3J7Yp

Structure of the large ribosomal subunit from human mitochondria
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
93
structure length
83
Chain Sequence
DIPLDRLTISYCRSVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 21
structure length 83
sequence length 93
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
p PF00472 RF-1 RF-1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3j7yp00
1HNXE 1IBLE 1X49A 1XNRE 4LF6E 3VYYA 2UXCE 4DV7E 1XNQE 1DI2A 5BR8E 1FKAE 2LTSA 2UXDE 2LUPB 4JI1E 2B3TB 1UILA 4X64E 4JI6E 1FJGE 4DV5E 2L2NA 3LLHA 2L2KB 4DV4E 2L3CA 1N32E 4NXNE 5IWAE 2ZM6E 3C4TA 3HTXA 4K0KE 1N33E 2NUEA 4B3TE 1YYWA 4JI0E 2NUFA 1N34E 1HR0E 5LMNE 4X65E 3T1YE 4GKKE 1WHQA 1O0WA 4LF5E 3J7Yp 4DV6E 2UUAE 2KHXA 4OOGC 4DV0E 2DMYA 1XMOE 2DB2A 2EZ6A 1N36E 4LFBE 4X66E 4DV2E 4DV1E 1WHNA 2LUQA 2LJHA 4JI4E 5CFFE 2B7VA 1XMQE 4JI7E 1HNWE 4WYQB 1PKPA 1T4LB 4JI3E 2UU9E 4DR7E 4YY3E 1T4NA 4JI8E 4LF8E 2LBSB 2L2MA 4X62E 1ZBTA 5LMUE 4DKKA 1IBKE 2UUBE 4LF7E 3ADIA 3ADLA 1X47A 4B3SE 1UHZA 1EKZA 1I94E 4NXME 1X48A 4LF9E 3ADJA 4DR4E 4DV3E 3OTOE 2HHHE 3C4BA 2NUGA 2LRSA 2N3HA 4LF4E 3VYXA 2L33A 4M30A 1YZ9A 2RS7A 4WFTA 2B7TA 2RS6A 3P1XA 2RSMA 4DUZE 4YHHE 4LFCE 4JI2E 1GQEA 4X8WA 4DR6E 4B3RE 2JY9A 4LFAE 2CPNA 2N3GA 2LTRA 1J26A 2JVAA 1T4OA 2IHR1 2UUCE 1YYKA 4DR1E 2DIXA 2VQEE 4OX9E 1YYOA 1STUA 4DR5E 4AQYE 4JYAE 4DR2E 2NA2A 4KHPE 2E5LE 1QU6A 4B3ME 4DUYE 2F4VE 3T1HE 1IBME 2UXBE 4M2ZA 2YT4A 2RTXA 3ADGA 4JI5E 1J5EE 2MDRA 4JV5E 1RQ0A 1RC7A 4DR3E 2VQFE 1HNZE 4GKJE 2L3JA
chains in the Genus database with same CATH superfamily
2GHFA 1BBGA 4LF6E 2JXPA 1DI2A 2YTOA 1FKAE 2LTSA 2UXDE 2EN3A 1A1FA 3HXLA 2YSPA 4I8OA 2EOSA 4ZYGA 2EPMX 4FK5C 3EPJA 1FJGE 2WCC3 2EOHA 4DV4E 3L00A 5KL3A 2V8QB 3MHSC 2EE8A 5KL6A 3FIGA 4B3TE 2M7QA 1BB8A 2ELYA 1N34E 4P7DA 2ENHA 2D9HA 1PDAA 2A25A 2YRHA 4ZYDA 3UK3C 1N3GA 4F6NA 2UUAE 4OOGC 4DV0E 3RMPA 1XMOE 2DB2A 2EL4A 2EN2A 2EMIA 2LJHA 4JI4E 2B7VA 1XMQE 2ENCA 4ZYEA 2LMZA 2EN7A 2HC5A 1X6HA 1X3CA 1ZBTA 5IXMB 3IWBA 4M9VC 4B3SE 4O5GA 2ELZA 2MKDA 1X48A 4LF9E 4NXME 1WXRA 1IMUA 4R8OA 3C4BA 1NEIA 2EPUA 2YTDA 4F9BB 4Q35B 2RS7A 4GEQB 2YPNA 3JAMC 