2I13A

Aart, a six finger zinc finger designed to recognize ann triplets
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
154
structure length
151
Chain Sequence
FSRSDHLAEHQRTHKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Aart, a Designed Six-finger Zinc Finger Peptide, Bound to DNA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*CP*AP*GP*AP*TP*GP*TP*AP*GP*GP*GP*AP*AP*AP*AP*GP*CP*CP*
total genus 45
structure length 151
sequence length 154
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2i13A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2i13A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2i13A03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2i13A04
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2i13A05
1X6HA 3EPJA 1X5WA 2ELYA 2EMFA 2YTIA 2JPAA 1ZU1A 2YTQA 2RSIA 1A1HA 2ENHA 2EOOA 2EMZA 2EM7A 2EN3A 2EN7A 2EOJA 2LVHA 2EL4A 2EQ1A 1A1KA 2YTEA 2EN6A 2D9HA 2EPRA 2MKNA 2I13A 2VRDA 2M9AA 2BB8A 1JK2A 1UN6B 4R2CA 2EPPA 4X9JA 2JP9A 3VHTB 2EOEA 2EMAA 2EQ0A 2WCC3 3UK3C 2EMLA 2DMIA 2WBUA 2CTDA 3MHHC 1MEYC 5KL7A 2EMIA 2YSPA 5KL3A 2EM0A 2YRKA 2MKDA 3EPLA 1JK1A 2YSOA 1YSAC 1WJPA 2EM5A 2MDGA 5KL4A 2LV2A 4F2JC 2EPXA 1YUIA 2EMBA 2EN2A 2EOSA 2A25A 3EPHA 1TN9A 2EPZA 2EP3A 2EMGA 2EQ3A 2E72A 1X6FA 2EM2A 5KL6A 1ZAAC 2EM6A 2GHFA 2EE8A 1Z1BA 1G2FC 2CT1A 2EOZA 2EM9A 5KL2A 2EM4A 2EOYA 2R1FA 1P47A 4R2SA 1NCSA 4R2DA 1UBDC 2EJ4A 2EMWA 1BB8A 2HGHA 2J7JA 2EMXA 1A1IA 1RMDA 2EOXA 1F2IG 2EOIA 2YRMA 1A1GA 1A1LA 2EM3A 2EL6A 3EPKA 2ELZA 1X3CA 2YTDA 4M9VC 2EPAA 2ADRA 1TF3A 2EMHA 2EN1A 2EMKA 2ENCA 4R2QA 2CSHA 2EPCA 2RPCA 3M99B 3MHSC 2YTNA 4IS1C 2ENAA 4R2AA 4R2RA 2YTOA 2LO3A 2YTFA 4GZNC 4IJDA 4R2EA 2EM8A 2LCEA 1X6EA 2EOFA 4F6MA 1A1JA 1A1FA 2EN4A 2YRHA 2EPUA 1YUJA 1KJKA 2DLKA 2YTPA 4F6NA 2NABA 4WSGA 2WBTA 2EMCA 2DRPA 2YU5A 2LT7A 1BBOA 2YU8A 4R2PA 2PRTA 1ZR9A 1B69A 2EOHA 4FK5C 1G2DC 2WBSA 2DLQA 2GLIA 2EOMA 1AAYA 1TF6A 2EOQA 2YTGA 2YTJA 2EN8A 1LLMC 5KL5A 2EORA 2EL5A 1DGCA 2EMYA 2DGCA
chains in the Genus database with same CATH superfamily
