3J7Yp

Structure of the large ribosomal subunit from human mitochondria
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
93
structure length
83
Chain Sequence
DIPLDRLTISYCRSVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
total genus 21
structure length 83
sequence length 93
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
p PF00472 RF-1 RF-1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3j7yp00
4LF8E 1XNQE 2NA2A 2NUGA 4X64E 2NUEA 4LF7E 4DUZE 4DV6E 2HHHE 3VYYA 1XMOE 2JY9A 2B3TB 2UUBE 4LF5E 1IBKE 2YT4A 2CPNA 1X48A 1RC7A 4WYQB 2L2MA 3J7Yp 1QU6A 3VYXA 2LRSA 2N3GA 2DB2A 4YY3E 4DV3E 5LMNE 4WFTA 4LFAE 1UILA 4JI2E 4DR1E 1WHQA 2B7TA 4JI8E 2LUPB 1XNRE 4DR4E 4DV1E 4OOGC 2UXCE 1FKAE 2ZM6E 1X49A 4LF4E 5IWAE 4OX9E 4JI1E 1ZBTA 4DV0E 3ADJA 2L3JA 1HR0E 4X62E 1GQEA 4X8WA 2LUQA 1T4OA 1WHNA 3ADGA 2L2KB 1J5EE 1J26A 4M2ZA 4M30A 4DV7E 4DR5E 1N33E 2LTSA 1YZ9A 1YYWA 2MDRA 4NXNE 5CFFE 1IBME 4NXME 1DI2A 2UXBE 2LBSB 2DMYA 1PKPA 2VQEE 5BR8E 2F4VE 4B3SE 2UUCE 2B7VA 4X66E 4B3TE 1HNZE 3C4BA 1STUA 2RSMA 2UUAE 4LF9E 4DR3E 1HNWE 4K0KE 3P1XA 2KHXA 2RTXA 2RS7A 1X47A 2NUFA 1UHZA 4DV4E 1O0WA 2N3HA 4DR6E 4DKKA 4B3ME 2L33A 1RQ0A 1N34E 4GKJE 3HTXA 2LTRA 2RS6A 3LLHA 3ADIA 4JI0E 2L2NA 4X65E 4DR2E 1T4NA 1IBLE 1N36E 3ADLA 4DV2E 4KHPE 3T1YE 2L3CA 1I94E 2UU9E 2E5LE 4LFBE 1XMQE 1T4LB 4JI7E 1N32E 4JI5E 2JVAA 1EKZA 4JI3E 1FJGE 1YYOA 2UXDE 2IHR1 2VQFE 4DV5E 4GKKE 5LMUE 4AQYE 4YHHE 4DR7E 4JYAE 2EZ6A 4LFCE 4JV5E 1HNXE 4JI4E 4B3RE 4JI6E 2LJHA 4DUYE 3T1HE 1YYKA 2DIXA 3C4TA 4LF6E 3OTOE
chains in the Genus database with same CATH superfamily
4LF8E 2EWLA 2EMCA 2NA2A 1XNQE 2EN2A 2KOUA 2V87A 2NUEA 4LF7E 4R8OA 2RSIA 3DF6A 3VYYA 1B69A 1ZU1A 2EMYA 4ZYDA 1IBKE 4ZYGA 4R2CA 5LLQA 5FLXC 3J7Yp 1A1LA 3KZZA 2JWOA 2DB2A 2R76A 2ODRC 3C6MA 5LL6R 2LMZA 2MKNA 1UILA 1AAYA 1AH5A 2EOHA 4F6MA 1X49A 2L8TA 1ZBTA 2WBUA 4X8WA 2EM6A 2CSHA 2JOXA 3VK6A 4FK5C 1MEYC 2EQ0A 3ADGA 1J26A 2FV4B 1IMUA 2EM9A 3IWCA 1T38A 3QG5C 1NEIA 2GHFA 4NXNE 2EPPA 2YTFA 5CFFE 2EPRA 2A25A 2MDGA 1IQSA 1NCSA 2DGCA 5KL3A 2ADRA 4P78A 2EQ3A 1HNZE 5A6AA 2YU8A 1ZR9A 3IWBA 2UUAE 4Q35B 2YSOA 2ELZA 4K0KE 1P47A 2YTQA 