3P1XA 3THOB 4YHHE 4JI2E 3EPLA 2DMIA 1GQEA 2V83A 1EH6A 2GLIA 4R2RA 4BBYA 1WRJA 2IHR1 1YYKA 2EQ3A 5A69A 2DIXA 2EMFA 2EOYA 2K4VA 4AQYE 4JYAE 2NA2A 1A1LA 2RPCA 5ADZA 4O43A 1IBME 4J8ZA 1G2FC 1SR9A 2KOUA 1J5EE 2EN8A 3F6GA 4JV5E 5KL2A 1RQ0A 2YTJA 4GKJE 2DLKA 5A6KA 5DNYA 1X49A 1XNRE 2EOJA 2EQ0A 4LTYA 4TUIA 2EOEA 2J7JA 1XNQE 1UN6B 2ODRD 2EMXA 3ECRA 1RMDA 2CT1A 1EH7A 2LUPB 4JI1E 3HQ1A 2YTFA 4L5NC 5AASA 2EMLA 2EPAA 4R2DA 4JI6E 4DV5E 2L3CA 2HJJA 4NXNE 5AE2A 2EMWA 5IWAE 2KONA 2RSIA 4IS1C 1A1HA 4K0KE 3C6KA 5KL7A 2NUEA 2YTIA 4WSGA 4JI0E 3HPSA 2NABA 5F3WA 4KWYA 4Q28A 1WHQA 4RH8A 2EOXA 1A1KA 1O0WA 2KHXA 2YSOA 1JK2A 4DV2E 2DRPA 3J7AG 2VF1A 2MC5A 2F8BA 4O24A 2L6MA 5CFFE 4F2JC 4R2AA 1HNWE 1DQ3A 1ZU1A 4BHBA 2UU9E 2V85A 1WJPA 3KWRA 1X5WA 4HEIA 3KZZA 2LBSB 2L2MA 3IWDA 2EPXA 4WPYA 5LMUE 1IBKE 4LF7E 2EMKA 2LO3A 2EOQA 1UHZA 1PJQA 2GPIA 4DV3E 2L92A 2E72A 2NUGA 1ZAAC 3BGHA 2LRSA 5IT9C 2EOMA 1NCSA 4LF4E 2L33A 4M30A 2RQLA 2YRMA 1B69A 2EPNA 2RSMA 3AUZA 4IJDA 2R1FA 2EPCA 2YTNA 5LLQA 2ADRA 4GZNC 4DR6E 1SFEA 2LVHA 1MGTA 1J26A 2UUCE 1T4OA 2G7HA 4DR1E 1MEYC 5IV8B 3J80C 5AE1A 2FTXB 2EN6A 4DR2E 4KHPE 1PJSA 2LE2A 2YZTA 2YWQA 2YT4A 2V88A 4KZSA 4N4RB 1T38A 2M4IA 2PRTA 1IQOA 3JTZA 2FGGA 2JOXA 3HPZA 2L3JA 3OMLA 2EMYA 1HNXE 1IBLE 2UXCE 2VRDA 3VYYA 4DV7E 2WBSA 4BMJA 3EQ1A 2CSHA 2ODRC 3VHTB 4X64E 2EM4A 4M0VA 3H09A 2L2NA 2EOFA 2L2KB 1N32E 2EPPA 5AC5A 2ZM6E 2JP9A 3C4TA 3HTXA 3IWCA 1G2DC 2CTDA 1YYWA 2EM0A 2EP3A 5AE3A 2NUFA 2HGHA 2JPAA 2WZOA 5A6BD 2MDGA 3T1YE 4GKKE 4F6MA 2EM2A 2EQ1A 2L8TA 2EMCA 2JWOA 2DGCA 4X66E 2EORA 2LCEA 2LUQA 2EJ4A 4JI7E 4WYQB 1PKPA 1TF6A 1AH5A 4JI3E 2EM7A 4YY3E 4MLVA 2EN1A 4L8NA 1ZBQA 2B9DA 2V86A 2E1MA 1Z1BA 1LLMC 4LF8E 2EMZA 3TQMA 2I9IA 3AV0A 3ADIA 3ADLA 2LT7A 1ZR9A 3EPHA 1PJTA 3KZYA 4DR4E 1X6FA 2N3HA 2EL6A 4RHBB 2YTEA 2R76A 2WBUA 1KJKA 3BIDA 1YSAC 4WXCA 2EPOA 5LL6R 2B7TA 3EPKA 2RS6A 4DUZE 2EN4A 2MKNA 1TF3A 2V89A 4X8WA 1A1JA 4F54A 4B3RE 2JY9A 1BBOA 4LFAE 2N8XA 2CPNA 2EPZA 2JVAA 2M9AA 2LJUA 1P47A 4OX9E 4P78A 1YYOA 1AAYA 2YU5A 1STUA 2BB8A 4NZVA 2E5LE 2JYAA 1KYQA 4BCAA 3MSWA 3T1HE 2YRKA 2RTXA 3ADGA 1RC7A 4R2SA 4DR3E 2VQFE 5FLXC 2LV2A 4TUGA 1JK1A 