3ADGA 3K6QA 1NEIA 3BF2A 1ZU1A 3KZZA 2LUQA 3QG5C 4LTYA 2RSIA 2EN7A 2LVHA 1N3GA 2EL4A 2LE2A 3OMLA 1O0WA 4M30A 1N36E 1L4SA 2DMYA 4DUZE 4NHRA 2UUBE 2JYAA 2M9AA 2BB8A 5CFFE 4R2CA 4JI0E 2WCC3 2EQ0A 4ZYHA 2Q8UA 4JI7E 1EH8A 3MHHC 2N3GA 4L8NA 2EMIA 5KL3A 5ADZA 2GPIA 1ZBTA 2YRKA 2MKDA 4WXCA 1YSAC 3VK6A 3J7AG 5KL4A 4F2JC 4JI8E 3C4BA 5AE3A 2JOBA 2HHHE 1QNTA 2KOUA 1TN9A 2EPZA 5IXMB 4BHCA 4ZYEA 4LF7E 2E72A 1G2FC 1Z1BA 2CT1A 2NUEA 5KL2A 5LL6R 4BCAA 1T38A 4DV3E 3VYXA 3J80C 4R2DA 2EJ4A 2JOXA 1BB8A 2HGHA 4M2ZA 2EPOA 2J7JA 2EMXA 4M0VA 1RMDA 5AE1A 2YRMA 1A1LA 2EL6A 2UXCE 4M9VC 1PJTA 4WXDA 2EN1A 1XMOE 4O24A 3HXLA 3F6GA 2RPCA 4NXME 3MHSC 5A6BA 1YFHA 2UUAE 2EPMX 2ENAA 2YTOA 3DF6A 2YTFA 2HC5A 2EM8A 1A1FA 2EN4A 2I9IA 2B7VA 2L6MA 4WSGA 2V83A 2EMCA 4F9CB 5A6JA 4DR6E 2RTXA 4WFTA 5AE2A 2JWOA 4JV5E 2EOHA 1N32E 4FK5C 1YYWA 2UUCE 1TF6A 4K0KE 2V87A 4BS9A 2EL5A 3THNA 1HNXE 2L8TA 3EPJA 2ELYA 2JPAA 4RHBB 4GKKE 4YY3E 4OX9E 3IWDA 2EOOA 2EMZA 4DV1E 4JI1E 1XNRE 2UXBE 1T4OA 2EN3A 2RS6A 4WPYA 2DSYA 2RS7A 2M7QA 1SFEA 1IBLE 4P78A 2YTEA 4O4KA 2EPRA 4Q35B 2MKNA 2CPNA 2VQFE 3C6KA 2JXPA 2EPPA 4NZVA 3VHTB 2JP9A 3UK3C 1HNWE 2WBUA 2CTDA 1MEYC 2L2MA 4WX9A 4JI2E 2B9DA 2M1SA 4DR5E 2L92A 2YSOA 3ZOQB 3HTXA 2EM5A 4DR1E 1N33E 3L00A 3LLHA 5A6BD 3FIGA 1KYQA 2NUGA 2EQ3A 1X6FA 1YYOA 5A6KA 3BBGA 1ZAAC 4LFAE 2GHFA 2L2NA 4JI5E 2EM4A 2LTRA 2R1FA 4R2SA 1NCSA 1UBDC 1DQ3A 2JR1A 1A1GA 2EM3A 2FTXB 4DV2E 2R76A 4F54A 4KWYA 1QU6A 2EPAA 1FKAE 1TF3A 2EMHA 4LU9A 1STUA 4R2QA 1IBME 2EPNA 4JYAE 4X65E 2YTNA 4DV7E 1EH6A 2JY9A 5F3WA 4LF6E 1SR9A 2LO3A 1YPNA 2F4VE 2LCEA 2EOFA 2DIXA 2YRHA 4OOGC 4J8ZA 3P1XA 1N34E 1IBKE 2FV4B 4LF9E 1BBOA 4X8WA 2NUFA 2YU8A 4BC9A 5LMUE 4LFBE 4LF4E 4HEIA 2V85A 2YPNA 4L5NC 4B3RE 4DKKA 1G2DC 2ODRC 2DLQA 2WZOA 1RC7A 1PJSA 2EOMA 1AAYA 4WSPA 2YZTA 2EZ6A 1LLMC 2E1MA 2B3TB 2EORA 4DMIA 4KZSA 2EMYA 1X6HA 2EMFA 4DR3E 2HJJA 1XMQE 2LBSB 2ENHA 2EWLA 2V88A 2MC5A 2EM7A 2IHR1 4DV5E 4R8OA 4GKJE 1T4NA 3AUZA 2EN6A 4KHPE 2I13A 1PJQA 2VRDA 1JK2A 4X66E 4X9JA 3RMPA 