4F6NA 4GKJE 1N34E 1RQ0A 2H36X 2YTDA 2RS6A 2MC5A 3FIGA 2YTNA 1IBLE 2F8BA 1N36E 3ADLA 2EPLX 3T1YE 3MSWA 4IS1C 1XMQE 1T4LB 2EOJA 1DQ3A 4BS9A 4JI5E 2EL4A 1FJGE 4JI3E 2UXDE 1YYOA 1BBOA 4R2RA 4L5NC 2HJJA 3HXLA 5LMUE 2L92A 2LT7A 3ZOQB 5AC4A 1JK2A 1HNXE 2EOZA 4B3RE 2EMFA 2DLKA 4DUYE 3BBGA 2EMZA 2EPXA 4LF6E 4F2JC 2JR1A 5ADZA 1A1JA 2HHHE 2YSPA 1XMOE 2B3TB 2YT4A 2KONA 5IXMB 4X9JA 2WCC3 2L2MA 4WXDA 2I13A 2EOOA 2DLQA 3EQ1A 5LMNE 4WFTA 2EE8A 4JI2E 4DR4E 4OOGC 4TUIA 1FKAE 1G2FC 2V86A 4BHBA 4RHBB 5IT9C 2LVHA 5IWAE 1N3GA 4JI1E 2L3JA 2YRHA 2G7HA 1X5WA 5KL7A 4GEQB 4GZNC 1GQEA 1EH6A 2L2KB 2JOBA 2YZTA 1PDAA 3MHSC 1N33E 4WXCA 5TSEA 2EQ1A 3THNA 3M99B 2EN6A 1QNTA 1IBME 2UXBE 2LBSB 2DMYA 4F9CB 2EOFA 1PKPA 2EPOA 2EN4A 5KL5A 5F3WA 2F4VE 5AE2A 2EMBA 5A6BA 2UUCE 4X66E 2I9IA 4R2EA 2YTJA 2LV2A 5KL4A 2CT1A 2RSMA 3AV0A 4LF9E 4DR3E 2M9AA 3P1XA 2RS7A 1X47A 2EMIA 1UBDC 3F6HA 4DV4E 1O0WA 2N3HA 3EPKA 1A1GA 4DKKA 2WBSA 3HTXA 2LTRA 2DSYA 2EM7A 2ELYA 3C6KA 4R2SA 2LJUA 4R2QA 1T4NA 2EP3A 2FTXB 1I94E 1SR9A 2E5LE 4LFBE 4JI7E 3KWRA 2JVAA 5A69A 2IHR1 3AUZA 1YFHA 2BBGA 4RH8A 4BCAA 4YHHE 2CTDA 3J80C 4P7DA 3JU0A 3J81C 2EL6A 2YPNA 2DRPA 4F54A 2HGHA 4JV5E 5A2QC 2LJHA 2VF1A 1ZBQA 3L00A 1TN9A 3HQ1A 3C4TA 2EMHA 1A1FA 3K6QA 2M4IA 2EM0A 5A6BD 5T6JA 4X64E 5AC5A 2ENAA 4DV6E 4KWYA 1WRJA 4TUGA 2EJ4A 2JY9A 2WBTA 4LF5E 4LU9A 2YTOA 5AE3A 4F9BB 1RC7A 4WYQB 3VYXA 2LRSA 4NZVA 3UK3C 2N3GA 2YWQA 2M7QA 4YY3E 4DV3E 4LFAE 2EORA 2EPKX 1WHQA 2UXCE 5KL6A 2LUPB 4DV1E 4WPYA 2MKDA 5A6JA 1X6EA 1KYQA 4F9AB 2ZM6E 4BC9A 4BC7A 4LF4E 2EM3A 4X62E 4ZYEA 3OMLA 3JTZA 2EOXA 4O24A 1TF3A 1SFEA 3EPLA 3BIDA 2N8XA 4M30A 2EMLA 2D9HA 2YRKA 1YZ9A 3KZYA 1JK1A 2ODRD 2EPZA 2Q8UA 2LCEA 4IJDA 2EOYA 2JYAA 4N4RB 3EPHA 4BMJA 2VQEE 2EM8A 4NHRA 1UN6B 3BF2A 1ZAAC 2B7VA 1G2DC 4B3TE 2L6MA 2EMWA 1X3CA 3C4BA 2E72A 1BBGA 1EH8A 1HNWE 3VHTB 4ZYHA 2KHXA 2RTXA 2NUFA 1X6HA 1UHZA 2E1MA 2LO3A 2GLIA 4DR6E 1YPNA 1PJTA 4B3ME 2K4VA 4R2PA 3RMPA 1A1HA 3ADIA 2L2NA 4X65E 4DR2E 3JAMC 4M0VA 4MLQA 4HEIA 4WSGA 4DV2E 1YSAC 2K7IA 2V83A 2V85A 4DMIA 2PRTA 2NABA 3LMLA 1N32E 1GTKA 1EKZA 4R2DA 2EPAA 1IQOA 2LE2A 2YRMA 2HC5A 1YUJA 4GKKE 2B9DA 2VE7C 2WZOA 4DR7E 