3J7Yp

Structure of the large ribosomal subunit from human mitochondria
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
93
structure length
83
Chain Sequence
DIPLDRLTISYCRSVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 83
sequence length 93
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
p PF00472 RF-1 RF-1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3j7yp00
2NA2A 1XMOE 4NXME 4GKKE 2L3JA 1HNWE 1FKAE 1QU6A 1ZBTA 1T4OA 2DMYA 1IBKE 1XNQE 4YHHE 4B3TE 4OX9E 4DV2E 2LTRA 1N36E 3ADJA 4DR3E 4LFCE 3T1YE 3HTXA 3T1HE 1YZ9A 2N3HA 1I94E 3P1XA 4JI3E 1STUA 2DB2A 4WFTA 2UUAE 4DR4E 3C4BA 1X49A 4JYAE 4DV7E 4B3RE 4X8WA 2VQFE 1HNXE 2NUFA 4AQYE 1X48A 2L2NA 3OTOE 2UXBE 4DR7E 1YYKA 5LMUE 1J5EE 2L2KB 3VYYA 2RS6A 4X65E 4DV3E 2LTSA 1HR0E 2UUBE 4JV5E 4X62E 1X47A 4DUZE 3J7Yp 1J26A 1O0WA 1IBME 2UU9E 2LUQA 2B7VA 4LF9E 2UXCE 2IHR1 4X64E 2E5LE 1IBLE 1XNRE 4LF4E 4DV6E 4DV1E 4YY3E 4LF7E 4LFAE 1UHZA 2NUEA 2JY9A 4LF8E 3VYXA 4DV0E 2MDRA 1T4NA 4WYQB 1RC7A 1YYWA 1RQ0A 2UXDE 2RSMA 1GQEA 2B7TA 2KHXA 2L2MA 1EKZA 2F4VE 4X66E 4M30A 4DV4E 4B3ME 4OOGC 2EZ6A 1YYOA 2NUGA 2DIXA 2RS7A 4DKKA 1T4LB 4DR2E 4JI2E 4JI0E 1FJGE 1WHNA 2L33A 2N3GA 4JI1E 2LJHA 1N34E 4DR6E 1PKPA 2JVAA 3ADIA 1WHQA 2RTXA 4JI6E 4B3SE 4K0KE 2CPNA 1HNZE 5CFFE 4LF6E 1XMQE 2HHHE 4NXNE 1UILA 2VQEE 4DR5E 4LF5E 2B3TB 3LLHA 4DUYE 2LBSB 2L3CA 4DR1E 2LRSA 4KHPE 3ADLA 4M2ZA 4DV5E 4JI4E 4JI5E 3ADGA 2LUPB 1N33E 4LFBE 4JI8E 2UUCE 2ZM6E 4JI7E 2YT4A 1DI2A 3C4TA 5LMNE 1N32E 5BR8E 5IWAE 4GKJE
chains in the Genus database with same CATH superfamily
2NA2A 2YTPA 5TSEA 5IT9C 1KYQA 1L4SA 2JYAA 1HNWE 1FKAE 1QU6A 1T4OA 1ZBTA 2DMYA 3QG5C 1P47A 4YHHE 1TN9A 1XNQE 4L8NA 3ADJA 4DR3E 1Z1BA 1EH6A 2KONA 5DNYA 3HTXA 1SR9A 2N3HA 1I94E 1ZAAC 2EP3A 2V83A 1ZBQA 4WXCA 3VK6A 5LL6R 3C4BA 1X49A 4F9AB 4JYAE 2EQ3A 4B3RE 1X3CA 1HNXE 4IS1C 3JTZA 2I9IA 2EMHA 2EM9A 2M1SA 1A1KA 1YYKA 2YRMA 2YPNA 3VYYA 4R2CA 2V87A 3IWCA 5A6BD 4F9CB 1X47A 3DJWA 1J26A 2EMXA 1IBME 3MHHC 2EMWA 2MKNA 2M9AA 1BBGA 2YTOA 3DF6A 5AC5A 2L8TA 4DV6E 2EMFA 4LFAE 4RHBB 2NUEA 2ELZA 2HC5A 2KOUA 2L92A 2D9HA 4WYQB 2LT7A 1YYWA 4NHRA 1A1IA 5A2QC 1BBOA 2L2MA 