3JAMC 2EMAA 1GQEA 4F9BB 2L3JA 4NXNE 1HNZE 1WHQA 1YZ9A 5KL7A 5BR8E 5A69A 3HPZA 3LMLA 2YSPA 1J26A 2EM0A 4JI4E 1WJPA 4JI3E 2L2KB 4DV6E 2LV2A 1YUIA 2EMBA 3DJWA 2MDRA 2EP3A 3JTZA 4P7DA 2EMGA 1FJGE 5AC4A 5LMNE 2VF1A 2EM2A 5IT9C 2EE8A 4X64E 4LF5E 2EM9A 2BBGA 1PDAA 4R03A 5IWAE 1BBGA 2N3HA 3J81C 4TUIA 2EOIA 5AASA 4RH8A 3BIDA 2EPLX 4WYQB 4N4RB 2ENCA 4O43A 2EPCA 4B3SE 4IS1C 2L33A 1X48A 2B7TA 4GZNC 5T6JA 2YT4A 1KJKA 2EPUA 2DLKA 4F6NA 2DRPA 2M4IA 2YU5A 2LT7A 1J5EE 3T1YE 4X62E 1B69A 1ZR9A 4BC7A 3ADIA 4YHHE 1RQ0A 2YWQA 3IWBA 2K4VA 2WBSA 1AH5A 2GLIA 4DR2E 2E5LE 1PKPA 2EOQA 2YTGA 2EN8A 4MLQA 2VE7C 1DGCA 4B3ME 2VQEE 1WHNA 2LTSA 1X5WA 2ODRD 2YTIA 4DV4E 2YTQA 1A1HA 2H36X 1DI2A 1EKZA 1ZBQA 1I94E 2EOJA 5AC5A 4DUYE 2JVAA 2EQ1A 3H09A 1A1KA 2G7HA 2D9HA 4LFCE 5A2QC 3EQ1A 2V89A 3KZYA 1UN6B 2KHXA 5LLQA 2L3CA 2EOEA 1UILA 2EMLA 1YYKA 2DMIA 2LMZA 3C6MA 1HR0E 1XNQE 1T4LB 3F6HA 3T1HE 3ECRA 4TUGA 3THOB 2FGGA 3EPLA 1JK1A 4MLVA 3J7Yp 2UXDE 2MDGA 1IQOA 4BBYA 2EPXA 2LJUA 2LUPB 2EN2A 2EOSA 2A25A 1WRJA 4GEQB 3EPHA 4DR4E 5TSEA 1IQSA 2KONA 1T39A 4ZYDA 1EH7A 1GZ6A 1WXRA 2LRSA 5KL6A 4B3TE 2EM6A 2MC6A 2EOZA 5IV8B 2EOYA 1P47A 2EMWA 3HPSA 1UHZA 1A1IA 2EOXA 1F2IG 3C4TA 1X47A 4HTGA 3EPKA 2ELZA 1X3CA 2YTDA 4BMJA 2N8XA 2ADRA 4DV0E 2F8BA 4BHBA 4DR7E 2ZM6E 2EMKA 2CSHA 3MSWA 4ZYGA 1MGTA 3M99B 2RSMA 2V8QB 4I8OA 4R2AA 3IWCA 5DNYA 4R2RA 3ADLA 3ADJA 4IJDA 4R2EA 1X6EA 4F6MA 1A1JA 2UU9E 4JI6E 1YUJA 1IMUA 2YTPA 3OTOE 4O5GA 2NABA 2WBTA 4R2PA 3JU0A 4Q28A 2PRTA 4AQYE 5A6AA 2DB2A 2K7IA 3BGHA 4F9AB 2NA2A 1X49A 2EPKX 3AV0A 2YTJA 1GTKA 2V86A 3HQ1A 2RQLA 3KWRA 3TQMA 5KL5A 3VYYA 2LJHA 5FLXC 2DGCA 4LF8E
chains in the Genus database with same CATH topology
1X6HA 3EPJA 1X5WA 2ELYA 2EMFA 2YTIA 2JPAA 1ZU1A 2YTQA 2RSIA 1A1HA 2ENHA 2EOOA 2EMZA 2EM7A 2EN3A 2EN7A 2EOJA 2LVHA 2EL4A 2EQ1A 1A1KA 2YTEA 2EN6A 2D9HA 2EPRA 2MKNA 2I13A 2VRDA 2M9AA 2BB8A 1JK2A 1UN6B 4R2CA 2EPPA 4X9JA 2JP9A 3VHTB 2EOEA 2EMAA 2EQ0A 2WCC3 3UK3C 2EMLA 2DMIA 2WBUA 2CTDA 3MHHC 1MEYC 5KL7A 2EMIA 2YSPA 5KL3A 2EM0A 2YRKA 