4JYAE 2EZ6A 4LFCE 2EPMX 4WSPA 2VRDA 4J8ZA 2JP9A 1MGTA 2EN7A 2FGGA 3THOB 3HPZA 2DIXA 1WJPA 2EM2A 1BB8A 2YTEA 2EPUA 4I8OA 2NUGA 2DMIA 2JPAA 2YTPA 4DUZE 3F6GA 2V88A 2UUBE 2V8QB 4L8NA 4BHCA 2CPNA 4BBYA 1X48A 5AE1A 4KZSA 2EMKA 1Z1BA 1QU6A 1A1IA 1GZ6A 1RMDA 2EPNA 3HPSA 5KL2A 5AASA 2B7TA 2RPCA 4JI8E 4DR1E 1XNRE 2ENHA 4O5GA 2EOIA 4WX9A 4OX9E 4DV0E 3ADJA 1HR0E 3MHHC 2RQLA 2LUQA 2BB8A 5A6KA 1T4OA 2EN3A 1PJQA 4R2AA 3BGHA 1WHNA 1J5EE 1PJSA 4M2ZA 4DV7E 2EMGA 4DR5E 3J7AG 2EOQA 2EL5A 2LTSA 1YYWA 2EN1A 3IWDA 2MDRA 2GPIA 2JXPA 1YUIA 4NXME 1DI2A 3ECRA 5BR8E 1F2IG 4B3SE 2M1SA 2YTGA 1X6FA 2V89A 3DJWA 1WXRA 1STUA 4HTGA 1T39A 2J7JA 1EH7A 4R03A 2EMAA 2EOEA 2EM5A 2EPCA 2YU5A 2L33A 2EN8A 3LLHA 2MC6A 2EOSA 1KJKA 2EOMA 4JI0E 4LTYA 3H09A 1L4SA 4O4KA 1A1KA 4KHPE 5DNYA 2L3CA 2UU9E 3EPJA 1TF6A 2EM4A 2VQFE 4DV5E 4AQYE 1DGCA 2YTIA 4Q28A 4MLVA 1LLMC 3TQMA 4M9VC 5IV8B 4JI4E 4JI6E 4O43A 3T1HE 2R1FA 1YYKA 2EMXA 2ENCA 3OTOE
chains in the Genus database with same CATH topology
5T6JA 2EWLA 2NA2A 4LF8E 1XNQE 2JR1A 4I8OA 2NUGA 4X64E 2KOUA 2V87A 5ADZA 2NUEA 4LF7E 4DUZE 4DV6E 2HHHE 4R8OA 3DF6A 4TUGA 3VYYA 1XMOE 2UU9E 3F6GA 2JY9A 2B3TB 2V88A 2UUBE 4LF5E 1IBKE 2V8QB 2YT4A 2KONA 4L8NA 2CPNA 4LU9A 4BBYA 1X48A 5AE1A 5AE3A 4KZSA 4F9BB 1RC7A 4WYQB 5FLXC 2L2MA 3J7Yp 1QU6A 3VYXA 2LRSA 2N3GA 1GZ6A 2JWOA 2DB2A 2ODRC 5LL6R 2M7QA 4YY3E 4DV3E 2LMZA 4WFTA 5LMNE 4LFAE 4DR4E 1UILA 4JI2E 3HPSA 4DR1E 1WHQA 2B7TA 4JI8E 5AASA 2LUPB 1XNRE 4DV1E 4OOGC 4WPYA 2UXCE 4F9AB 4TUIA 1FKAE 2ZM6E 2V86A 1X49A 5IT9C 4BC9A 4BC7A 4LF4E 2L8TA 5IWAE 4JI1E 1ZBTA 4OX9E 4DV0E 3ADJA 2L3JA 1HR0E 2G7HA 4X62E 4GEQB 1GQEA 4X8WA 2LUQA 1T4OA 2JOXA 3OMLA 3JTZA 3VK6A 1WHNA 3ADGA 2JOBA 2L2KB 1J5EE 1J26A 2E5LE 2FV4B 4M2ZA 4M30A 2YZTA 4DV7E 4DR5E 3J7AG 3IWCA 1N33E 2LTSA 1YZ9A 2ODRD 1YYWA 2MDRA 3IWDA 4NXNE 5CFFE 1IBME 4NXME 1DI2A 2UXBE 2LBSB 2DMYA 4F9CB 1PKPA 5F3WA 4BMJA 2VQEE 5BR8E 5AE2A 2F4VE 4B3SE 2UUCE 2M1SA 3K6QA 4P78A 2B7VA 4X66E 4B3TE 2L6MA 2V89A 1HNZE 3C4BA 3DJWA 1WXRA 1STUA 2RSMA 3IWBA 3AV0A 2UUAE 4LF9E 4DR3E 1HNWE 4K0KE 3P1XA 2KHXA 2RTXA 2RS7A 4LFBE 1X47A 4R03A 2NUFA 1UHZA 2E1MA 3F6HA 4DV4E 1O0WA 2N3HA 