2M7QA

Solution structure of tax1bp1 ubz1+2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
GPHMDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Tax1-binding protein 1
publication title The Structure of Tax1bp1 Ubz1+2 Provides Insight into Target Specificity and Adaptability
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18112 Zn-C2H2_12 Autophagy receptor zinc finger-C2H2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.550 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2m7qA00
2M7QA 5AASA 4BMJA
chains in the Genus database with same CATH superfamily
2V8QB 4WX9A 4GKKE 4NHRA 2EOMA 3J7AG 4R2RA 3MHHC 2CSHA 4M0VA 4K0KE 1LLMC 2WBTA 1T39A 1QNTA 1UBDC 2EPZA 2EMYA 2DSYA 2JWOA 4BCAA 2GPIA 5ADZA 2YWQA 1J26A 2F8BA 3T1YE 4Q28A 2RS7A 5IXMB 1IBLE 2E1MA 5KL5A 2DMIA 1PKPA 3IWBA 3IWCA 4KZSA 2N8XA 2EL4A 2EOQA 1HNWE 2LTRA 5IWAE 2YRKA 2K4VA 4BC7A 5A69A 3BF2A 2EOIA 2EPNA 4OOGC 4JI5E 4JI0E 2R1FA 5LMUE 2DMYA 1A1IA 5LMNE 2MKNA 3EPHA 3K6QA 3M99B 1EH6A 1YZ9A 2EPCA 3C4TA 4JI3E 4WXDA 2EMKA 3HPZA 2ENCA 4DR6E 4JI7E 2K7IA 5AC5A 2EPOA 1HR0E 3HPSA 4LF4E 2DRPA 4JI6E 3THNA 4JV5E 4R2CA 2FTXB 1PJQA 2EE8A 2CPNA 1T4LB 1MEYC 2UXBE 1HNXE 2EN8A 2BB8A 2DIXA 5AE1A 2RPCA 4NXNE 3MHSC 4YY3E 3ADGA 3T1HE 3KZZA 1DI2A 3ADLA 1UHZA 4P78A 2YT4A 4JYAE 2RTXA 3ADIA 1UN6B 2LCEA 1IBKE 2BBGA 4BHCA 2YTIA 2V89A 2YTEA 4I8OA 3DF6A 1RC7A 1DQ3A 3C4BA 3C6MA 4RHBB 3J80C 2EWLA 1PJSA 3HXLA 2RSMA 1X6HA 5CFFE 1T38A 1YUIA 4R2DA 3KZYA 1XNRE 4O24A 2EM0A 4IS1C 5LLQA 1B69A 2DLQA 2EPKX 4LFCE 2EQ1A 2EM7A 2MKDA 4DKKA 1A1FA 4F9CB 1IBME 3EPJA 1IQOA 4WXCA 3OTOE 2V88A 3DJWA 3HQ1A 2L6MA 4O4KA 4X62E 1BBOA 1AH5A 2YTQA 2M7QA 4DR3E 2LVHA 4WSGA 4DV4E 5DNYA 2UU9E 4JI2E 4X9JA 4R8OA 2B7TA 2KOUA 2UUBE 4MLVA 1P47A 1QU6A 4DV0E 1BBGA 2L33A 2B3TB 2UXDE 2EOJA 2DLKA 1EH7A 2EPLX 2YTGA 5KL3A 2ZM6E 2CTDA 1RMDA 4BMJA 1WXRA 2ENAA 2N3HA 2FGGA 4DR7E 1KYQA 5KL4A 4BBYA 3JTZA 4RH8A 4R2SA 2E72A 2EQ3A 2ELYA 3BBGA 4R2EA 3UK3C 1G2DC 4ZYGA 1A1GA 1SFEA 5A6BA 2EN2A 2IHR1 2EN7A 2LTSA 4O5GA 2F4VE 2V87A 2EN3A 1XNQE 1Z1BA 4F6MA 1YFHA 1AAYA 2JY9A 5A6KA 5TSEA 3F6GA 2EL5A 4GEQB 1A1LA 4O43A 1ZR9A 4M30A 1X3CA 2EM3A 2EM9A 2N3GA 