3J7Yp

Structure of the large ribosomal subunit from human mitochondria
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
93
structure length
83
Chain Sequence
DIPLDRLTISYCRSVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 83
sequence length 93
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
p PF00472 RF-1 RF-1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3j7yp00
1XMOE 4M30A 2KHXA 4X65E 1YYKA 2NUEA 2CPNA 2VQFE 1ZBTA 4B3TE 1FJGE 3T1HE 4DR7E 2L3JA 4LF8E 3OTOE 1FKAE 4JI5E 4M2ZA 2ZM6E 1T4NA 1X47A 2RSMA 5LMNE 4LFBE 2LUPB 1HNZE 1UHZA 2RS7A 3P1XA 2B3TB 2N3HA 2UXBE 2YT4A 5BR8E 1HNXE 3ADGA 2B7VA 4DV4E 4LFAE 2JY9A 2UXCE 1WHQA 3C4BA 4LF7E 3VYXA 2DMYA 2VQEE 2HHHE 1RQ0A 3ADJA 4GKKE 2DIXA 4B3RE 1XNRE 4DUYE 1T4OA 3C4TA 4JI8E 4LF5E 1UILA 1GQEA 4JV5E 4X66E 1IBLE 1EKZA 4K0KE 1IBME 1HR0E 4B3SE 4X8WA 4JYAE 2LBSB 4LF4E 2E5LE 2NUGA 1DI2A 4DV7E 3ADLA 1XNQE 4NXME 4DV3E 2N3GA 2L2NA 4YHHE 4DR5E 4JI2E 4DR6E 2L3CA 3T1YE 2LTRA 2MDRA 1YYOA 2L2MA 4LFCE 4WFTA 1RC7A 1X49A 2UU9E 3ADIA 4X62E 3HTXA 3VYYA 2NUFA 4WYQB 2EZ6A 1N33E 1YYWA 1IBKE 4JI6E 1J26A 2F4VE 2RS6A 2UXDE 2LRSA 4JI3E 2B7TA 1I94E 1XMQE 4DR2E 4DV0E 2DB2A 4JI1E 1N32E 4YY3E 1N36E 4DV2E 1O0WA 3LLHA 4GKJE 1PKPA 1QU6A 2RTXA 5LMUE 1YZ9A 4DUZE 2UUAE 4JI4E 5IWAE 4NXNE 4B3ME 4DR3E 2UUBE 4KHPE 2UUCE 2IHR1 4X64E 2JVAA 2LJHA 2LUQA 1T4LB 4DV5E 4DV6E 4DKKA 3J7Yp 2L2KB 4DV1E 1WHNA 4LF9E 4OX9E 1N34E 4OOGC 4DR1E 4LF6E 4DR4E 1STUA 2LTSA 5CFFE 1X48A 4JI7E 4JI0E 4AQYE 1HNWE 1J5EE 2NA2A 2L33A
chains in the Genus database with same CATH superfamily
2JXPA 4P7DA 2YRMA 4ZYGA 1T39A 4B3TE 2FGGA 1DGCA 4LF8E 5AC5A 3JU0A 1T4NA 2EL4A 1A1FA 4LFBE 2LUPB 4R2EA 1HNZE 1N3GA 3H09A 2EM5A 2BBGA 5ADZA 1MEYC 2JY9A 4HEIA 1MGTA 2EOFA 2EOOA 4LF7E 3VYXA 4BC9A 2YTQA 3EQ1A 4BMJA 2EOEA 1XNRE 4KWYA 2YTPA 2CSHA 4ZYDA 1A1LA 2A25A 4JV5E 2CT1A 3BF2A 1IBLE 2KOUA 4JYAE 2E5LE 2M9AA 4MLVA 3JAMC 1XNQE 2YTDA 2LJUA 3KZZA 2EMWA 4NXME 4M9VC 2EM4A 4JI2E 4GZNC 1YYOA 1YPNA 2WZOA 2V88A 3HTXA 3C6KA 1JK1A 2JP9A 2EZ6A 4WYQB 3MHSC 2PRTA 2LT7A 1YYWA 1IBKE 2ELZA 1J26A 1YUJA 4F2JC 2UXDE 2LRSA 2YSOA 4DR2E 2EOMA 4DV0E 1ZU1A 3EPHA 1EH7A 4BHCA 