3DJWA 2H36X 2EOZA 4O4KA 4ZYHA 5BR8E 4R2EA 4BC9A 2B3TB 2M1SA 2EWLA 1UILA 2EMGA 2EM9A 4MLQA 2BBGA 5A6AA 3LLHA 2YTQA 1QNTA 1N33E 1DGCA 2EMAA 5KL4A 3LMLA 2EM5A 1HR0E 5LMNE 4X65E 2EPRA 1L4SA 4WSPA 4LF5E 5TSEA 3J7Yp 4DV6E 2EOOA 5T6JA 1YUIA 3ZOQB 1A1GA 2DMYA 2EZ6A 4LFBE 1N36E 4F9AB 3BBGA 1EH8A 1WHNA 3DF6A 4DV1E 2VE7C 2Q8UA 2YTGA 3QG5C 1T4LB 2EM8A 5AC4A 4DR7E 1IQSA 2DSYA 2DLQA 1GTKA 1T4NA 4JI8E 3BF2A 1YPNA 3C6MA 4NHRA 3THNA 4X62E 1UBDC 5A6BA 4DKKA 2UUBE 2JR1A 2EMBA 1X47A 1EKZA 1I94E 3ADJA 4HTGA 2EOIA 3OTOE 2HHHE 3K6QA 4R2CA 1TN9A 1T39A 1A1IA 4LU9A 1YFHA 4R2PA 4BS9A 2EM3A 3VYXA 3MHHC 1YZ9A 4WFTA 3M99B 2EM6A 1X6EA 4LFCE 2EMHA 2V87A 4WX9A 2EPKX 2WBTA 3F6HA 1F2IG 4F9CB 2FV4B 4BHCA 2N3GA 2LTRA 4WXDA 4DMIA 2MC6A 2K7IA 2YTPA 5A2QC 2VQEE 4DR5E 1GZ6A 5KL5A 1QU6A 4B3ME 4DUYE 2F4VE 5A6JA 2UXBE 4X9JA 3VK6A 2EPLX 4M2ZA 2ENAA 4JI5E 2I13A 3J81C 2MDRA 4R03A 2EL5A 1YUJA 3JU0A 4BC7A 2JOBA 4R2QA 1HNZE 2YU8A
chains in the Genus database with same CATH topology
3OMLA 4TUGA 1HNXE 1IBLE 5DNYA 3DJWA 1X49A 1XNRE 4LF6E 3VYYA 2UXCE 4DV7E 4LTYA 2H36X 4TUIA 1XNQE 1DI2A 2ODRD 5BR8E 4BMJA 2LTSA 1FKAE 2UXDE 2LUPB 4JI1E 3HXLA 3HQ1A 2B3TB 2ODRC 4BC9A 2M1SA 4L5NC 2EWLA 1UILA 4I8OA 5AASA 4X64E 4M0VA 4JI6E 1FJGE 3H09A 4DV5E 2L2NA 3LLHA 2L2KB 4DV4E 1HNZE 2L3CA 1N32E 4NXNE 5AE2A 5IWAE 2ZM6E 2KONA 3C4TA 3HTXA 2V8QB 3IWCA 2NUEA 4K0KE 1N33E 3FIGA 4B3TE 2M7QA 1YYWA 3LMLA 2NUFA 5AE3A 3HPSA 4JI0E 1N34E 1HR0E 5LMNE 2WZOA 4P7DA 4X65E 5F3WA 3T1YE 4Q28A 1WHQA 4GKKE 4WSPA 1O0WA 4LF5E 3J7Yp 4DV6E 2L8TA 2JWOA 2UUAE 5T6JA 2KHXA 4OOGC 3ZOQB 4DV0E 2DMYA 3RMPA 1XMOE 2DB2A 2EZ6A 1N36E 4F9AB 4X66E 4DV2E 3J7AG 4LFBE 2VF1A 1WHNA 3DF6A 4DV1E 2MC5A 2F8BA 2VE7C 2LUQA 2LJHA 4JI4E 2L6MA 5CFFE 2B7VA 1XMQE 4JI7E 1HNWE 4WYQB 1PKPA 1T4LB 1DQ3A 4JI3E 2LMZA 2UU9E 4DR7E 2V85A 4YY3E 3KWRA 4L8NA 2DSYA 1ZBQA 1T4NA 2B9DA 4JI8E 2V86A 2E1MA 4LF8E 2LBSB 2L2MA 3IWDA 1ZBTA 4X62E 4WPYA 5LMUE 3IWBA 4DKKA 1IBKE 2JR1A 3AV0A 2UUBE 4LF7E 3ADIA 3ADLA 1X47A 4B3SE 1UHZA 1EKZA 1I94E 4NXME 1X48A 4LF9E 3ADJA 1WXRA 4R8OA 4DV3E 3OTOE 2L92A 3K6QA 2HHHE 3C4BA 2NUGA 4DR4E 4LU9A 2LRSA 2N3HA 4BS9A 5IT9C 4LF4E 3VYXA 4F9BB 2L33A 