2MKDA 3EPLA 1JK1A 2YSOA 1YSAC 1WJPA 2EM5A 2MDGA 5KL4A 2LV2A 4F2JC 2EPXA 1YUIA 2EMBA 2EN2A 2EOSA 2A25A 3EPHA 1TN9A 2EPZA 2EP3A 2EMGA 2EQ3A 2E72A 1X6FA 2EM2A 5KL6A 1ZAAC 2EM6A 2GHFA 2EE8A 1Z1BA 1G2FC 2CT1A 2EOZA 2EM9A 5KL2A 2EM4A 2EOYA 2R1FA 1P47A 4R2SA 1NCSA 4R2DA 1UBDC 2EJ4A 2EMWA 1BB8A 2HGHA 2J7JA 2EMXA 1A1IA 1RMDA 2EOXA 1F2IG 2EOIA 2YRMA 1A1GA 1A1LA 2EM3A 2EL6A 3EPKA 2ELZA 1X3CA 2YTDA 4M9VC 2EPAA 2ADRA 1TF3A 2EMHA 2EN1A 2EMKA 2ENCA 4R2QA 2CSHA 2EPCA 2RPCA 3M99B 3MHSC 2YTNA 4IS1C 2ENAA 4R2AA 4R2RA 2YTOA 2LO3A 2YTFA 4GZNC 4IJDA 4R2EA 2EM8A 2LCEA 1X6EA 2EOFA 4F6MA 1A1JA 1A1FA 2EN4A 2YRHA 2EPUA 1YUJA 1KJKA 2DLKA 2YTPA 4F6NA 2NABA 4WSGA 2WBTA 2EMCA 2DRPA 2YU5A 2LT7A 1BBOA 2YU8A 4R2PA 2PRTA 1ZR9A 1B69A 2EOHA 4FK5C 1G2DC 2WBSA 2DLQA 2GLIA 2EOMA 1AAYA 1TF6A 2EOQA 2YTGA 2YTJA 2EN8A 1LLMC 5KL5A 2EORA 2EL5A 1DGCA 2EMYA 2DGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X6H A;  3EPJ A;  1X5W A;  2ELY A;  2EMF A;  2YTI A;  2JPA A;  1ZU1 A;  2YTQ A;  2RSI A;  1A1H A;  2ENH A;  2EOO A;  2EMZ A;  2EM7 A;  2EN3 A;  2EN7 A;  2EOJ A;  2LVH A;  2EL4 A;  2EQ1 A;  1A1K A;  2YTE A;  2EN6 A;  2D9H A;  2EPR A;  2MKN A;  2I13 A;  2VRD A;  2M9A A;  2BB8 A;  1JK2 A;  1UN6 B;  4R2C A;  2EPP A;  4X9J A;  2JP9 A;  3VHT B;  2EOE A;  2EMA A;  2EQ0 A;  2WCC 3;  3UK3 C;  2EML A;  2DMI A;  2WBU A;  2CTD A;  3MHH C;  1MEY C;  5KL7 A;  2EMI A;  2YSP A;  5KL3 A;  2EM0 A;  2YRK A;  2MKD A;  3EPL A;  1JK1 A;  2YSO A;  1YSA C;  1WJP A;  2EM5 A;  2MDG A;  5KL4 A;  2LV2 A;  4F2J C;  2EPX A;  1YUI A;  2EMB A;  2EN2 A;  2EOS A;  2A25 A;  3EPH A;  1TN9 A;  2EPZ A;  2EP3 A;  2EMG A;  2EQ3 A;  2E72 A;  1X6F A;  2EM2 A;  5KL6 A;  1ZAA C;  2EM6 A;  2GHF A;  2EE8 A;  1Z1B A;  1G2F C;  2CT1 A;  2EOZ A;  2EM9 A;  5KL2 A;  2EM4 A;  2EOY A;  2R1F A;  1P47 A;  4R2S A;  1NCS A;  4R2D A;  1UBD C;  2EJ4 A;  2EMW A;  1BB8 A;  2HGH A;  2J7J A;  2EMX A;  1A1I A;  1RMD A;  2EOX A;  1F2I G;  2EOI A;  2YRM A;  1A1G A;  1A1L A;  2EM3 A;  2EL6 A;  3EPK A;  2ELZ A;  1X3C A;  