2EPCA 2F4VE 4B3ME 3J81C 4WPYA 2YTJA 5KL4A 2N8XA 2VRDA 3HXLA 2L6MA 2M4IA 2ODRD 3JU0A 2JOXA 4JI6E 5AE3A 4R2DA 2EOZA 2VF1A 5CFFE 4LF6E 1N3GA 4N4RB 4NXNE 1PJQA 2LMZA 4IJDA 5AC4A 3JAMC 2WBUA 3HQ1A 2FV4B 2LRSA 4KHPE 2EM7A 1DGCA 2DLKA 2EMKA 1N33E 2FTXB 4R8OA 4J8ZA 4JI8E 2YZTA 1T39A 2HJJA 4JI7E 4RH8A 2YRKA 5KL3A 1QNTA 2R1FA 1N32E 4NXME 4GKKE 2EPRA 3UK3C 1YFHA 4R2AA 1T38A 2F8BA 4X9JA 4OX9E 3ZOQB 4DV2E 3IWDA 5IXMB 1N36E 2EOYA 2EN6A 3T1YE 3T1HE 1YZ9A 1NEIA 2EOEA 3F6HA 2K7IA 4JI3E 4R2EA 2EOJA 1A1HA 2EOMA 2EOXA 5AE1A 3VHTB 5A6AA 4DV7E 2JR1A 5FLXC 2Q8UA 2NUFA 4BC9A 2E72A 1KJKA 2HGHA 4DR7E 5LMUE 5AASA 2EL5A 1A1JA 3HPSA 4X65E 4DV3E 2LTSA 4JV5E 2V88A 2ENHA 3EQ1A 4X62E 2WZOA 4LU9A 3EPLA 3AV0A 5T6JA 3LMLA 2LUQA 2UXCE 3F6GA 1PJSA 1WRJA 2IHR1 3J7AG 4X64E 1IQSA 1XNRE 4BHBA 5ADZA 4DV1E 4Q35B 2WBTA 2LVHA 2EJ4A 4LF8E 2EQ0A 4BC7A 5AE2A 2EPOA 4DV0E 2EPXA 1BB8A 2WBSA 3THNA 4BS9A 1RQ0A 3K6QA 4M9VC 4BMJA 3BGHA 2EWLA 2KHXA 2MDGA 4M30A 4GEQB 4DV4E 4BHCA 1RMDA 2CSHA 2DIXA 3C6KA 1T4LB 2GLIA 4JI2E 5F3WA 4MLQA 2YSPA 2L33A 2N3GA 3BBGA 2EE8A 2DSYA 3ADIA 2RTXA 1JK2A 4HTGA 4F6NA 4I8OA 2EPMX 1HNZE 1XMQE 4Q28A 3EPJA 2EMBA 2VQEE 1GZ6A 4LF5E 2B3TB 3THOB 2EMZA 1UBDC 2WCC3 2V89A 1GTKA 4LTYA 1PDAA 2VE7C 2YU8A 3ADLA 4M2ZA 1PJTA 4MLVA 3ECRA 2EPUA 1B69A 2DMIA 2YTFA 2JOBA 2ZM6E 2EPNA 5LMNE 5IWAE 1AAYA 4KWYA 1XMOE 2R76A 4R2PA 3RMPA 2L3JA 2BBGA 5A6KA 1IBKE 2ADRA 4DMIA 4TUGA 5LLQA 1NCSA 2DLQA 4LFCE 1X5WA 1WJPA 2PRTA 3P1XA 2GPIA 4WX9A 4DR4E 3KZZA 2EMGA 4X8WA 2VQFE 2M7QA 4R2RA 4AQYE 2EPZA 2UXBE 2L2NA 3OTOE 2JXPA 2EM5A 3FIGA 2EOHA 4FK5C 2EOSA 2L2KB 1A1GA 2RS6A 1EH7A 2LJUA 2E1MA 1O0WA 2EQ1A 1G2DC 4ZYHA 2EN1A 2EL6A 4WSPA 1YUIA 4LF4E 4F54A 4BBYA 4ZYGA 1X6EA 1X6HA 2YTGA 1UHZA 2EN7A 2JY9A 2ENCA 2EPAA 3VYXA 1T4NA 1RC7A 2V8QB 4WSGA 2LO3A 3MSWA 2UXDE 3L00A 2EL4A 1GQEA 1TF6A 4X66E 3MHSC 2RS7A 2V86A 1AH5A 4JI0E 2YTDA 1WHNA 2EMAA 2MKDA 2EN4A 2EM0A 4JI1E 2LJHA 1EH8A 3IWBA 1N34E 4DR6E 2JVAA 4P78A 4O4KA 4B3SE 4K0KE 2EM4A 2EOQA 1G2FC 2B9DA 2EPLX 2HHHE 1UILA 1YPNA 4TUIA 2A25A 2JP9A 3OMLA 2LCEA 4DUYE 4NZVA 3EPKA 4WXDA 2L3CA 4DR1E 4F6MA 5KL6A 4DV5E 2EOFA 1ZU1A 1A1LA 1UN6B 3J80C 2CTDA 1F2IG 