4DR6E 4DKKA 4B3ME 2K4VA 1RQ0A 2H36X 2L33A 1N34E 4GKJE 3HTXA 2LTRA 2RS6A 3LLHA 2MC6A 2DSYA 3RMPA 3ADIA 4JI0E 2L2NA 4X65E 2MC5A 3FIGA 4LTYA 3JAMC 1T4NA 4M0VA 4DR2E 3H09A 1IBLE 2F8BA 1N36E 2FTXB 3ADLA 4DV2E 4KHPE 3T1YE 5DNYA 2L3CA 2V83A 2V85A 1SR9A 3MSWA 4DMIA 1XMQE 1T4LB 4JI7E 1I94E 1DQ3A 3KWRA 3LMLA 4BS9A 4JI5E 2JVAA 1N32E 1EKZA 4JI3E 1FJGE 1YYOA 2UXDE 2IHR1 3AUZA 2VQFE 2LE2A 4DV5E 4L5NC 4GKKE 5LMUE 2B9DA 3HXLA 2VE7C 4BCAA 4YHHE 4AQYE 2L92A 2WZOA 3J80C 4DR7E 4JYAE 4P7DA 3JU0A 3ZOQB 3J81C 2EZ6A 4Q28A 4LFCE 4F54A 4WSPA 4J8ZA 4JV5E 1HNXE 5A2QC 4JI4E 4B3RE 4JI6E 2LJHA 2VF1A 1ZBQA 4DUYE 2FGGA 3HPZA 3T1HE 1YYKA 2DIXA 3HQ1A 3C4TA 4LF6E 3OTOE 2M4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF8 E;  1XNQ E;  2NA2 A;  2NUG A;  4X64 E;  2NUE A;  4LF7 E;  4DUZ E;  4DV6 E;  2HHH E;  3VYY A;  1XMO E;  2JY9 A;  2B3T B;  2UUB E;  4LF5 E;  1IBK E;  2YT4 A;  2CPN A;  1X48 A;  1RC7 A;  4WYQ B;  2L2M A;  3J7Y p;  1QU6 A;  3VYX A;  2LRS A;  2N3G A;  2DB2 A;  4YY3 E;  4DV3 E;  5LMN E;  4WFT A;  4LFA E;  1UIL A;  4JI2 E;  4DR1 E;  1WHQ A;  2B7T A;  4JI8 E;  2LUP B;  1XNR E;  4DR4 E;  4DV1 E;  4OOG C;  2UXC E;  1FKA E;  2ZM6 E;  1X49 A;  4LF4 E;  5IWA E;  4OX9 E;  4JI1 E;  1ZBT A;  4DV0 E;  3ADJ A;  2L3J A;  1HR0 E;  4X62 E;  1GQE A;  4X8W A;  2LUQ A;  1T4O A;  1WHN A;  3ADG A;  2L2K B;  1J5E E;  1J26 A;  4M2Z A;  4M30 A;  4DV7 E;  4DR5 E;  1N33 E;  2LTS A;  1YZ9 A;  1YYW A;  2MDR A;  4NXN E;  5CFF E;  1IBM E;  4NXM E;  1DI2 A;  2UXB E;  2LBS B;  2DMY A;  1PKP A;  2VQE E;  5BR8 E;  2F4V E;  4B3S E;  2UUC E;  2B7V A;  4X66 E;  4B3T E;  1HNZ E;  3C4B A;  1STU A;  2RSM A;  2UUA E;  4LF9 E;  4DR3 E;  1HNW E;  4K0K E;  3P1X A;  2KHX A;  2RTX A;  2RS7 A;  1X47 A;  2NUF A;  1UHZ A;  4DV4 E;  1O0W A;  2N3H A;  4DR6 E;  4DKK A;  4B3M E;  2L33 A;  1RQ0 A;  1N34 E;  4GKJ E;  3HTX A;  2LTR A;  2RS6 A;  3LLH A;  3ADI A;  4JI0 E;  2L2N A;  4X65 E;  4DR2 E;  1T4N A;  1IBL E;  1N36 E;  3ADL A;  4DV2 E;  4KHP E;  3T1Y E;  2L3C A;  1I94 E;  2UU9 E;  2E5L E;  4LFB E;  1XMQ E;  1T4L B;  4JI7 E;  1N32 E;  4JI5 E;  2JVA A;  1EKZ A;  4JI3 E;  1FJG E;  1YYO A;  2UXD E;  2IHR 1;  2VQF E;  4DV5 E;  4GKK E;  5LMU E;  4AQY E;  4YHH E;  4DR7 E;  4JYA E;  2EZ6 A;  4LFC E;  4JV5 E;  1HNX E;  4JI4 E;  4B3R E;  4JI6 E;  2LJH A;  4DUY E;  3T1H E;  1YYK A;  2DIX A;  3C4T A;  4LF6 E;  3OTO E; 
