  1Z1B A;  1YYK A;  1WHQ A;  2DIX A;  3MHH C;  5DNY A;  2L92 A;  3BBG A;  4P78 A;  4B3T E;  1NCS A;  2YRK A;  1PJS A;  2EPN A;  2R1F A;  2EN4 A;  1XMQ E;  5ADZ A;  1PJQ A;  5AE1 A;  3HPS A;  4MLV A;  2JWO A;  2RS6 A;  3BF2 A;  2YTQ A;  4L5N C;  4WXC A;  2LJH A;  4J8Z A;  2I13 A;  2EOY A;  3C4B A;  4DV6 E;  4JI5 E;  4B3M E;  2YSO A;  4LU9 A;  4DV3 E;  2LTR A;  2EQ3 A;  4F54 A;  2YRM A;  2CSH A;  2DLQ A;  2HC5 A;  3K6Q A;  4ZYE A;  1XNR E;  1EH6 A;  2YWQ A;  1PJT A;  3F6H A;  5T6J A;  2VQF E;  1X6E A;  4DR6 E;  2EN6 A;  1XMO E;  2EOR A;  2NUG A;  3VYY A;  2YU5 A;  1ZU1 A;  1FKA E;  1A1G A;  2YTI A;  1TN9 A;  3ADG A;  1YPN A;  3EPJ A;  1DI2 A;  2EL5 A;  4N4R B;  2ADR A;  4FK5 C;  2KOU A;  4P7D A;  4Q35 B;  1YUJ A;  4DR4 E;  1X6H A;  3ADI A;  2EM8 A;  4O24 A;  1PKP A;  2GLI A;  4NHR A;  4WYQ B;  1MGT A;  1TF6 A;  5KL7 A;  5KL4 A;  3LLH A;  2V87 A;  2WZO A;  2LMZ A;  2ODR C;  1ZBT A;  2YTP A;  2UXC E;  2RQL A;  2B7T A;  2GPI A;  3MHS C;  2CT1 A;  2EMK A;  1TF3 A;  4BHC A;  2YU8 A;  4GEQ B;  1RC7 A;  2NUF A;  3VHT B;  3RMP A;  4DR5 E;  2YTN A;  4YY3 E;  2JOX A;  1YZ9 A;  3EPK A;  2EQ0 A;  4F2J C;  5KL3 A;  3ECR A;  1T39 A;  5A6B A;  2EOS A;  3P1X A;  4B3R E;  4BBY A;  3DJW A;  5A6K A;  2LJU A;  2JR1 A;  2YT4 A;  4JV5 E;  4YHH E;  3IWB A;  2UXB E;  2YZT A;  2DMI A;  1XNQ E;  2BB8 A;  2L3C A;  5KL6 A;  5A6B D;  5IWA E;  2LUQ A;  3QG5 C;  4JI2 E;  2EOE A;  2EM9 A;  2J7J A;  4R2P A;  4WPY A;  2EMF A;  5F3W A;  3EPL A;  2WBT A;  4X9J A;  2EPM X;  3AUZ A;  3J7A G;  3VYX A;  4O5G A;  2HHH E;  2EE8 A;  4R03 A;  1YYW A;  1ZAA C;  4X65 E;  2EN3 A;  1PDA A;  2YTO A;  1LLM C;  4JI4 E;  2EPA A;  2E72 A;  2FTX B;  2EMX A;  3H09 A;  4R2E A;  2LTS A;  2ELZ A;  4X62 E;  4K0K E;  2M4I A;  1T4N A;  5AE2 A;  2LRS A;  2EM2 A;  4F9A B;  1WXR A;  2BBG A;  4X66 E;  1UN6 B;  2EZ6 A;  2EOO A;  1EH7 A;  5AE3 A;  1DQ3 A;  5A6J A;  1A1F A;  1X3C A;  4M2Z A;  3KZZ A;  1QU6 A;  4DR1 E;  2YTE A;  4DR7 E;  1UBD C;  4OOG C;  2EN8 A;  1IMU A;  1BBG A;  2LUP B;  2VQE E;  2L2K B;  1N32 E;  3ZOQ B;  4F9B B;  1N34 E;  2B7V A;  4F9C B;  4R2A A;  2MC6 A;  2YRH A;  2EM6 A;  2MDR A;  2EJ4 A;  1YUI A;  2EOH A;  3IWD A;  2EMB A;  2LCE A;  1A1J A;  1WJP A;  2EPR A;  3HXL A;  2EPU A;  2LE2 A;  1G2D C;  1HNW E;  4BS9 A;  2VE7 C;  4RH8 A;  2UUA E;  2YTG A;  2DMY A;  2V8Q B;  3JTZ A;  1GZ6 A;  2EOQ A;  4NXM E;  5KL2 A;  3OML A;  3J81 C;  4DV2 E;  2ZM6 E;  3TQM A;  4NXN E;  1I94 E;  1ZBQ A;  2RSM A;  2YTF A;  4DV7 E;  4ZYG A;  3ADL A;  2RSI A;  3KZY A;  3OTO E;  2EOM A;  4M30 A;  2WBU A;  5LMN E;  5AAS A;  3HTX A;  2KHX A;  1O0W A;  