4M30A 1YZ9A 2RS7A 4GEQB 4WFTA 5LL6R 3JAMC 2B7TA 2RS6A 3P1XA 2RSMA 3AUZA 4DUZE 4YHHE 4LFCE 4JI2E 1GQEA 2V83A 2V89A 2V87A 4X8WA 4DR6E 3F6HA 4F54A 4BBYA 4F9CB 4B3RE 2FV4B 2JY9A 4LFAE 2CPNA 2N3GA 2LTRA 1J26A 2JVAA 1T4OA 2IHR1 2G7HA 4DMIA 2MC6A 2UUCE 1YYKA 5A2QC 4DR1E 2DIXA 2VQEE 4P78A 3J80C 1YYOA 4OX9E 1STUA 2K4VA 1GZ6A 2FTXB 5AE1A 4DR2E 2NA2A 4DR5E 4AQYE 2E5LE 4JYAE 1QU6A 4KHPE 4B3ME 2LE2A 2YZTA 4DUYE 4BCAA 2F4VE 3MSWA 5ADZA 3T1HE 1IBME 2UXBE 4J8ZA 3VK6A 2YT4A 4M2ZA 2RTXA 2V88A 3ADGA 2L3JA 4JI5E 1SR9A 2KOUA 4KZSA 1J5EE 3J81C 2MDRA 4R03A 3F6GA 2M4IA 4JV5E 3JU0A 1RQ0A 4BC7A 4DR3E 2JOBA 1RC7A 2VQFE 3JTZA 2FGGA 4GKJE 5FLXC 2JOXA 3HPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNX E;  1IBL E;  1X49 A;  1XNR E;  4LF6 E;  3VYY A;  2UXC E;  4DV7 E;  1XNQ E;  1DI2 A;  5BR8 E;  1FKA E;  2LTS A;  2UXD E;  2LUP B;  4JI1 E;  2B3T B;  1UIL A;  4X64 E;  4JI6 E;  1FJG E;  4DV5 E;  2L2N A;  3LLH A;  2L2K B;  4DV4 E;  2L3C A;  1N32 E;  4NXN E;  5IWA E;  2ZM6 E;  3C4T A;  3HTX A;  4K0K E;  1N33 E;  2NUE A;  4B3T E;  1YYW A;  4JI0 E;  2NUF A;  1N34 E;  1HR0 E;  5LMN E;  4X65 E;  3T1Y E;  4GKK E;  1WHQ A;  1O0W A;  4LF5 E;  3J7Y p;  4DV6 E;  2UUA E;  2KHX A;  4OOG C;  4DV0 E;  2DMY A;  1XMO E;  2DB2 A;  2EZ6 A;  1N36 E;  4LFB E;  4X66 E;  4DV2 E;  4DV1 E;  1WHN A;  2LUQ A;  2LJH A;  4JI4 E;  5CFF E;  2B7V A;  1XMQ E;  4JI7 E;  1HNW E;  4WYQ B;  1PKP A;  1T4L B;  4JI3 E;  2UU9 E;  4DR7 E;  4YY3 E;  1T4N A;  4JI8 E;  4LF8 E;  2LBS B;  2L2M A;  4X62 E;  1ZBT A;  5LMU E;  4DKK A;  1IBK E;  2UUB E;  4LF7 E;  3ADI A;  3ADL A;  1X47 A;  4B3S E;  1UHZ A;  1EKZ A;  1I94 E;  4NXM E;  1X48 A;  4LF9 E;  3ADJ A;  4DR4 E;  4DV3 E;  3OTO E;  2HHH E;  3C4B A;  2NUG A;  2LRS A;  2N3H A;  4LF4 E;  3VYX A;  2L33 A;  4M30 A;  1YZ9 A;  2RS7 A;  4WFT A;  2B7T A;  2RS6 A;  3P1X A;  2RSM A;  4DUZ E;  4YHH E;  4LFC E;  4JI2 E;  1GQE A;  4X8W A;  4DR6 E;  4B3R E;  2JY9 A;  4LFA E;  2CPN A;  2N3G A;  2LTR A;  1J26 A;  2JVA A;  1T4O A;  2IHR 1;  2UUC E;  1YYK A;  4DR1 E;  2DIX A;  2VQE E;  4OX9 E;  1YYO A;  1STU A;  4DR5 E;  4AQY E;  4JYA E;  4DR2 E;  2NA2 A;  4KHP E;  2E5L E;  1QU6 A;  4B3M E;  4DUY E;  2F4V E;  3T1H E;  1IBM E;  2UXB E;  4M2Z A;  2YT4 A;  2RTX A;  3ADG A;  4JI5 E;  1J5E E;  2MDR A;  4JV5 E;  1RQ0 A;  1RC7 A;  4DR3 E;  2VQF E;  1HNZ E;  4GKJ E;  2L3J A; 