#chains in the Genus database with same CATH topology
 4LF8 E;  2EWL A;  2EMC A;  2NA2 A;  1XNQ E;  2EN2 A;  2KOU A;  2V87 A;  2NUE A;  4LF7 E;  4R8O A;  2RSI A;  3DF6 A;  3VYY A;  1B69 A;  1ZU1 A;  2EMY A;  4ZYD A;  1IBK E;  4ZYG A;  4R2C A;  5LLQ A;  5FLX C;  3J7Y p;  1A1L A;  3KZZ A;  2JWO A;  2DB2 A;  2R76 A;  2ODR C;  3C6M A;  5LL6 R;  2LMZ A;  2MKN A;  1UIL A;  1AAY A;  1AH5 A;  2EOH A;  4F6M A;  1X49 A;  2L8T A;  1ZBT A;  2WBU A;  4X8W A;  2EM6 A;  2CSH A;  2JOX A;  3VK6 A;  4FK5 C;  1MEY C;  2EQ0 A;  3ADG A;  1J26 A;  2FV4 B;  1IMU A;  2EM9 A;  3IWC A;  1T38 A;  3QG5 C;  1NEI A;  2GHF A;  4NXN E;  2EPP A;  2YTF A;  5CFF E;  2EPR A;  2A25 A;  2MDG A;  1IQS A;  1NCS A;  2DGC A;  5KL3 A;  2ADR A;  4P78 A;  2EQ3 A;  1HNZ E;  5A6A A;  2YU8 A;  1ZR9 A;  3IWB A;  2UUA E;  4Q35 B;  2YSO A;  2ELZ A;  4K0K E;  1P47 A;  2YTQ A;  4F6N A;  4GKJ E;  1N34 E;  1RQ0 A;  2H36 X;  2YTD A;  2RS6 A;  2MC5 A;  3FIG A;  2YTN A;  1IBL E;  2F8B A;  1N36 E;  3ADL A;  2EPL X;  3T1Y E;  3MSW A;  4IS1 C;  1XMQ E;  1T4L B;  2EOJ A;  1DQ3 A;  4BS9 A;  4JI5 E;  2EL4 A;  1FJG E;  4JI3 E;  2UXD E;  1YYO A;  1BBO A;  4R2R A;  4L5N C;  2HJJ A;  3HXL A;  5LMU E;  2L92 A;  2LT7 A;  3ZOQ B;  5AC4 A;  1JK2 A;  1HNX E;  2EOZ A;  4B3R E;  2EMF A;  2DLK A;  4DUY E;  3BBG A;  2EMZ A;  2EPX A;  4LF6 E;  4F2J C;  2JR1 A;  5ADZ A;  1A1J A;  2HHH E;  2YSP A;  1XMO E;  2B3T B;  2YT4 A;  2KON A;  5IXM B;  4X9J A;  2WCC 3;  2L2M A;  4WXD A;  2I13 A;  2EOO A;  2DLQ A;  3EQ1 A;  5LMN E;  4WFT A;  2EE8 A;  4JI2 E;  4DR4 E;  4OOG C;  4TUI A;  1FKA E;  1G2F C;  2V86 A;  4BHB A;  4RHB B;  5IT9 C;  2LVH A;  5IWA E;  1N3G A;  4JI1 E;  2L3J A;  2YRH A;  2G7H A;  1X5W A;  5KL7 A;  4GEQ B;  4GZN C;  1GQE A;  1EH6 A;  2L2K B;  2JOB A;  2YZT A;  1PDA A;  3MHS C;  1N33 E;  4WXC A;  5TSE A;  2EQ1 A;  3THN A;  3M99 B;  2EN6 A;  1QNT A;  1IBM E;  2UXB E;  2LBS