1KJKA 1NCSA 2EM2A 2V83A 3BGHA 2CTDA 1T38A 4BC7A 4DV2E 2EPKX 2WBTA 2YTIA 3DJWA 3HPSA 2RTXA 3BBGA 4WSPA 2V8QB 4TUIA 4P78A 5IWAE 4KHPE 2UUCE 2IHR1 2EPCA 2EPRA 2JVAA 1AH5A 1T4LB 2VF1A 4DKKA 3J7Yp 1WXRA 3MSWA 1WHNA 2N8XA 2EN4A 2JR1A 2J7JA 4DR4E 2MC5A 2EP3A 1RMDA 3HXLA 5CFFE 1G2DC 5A6AA 2EPXA 1J5EE 2NA2A 2LMZA 3MHHC 2EN8A 2WCC3 1NEIA 2JOXA 2L33A 5T6JA 4R2QA 1WJPA 2L6MA 5KL4A 1YYKA 1UN6B 2R1FA 1FJGE 4MLQA 3TQMA 4M2ZA 2LV2A 1SFEA 3THOB 2ZM6E 1X47A 2RSMA 3EPJA 1UHZA 3P1XA 2EMXA 4WX9A 3QG5C 4ZYEA 4NHRA 2DRPA 2EJ4A 1A1HA 2VQEE 4FK5C 2EN6A 4KZSA 1DQ3A 1ZBQA 2DIXA 3KZYA 2YTNA 1X3CA 1T4OA 3C4TA 2YU8A 1B69A 3HQ1A 2V85A 1UILA 1EH6A 2EN7A 4Q28A 2DLQA 2EPUA 3DF6A 4X66E 2ENAA 1IBME 1HR0E 2LBSB 1AAYA 4LF4E 5TSEA 4F9BB 2KONA 2RQLA 3UK3C 3ECRA 1DI2A 3ADLA 2GLIA 2L2NA 2YSPA 2VE7C 5IT9C 3IWCA 4WFTA 3ADIA 2ENHA 1X6FA 3VYYA 2WBUA 3KWRA 2F4VE 4R2AA 1JK2A 4R2SA 2B7TA 2I13A 2DB2A 2EQ3A 4JI1E 4Q35B 5LL6R 5A69A 1Z1BA 2M1SA 2YTEA 2D9HA 3LLHA 4GKJE 1PDAA 1QU6A 4R2PA 2EM0A 5LMUE 1GZ6A 4WSGA 2RPCA 2YZTA 2LUQA 4DV5E 4DV6E 4OX9E 2ELYA 4J8ZA 1YUIA 4OOGC 4LF6E 3VHTB 2M7QA 2LTSA 2YRHA 1X48A 4JI7E 3THNA 1PJSA 1QNTA 5A6BA 2V89A 3J81C 2EOHA 5F3WA 2RSIA 4X65E 1X5WA 2HJJA 2NUEA 2CPNA 3T1HE 4DR7E 2L3JA 4LTYA 4JI5E 1SR9A 2EM6A 4BCAA 3FIGA 1BBOA 2RS7A 2B3TB 2EMKA 2N3HA 2EOJA 2YPNA 2YT4A 4F54A 2WBSA 3ADGA 2B7VA 4LFAE 2UXCE 3EPLA 2HHHE 3L00A 1RQ0A 2EOQA 3EPKA 2EN1A 3J80C 2JPAA 4GKKE 2DMIA 5KL7A 2EQ0A 4M0VA 4DUYE 2EMGA 4L5NC 4JI8E 5KL5A 4LF5E 1A1GA 2MKDA 2ODRC 4GEQB 1YSAC 1A1KA 4HTGA 1L4SA 4O24A 3HPZA 1A1JA 2EMCA 1G2FC 2I9IA 2EMIA 5KL3A 4L8NA 2EMYA 4WXCA 4DV3E 2ENCA 3J7AG 4YHHE 4DR5E 2E1MA 4R2CA 2MDRA 2L2MA 2LVHA 2EPZA 3C6MA 3IWDA 2EM8A 1RC7A 1X49A 4LU9A 4X62E 1EH8A 4I8OA 2EL6A 3LMLA 2EMLA 3F6GA 5KL6A 4ZYHA 4JI6E 1A1IA 2EORA 2M4IA 1I94E 2EWLA 4IS1C 5A6BD 3RMPA 4RHBB 4WPYA 1GTKA 5AE3A 4YY3E 2JYAA 2EOYA 1O0WA 1BB8A 4R8OA 4X9JA 1PKPA 3M99B 1F2IG 4BS9A 4DUZE 4JI4E 2Q8UA 4NXNE 4F9CB 4DR3E 2EL5A 2EM7A 3IWBA 2EMHA 2YTGA 2GHFA 1P47A 2L2KB 4DV1E 4IJDA 2K4VA 1N34E 3BIDA 3AV0A 4DR1E 4N4RB 2EM9A 4AQYE 1HNWE 2ADRA 2YTJA 2EOXA 2JWOA 5A2QC 2VRDA 4RH8A 1XMOE 2EMZA 4M30A 2KHXA 4R2RA 