2RTX A;  2M7Q A;  2JOB A;  4LFA E;  4JI8 E;  3FIG A;  2EPO A;  1L4S A;  2M1S A;  4BMJ A;  4R2C A;  1F2I G;  2MC5 A;  2NA2 A;  5IV8 B;  2ENA A;  4DV0 E;  1BB8 A;  4LFC E;  4WX9 A;  4WFT A;  2Q8U A;  2K4V A;  1IBK E;  5AC4 A;  2D9H A;  2L2M A;  4JI7 E;  5BR8 E;  2EN1 A;  1IBL E;  4NZV A;  5AC5 A;  4KHP E;  4HEI A;  3LML A;  1HNZ E;  2LV2 A;  3JU0 A;  1IQO A;  2LT7 A;  5LMU E;  2DB2 A;  2EM4 A;  5A2Q C;  2L6M A;  2IHR 1;  2R76 A;  2N3H A;  2V85 A;  2CPN A;  2LO3 A;  2MKN A;  4GZN C;  1JK2 A;  4BHB A;  2EPP A;  1ZR9 A;  4Q28 A;  5CFF E;  2L3J A;  2DLK A;  2V86 A;  4LF4 E;  4R8O A;  4M0V A;  2EQ1 A;  2CTD A;  2EM5 A;  4HTG A;  2ENC A;  1T4O A;  3F6G A;  3J80 C;  1UHZ A;  1GTK A; 
#chains in the Genus database with same CATH homology
 2EJ4 A;  1TF6 A;  2EPC A;  2EOH A;  5KL7 A;  1DGC A;  1YUI A;  2EMB A;  5KL4 A;  4F6M A;  2LCE A;  1A1J A;  1X5W A;  1WJP A;  2EOX A;  2EPR A;  1YSA C;  3EPH A;  2EPU A;  2EP3 A;  2VRD A;  1G2D C;  2EML A;  2YTG A;  2EMH A;  2YTP A;  2EPZ A;  2LVH A;  3M99 B;  3MHS C;  2CT1 A;  2NAB A;  1G2F C;  2EN2 A;  2DGC A;  1JK1 A;  2EOQ A;  2EMK A;  1TF3 A;  2RPC A;  5KL2 A;  3UK3 C;  2YU8 A;  1BBO A;  1B69 A;  2EMZ A;  3VHT B;  1MEY C;  2YTF A;  2GHF A;  2YTN A;  4IS1 C;  2EMY A;  3EPK A;  2EN7 A;  2EQ0 A;  4F2J C;  5KL3 A;  2WCC 3;  4M9V C;  4R2Q A;  1A1K A;  2DRP A;  2EPX A;  2RSI A;  2EOS A;  2JP9 A;  2EOM A;  5KL5 A;  2WBU A;  2YSP A;  4F6N A;  2MKD A;  2ENH A;  2EMA A;  1KJK A;  2EMI A;  2EMG A;  2HGH A;  1AAY A;  2EOI A;  2A25 A;  2JPA A;  4R2C A;  4IJD A;  1Z1B A;  1F2I G;  2DMI A;  2BB8 A;  2EM3 A;  3MHH C;  2EM0 A;  2EL4 A;  2ENA A;  5KL6 A;  1BB8 A;  1P47 A;  1NCS A;  2YRK A;  2R1F A;  2EOE A;  2EM9 A;  2J7J A;  4R2P A;  2EMF A;  2EN4 A;  3EPL A;  2WBT A;  4X9J A;  2D9H A;  1A1L A;  2YRH A;  2EN1 A;  4WSG A;  2EL6 A;  2EMW A;  2YTQ A;  2EE8 A;  2I13 A;  2EOY A;  2LV2 A;  2EM7 A;  2EMC A;  2MDG A;  1ZAA C;  2LT7 A;  2EN3 A;  2YSO A;  2EM4 A;  2YTO A;  1LLM C;  2EOF A;  2EQ3 A;  2EPA A;  2E72 A;  4R2R A;  2YRM A;  2CSH A;  2DLQ A;  2M9A A;  2PRT A;  2YTJ A;  1A1H A;  2EMX A;  4R2E A;  2LO3 A;  2WBS A;  2ELZ A;  2MKN A;  1X6E A;  4GZN C;  2EN6 A;  1JK2 A;  2EPP A;  1ZR9 A;  2EM2 A;  2EOR A;  1UN6 B;  2YU5 A;  1A1I A;  1ZU1 A;  2EOO A;  2DLK A;  1A1G A;  2YTI A;  1TN9 A;  1X6F A;  2EQ1 A;  1A1F A;  1X3C A;  3EPJ A;  2CTD A;  2EL5 A;  2YTD A;  2EM5 A;  2YTE A;  4R2D A;  1UBD C;  2EN8 A;  2ADR A;  2ENC A;  2EOJ A;  4FK5 C;  1RMD A;  1YUJ A;  2EOZ A;  1X6H A;  2EM8 A;  2GLI A;  4R2A A;  2ELY A;  4R2S A;  2EM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...