2YT4A 1DI2A 2JPAA 3C4TA 5BR8E 1STUA 1JK1A 1A1FA 1IMUA 2EM8A 2RQLA 5KL7A 3TQMA 2GHFA 2ENAA 2NABA 4B3TE 2LTRA 1MEYC 5A6BA 2YSOA 2J7JA 4KZSA 4O24A 2EN2A 4BCAA 2DB2A 4WFTA 2UUAE 1IQOA 2EMYA 2V85A 5A69A 1WXRA 1X48A 2I13A 2EM6A 2FGGA 2EM2A 2LV2A 2ODRC 2EOOA 4M0VA 5IV8B 1J5EE 1YSAC 2YU5A 1HR0E 2K4VA 2UUBE 1SFEA 4DUZE 5A6JA 3J7Yp 2YTNA 2UU9E 2B7VA 4LF9E 2H36X 4R2SA 1DQ3A 4ZYDA 1IBLE 2EM3A 2EMIA 2E5LE 3H09A 4YY3E 4LF7E 2EMCA 4GKJE 1TF3A 4P7DA 2EN8A 4R03A 2EPKX 2MDRA 2JWOA 1LLMC 1X6FA 1MGTA 4F9BB 2ELYA 3EPHA 2RSMA 5KL2A 2B7TA 2CT1A 1EKZA 2YTEA 1YUJA 3BIDA 5KL5A 3BF2A 4OOGC 2EZ6A 1YYOA 2NUGA 4DKKA 4O5GA 1ZR9A 4DR2E 2YWQA 3KZYA 1FJGE 1PKPA 2DRPA 1WHQA 2RPCA 2CPNA 2BB8A 2YTIA 2EMLA 2LE2A 4DR5E 3LLHA 2RSIA 2LBSB 3M99B 4L5NC 4F2JC 4HEIA 3HPZA 4JI4E 4JI5E 2YRHA 2YTQA 3ADGA 2LUPB 2EOIA 2G7HA 4LFBE 2MC6A 3AUZA 3KWRA 2MC5A 4R2QA 2EN3A 2EPPA 4ZYEA 2DGCA 3C6MA 2UUCE 2EORA 4O43A 4GZNC
chains in the Genus database with same CATH topology
2NA2A 1XMOE 4NXME 4GKKE 3RMPA 5IT9C 2L3JA 1HNWE 2F8BA 1FKAE 1QU6A 1ZBTA 1T4OA 2DMYA 1IBKE 1XNQE 4DMIA 4YHHE 3ZOQB 4TUGA 4DV2E 2LTRA 3IWDA 1N36E 4B3TE 4OX9E 4L8NA 3ADJA 4DR3E 4LFCE 2KONA 3T1YE 4KZSA 5DNYA 3T1HE 1YZ9A 3HTXA 1SR9A 2N3HA 3F6HA 1I94E 3P1XA 4BCAA 4JI3E 2V83A 1ZBQA 2DB2A 4WFTA 3VK6A 2UUAE 4DR4E 5LL6R 3C4BA 1X49A 4F9AB 5AE1A 4JYAE 4DV7E 2JR1A 4B3RE 4X8WA 5FLXC 2VQFE 1HNXE 3JTZA 2NUFA 2M7QA 2V85A 4BC9A 4AQYE 1WXRA 1X48A 2L2NA 3OTOE 2UXBE 2FGGA 2M1SA 4DR7E 1YYKA 3FIGA 5LMUE 2ODRC 5AASA 1J5EE 4M0VA 3HPSA 2L2KB 3VYYA 2RS6A 4X65E 4DV3E 2K4VA 2LTSA 1HR0E 2UUBE 2V87A 3IWCA 2V88A 4JV5E 4F9CB 1X47A 2WZOA 3DJWA 4X62E 3J7Yp 4LU9A 4DUZE 1J26A 3AV0A 2E1MA 5T6JA 1O0WA 3LMLA 1IBME 2UU9E 2LUQA 2B7VA 4LF9E 2H36X 2UXCE 3F6GA 2IHR1 3J7AG 4X64E 1DQ3A 1IBLE 2E5LE 1XNRE 3DF6A 4WSPA 4LF4E 2L8TA 3H09A 4DV6E 4F54A 5ADZA 4BBYA 4YY3E 4DV1E 4LF7E 4LFAE 1UHZA 2NUEA 2JY9A 2KOUA 4LF8E 3VYXA 2L92A 4P7DA 4R03A 4BC7A 5AE2A 4DV0E 2MDRA 1T4NA 2JWOA 2V8QB 4WYQB 1RC7A 3MSWA 4BS9A 1YYWA 1RQ0A 3K6QA 4F9BB 2UXDE 4BMJA 2RSMA 1GQEA 2B7TA 2EWLA 2KHXA 5A2QC 2L2MA 1EKZA 2F4VE 4X66E 4M30A 4GEQB 4DV4E 4B3ME 4OOGC 4WPYA 3J81C 1YYOA 2EZ6A 2NUGA 