2YTD A;  4M9V C;  2EPA A;  2ADR A;  1TF3 A;  2EMH A;  2EN1 A;  2EMK A;  2ENC A;  4R2Q A;  2CSH A;  2EPC A;  2RPC A;  3M99 B;  3MHS C;  2YTN A;  4IS1 C;  2ENA A;  4R2A A;  4R2R A;  2YTO A;  2LO3 A;  2YTF A;  4GZN C;  4IJD A;  4R2E A;  2EM8 A;  2LCE A;  1X6E A;  2EOF A;  4F6M A;  1A1J A;  1A1F A;  2EN4 A;  2YRH A;  2EPU A;  1YUJ A;  1KJK A;  2DLK A;  2YTP A;  4F6N A;  2NAB A;  4WSG A;  2WBT A;  2EMC A;  2DRP A;  2YU5 A;  2LT7 A;  1BBO A;  2YU8 A;  4R2P A;  2PRT A;  1ZR9 A;  1B69 A;  2EOH A;  4FK5 C;  1G2D C;  2WBS A;  2DLQ A;  2GLI A;  2EOM A;  1AAY A;  1TF6 A;  2EOQ A;  2YTG A;  2YTJ A;  2EN8 A;  1LLM C;  5KL5 A;  2EOR A;  2EL5 A;  1DGC A;  2EMY A;  2DGC A; 
#chains in the Genus database with same CATH topology
 3ADG A;  3K6Q A;  1NEI A;  3BF2 A;  1ZU1 A;  3KZZ A;  2LUQ A;  3QG5 C;  4LTY A;  2RSI A;  2EN7 A;  2LVH A;  1N3G A;  2EL4 A;  2LE2 A;  3OML A;  1O0W A;  4M30 A;  1N36 E;  1L4S A;  2DMY A;  4DUZ E;  4NHR A;  2UUB E;  2JYA A;  2M9A A;  2BB8 A;  5CFF E;  4R2C A;  4JI0 E;  2WCC 3;  2EQ0 A;  4ZYH A;  2Q8U A;  4JI7 E;  1EH8 A;  3MHH C;  2N3G A;  4L8N A;  2EMI A;  5KL3 A;  5ADZ A;  2GPI A;  1ZBT A;  2YRK A;  2MKD A;  4WXC A;  1YSA C;  3VK6 A;  3J7A G;  5KL4 A;  4F2J C;  4JI8 E;  3C4B A;  5AE3 A;  2JOB A;  2HHH E;  1QNT A;  2KOU A;  1TN9 A;  2EPZ A;  5IXM B;  4BHC A;  4ZYE A;  4LF7 E;  2E72 A;  1G2F C;  1Z1B A;  2CT1 A;  2NUE A;  5KL2 A;  5LL6 R;  4BCA A;  1T38 A;  4DV3 E;  3VYX A;  3J80 C;  4R2D A;  2EJ4 A;  2JOX A;  1BB8 A;  2HGH A;  4M2Z A;  2EPO A;  2J7J A;  2EMX A;  4M0V A;  1RMD A;  5AE1 A;  2YRM A;  1A1L A;  2EL6 A;  2UXC E;  4M9V C;  1PJT A;  4WXD A;  2EN1 A;  1XMO E;  4O24 A;  3HXL A;  3F6G A;  2RPC A;  4NXM E;  3MHS C;  5A6B A;  1YFH A;  2UUA E;  2EPM X;  2ENA A;  2YTO A;  3DF6 A;  2YTF A;  2HC5 A;  2EM8 A;  1A1F A;  2EN4 A;  2I9I A;  2B7V A;  2L6M A;  4WSG A;  2V83 A;  2EMC A;  4F9C B;  5A6J A;  4DR6 E;  2RTX A;  4WFT A;  5AE2 A;  2JWO A;  4JV5 E;  2EOH A;  1N32 E;  4FK5 C;  1YYW A;  2UUC E;  1TF6 A;  