B;  2DMY A;  4F9C B;  2EOF A;  1PKP A;  2EPO A;  2EN4 A;  5KL5 A;  5F3W A;  2F4V E;  5AE2 A;  2EMB A;  5A6B A;  2UUC E;  4X66 E;  2I9I A;  4R2E A;  2YTJ A;  2LV2 A;  5KL4 A;  2CT1 A;  2RSM A;  3AV0 A;  4LF9 E;  4DR3 E;  2M9A A;  3P1X A;  2RS7 A;  1X47 A;  2EMI A;  1UBD C;  3F6H A;  4DV4 E;  1O0W A;  2N3H A;  3EPK A;  1A1G A;  4DKK A;  2WBS A;  3HTX A;  2LTR A;  2DSY A;  2EM7 A;  2ELY A;  3C6K A;  4R2S A;  2LJU A;  4R2Q A;  1T4N A;  2EP3 A;  2FTX B;  1I94 E;  1SR9 A;  2E5L E;  4LFB E;  4JI7 E;  3KWR A;  2JVA A;  5A69 A;  2IHR 1;  3AUZ A;  1YFH A;  2BBG A;  4RH8 A;  4BCA A;  4YHH E;  2CTD A;  3J80 C;  4P7D A;  3JU0 A;  3J81 C;  2EL6 A;  2YPN A;  2DRP A;  4F54 A;  2HGH A;  4JV5 E;  5A2Q C;  2LJH A;  2VF1 A;  1ZBQ A;  3L00 A;  1TN9 A;  3HQ1 A;  3C4T A;  2EMH A;  1A1F A;  3K6Q A;  2M4I A;  2EM0 A;  5A6B D;  5T6J A;  4X64 E;  5AC5 A;  2ENA A;  4DV6 E;  4KWY A;  1WRJ A;  4TUG A;  2EJ4 A;  2JY9 A;  2WBT A;  4LF5 E;  4LU9 A;  2YTO A;  5AE3 A;  4F9B B;  1RC7 A;  4WYQ B;  3VYX A;  2LRS A;  4NZV A;  3UK3 C;  2N3G A;  2YWQ A;  2M7Q A;  4YY3 E;  4DV3 E;  4LFA E;  2EOR A;  2EPK X;  1WHQ A;  2UXC E;  5KL6 A;  2LUP B;  4DV1 E;  4WPY A;  2MKD A;  5A6J A;  1X6E A;  1KYQ A;  4F9A B;  2ZM6 E;  4BC9 A;  4BC7 A;  4LF4 E;  2EM3 A;  4X62 E;  4ZYE A;  3OML A;  3JTZ A;  2EOX A;  4O24 A;  1TF3 A;  1SFE A;  3EPL A;  3BID A;  2N8X A;  4M30 A;  2EML A;  2D9H A;  2YRK A;  1YZ9 A;  3KZY A;  1JK1 A;  2ODR D;  2EPZ A;  2Q8U A;  2LCE A;  4IJD A;  2EOY A;  2JYA A;  4N4R B;  3EPH A;  4BMJ A;  2VQE E;  2EM8 A;  4NHR A;  1UN6 B;  3BF2 A;  1ZAA C;  2B7V A;  1G2D C;  4B3T E;  2L6M A;  2EMW A;  1X3C A;  3C4B A;  2E72 A;  1BBG A;  1EH8 A;  1HNW E;  3VHT B;  4ZYH A;  2KHX A;  2RTX A;  2NUF A;  1X6H A;  1UHZ A;  2E1M A;  2LO3 A;  2GLI A;  4DR6 E;  1YPN A;  1PJT A;  4B3M E;  2K4V A;  4R2P A;  3RMP A;  1A1H A;  3ADI A;  2L2N A;  4X65 E;  4DR2 E;  3JAM C;  4M0V A;  4MLQ A;  4HEI A;  4WSG A;  4DV2 E;  1YSA C;  2K7I A;  2V83 A;  2V85 A;  4DMI A;  2PRT A;  2NAB A;  3LML A;  1N32 E;  1GTK A;  1EKZ A;  4R2D A;  2EPA A;  1IQO A;  2LE2 A;  2YRM A;  2HC5 A;  1YUJ A;  4GKK E;  