#chains in the Genus database with same CATH topology
 2GHF A;  1BBG A;  4LF6 E;  2JXP A;  1DI2 A;  2YTO A;  1FKA E;  2LTS A;  2UXD E;  2EN3 A;  1A1F A;  3HXL A;  2YSP A;  4I8O A;  2EOS A;  4ZYG A;  2EPM X;  4FK5 C;  3EPJ A;  1FJG E;  2WCC 3;  2EOH A;  4DV4 E;  3L00 A;  5KL3 A;  2V8Q B;  3MHS C;  2EE8 A;  5KL6 A;  3FIG A;  4B3T E;  2M7Q A;  1BB8 A;  2ELY A;  1N34 E;  4P7D A;  2ENH A;  2D9H A;  1PDA A;  2A25 A;  2YRH A;  4ZYD A;  3UK3 C;  1N3G A;  4F6N A;  2UUA E;  4OOG C;  4DV0 E;  3RMP A;  1XMO E;  2DB2 A;  2EL4 A;  2EN2 A;  2EMI A;  2LJH A;  4JI4 E;  2B7V A;  1XMQ E;  2ENC A;  4ZYE A;  2LMZ A;  2EN7 A;  2HC5 A;  1X6H A;  1X3C A;  1ZBT A;  5IXM B;  3IWB A;  4M9V C;  4B3S E;  4O5G A;  2ELZ A;  2MKD A;  1X48 A;  4LF9 E;  4NXM E;  1WXR A;  1IMU A;  4R8O A;  3C4B A;  1NEI A;  2EPU A;  2YTD A;  4F9B B;  4Q35 B;  2RS7 A;  4GEQ B;  2YPN A;  3JAM C;  3P1X A;  3THO B;  4YHH E;  4JI2 E;  3EPL A;  2DMI A;  1GQE A;  2V83 A;  1EH6 A;  2GLI A;  4R2R A;  4BBY A;  1WRJ A;  2IHR 1;  1YYK A;  2EQ3 A;  5A69 A;  2DIX A;  2EMF A;  2EOY A;  2K4V A;  4AQY E;  4JYA E;  2NA2 A;  1A1L A;  2RPC A;  5ADZ A;  4O43 A;  1IBM E;  4J8Z A;  1G2F C;  1SR9 A;  2KOU A;  1J5E E;  2EN8 A;  3F6G A;  4JV5 E;  5KL2 A;  1RQ0 A;  2YTJ A;  4GKJ E;  2DLK A;  5A6K A;  5DNY A;  1X49 A;  1XNR E;  2EOJ A;  2EQ0 A;  4LTY A;  4TUI A;  2EOE A;  2J7J A;  1XNQ E;  1UN6 B;  2ODR D;  2EMX A;  3ECR A;  1RMD A;  2CT1 A;  1EH7 A;  2LUP B;  4JI1 E;  3HQ1 A;  2YTF A;  4L5N C;  5AAS A;  2EML A;  2EPA A;  4R2D A;  4JI6 E;  4DV5 E;  2L3C A;  2HJJ A;  4NXN E;  5AE2 A;  2EMW A;  5IWA E;  2KON A;  2RSI A;  4IS1 C;  1A1H A;  4K0K E;  3C6K A;  5KL7 A;  2NUE A;  2YTI A;  4WSG A;  4JI0 E;  3HPS A;  2NAB A;  5F3W A;  4KWY A;  4Q28 A;  1WHQ A;  4RH8 A;  2EOX A;  1A1K A;  1O0W A;  2KHX A;  2YSO A;  1JK2 A;  4DV2 E;  2DRP A;  3J7A G;  2VF1 A;  2MC5 A;  2F8B A;  4O24 A;  2L6M A;  