4K0K E;  2V87 A;  4BS9 A;  2EL5 A;  3THN A;  1HNX E;  2L8T A;  3EPJ A;  2ELY A;  2JPA A;  4RHB B;  4GKK E;  4YY3 E;  4OX9 E;  3IWD A;  2EOO A;  2EMZ A;  4DV1 E;  4JI1 E;  1XNR E;  2UXB E;  1T4O A;  2EN3 A;  2RS6 A;  4WPY A;  2DSY A;  2RS7 A;  2M7Q A;  1SFE A;  1IBL E;  4P78 A;  2YTE A;  4O4K A;  2EPR A;  4Q35 B;  2MKN A;  2CPN A;  2VQF E;  3C6K A;  2JXP A;  2EPP A;  4NZV A;  3VHT B;  2JP9 A;  3UK3 C;  1HNW E;  2WBU A;  2CTD A;  1MEY C;  2L2M A;  4WX9 A;  4JI2 E;  2B9D A;  2M1S A;  4DR5 E;  2L92 A;  2YSO A;  3ZOQ B;  3HTX A;  2EM5 A;  4DR1 E;  1N33 E;  3L00 A;  3LLH A;  5A6B D;  3FIG A;  1KYQ A;  2NUG A;  2EQ3 A;  1X6F A;  1YYO A;  5A6K A;  3BBG A;  1ZAA C;  4LFA E;  2GHF A;  2L2N A;  4JI5 E;  2EM4 A;  2LTR A;  2R1F A;  4R2S A;  1NCS A;  1UBD C;  1DQ3 A;  2JR1 A;  1A1G A;  2EM3 A;  2FTX B;  4DV2 E;  2R76 A;  4F54 A;  4KWY A;  1QU6 A;  2EPA A;  1FKA E;  1TF3 A;  2EMH A;  4LU9 A;  1STU A;  4R2Q A;  1IBM E;  2EPN A;  4JYA E;  4X65 E;  2YTN A;  4DV7 E;  1EH6 A;  2JY9 A;  5F3W A;  4LF6 E;  1SR9 A;  2LO3 A;  1YPN A;  2F4V E;  2LCE A;  2EOF A;  2DIX A;  2YRH A;  4OOG C;  4J8Z A;  3P1X A;  1N34 E;  1IBK E;  2FV4 B;  4LF9 E;  1BBO A;  4X8W A;  2NUF A;  2YU8 A;  4BC9 A;  5LMU E;  4LFB E;  4LF4 E;  4HEI A;  2V85 A;  2YPN A;  4L5N C;  4B3R E;  4DKK A;  1G2D C;  2ODR C;  2DLQ A;  2WZO A;  1RC7 A;  1PJS A;  2EOM A;  1AAY A;  4WSP A;  2YZT A;  2EZ6 A;  1LLM C;  2E1M A;  2B3T B;  2EOR A;  4DMI A;  4KZS A;  2EMY A;  1X6H A;  2EMF A;  4DR3 E;  2HJJ A;  1XMQ E;  2LBS B;  2ENH A;  2EWL A;  2V88 A;  2MC5 A;  2EM7 A;  2IHR 1;  4DV5 E;  4R8O A;  4GKJ E;  1T4N A;  3AUZ A;  2EN6 A;  4KHP E;  2I13 A;  1PJQ A;  2VRD A;  1JK2 A;  4X66 E;  4X9J A;  3RMP A;  3JAM C;  2EMA A;  1GQE A;  4F9B B;  2L3J A;  4NXN E;  1HNZ E;  1WHQ A;  1YZ9 A;  5KL7 A;  5BR8 E;  5A69 A;  3HPZ A;  3LML A;  2YSP A;  1J26 A;  2EM0 A;  4JI4 E;  1WJP A;  4JI3 E;  2L2K B;  4DV6 E;  2LV2 A;  1YUI A;  2EMB A;  3DJW A;  2MDR A;  2EP3 A;  3JTZ A;  4P7D A;  2EMG A;  1FJG E;  