2B9D A;  2VE7 C;  2WZO A;  4DR7 E;  4JYA E;  2EZ6 A;  4LFC E;  2EPM X;  4WSP A;  2VRD A;  4J8Z A;  2JP9 A;  1MGT A;  2EN7 A;  2FGG A;  3THO B;  3HPZ A;  2DIX A;  1WJP A;  2EM2 A;  1BB8 A;  2YTE A;  2EPU A;  4I8O A;  2NUG A;  2DMI A;  2JPA A;  2YTP A;  4DUZ E;  3F6G A;  2V88 A;  2UUB E;  2V8Q B;  4L8N A;  4BHC A;  2CPN A;  4BBY A;  1X48 A;  5AE1 A;  4KZS A;  2EMK A;  1Z1B A;  1QU6 A;  1A1I A;  1GZ6 A;  1RMD A;  2EPN A;  3HPS A;  5KL2 A;  5AAS A;  2B7T A;  2RPC A;  4JI8 E;  4DR1 E;  1XNR E;  2ENH A;  4O5G A;  2EOI A;  4WX9 A;  4OX9 E;  4DV0 E;  3ADJ A;  1HR0 E;  3MHH C;  2RQL A;  2LUQ A;  2BB8 A;  5A6K A;  1T4O A;  2EN3 A;  1PJQ A;  4R2A A;  3BGH A;  1WHN A;  1J5E E;  1PJS A;  4M2Z A;  4DV7 E;  2EMG A;  4DR5 E;  3J7A G;  2EOQ A;  2EL5 A;  2LTS A;  1YYW A;  2EN1 A;  3IWD A;  2MDR A;  2GPI A;  2JXP A;  1YUI A;  4NXM E;  1DI2 A;  3ECR A;  5BR8 E;  1F2I G;  4B3S E;  2M1S A;  2YTG A;  1X6F A;  2V89 A;  3DJW A;  1WXR A;  1STU A;  4HTG A;  1T39 A;  2J7J A;  1EH7 A;  4R03 A;  2EMA A;  2EOE A;  2EM5 A;  2EPC A;  2YU5 A;  2L33 A;  2EN8 A;  3LLH A;  2MC6 A;  2EOS A;  1KJK A;  2EOM A;  4JI0 E;  4LTY A;  3H09 A;  1L4S A;  4O4K A;  1A1K A;  4KHP E;  5DNY A;  2L3C A;  2UU9 E;  3EPJ A;  1TF6 A;  2EM4 A;  2VQF E;  4DV5 E;  4AQY E;  1DGC A;  2YTI A;  4Q28 A;  4MLV A;  1LLM C;  3TQM A;  4M9V C;  5IV8 B;  4JI4 E;  4JI6 E;  4O43 A;  3T1H E;  2R1F A;  1YYK A;  2EMX A;  2ENC A;  3OTO E; 
#chains in the Genus database with same CATH homology
 5T6J A;  2EWL A;  2NA2 A;  4LF8 E;  1XNQ E;  2JR1 A;  4I8O A;  2NUG A;  4X64 E;  2KOU A;  2V87 A;  5ADZ A;  2NUE A;  4LF7 E;  4DUZ E;  4DV6 E;  2HHH E;  4R8O A;  3DF6 A;  4TUG A;  3VYY A;  1XMO E;  2UU9 E;  3F6G A;  2JY9 A;  2B3T B;  2V88 A;  2UUB E;  4LF5 E;  1IBK E;  2V8Q B;  2YT4 A;  2KON A;  4L8N A;  2CPN A;  4LU9 A;  4BBY A;  1X48 A;  5AE1 A;  5AE3 A;  4KZS A;  4F9B B;  1RC7 A;  4WYQ B;  5FLX C;  2L2M A;  3J7Y p;  1QU6 A;  3VYX A;  2LRS A;  2N3G A;  1GZ6 A;  2JWO A;  2DB2 A;  2ODR C;  5LL6 R;  2M7Q A;  4YY3 E;  4DV3 E;  2LMZ A;  4WFT A;  5LMN E;  4LFA E;  4DR4 E;  1UIL A;  4JI2 E;  3HPS A;  4DR1 E;  