2DIXA 2RS7A 2V86A 4DKKA 1T4LB 4DR2E 4JI2E 5F3WA 4JI0E 3HXLA 1FJGE 1WHNA 2L33A 2N3GA 4JI1E 2L6MA 2LJHA 2M4IA 2ODRD 3IWBA 1N34E 4DR6E 1PKPA 2JVAA 4P78A 3JU0A 2DSYA 2JOXA 3ADIA 1WHQA 2RTXA 4JI6E 5AE3A 4B3SE 4K0KE 2B9DA 2CPNA 4I8OA 2VF1A 1HNZE 5CFFE 4LF6E 1XMQE 2HHHE 4Q28A 4NXNE 1UILA 2LMZA 4TUIA 1GZ6A 2LE2A 2VQEE 2B3TB 3LLHA 3OMLA 4DR5E 4LF5E 4DUYE 2LBSB 3JAMC 3HQ1A 2FV4B 2V89A 4LTYA 2L3CA 2VE7C 2LRSA 4L5NC 5IWAE 4DR1E 3ADLA 4KHPE 4M2ZA 4DV5E 3HPZA 4JI4E 4JI5E 3ADGA 2LUPB 2FTXB 1N33E 4R8OA 2G7HA 4J8ZA 4JI8E 3J80C 2UUCE 4LFBE 2YZTA 2MC6A 2ZM6E 2JOBA 3AUZA 3KWRA 4JI7E 2YT4A 2MC5A 1DI2A 3C4TA 5LMNE 1N32E 5BR8E 1STUA 4GKJE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NA2 A;  1XMO E;  4NXM E;  4GKK E;  2L3J A;  1HNW E;  1FKA E;  1QU6 A;  1ZBT A;  1T4O A;  2DMY A;  1IBK E;  1XNQ E;  4YHH E;  4B3T E;  4OX9 E;  4DV2 E;  2LTR A;  1N36 E;  3ADJ A;  4DR3 E;  4LFC E;  3T1Y E;  3HTX A;  3T1H E;  1YZ9 A;  2N3H A;  1I94 E;  3P1X A;  4JI3 E;  1STU A;  2DB2 A;  4WFT A;  2UUA E;  4DR4 E;  3C4B A;  1X49 A;  4JYA E;  4DV7 E;  4B3R E;  4X8W A;  2VQF E;  1HNX E;  2NUF A;  4AQY E;  1X48 A;  2L2N A;  3OTO E;  2UXB E;  4DR7 E;  1YYK A;  5LMU E;  1J5E E;  2L2K B;  3VYY A;  2RS6 A;  4X65 E;  4DV3 E;  2LTS A;  1HR0 E;  2UUB E;  4JV5 E;  4X62 E;  1X47 A;  4DUZ E;  3J7Y p;  1J26 A;  1O0W A;  1IBM E;  2UU9 E;  2LUQ A;  2B7V A;  4LF9 E;  2UXC E;  2IHR 1;  4X64 E;  2E5L E;  1IBL E;  1XNR E;  4LF4 E;  4DV6 E;  4DV1 E;  4YY3 E;  4LF7 E;  4LFA E;  1UHZ A;  2NUE A;  2JY9 A;  4LF8 E;  3VYX A;  4DV0 E;  2MDR A;  1T4N A;  4WYQ B;  1RC7 A;  1YYW A;  1RQ0 A;  2UXD E;  2RSM A;  1GQE A;  2B7T A;  2KHX A;  2L2M A;  1EKZ A;  2F4V E;  4X66 E;  4M30 A;  4DV4 E;  4B3M E;  4OOG C;  2EZ6 A;  1YYO A;  2NUG A;  2DIX A;  2RS7 A;  4DKK A;  1T4L B;  4DR2 E;  4JI2 E;  4JI0 E;  1FJG E;  1WHN A;  2L33 A;  2N3G A;  4JI1 E;  2LJH A;  1N34 E;  4DR6 E;  1PKP A;  2JVA A;  3ADI A;  1WHQ A;  2RTX A;  4JI6 E;  4B3S E;  4K0K E;  2CPN A;  1HNZ E;  5CFF E;  4LF6 E;  1XMQ E;  2HHH E;  4NXN E;  1UIL A;  2VQE E;  4DR5 E;  4LF5 E;  2B3T B;  3LLH A;  4DUY E;  2LBS B;  2L3C A;  4DR1 E;  2LRS A;  4KHP E;  3ADL A;  4M2Z A;  4DV5 E;  4JI4 E;  4JI5 E;  3ADG A;  2LUP B;  1N33 E;  4LFB E;  4JI8 E;  2UUC E;  2ZM6 E;  4JI7 E;  2YT4 A;  1DI2 A;  3C4T A;  5LMN E;  1N32 E;  5BR8 E;  5IWA E;  4GKJ E; 