5AC4 A;  5LMN E;  2VF1 A;  2EM2 A;  5IT9 C;  2EE8 A;  4X64 E;  4LF5 E;  2EM9 A;  2BBG A;  1PDA A;  4R03 A;  5IWA E;  1BBG A;  2N3H A;  3J81 C;  4TUI A;  2EOI A;  5AAS A;  4RH8 A;  3BID A;  2EPL X;  4WYQ B;  4N4R B;  2ENC A;  4O43 A;  2EPC A;  4B3S E;  4IS1 C;  2L33 A;  1X48 A;  2B7T A;  4GZN C;  5T6J A;  2YT4 A;  1KJK A;  2EPU A;  2DLK A;  4F6N A;  2DRP A;  2M4I A;  2YU5 A;  2LT7 A;  1J5E E;  3T1Y E;  4X62 E;  1B69 A;  1ZR9 A;  4BC7 A;  3ADI A;  4YHH E;  1RQ0 A;  2YWQ A;  3IWB A;  2K4V A;  2WBS A;  1AH5 A;  2GLI A;  4DR2 E;  2E5L E;  1PKP A;  2EOQ A;  2YTG A;  2EN8 A;  4MLQ A;  2VE7 C;  1DGC A;  4B3M E;  2VQE E;  1WHN A;  2LTS A;  1X5W A;  2ODR D;  2YTI A;  4DV4 E;  2YTQ A;  1A1H A;  2H36 X;  1DI2 A;  1EKZ A;  1ZBQ A;  1I94 E;  2EOJ A;  5AC5 A;  4DUY E;  2JVA A;  2EQ1 A;  3H09 A;  1A1K A;  2G7H A;  2D9H A;  4LFC E;  5A2Q C;  3EQ1 A;  2V89 A;  3KZY A;  1UN6 B;  2KHX A;  5LLQ A;  2L3C A;  2EOE A;  1UIL A;  2EML A;  1YYK A;  2DMI A;  2LMZ A;  3C6M A;  1HR0 E;  1XNQ E;  1T4L B;  3F6H A;  3T1H E;  3ECR A;  4TUG A;  3THO B;  2FGG A;  3EPL A;  1JK1 A;  4MLV A;  3J7Y p;  2UXD E;  2MDG A;  1IQO A;  4BBY A;  2EPX A;  2LJU A;  2LUP B;  2EN2 A;  2EOS A;  2A25 A;  1WRJ A;  4GEQ B;  3EPH A;  4DR4 E;  5TSE A;  1IQS A;  2KON A;  1T39 A;  4ZYD A;  1EH7 A;  1GZ6 A;  1WXR A;  2LRS A;  5KL6 A;  4B3T E;  2EM6 A;  2MC6 A;  2EOZ A;  5IV8 B;  2EOY A;  1P47 A;  2EMW A;  3HPS A;  1UHZ A;  1A1I A;  2EOX A;  1F2I G;  3C4T A;  1X47 A;  4HTG A;  3EPK A;  2ELZ A;  1X3C A;  2YTD A;  4BMJ A;  2N8X A;  2ADR A;  4DV0 E;  2F8B A;  4BHB A;  4DR7 E;  2ZM6 E;  2EMK A;  2CSH A;  3MSW A;  4ZYG A;  1MGT A;  3M99 B;  2RSM A;  2V8Q B;  4I8O A;  4R2A A;  3IWC A;  5DNY A;  4R2R A;  3ADL A;  3ADJ A;  4IJD A;  4R2E A;  1X6E A;  4F6M A;  1A1J A;  2UU9 E;  4JI6 E;  1YUJ A;  1IMU A;  2YTP A;  3OTO E;  4O5G A;  2NAB A;  2WBT A;  4R2P A;  3JU0 A;  4Q28 A;  2PRT A;  4AQY E;  5A6A A;  2DB2 A;  2K7I A;  3BGH A;  4F9A B;  2NA2 A;  1X49 A;  2EPK X;  3AV0 A;  2YTJ A;  1GTK A;  2V86 A;  3HQ1 A;  2RQL A;  3KWR A;  3TQM A;  5KL5 A;  3VYY A;  2LJH A;  5FLX C;  2DGC A;  4LF8 E; 