1TF6A 2VQFE 2YRKA 1ZBTA 1WRJA 3K6QA 2EPLX 4O43A 1ZAAC 2EPAA 2HGHA 2EPNA 3OTOE 1FKAE 3F6HA 2EN2A 5A6JA 2LO3A 5LMNE 1X6EA 2UXBE 5BR8E 1IMUA 4F9AB 1HNXE 4DV4E 1WHQA 3C4BA 2FTXB 5IXMB 3ZOQB 2DMYA 2EPMX 4NZVA 2E72A 3ADJA 4O5GA 1YFHA 4B3RE 2ODRD 2EOIA 2GPIA 2EMFA 2B9DA 4BHBA 2EMBA 2EQ1A 1GQEA 4F6NA 2HC5A 1IQSA 2MDGA 2EOZA 3JTZA 1EKZA 4K0KE 4B3SE 4X8WA 5IV8B 2DLKA 2YTFA 2L8TA 2YWQA 2NUGA 1UBDC 4DV7E 1KYQA 3VK6A 2K7IA 2EN3A 2N3GA 4O4KA 5AC4A 4DR6E 2MKNA 2L3CA 3T1YE 2LTRA 1TF3A 2MC6A 4LFCE 2UU9E 2LE2A 5AASA 5LLQA 2EE8A 5FLXC 4R03A 5A6KA 2NUFA 1N33E 5KL2A 2JOBA 4BBYA 2RS6A 1IQOA 2EM3A 4JI3E 2YU5A 1XMQE 2F8BA 2FV4B 4F6MA 5DNYA 4TUGA 2R76A 1PJQA 1N32E 1N36E 2L92A 1LLMC 1YZ9A 2H36X 2UUAE 1ZR9A 2DSYA 4B3ME 1BBGA 2UUBE 3OMLA 2EMAA 4X64E 2LJHA 4R2DA 2EPPA 1PJTA 2EOSA 4WXDA 2G7HA 2V86A 2EPOA 5AE1A 2V87A 4DMIA 4LF9E 1TN9A 2DGCA 1X6HA 1STUA 2BB8A 5AE2A 4JI0E 2NABA 2YTOA 3AUZA 2LCEA
chains in the Genus database with same CATH topology
2V89A 3J81C 1XMOE 4P7DA 4M30A 5F3WA 2KHXA 4X65E 2L6MA 1YYKA 2NUEA 2CPNA 2VQFE 3K6QA 1ZBTA 4B3TE 2FGGA 3T1HE 1FJGE 4DR7E 2L3JA 4LF8E 4LTYA 3OTOE 1FKAE 4JI5E 4M2ZA 2ZM6E 1SR9A 3F6HA 1T4NA 3JU0A 1X47A 2RSMA 4BCAA 3FIGA 5LMNE 4LFBE 2LUPB 1HNZE 1UHZA 2RS7A 3P1XA 2B3TB 2N3HA 2UXBE 4F54A 2YT4A 3H09A 5BR8E 4F9AB 5ADZA 1HNXE 3ADGA 2B7VA 4DV4E 4LFAE 2JY9A 2UXCE 1WHQA 3C4BA 2FTXB 4LF7E 3VYXA 3ZOQB 2DMYA 4BC9A 2VQEE 2HHHE 1RQ0A 3ADJA 3ADIA 4KZSA 1DQ3A 1ZBQA 2DIXA 3J80C 4GKKE 4BMJA 4B3RE 2ODRD 4M0VA 4DUYE 1XNRE 1T4OA 3C4TA 4L5NC 4JI8E 3HQ1A 4LF5E 2B9DA 1UILA 2V85A 2ODRC 4GEQB 4Q28A 1GQEA 4JV5E 3DF6A 4X66E 1IBLE 3JTZA 1EKZA 4K0KE 4JI2E 1IBME 2KOUA 3HPZA 1HR0E 4B3SE 4X8WA 4JYAE 2LBSB 2L8TA 4LF4E 4F9BB 2E5LE 2KONA 2NUGA 1DI2A 4DV7E 3ADLA 4L8NA 3VK6A 3JAMC 1XNQE 4NXME 4DV3E 2N3GA 2L2NA 3J7AG 4YHHE 2VE7C 4DR5E 5IT9C 2E1MA 2L3CA 3T1YE 2LTRA 2MDRA 1YYOA 2L2MA 2MC6A 3IWCA 2WZOA 3IWDA 4LFCE 4WFTA 2V88A 1RC7A 1X49A 2LE2A 4LU9A 5AASA 4X62E 5FLXC 4R03A 2UU9E 3VYYA 2NUFA 4I8OA 4WYQB 2EZ6A 3KWRA 3LMLA 1N33E 1YYWA 2JOBA 3F6GA 1IBKE 4JI6E 2F4VE 4BBYA 2RS6A 4KHPE 1J26A 2UXDE 2LRSA 4JI3E 2B7TA 2M4IA 1I94E 2EWLA 4DR2E 1XMQE 4DV0E 2F8BA 