#chains in the Genus database with same CATH topology
 2NA2 A;  2YTP A;  5TSE A;  5IT9 C;  1KYQ A;  1L4S A;  2JYA A;  1HNW E;  1FKA E;  1QU6 A;  1T4O A;  1ZBT A;  2DMY A;  3QG5 C;  1P47 A;  4YHH E;  1TN9 A;  1XNQ E;  4L8N A;  3ADJ A;  4DR3 E;  1Z1B A;  1EH6 A;  2KON A;  5DNY A;  3HTX A;  1SR9 A;  2N3H A;  1I94 E;  1ZAA C;  2EP3 A;  2V83 A;  1ZBQ A;  4WXC A;  3VK6 A;  5LL6 R;  3C4B A;  1X49 A;  4F9A B;  4JYA E;  2EQ3 A;  4B3R E;  1X3C A;  1HNX E;  4IS1 C;  3JTZ A;  2I9I A;  2EMH A;  2EM9 A;  2M1S A;  1A1K A;  1YYK A;  2YRM A;  2YPN A;  3VYY A;  4R2C A;  2V87 A;  3IWC A;  5A6B D;  4F9C B;  1X47 A;  3DJW A;  1J26 A;  2EMX A;  1IBM E;  3MHH C;  2EMW A;  2MKN A;  2M9A A;  1BBG A;  2YTO A;  3DF6 A;  5AC5 A;  2L8T A;  4DV6 E;  2EMF A;  4LFA E;  4RHB B;  2NUE A;  2ELZ A;  2HC5 A;  2KOU A;  2L92 A;  2D9H A;  4WYQ B;  2LT7 A;  1YYW A;  4NHR A;  1A1I A;  5A2Q C;  1BBO A;  2L2M A;  2EPC A;  2F4V E;  4B3M E;  3J81 C;  4WPY A;  2YTJ A;  5KL4 A;  2N8X A;  2VRD A;  3HXL A;  2L6M A;  2M4I A;  2ODR D;  3JU0 A;  2JOX A;  4JI6 E;  5AE3 A;  4R2D A;  2EOZ A;  2VF1 A;  5CFF E;  4LF6 E;  1N3G A;  4N4R B;  4NXN E;  1PJQ A;  2LMZ A;  4IJD A;  5AC4 A;  3JAM C;  2WBU A;  3HQ1 A;  2FV4 B;  2LRS A;  4KHP E;  2EM7 A;  1DGC A;  2DLK A;  2EMK A;  1N33 E;  2FTX B;  4R8O A;  4J8Z A;  4JI8 E;  2YZT A;  1T39 A;  2HJJ A;  4JI7 E;  4RH8 A;  2YRK A;  5KL3 A;  1QNT A;  2R1F A;  1N32 E;  4NXM E;  4GKK E;  2EPR A;  3UK3 C;  1YFH A;  4R2A A;  1T38 A;  2F8B A;  4X9J A;  4OX9 E;  3ZOQ B;  4DV2 E;  3IWD A;  5IXM B;  1N36 E;  2EOY A;  2EN6 A;  3T1Y E;  3T1H E;  1YZ9 A;  1NEI A;  2EOE A;  3F6H A;  2K7I A;  4JI3 E;  4R2E A;  2EOJ A;  1A1H A;  2EOM A;  2EOX A;  5AE1 A;  3VHT B;  5A6A A;  4DV7 E;  2JR1 A;  5FLX C;  2Q8U A;  2NUF A;  4BC9 A;  2E72 A;  1KJK A;  2HGH A;  4DR7 E;  5LMU E;  5AAS A;  2EL5 A;  1A1J A;  3HPS A;  4X65 E;  4DV3 E;  2LTS A;  4JV5 E;  2V88 A;  