5CFF E;  4F2J C;  4R2A A;  1HNW E;  1DQ3 A;  1ZU1 A;  4BHB A;  2UU9 E;  2V85 A;  1WJP A;  3KWR A;  1X5W A;  4HEI A;  3KZZ A;  2LBS B;  2L2M A;  3IWD A;  2EPX A;  4WPY A;  5LMU E;  1IBK E;  4LF7 E;  2EMK A;  2LO3 A;  2EOQ A;  1UHZ A;  1PJQ A;  2GPI A;  4DV3 E;  2L92 A;  2E72 A;  2NUG A;  1ZAA C;  3BGH A;  2LRS A;  5IT9 C;  2EOM A;  1NCS A;  4LF4 E;  2L33 A;  4M30 A;  2RQL A;  2YRM A;  1B69 A;  2EPN A;  2RSM A;  3AUZ A;  4IJD A;  2R1F A;  2EPC A;  2YTN A;  5LLQ A;  2ADR A;  4GZN C;  4DR6 E;  1SFE A;  2LVH A;  1MGT A;  1J26 A;  2UUC E;  1T4O A;  2G7H A;  4DR1 E;  1MEY C;  5IV8 B;  3J80 C;  5AE1 A;  2FTX B;  2EN6 A;  4DR2 E;  4KHP E;  1PJS A;  2LE2 A;  2YZT A;  2YWQ A;  2YT4 A;  2V88 A;  4KZS A;  4N4R B;  1T38 A;  2M4I A;  2PRT A;  1IQO A;  3JTZ A;  2FGG A;  2JOX A;  3HPZ A;  2L3J A;  3OML A;  2EMY A;  1HNX E;  1IBL E;  2UXC E;  2VRD A;  3VYY A;  4DV7 E;  2WBS A;  4BMJ A;  3EQ1 A;  2CSH A;  2ODR C;  3VHT B;  4X64 E;  2EM4 A;  4M0V A;  3H09 A;  2L2N A;  2EOF A;  2L2K B;  1N32 E;  2EPP A;  5AC5 A;  2ZM6 E;  2JP9 A;  3C4T A;  3HTX A;  3IWC A;  1G2D C;  2CTD A;  1YYW A;  2EM0 A;  2EP3 A;  5AE3 A;  2NUF A;  2HGH A;  2JPA A;  2WZO A;  5A6B D;  2MDG A;  3T1Y E;  4GKK E;  4F6M A;  2EM2 A;  2EQ1 A;  2L8T A;  2EMC A;  2JWO A;  2DGC A;  4X66 E;  2EOR A;  2LCE A;  2LUQ A;  2EJ4 A;  4JI7 E;  4WYQ B;  1PKP A;  1TF6 A;  1AH5 A;  4JI3 E;  2EM7 A;  4YY3 E;  4MLV A;  2EN1 A;  4L8N A;  1ZBQ A;  2B9D A;  2V86 A;  2E1M A;  1Z1B A;  1LLM C;  4LF8 E;  2EMZ A;  3TQM A;  2I9I A;  3AV0 A;  3ADI A;  3ADL A;  2LT7 A;  1ZR9 A;  3EPH A;  1PJT A;  3KZY A;  4DR4 E;  1X6F A;  2N3H A;  2EL6 A;  4RHB B;  2YTE A;  2R76 A;  2WBU A;  1KJK A;  3BID A;  1YSA C;  4WXC A;  2EPO A;  5LL6 R;  2B7T A;  3EPK A;  2RS6 A;  4DUZ E;  2EN4 A;  2MKN A;  1TF3 A;  2V89 A;  4X8W A;  1A1J A;  4F54 A;  4B3R E;  2JY9 A;  1BBO A;  4LFA E;  2N8X A;  2CPN A;  2EPZ A;  2JVA A;  2M9A A;  2LJU A;  1P47 A;  4OX9 E;  4P78 A;  1YYO A;  1AAY A;  2YU5 A;  1STU A;  2BB8 A;  4NZV A;  2E5L E;  2JYA A;  1KYQ A;  4BCA A;  3MSW A;  3T1H E;  2YRK A;  2RTX A;  3ADG A;  1RC7 A;  4R2S A;  4DR3 E;  