2FV4B 3RMPA 2DB2A 4WPYA 5DNYA 4JI1E 4TUGA 2V83A 5AE3A 1N32E 4YY3E 2L92A 5LL6R 1N36E 4BC7A 2M1SA 4DV2E 1O0WA 3DJWA 3LLHA 3HPSA 4R8OA 4GKJE 1PKPA 1QU6A 4DR6E 2RTXA 4WSPA 5LMUE 1YZ9A 2V8QB 2H36X 4BS9A 1GZ6A 4DUZE 2UUAE 4JI4E 4TUIA 4P78A 2JWOA 5IWAE 2DSYA 4NXNE 4F9CB 4DR3E 2UUBE 4B3ME 3OMLA 2IHR1 3IWBA 4X64E 2UUCE 2JVAA 2LJHA 2YZTA 2LUQA 1T4LB 2G7HA 4DV5E 3HTXA 4DV6E 2V86A 2VF1A 4DKKA 3J7Yp 2L2KB 1WXRA 4DV1E 5AE1A 2V87A 3MSWA 4DMIA 1WHNA 4LF9E 4J8ZA 4OX9E 2K4VA 1N34E 2JR1A 3AV0A 4OOGC 4DR1E 4LF6E 4DR4E 1STUA 2MC5A 2LTSA 2M7QA 3HXLA 1X48A 4JI7E 5AE2A 5CFFE 4JI0E 4AQYE 1HNWE 1J5EE 3AUZA 2NA2A 2LMZA 2JOXA 2L33A 5T6JA 5A2QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMO E;  4M30 A;  2KHX A;  4X65 E;  1YYK A;  2NUE A;  2CPN A;  2VQF E;  1ZBT A;  4B3T E;  1FJG E;  3T1H E;  4DR7 E;  2L3J A;  4LF8 E;  3OTO E;  1FKA E;  4JI5 E;  4M2Z A;  2ZM6 E;  1T4N A;  1X47 A;  2RSM A;  5LMN E;  4LFB E;  2LUP B;  1HNZ E;  1UHZ A;  2RS7 A;  3P1X A;  2B3T B;  2N3H A;  2UXB E;  2YT4 A;  5BR8 E;  1HNX E;  3ADG A;  2B7V A;  4DV4 E;  4LFA E;  2JY9 A;  2UXC E;  1WHQ A;  3C4B A;  4LF7 E;  3VYX A;  2DMY A;  2VQE E;  2HHH E;  1RQ0 A;  3ADJ A;  4GKK E;  2DIX A;  4B3R E;  1XNR E;  4DUY E;  1T4O A;  3C4T A;  4JI8 E;  4LF5 E;  1UIL A;  1GQE A;  4JV5 E;  4X66 E;  1IBL E;  1EKZ A;  4K0K E;  1IBM E;  1HR0 E;  4B3S E;  4X8W A;  4JYA E;  2LBS B;  4LF4 E;  2E5L E;  2NUG A;  1DI2 A;  4DV7 E;  3ADL A;  1XNQ E;  4NXM E;  4DV3 E;  2N3G A;  2L2N A;  4YHH E;  4DR5 E;  4JI2 E;  4DR6 E;  2L3C A;  3T1Y E;  2LTR A;  2MDR A;  1YYO A;  2L2M A;  4LFC E;  4WFT A;  1RC7 A;  1X49 A;  2UU9 E;  3ADI A;  4X62 E;  3HTX A;  3VYY A;  2NUF A;  4WYQ B;  2EZ6 A;  1N33 E;  1YYW A;  1IBK E;  4JI6 E;  1J26 A;  2F4V E;  2RS6 A;  2UXD E;  2LRS A;  4JI3 E;  2B7T A;  1I94 E;  1XMQ E;  4DR2 E;  4DV0 E;  2DB2 A;  4JI1 E;  1N32 E;  4YY3 E;  1N36 E;  4DV2 E;  1O0W A;  3LLH A;  4GKJ E;  1PKP A;  1QU6 A;  2RTX A;  5LMU E;  1YZ9 A;  4DUZ E;  2UUA E;  4JI4 E;  5IWA E;  4NXN E;  4B3M E;  4DR3 E;  2UUB E;  4KHP E;  2UUC E;  2IHR 1;  4X64 E;  2JVA A;  2LJH A;  2LUQ A;  1T4L B;  4DV5 E;  4DV6 E;  4DKK A;  3J7Y p;  2L2K B;  4DV1 E;  1WHN A;  4LF9 E;  4OX9 E;  1N34 E;  4OOG C;  4DR1 E;  4LF6 E;  4DR4 E;  1STU A;  2LTS A;  5CFF E;  1X48 A;  4JI7 E;  4JI0 E;  4AQY E;  1HNW E;  1J5E E;  2NA2 A;  2L33 A; 