2ENH A;  3EQ1 A;  4X62 E;  2WZO A;  4LU9 A;  3EPL A;  3AV0 A;  5T6J A;  3LML A;  2LUQ A;  2UXC E;  3F6G A;  1PJS A;  1WRJ A;  2IHR 1;  3J7A G;  4X64 E;  1IQS A;  1XNR E;  4BHB A;  5ADZ A;  4DV1 E;  4Q35 B;  2WBT A;  2LVH A;  2EJ4 A;  4LF8 E;  2EQ0 A;  4BC7 A;  5AE2 A;  2EPO A;  4DV0 E;  2EPX A;  1BB8 A;  2WBS A;  3THN A;  4BS9 A;  1RQ0 A;  3K6Q A;  4M9V C;  4BMJ A;  3BGH A;  2EWL A;  2KHX A;  2MDG A;  4M30 A;  4GEQ B;  4DV4 E;  4BHC A;  1RMD A;  2CSH A;  2DIX A;  3C6K A;  1T4L B;  2GLI A;  4JI2 E;  5F3W A;  4MLQ A;  2YSP A;  2L33 A;  2N3G A;  3BBG A;  2EE8 A;  2DSY A;  3ADI A;  2RTX A;  1JK2 A;  4HTG A;  4F6N A;  4I8O A;  2EPM X;  1HNZ E;  1XMQ E;  4Q28 A;  3EPJ A;  2EMB A;  2VQE E;  1GZ6 A;  4LF5 E;  2B3T B;  3THO B;  2EMZ A;  1UBD C;  2WCC 3;  2V89 A;  1GTK A;  4LTY A;  1PDA A;  2VE7 C;  2YU8 A;  3ADL A;  4M2Z A;  1PJT A;  4MLV A;  3ECR A;  2EPU A;  1B69 A;  2DMI A;  2YTF A;  2JOB A;  2ZM6 E;  2EPN A;  5LMN E;  5IWA E;  1AAY A;  4KWY A;  1XMO E;  2R76 A;  4R2P A;  3RMP A;  2L3J A;  2BBG A;  5A6K A;  1IBK E;  2ADR A;  4DMI A;  4TUG A;  5LLQ A;  1NCS A;  2DLQ A;  4LFC E;  1X5W A;  1WJP A;  2PRT A;  3P1X A;  2GPI A;  4WX9 A;  4DR4 E;  3KZZ A;  2EMG A;  4X8W A;  2VQF E;  2M7Q A;  4R2R A;  4AQY E;  2EPZ A;  2UXB E;  2L2N A;  3OTO E;  2JXP A;  2EM5 A;  3FIG A;  2EOH A;  4FK5 C;  2EOS A;  2L2K B;  1A1G A;  2RS6 A;  1EH7 A;  2LJU A;  2E1M A;  1O0W A;  2EQ1 A;  1G2D C;  4ZYH A;  2EN1 A;  2EL6 A;  4WSP A;  1YUI A;  4LF4 E;  4F54 A;  4BBY A;  4ZYG A;  1X6E A;  1X6H A;  2YTG A;  1UHZ A;  2EN7 A;  2JY9 A;  2ENC A;  2EPA A;  3VYX A;  1T4N A;  1RC7 A;  2V8Q B;  4WSG A;  2LO3 A;  3MSW A;  2UXD E;  3L00 A;  2EL4 A;  1GQE A;  1TF6 A;  4X66 E;  3MHS C;  2RS7 A;  2V86 A;  1AH5 A;  4JI0 E;  2YTD A;  1WHN A;  2EMA A;  2MKD A;  2EN4 A;  2EM0 A;  4JI1 E;  2LJH A;  1EH8 A;  3IWB A;  1N34 E;  4DR6 E;  2JVA A;  4P78 A;  4O4K A;  4B3S E;  4K0K E;  2EM4 A;  2EOQ A;  1G2F C;  2B9D A;  2EPL X;  2HHH E;  1UIL A;  1YPN A;  4TUI A;  2A25 A;  2JP9 A;  3OML A;  2LCE A;  4DUY E;  4NZV A;  3EPK A;  4WXD A;  2L3C A;  4DR1 E;  4F6M A;  5KL6 A;  4DV5 E;  