1WHQ A;  2B7T A;  4JI8 E;  5AAS A;  2LUP B;  1XNR E;  4DV1 E;  4OOG C;  4WPY A;  2UXC E;  4F9A B;  4TUI A;  1FKA E;  2ZM6 E;  2V86 A;  1X49 A;  5IT9 C;  4BC9 A;  4BC7 A;  4LF4 E;  2L8T A;  5IWA E;  4JI1 E;  1ZBT A;  4OX9 E;  4DV0 E;  3ADJ A;  2L3J A;  1HR0 E;  2G7H A;  4X62 E;  4GEQ B;  1GQE A;  4X8W A;  2LUQ A;  1T4O A;  2JOX A;  3OML A;  3JTZ A;  3VK6 A;  1WHN A;  3ADG A;  2JOB A;  2L2K B;  1J5E E;  1J26 A;  2E5L E;  2FV4 B;  4M2Z A;  4M30 A;  2YZT A;  4DV7 E;  4DR5 E;  3J7A G;  3IWC A;  1N33 E;  2LTS A;  1YZ9 A;  2ODR D;  1YYW A;  2MDR A;  3IWD A;  4NXN E;  5CFF E;  1IBM E;  4NXM E;  1DI2 A;  2UXB E;  2LBS B;  2DMY A;  4F9C B;  1PKP A;  5F3W A;  4BMJ A;  2VQE E;  5BR8 E;  5AE2 A;  2F4V E;  4B3S E;  2UUC E;  2M1S A;  3K6Q A;  4P78 A;  2B7V A;  4X66 E;  4B3T E;  2L6M A;  2V89 A;  1HNZ E;  3C4B A;  3DJW A;  1WXR A;  1STU A;  2RSM A;  3IWB A;  3AV0 A;  2UUA E;  4LF9 E;  4DR3 E;  1HNW E;  4K0K E;  3P1X A;  2KHX A;  2RTX A;  2RS7 A;  4LFB E;  1X47 A;  4R03 A;  2NUF A;  1UHZ A;  2E1M A;  3F6H A;  4DV4 E;  1O0W A;  2N3H A;  4DR6 E;  4DKK A;  4B3M E;  2K4V A;  1RQ0 A;  2H36 X;  2L33 A;  1N34 E;  4GKJ E;  3HTX A;  2LTR A;  2RS6 A;  3LLH A;  2MC6 A;  2DSY A;  3RMP A;  3ADI A;  4JI0 E;  2L2N A;  4X65 E;  2MC5 A;  3FIG A;  4LTY A;  3JAM C;  1T4N A;  4M0V A;  4DR2 E;  3H09 A;  1IBL E;  2F8B A;  1N36 E;  2FTX B;  3ADL A;  4DV2 E;  4KHP E;  3T1Y E;  5DNY A;  2L3C A;  2V83 A;  2V85 A;  1SR9 A;  3MSW A;  4DMI A;  1XMQ E;  1T4L B;  4JI7 E;  1I94 E;  1DQ3 A;  3KWR A;  3LML A;  4BS9 A;  4JI5 E;  2JVA A;  1N32 E;  1EKZ A;  4JI3 E;  1FJG E;  1YYO A;  2UXD E;  2IHR 1;  3AUZ A;  2VQF E;  2LE2 A;  4DV5 E;  4L5N C;  4GKK E;  5LMU E;  2B9D A;  3HXL A;  2VE7 C;  4BCA A;  4YHH E;  4AQY E;  2L92 A;  2WZO A;  3J80 C;  4DR7 E;  4JYA E;  4P7D A;  3JU0 A;  3ZOQ B;  3J81 C;  2EZ6 A;  4Q28 A;  4LFC E;  4F54 A;  4WSP A;  4J8Z A;  4JV5 E;  1HNX E;  5A2Q C;  4JI4 E;  4B3R E;  4JI6 E;  2LJH A;  2VF1 A;  1ZBQ A;  4DUY E;  2FGG A;  3HPZ A;  3T1H E;  1YYK A;  2DIX A;  3HQ1 A;  3C4T A;  4LF6 E;  3OTO E;  2M4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...