#chains in the Genus database with same CATH topology
 2JXP A;  4P7D A;  2YRM A;  4ZYG A;  1T39 A;  4B3T E;  2FGG A;  1DGC A;  4LF8 E;  5AC5 A;  3JU0 A;  1T4N A;  2EL4 A;  1A1F A;  4LFB E;  2LUP B;  4R2E A;  1HNZ E;  1N3G A;  3H09 A;  2EM5 A;  2BBG A;  5ADZ A;  1MEY C;  2JY9 A;  4HEI A;  1MGT A;  2EOF A;  2EOO A;  4LF7 E;  3VYX A;  4BC9 A;  2YTQ A;  3EQ1 A;  4BMJ A;  2EOE A;  1XNR E;  4KWY A;  2YTP A;  2CSH A;  4ZYD A;  1A1L A;  2A25 A;  4JV5 E;  2CT1 A;  3BF2 A;  1IBL E;  2KOU A;  4JYA E;  2E5L E;  2M9A A;  4MLV A;  3JAM C;  1XNQ E;  2YTD A;  2LJU A;  3KZZ A;  2EMW A;  4NXM E;  4M9V C;  2EM4 A;  4JI2 E;  4GZN C;  1YYO A;  1YPN A;  2WZO A;  2V88 A;  3HTX A;  3C6K A;  1JK1 A;  2JP9 A;  2EZ6 A;  4WYQ B;  3MHS C;  2PRT A;  2LT7 A;  1YYW A;  1IBK E;  2ELZ A;  1J26 A;  1YUJ A;  4F2J C;  2UXD E;  2LRS A;  2YSO A;  4DR2 E;  2EOM A;  4DV0 E;  1ZU1 A;  3EPH A;  1EH7 A;  4BHC A;  1KJK A;  1NCS A;  2EM2 A;  2V83 A;  3BGH A;  2CTD A;  1T38 A;  4BC7 A;  4DV2 E;  2EPK X;  2WBT A;  2YTI A;  3DJW A;  3HPS A;  2RTX A;  3BBG A;  4WSP A;  2V8Q B;  4TUI A;  4P78 A;  5IWA E;  4KHP E;  2UUC E;  2IHR 1;  2EPC A;  2EPR A;  2JVA A;  1AH5 A;  1T4L B;  2VF1 A;  4DKK A;  3J7Y p;  1WXR A;  3MSW A;  1WHN A;  2N8X A;  2EN4 A;  2JR1 A;  2J7J A;  4DR4 E;  2MC5 A;  2EP3 A;  1RMD A;  3HXL A;  5CFF E;  1G2D C;  5A6A A;  2EPX A;  1J5E E;  2NA2 A;  2LMZ A;  3MHH C;  2EN8 A;  2WCC 3;  1NEI A;  2JOX A;  2L33 A;  5T6J A;  4R2Q A;  1WJP A;  2L6M A;  5KL4 A;  1YYK A;  1UN6 B;  2R1F A;  1FJG E;  4MLQ A;  3TQM A;  4M2Z A;  2LV2 A;  1SFE A;  3THO B;  2ZM6 E;  1X47 A;  2RSM A;  3EPJ A;  1UHZ A;  3P1X A;  2EMX A;  4WX9 A;  3QG5 C;  4ZYE A;  4NHR A;  2DRP A;  2EJ4 A;  1A1H A;  2VQE E;  4FK5 C;  2EN6 A;  4KZS A;  1DQ3 A;  1ZBQ A;  2DIX A;  3KZY A;  2YTN A;  1X3C A;  1T4O A;  3C4T A;  2YU8 A;  1B69 A;  3HQ1 A;  2V85 A;  1UIL A;  1EH6 A;  2EN7 A;  4Q28 A;  2DLQ A;  