2VQF E;  5FLX C;  2LV2 A;  4TUG A;  1JK1 A;  3DJW A;  2H36 X;  2EOZ A;  4O4K A;  4ZYH A;  5BR8 E;  4R2E A;  4BC9 A;  2B3T B;  2M1S A;  2EWL A;  1UIL A;  2EMG A;  2EM9 A;  4MLQ A;  2BBG A;  5A6A A;  3LLH A;  2YTQ A;  1QNT A;  1N33 E;  1DGC A;  2EMA A;  5KL4 A;  3LML A;  2EM5 A;  1HR0 E;  5LMN E;  4X65 E;  2EPR A;  1L4S A;  4WSP A;  4LF5 E;  5TSE A;  3J7Y p;  4DV6 E;  2EOO A;  5T6J A;  1YUI A;  3ZOQ B;  1A1G A;  2DMY A;  2EZ6 A;  4LFB E;  1N36 E;  4F9A B;  3BBG A;  1EH8 A;  1WHN A;  3DF6 A;  4DV1 E;  2VE7 C;  2Q8U A;  2YTG A;  3QG5 C;  1T4L B;  2EM8 A;  5AC4 A;  4DR7 E;  1IQS A;  2DSY A;  2DLQ A;  1GTK A;  1T4N A;  4JI8 E;  3BF2 A;  1YPN A;  3C6M A;  4NHR A;  3THN A;  4X62 E;  1UBD C;  5A6B A;  4DKK A;  2UUB E;  2JR1 A;  2EMB A;  1X47 A;  1EKZ A;  1I94 E;  3ADJ A;  4HTG A;  2EOI A;  3OTO E;  2HHH E;  3K6Q A;  4R2C A;  1TN9 A;  1T39 A;  1A1I A;  4LU9 A;  1YFH A;  4R2P A;  4BS9 A;  2EM3 A;  3VYX A;  3MHH C;  1YZ9 A;  4WFT A;  3M99 B;  2EM6 A;  1X6E A;  4LFC E;  2EMH A;  2V87 A;  4WX9 A;  2EPK X;  2WBT A;  3F6H A;  1F2I G;  4F9C B;  2FV4 B;  4BHC A;  2N3G A;  2LTR A;  4WXD A;  4DMI A;  2MC6 A;  2K7I A;  2YTP A;  5A2Q C;  2VQE E;  4DR5 E;  1GZ6 A;  5KL5 A;  1QU6 A;  4B3M E;  4DUY E;  2F4V E;  5A6J A;  2UXB E;  4X9J A;  3VK6 A;  2EPL X;  4M2Z A;  2ENA A;  4JI5 E;  2I13 A;  3J81 C;  2MDR A;  4R03 A;  2EL5 A;  1YUJ A;  3JU0 A;  4BC7 A;  2JOB A;  4R2Q A;  1HNZ E;  2YU8 A; 
#chains in the Genus database with same CATH homology
 3OML A;  4TUG A;  1HNX E;  1IBL E;  5DNY A;  3DJW A;  1X49 A;  1XNR E;  4LF6 E;  3VYY A;  2UXC E;  4DV7 E;  4LTY A;  2H36 X;  4TUI A;  1XNQ E;  1DI2 A;  2ODR D;  5BR8 E;  4BMJ A;  2LTS A;  1FKA E;  2UXD E;  2LUP B;  4JI1 E;  3HXL A;  3HQ1 A;  2B3T B;  2ODR C;  4BC9 A;  2M1S A;  4L5N C;  2EWL A;  1UIL A;  4I8O A;  5AAS A;  4X64 E;  4M0V A;  4JI6 E;  1FJG E;  3H09 A;  4DV5 E;  2L2N A;  3LLH A;  2L2K B;  4DV4 E;  1HNZ E;  2L3C A;  1N32 E;  4NXN E;  5AE2 A;  5IWA E;  2ZM6 E;  2KON A;  3C4T A;  3HTX A;  2V8Q B;  3IWC A;  2NUE A;  4K0K E;  1N33 E;  3FIG A;  4B3T E;  2M7Q A;  1YYW A;  3LML A;  2NUF A;  5AE3 A;  3HPS