#chains in the Genus database with same CATH homology
 1X6H A;  3EPJ A;  1X5W A;  2ELY A;  2EMF A;  2YTI A;  2JPA A;  1ZU1 A;  2YTQ A;  2RSI A;  1A1H A;  2ENH A;  2EOO A;  2EMZ A;  2EM7 A;  2EN3 A;  2EN7 A;  2EOJ A;  2LVH A;  2EL4 A;  2EQ1 A;  1A1K A;  2YTE A;  2EN6 A;  2D9H A;  2EPR A;  2MKN A;  2I13 A;  2VRD A;  2M9A A;  2BB8 A;  1JK2 A;  1UN6 B;  4R2C A;  2EPP A;  4X9J A;  2JP9 A;  3VHT B;  2EOE A;  2EMA A;  2EQ0 A;  2WCC 3;  3UK3 C;  2EML A;  2DMI A;  2WBU A;  2CTD A;  3MHH C;  1MEY C;  5KL7 A;  2EMI A;  2YSP A;  5KL3 A;  2EM0 A;  2YRK A;  2MKD A;  3EPL A;  1JK1 A;  2YSO A;  1YSA C;  1WJP A;  2EM5 A;  2MDG A;  5KL4 A;  2LV2 A;  4F2J C;  2EPX A;  1YUI A;  2EMB A;  2EN2 A;  2EOS A;  2A25 A;  3EPH A;  1TN9 A;  2EPZ A;  2EP3 A;  2EMG A;  2EQ3 A;  2E72 A;  1X6F A;  2EM2 A;  5KL6 A;  1ZAA C;  2EM6 A;  2GHF A;  2EE8 A;  1Z1B A;  1G2F C;  2CT1 A;  2EOZ A;  2EM9 A;  5KL2 A;  2EM4 A;  2EOY A;  2R1F A;  1P47 A;  4R2S A;  1NCS A;  4R2D A;  1UBD C;  2EJ4 A;  2EMW A;  1BB8 A;  2HGH A;  2J7J A;  2EMX A;  1A1I A;  1RMD A;  2EOX A;  1F2I G;  2EOI A;  2YRM A;  1A1G A;  1A1L A;  2EM3 A;  2EL6 A;  3EPK A;  2ELZ A;  1X3C A;  2YTD A;  4M9V C;  2EPA A;  2ADR A;  1TF3 A;  2EMH A;  2EN1 A;  2EMK A;  2ENC A;  4R2Q A;  2CSH A;  2EPC A;  2RPC A;  3M99 B;  3MHS C;  2YTN A;  4IS1 C;  2ENA A;  4R2A A;  4R2R A;  2YTO A;  2LO3 A;  2YTF A;  4GZN C;  4IJD A;  4R2E A;  2EM8 A;  2LCE A;  1X6E A;  2EOF A;  4F6M A;  1A1J A;  1A1F A;  2EN4 A;  2YRH A;  2EPU A;  1YUJ A;  1KJK A;  2DLK A;  2YTP A;  4F6N A;  2NAB A;  4WSG A;  2WBT A;  2EMC A;  2DRP A;  2YU5 A;  2LT7 A;  1BBO A;  2YU8 A;  4R2P A;  2PRT A;  1ZR9 A;  1B69 A;  2EOH A;  4FK5 C;  1G2D C;  2WBS A;  2DLQ A;  2GLI A;  2EOM A;  1AAY A;  1TF6 A;  2EOQ A;  2YTG A;  2YTJ A;  2EN8 A;  1LLM C;  5KL5 A;  2EOR A;  2EL5 A;  1DGC A;  2EMY A;  2DGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...