2EOF A;  1ZU1 A;  1A1L A;  1UN6 B;  3J80 C;  2CTD A;  1F2I G;  2YT4 A;  1DI2 A;  2JPA A;  3C4T A;  5BR8 E;  1STU A;  1JK1 A;  1A1F A;  1IMU A;  2EM8 A;  2RQL A;  5KL7 A;  3TQM A;  2GHF A;  2ENA A;  2NAB A;  4B3T E;  2LTR A;  1MEY C;  5A6B A;  2YSO A;  2J7J A;  4KZS A;  4O24 A;  2EN2 A;  4BCA A;  2DB2 A;  4WFT A;  2UUA E;  1IQO A;  2EMY A;  2V85 A;  5A69 A;  1WXR A;  1X48 A;  2I13 A;  2EM6 A;  2FGG A;  2EM2 A;  2LV2 A;  2ODR C;  2EOO A;  4M0V A;  5IV8 B;  1J5E E;  1YSA C;  2YU5 A;  1HR0 E;  2K4V A;  2UUB E;  1SFE A;  4DUZ E;  5A6J A;  3J7Y p;  2YTN A;  2UU9 E;  2B7V A;  4LF9 E;  2H36 X;  4R2S A;  1DQ3 A;  4ZYD A;  1IBL E;  2EM3 A;  2EMI A;  2E5L E;  3H09 A;  4YY3 E;  4LF7 E;  2EMC A;  4GKJ E;  1TF3 A;  4P7D A;  2EN8 A;  4R03 A;  2EPK X;  2MDR A;  2JWO A;  1LLM C;  1X6F A;  1MGT A;  4F9B B;  2ELY A;  3EPH A;  2RSM A;  5KL2 A;  2B7T A;  2CT1 A;  1EKZ A;  2YTE A;  1YUJ A;  3BID A;  5KL5 A;  3BF2 A;  4OOG C;  2EZ6 A;  1YYO A;  2NUG A;  4DKK A;  4O5G A;  1ZR9 A;  4DR2 E;  2YWQ A;  3KZY A;  1FJG E;  1PKP A;  2DRP A;  1WHQ A;  2RPC A;  2CPN A;  2BB8 A;  2YTI A;  2EML A;  2LE2 A;  4DR5 E;  3LLH A;  2RSI A;  2LBS B;  3M99 B;  4L5N C;  4F2J C;  4HEI A;  3HPZ A;  4JI4 E;  4JI5 E;  2YRH A;  2YTQ A;  3ADG A;  2LUP B;  2EOI A;  2G7H A;  4LFB E;  2MC6 A;  3AUZ A;  3KWR A;  2MC5 A;  4R2Q A;  2EN3 A;  2EPP A;  4ZYE A;  2DGC A;  3C6M A;  2UUC E;  2EOR A;  4O43 A;  4GZN C; 
#chains in the Genus database with same CATH homology
 2NA2 A;  1XMO E;  4NXM E;  4GKK E;  3RMP A;  5IT9 C;  2L3J A;  1HNW E;  2F8B A;  1FKA E;  1QU6 A;  1ZBT A;  1T4O A;  2DMY A;  1IBK E;  1XNQ E;  4DMI A;  4YHH E;  3ZOQ B;  4TUG A;  4DV2 E;  2LTR A;  3IWD A;  1N36 E;  4B3T E;  4OX9 E;  4L8N A;  3ADJ A;  4DR3 E;  4LFC E;  2KON A;  3T1Y E;  4KZS A;  5DNY A;  3T1H E;  1YZ9 A;  3HTX A;  1SR9 A;  2N3H A;  3F6H A;  1I94 E;  3P1X A;  4BCA A;  4JI3 E;  2V83 A;  1ZBQ A;  2DB2 A;  4WFT A;  3VK6 A;  2UUA E;  4DR4 E;  5LL6 R;  3C4B A;  1X49 A;  4F9A B;  5AE1 A;  4JYA E;  4DV7 E;  2JR1 A;  4B3R E;  4X8W A;  5FLX C;  2VQF E;  1HNX E;  3JTZ A;  2NUF A;  2M7Q A;  2V85 A;  4BC9 