A;  4JI0 E;  1N34 E;  1HR0 E;  5LMN E;  2WZO A;  4P7D A;  4X65 E;  5F3W A;  3T1Y E;  4Q28 A;  1WHQ A;  4GKK E;  4WSP A;  1O0W A;  4LF5 E;  3J7Y p;  4DV6 E;  2L8T A;  2JWO A;  2UUA E;  5T6J A;  2KHX A;  4OOG C;  3ZOQ B;  4DV0 E;  2DMY A;  3RMP A;  1XMO E;  2DB2 A;  2EZ6 A;  1N36 E;  4F9A B;  4X66 E;  4DV2 E;  3J7A G;  4LFB E;  2VF1 A;  1WHN A;  3DF6 A;  4DV1 E;  2MC5 A;  2F8B A;  2VE7 C;  2LUQ A;  2LJH A;  4JI4 E;  2L6M A;  5CFF E;  2B7V A;  1XMQ E;  4JI7 E;  1HNW E;  4WYQ B;  1PKP A;  1T4L B;  1DQ3 A;  4JI3 E;  2LMZ A;  2UU9 E;  4DR7 E;  2V85 A;  4YY3 E;  3KWR A;  4L8N A;  2DSY A;  1ZBQ A;  1T4N A;  2B9D A;  4JI8 E;  2V86 A;  2E1M A;  4LF8 E;  2LBS B;  2L2M A;  3IWD A;  1ZBT A;  4X62 E;  4WPY A;  5LMU E;  3IWB A;  4DKK A;  1IBK E;  2JR1 A;  3AV0 A;  2UUB E;  4LF7 E;  3ADI A;  3ADL A;  1X47 A;  4B3S E;  1UHZ A;  1EKZ A;  1I94 E;  4NXM E;  1X48 A;  4LF9 E;  3ADJ A;  1WXR A;  4R8O A;  4DV3 E;  3OTO E;  2L92 A;  3K6Q A;  2HHH E;  3C4B A;  2NUG A;  4DR4 E;  4LU9 A;  2LRS A;  2N3H A;  4BS9 A;  5IT9 C;  4LF4 E;  3VYX A;  4F9B B;  2L33 A;  4M30 A;  1YZ9 A;  2RS7 A;  4GEQ B;  4WFT A;  5LL6 R;  3JAM C;  2B7T A;  2RS6 A;  3P1X A;  2RSM A;  3AUZ A;  4DUZ E;  4YHH E;  4LFC E;  4JI2 E;  1GQE A;  2V83 A;  2V89 A;  2V87 A;  4X8W A;  4DR6 E;  3F6H A;  4F54 A;  4BBY A;  4F9C B;  4B3R E;  2FV4 B;  2JY9 A;  4LFA E;  2CPN A;  2N3G A;  2LTR A;  1J26 A;  2JVA A;  1T4O A;  2IHR 1;  2G7H A;  4DMI A;  2MC6 A;  2UUC E;  1YYK A;  5A2Q C;  4DR1 E;  2DIX A;  2VQE E;  4P78 A;  3J80 C;  1YYO A;  4OX9 E;  1STU A;  2K4V A;  1GZ6 A;  2FTX B;  5AE1 A;  4DR2 E;  2NA2 A;  4DR5 E;  4AQY E;  2E5L E;  4JYA E;  1QU6 A;  4KHP E;  4B3M E;  2LE2 A;  2YZT A;  4DUY E;  4BCA A;  2F4V E;  3MSW A;  5ADZ A;  3T1H E;  1IBM E;  2UXB E;  4J8Z A;  3VK6 A;  2YT4 A;  4M2Z A;  2RTX A;  2V88 A;  3ADG A;  2L3J A;  4JI5 E;  1SR9 A;  2KOU A;  4KZS A;  1J5E E;  3J81 C;  2MDR A;  4R03 A;  3F6G A;  2M4I A;  4JV5 E;  3JU0 A;  1RQ0 A;  4BC7 A;  4DR3 E;  2JOB A;  1RC7 A;  2VQF E;  3JTZ A;  2FGG A;  4GKJ E;  5FLX C;  2JOX A;  3HPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...