2EPU A;  3DF6 A;  4X66 E;  2ENA A;  1IBM E;  1HR0 E;  2LBS B;  1AAY A;  4LF4 E;  5TSE A;  4F9B B;  2KON A;  2RQL A;  3UK3 C;  3ECR A;  1DI2 A;  3ADL A;  2GLI A;  2L2N A;  2YSP A;  2VE7 C;  5IT9 C;  3IWC A;  4WFT A;  3ADI A;  2ENH A;  1X6F A;  3VYY A;  2WBU A;  3KWR A;  2F4V E;  4R2A A;  1JK2 A;  4R2S A;  2B7T A;  2I13 A;  2DB2 A;  2EQ3 A;  4JI1 E;  4Q35 B;  5LL6 R;  5A69 A;  1Z1B A;  2M1S A;  2YTE A;  2D9H A;  3LLH A;  4GKJ E;  1PDA A;  1QU6 A;  4R2P A;  2EM0 A;  5LMU E;  1GZ6 A;  4WSG A;  2RPC A;  2YZT A;  2LUQ A;  4DV5 E;  4DV6 E;  4OX9 E;  2ELY A;  4J8Z A;  1YUI A;  4OOG C;  4LF6 E;  3VHT B;  2M7Q A;  2LTS A;  2YRH A;  1X48 A;  4JI7 E;  3THN A;  1PJS A;  1QNT A;  5A6B A;  2V89 A;  3J81 C;  2EOH A;  5F3W A;  2RSI A;  4X65 E;  1X5W A;  2HJJ A;  2NUE A;  2CPN A;  3T1H E;  4DR7 E;  2L3J A;  4LTY A;  4JI5 E;  1SR9 A;  2EM6 A;  4BCA A;  3FIG A;  1BBO A;  2RS7 A;  2B3T B;  2EMK A;  2N3H A;  2EOJ A;  2YPN A;  2YT4 A;  4F54 A;  2WBS A;  3ADG A;  2B7V A;  4LFA E;  2UXC E;  3EPL A;  2HHH E;  3L00 A;  1RQ0 A;  2EOQ A;  3EPK A;  2EN1 A;  3J80 C;  2JPA A;  4GKK E;  2DMI A;  5KL7 A;  2EQ0 A;  4M0V A;  4DUY E;  2EMG A;  4L5N C;  4JI8 E;  5KL5 A;  4LF5 E;  1A1G A;  2MKD A;  2ODR C;  4GEQ B;  1YSA C;  1A1K A;  4HTG A;  1L4S A;  4O24 A;  3HPZ A;  1A1J A;  2EMC A;  1G2F C;  2I9I A;  2EMI A;  5KL3 A;  4L8N A;  2EMY A;  4WXC A;  4DV3 E;  2ENC A;  3J7A G;  4YHH E;  4DR5 E;  2E1M A;  4R2C A;  2MDR A;  2L2M A;  2LVH A;  2EPZ A;  3C6M A;  3IWD A;  2EM8 A;  1RC7 A;  1X49 A;  4LU9 A;  4X62 E;  1EH8 A;  4I8O A;  2EL6 A;  3LML A;  2EML A;  3F6G A;  5KL6 A;  4ZYH A;  4JI6 E;  1A1I A;  2EOR A;  2M4I A;  1I94 E;  2EWL A;  4IS1 C;  5A6B D;  3RMP A;  4RHB B;  4WPY A;  1GTK A;  5AE3 A;  4YY3 E;  2JYA A;  2EOY A;  1O0W A;  1BB8 A;  4R8O A;  4X9J A;  1PKP A;  3M99 B;  1F2I G;  4BS9 A;  4DUZ E;  4JI4 E;  2Q8U A;  4NXN E;  4F9C B;  4DR3 E;  2EL5 A;  2EM7 A;  3IWB A;  2EMH A;  2YTG A;  2GHF A;  1P47 A;  2L2K B;  4DV1 E;  4IJD A;  2K4V A;  1N34 E;  3BID A;  3AV0 A;  4DR1 E;  4N4R B;  2EM9 A;  4AQY E;  1HNW E;  2ADR A;  2YTJ A;  2EOX A;  2JWO A;  5A2Q