A;  4AQY E;  1WXR A;  1X48 A;  2L2N A;  3OTO E;  2UXB E;  2FGG A;  2M1S A;  4DR7 E;  1YYK A;  3FIG A;  5LMU E;  2ODR C;  5AAS A;  1J5E E;  4M0V A;  3HPS A;  2L2K B;  3VYY A;  2RS6 A;  4X65 E;  4DV3 E;  2K4V A;  2LTS A;  1HR0 E;  2UUB E;  2V87 A;  3IWC A;  2V88 A;  4JV5 E;  4F9C B;  1X47 A;  2WZO A;  3DJW A;  4X62 E;  3J7Y p;  4LU9 A;  4DUZ E;  1J26 A;  3AV0 A;  2E1M A;  5T6J A;  1O0W A;  3LML A;  1IBM E;  2UU9 E;  2LUQ A;  2B7V A;  4LF9 E;  2H36 X;  2UXC E;  3F6G A;  2IHR 1;  3J7A G;  4X64 E;  1DQ3 A;  1IBL E;  2E5L E;  1XNR E;  3DF6 A;  4WSP A;  4LF4 E;  2L8T A;  3H09 A;  4DV6 E;  4F54 A;  5ADZ A;  4BBY A;  4YY3 E;  4DV1 E;  4LF7 E;  4LFA E;  1UHZ A;  2NUE A;  2JY9 A;  2KOU A;  4LF8 E;  3VYX A;  2L92 A;  4P7D A;  4R03 A;  4BC7 A;  5AE2 A;  4DV0 E;  2MDR A;  1T4N A;  2JWO A;  2V8Q B;  4WYQ B;  1RC7 A;  3MSW A;  4BS9 A;  1YYW A;  1RQ0 A;  3K6Q A;  4F9B B;  2UXD E;  4BMJ A;  2RSM A;  1GQE A;  2B7T A;  2EWL A;  2KHX A;  5A2Q C;  2L2M A;  1EKZ A;  2F4V E;  4X66 E;  4M30 A;  4GEQ B;  4DV4 E;  4B3M E;  4OOG C;  4WPY A;  3J81 C;  1YYO A;  2EZ6 A;  2NUG A;  2DIX A;  2RS7 A;  2V86 A;  4DKK A;  1T4L B;  4DR2 E;  4JI2 E;  5F3W A;  4JI0 E;  3HXL A;  1FJG E;  1WHN A;  2L33 A;  2N3G A;  4JI1 E;  2L6M A;  2LJH A;  2M4I A;  2ODR D;  3IWB A;  1N34 E;  4DR6 E;  1PKP A;  2JVA A;  4P78 A;  3JU0 A;  2DSY A;  2JOX A;  3ADI A;  1WHQ A;  2RTX A;  4JI6 E;  5AE3 A;  4B3S E;  4K0K E;  2B9D A;  2CPN A;  4I8O A;  2VF1 A;  1HNZ E;  5CFF E;  4LF6 E;  1XMQ E;  2HHH E;  4Q28 A;  4NXN E;  1UIL A;  2LMZ A;  4TUI A;  1GZ6 A;  2LE2 A;  2VQE E;  2B3T B;  3LLH A;  3OML A;  4DR5 E;  4LF5 E;  4DUY E;  2LBS B;  3JAM C;  3HQ1 A;  2FV4 B;  2V89 A;  4LTY A;  2L3C A;  2VE7 C;  2LRS A;  4L5N C;  5IWA E;  4DR1 E;  3ADL A;  4KHP E;  4M2Z A;  4DV5 E;  3HPZ A;  4JI4 E;  4JI5 E;  3ADG A;  2LUP B;  2FTX B;  1N33 E;  4R8O A;  2G7H A;  4J8Z A;  4JI8 E;  3J80 C;  2UUC E;  4LFB E;  2YZT A;  2MC6 A;  2ZM6 E;  2JOB A;  3AUZ A;  3KWR A;  4JI7 E;  2YT4 A;  2MC5 A;  1DI2 A;  3C4T A;  5LMN E;  1N32 E;  5BR8 E;  1STU A;  4GKJ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...