C;  2VRD A;  4RH8 A;  1XMO E;  2EMZ A;  4M30 A;  2KHX A;  4R2R A;  1TF6 A;  2VQF E;  2YRK A;  1ZBT A;  1WRJ A;  3K6Q A;  2EPL X;  4O43 A;  1ZAA C;  2EPA A;  2HGH A;  2EPN A;  3OTO E;  1FKA E;  3F6H A;  2EN2 A;  5A6J A;  2LO3 A;  5LMN E;  1X6E A;  2UXB E;  5BR8 E;  1IMU A;  4F9A B;  1HNX E;  4DV4 E;  1WHQ A;  3C4B A;  2FTX B;  5IXM B;  3ZOQ B;  2DMY A;  2EPM X;  4NZV A;  2E72 A;  3ADJ A;  4O5G A;  1YFH A;  4B3R E;  2ODR D;  2EOI A;  2GPI A;  2EMF A;  2B9D A;  4BHB A;  2EMB A;  2EQ1 A;  1GQE A;  4F6N A;  2HC5 A;  1IQS A;  2MDG A;  2EOZ A;  3JTZ A;  1EKZ A;  4K0K E;  4B3S E;  4X8W A;  5IV8 B;  2DLK A;  2YTF A;  2L8T A;  2YWQ A;  2NUG A;  1UBD C;  4DV7 E;  1KYQ A;  3VK6 A;  2K7I A;  2EN3 A;  2N3G A;  4O4K A;  5AC4 A;  4DR6 E;  2MKN A;  2L3C A;  3T1Y E;  2LTR A;  1TF3 A;  2MC6 A;  4LFC E;  2UU9 E;  2LE2 A;  5AAS A;  5LLQ A;  2EE8 A;  5FLX C;  4R03 A;  5A6K A;  2NUF A;  1N33 E;  5KL2 A;  2JOB A;  4BBY A;  2RS6 A;  1IQO A;  2EM3 A;  4JI3 E;  2YU5 A;  1XMQ E;  2F8B A;  2FV4 B;  4F6M A;  5DNY A;  4TUG A;  2R76 A;  1PJQ A;  1N32 E;  1N36 E;  2L92 A;  1LLM C;  1YZ9 A;  2H36 X;  2UUA E;  1ZR9 A;  2DSY A;  4B3M E;  1BBG A;  2UUB E;  3OML A;  2EMA A;  4X64 E;  2LJH A;  4R2D A;  2EPP A;  1PJT A;  2EOS A;  4WXD A;  2G7H A;  2V86 A;  2EPO A;  5AE1 A;  2V87 A;  4DMI A;  4LF9 E;  1TN9 A;  2DGC A;  1X6H A;  1STU A;  2BB8 A;  5AE2 A;  4JI0 E;  2NAB A;  2YTO A;  3AUZ A;  2LCE A; 
#chains in the Genus database with same CATH homology
 2V89 A;  3J81 C;  1XMO E;  4P7D A;  4M30 A;  5F3W A;  2KHX A;  4X65 E;  2L6M A;  1YYK A;  2NUE A;  2CPN A;  2VQF E;  3K6Q A;  1ZBT A;  4B3T E;  2FGG A;  3T1H E;  1FJG E;  4DR7 E;  2L3J A;  4LF8 E;  4LTY A;  3OTO E;  1FKA E;  4JI5 E;  4M2Z A;  2ZM6 E;  1SR9 A;  3F6H A;  1T4N A;  3JU0 A;  1X47 A;  2RSM A;  4BCA A;  3FIG A;  5LMN E;  4LFB E;  2LUP B;  1HNZ E;  1UHZ A;  2RS7 A;  3P1X A;  2B3T B;  2N3H A;  2UXB E;  4F54 A;  2YT4 A;  3H09 A;  5BR8 E;  4F9A B;  5ADZ A;  1HNX E;  3ADG A;  2B7V A;  4DV4 E;  4LFA E;  2JY9 A;  2UXC E;  1WHQ A;  3C4B A;  2FTX B;  4LF7 E;  3VYX A;  3ZOQ B;  2DMY A;  4BC9 A;  2VQE E;  2HHH E;  1RQ0 A;  3ADJ A;  3ADI A;  4KZS A;  1DQ3 A;  1ZBQ A;  2DIX A;  3J80 C;  4GKK E;  4BMJ A;  4B3R E;  2ODR D;  4M0V A;  4DUY E;  1XNR E;  1T4O A;  3C4T A;  4L5N C;  4JI8 E;  3HQ1 A;  4LF5 E;  2B9D A;  1UIL A;  2V85 A;  2ODR C;  4GEQ B;  4Q28 A;  1GQE A;  4JV5 E;  3DF6 A;  4X66 E;  1IBL E;  3JTZ A;  1EKZ A;  4K0K E;  4JI2 E;  1IBM E;  2KOU A;  3HPZ A;  1HR0 E;  4B3S E;  4X8W A;  4JYA E;  2LBS B;  2L8T A;  4LF4 E;  4F9B B;  2E5L E;  2KON A;  2NUG A;  1DI2 A;  4DV7 E;  3ADL A;  4L8N A;  3VK6 A;  3JAM C;  1XNQ E;  4NXM E;  4DV3 E;  2N3G A;  2L2N A;  3J7A G;  4YHH E;  2VE7 C;  4DR5 E;  5IT9 C;  2E1M A;  2L3C A;  3T1Y E;  2LTR A;  2MDR A;  1YYO A;  2L2M A;  2MC6 A;  3IWC A;  2WZO A;  3IWD A;  4LFC E;  4WFT A;  2V88 A;  1RC7 A;  1X49 A;  2LE2 A;  4LU9 A;  5AAS A;  4X62 E;  5FLX C;  4R03 A;  2UU9 E;  3VYY A;  2NUF A;  4I8O A;  4WYQ B;  2EZ6 A;  3KWR A;  3LML A;  1N33 E;  1YYW A;  2JOB A;  3F6G A;  1IBK E;  4JI6 E;  2F4V E;  4BBY A;  2RS6 A;  4KHP E;  1J26 A;  2UXD E;  2LRS A;  4JI3 E;  2B7T A;  2M4I A;  1I94 E;  2EWL A;  4DR2 E;  1XMQ E;  4DV0 E;  2F8B A;  2FV4 B;  3RMP A;  2DB2 A;  4WPY A;  5DNY A;  4JI1 E;  4TUG A;  2V83 A;  5AE3 A;  1N32 E;  4YY3 E;  2L92 A;  5LL6 R;  1N36 E;  4BC7 A;  2M1S A;  4DV2 E;  1O0W A;  3DJW A;  3LLH A;  3HPS A;  4R8O A;  4GKJ E;  1PKP A;  1QU6 A;  4DR6 E;  2RTX A;  4WSP A;  5LMU E;  1YZ9 A;  2V8Q B;  2H36 X;  4BS9 A;  1GZ6 A;  4DUZ E;  2UUA E;  4JI4 E;  4TUI A;  4P78 A;  2JWO A;  5IWA E;  2DSY A;  4NXN E;  4F9C B;  4DR3 E;  2UUB E;  4B3M E;  3OML A;  2IHR 1;  3IWB A;  4X64 E;  2UUC E;  2JVA A;  2LJH A;  2YZT A;  2LUQ A;  1T4L B;  2G7H A;  4DV5 E;  3HTX A;  4DV6 E;  2V86 A;  2VF1 A;  4DKK A;  3J7Y p;  2L2K B;  1WXR A;  4DV1 E;  5AE1 A;  2V87 A;  3MSW A;  4DMI A;  1WHN A;  4LF9 E;  4J8Z A;  4OX9 E;  2K4V A;  1N34 E;  2JR1 A;  3AV0 A;  4OOG C;  4DR1 E;  4LF6 E;  4DR4 E;  1STU A;  2MC5 A;  2LTS A;  2M7Q A;  3HXL A;  1X48 A;  4JI7 E;  5AE2 A;  5CFF E;  4JI0 E;  4AQY E;  1HNW E;  1J5E E;  3AUZ A;  2NA2 A;  2LMZ A;  2JOX A;  2L33 A;  5T6J A;  5A2Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...