2VF1A 2EJ4A 3HTXA 2I13A 2JXPA 2L2MA 2EOOA 4WPYA 2VE7C 5BR8E 3FIGA 5A6JA 2ADRA 4TUIA 2EP3A 1FJGE 4GKJE 1WRJA 2GLIA 5AE3A 2E5LE 4LFAE 1SR9A 1ZU1A 4N4RB 4ZYDA 3VHTB 1A1HA 2EOYA 2EOXA 3P1XA 3LMLA 2MDRA 4KHPE 2EQ0A 5LL6R 2NABA 4L8NA 5FLXC 2EMWA 4DV3E 2DB2A 1ZAAC 2JVAA 2L2NA 4JI1E 4LF8E 3H09A 3J81C 1NEIA 1STUA 2YTNA 1TF3A 3JAMC 4DV5E 3LLHA 1X6EA 4DUZE 2L8TA 2NA2A 2L2KB 2I9IA 5IT9C 1N36E 5A2QC 2LUQA 4NXME 2HC5A 3L00A 1X49A 1TF6A 2EL6A 2EPAA 5KL2A 2PRTA 2UUCE 1JK2A 4OX9E 2YTOA 1YSAC 2EOSA 2EM4A 2EOFA 2B9DA 1WHNA 4B3TE 4DUYE 2L92A 2EM5A 2ODRD 1GQEA 4J8ZA 4R03A 4DR5E 4F9AB 4R2PA 2EM2A 2LE2A 1GTKA 5A6AA 2YPNA 2JOBA 2G7HA 4TUGA 2YRHA 2VRDA 5KL6A 4HTGA 2B7VA 2EPXA 4KWYA 4DR4E 3VYYA 2YTJA 3IWDA 2ELZA 1X5WA 3RMPA 1PDAA 4GZNC 1BB8A 1WHQA 2EMHA 2YZTA 3JU0A 1J5EE 1EKZA 2EOEA 2LJHA 2YTFA 5T6JA 4DV1E 2A25A 4DV2E 4ZYHA 4X8WA 2EOZA 2LO3A 2M4IA 1PJTA 2EPMX 3BGHA 3F6HA 2RQLA 2UXCE 4BC9A 4X65E 4M2ZA 2Q8UA 1IQSA 2WBSA 3AV0A 1NCSA 4LU9A 4F2JC 4AQYE 2EMLA 1N34E 2M1SA 4R2AA 3EPLA 2JP9A 2EN6A 1EH8A 4BS9A 3VYXA 4B3RE 1A1KA 2YU8A 2NUGA 1YUJA 2EPUA 2EM6A 1MGTA 1XMQE 2EM8A 2V85A 3ADJA 2L3CA 2LUPB 4WYQB 1N33E 4L5NC 1XMOE 2JPAA 3KWRA 2EMXA 2DGCA 4F54A 3TQMA 5AASA 4DR1E 2EMCA 4JI4E 2JOXA 1O0WA 5KL7A 2ODRC 1ZBTA 5F3WA 4B3ME 1HNZE 5AC4A 2EMZA 2EN4A 4LF7E 2J7JA 4LFBE 2JYAA 2YSOA 2HGHA 2LMZA 2EMGA 2EPRA 2YU5A 1ZBQA 2ENHA 1X47A 2D9HA 4WSPA 2CT1A 2H36X 4WFTA 4ZYEA 3C6KA 1IMUA 1TN9A 2NUFA 2LV2A 2YSPA 4F9BB 1DGCA 4F6NA 2NUEA 3OMLA 4LF6E 4M9VC 2RSIA 4DV7E 2EMAA 1FKAE 3EQ1A 2EORA 2LT7A 1N32E 2EPPA 1WJPA 2YTDA 1T4OA 2L3JA 2UUAE 1L4SA 3ZOQB 2R76A 3QG5C 5IV8B 2YTPA 4Q35B 4MLQA 1X48A 2LRSA 2EOHA 2EN1A 4DR2E 2EMBA 4JI8E 2WCC3 1UILA 2HHHE 2M9AA 3MSWA 2EMFA 2RS6A 2HJJA 2VQFE 2GHFA 2YRMA 4LF5E 2WZOA 2LBSB 1KJKA 1A1JA 4LF9E 2MC5A 2KONA 4IJDA 2LJUA 4DV6E 1YYWA 1RQ0A 4R2QA 4BHBA 4NZVA 3BIDA 2V83A 2EMIA 2V86A 2WBUA 5AE2A 1YPNA 4X64E 3THOB 1F2IG 4HEIA 2MC6A 4YHHE 2MDGA 1YYOA 4P7DA 3EPKA 1G2FC 1N3GA 2VQEE 3ECRA 4X66E 4LTYA 1X6FA 4FK5C 4DMIA 2EZ6A 4B3SE 5A6BD 2KHXA 3J7Yp 1T4NA 1GZ6A 3AUZA 1YYKA 3VK6A 1JK1A 1I94E 2JR1A 2FV4B
chains in the Genus database with same CATH topology
4F54A 4LFCE 1STUA 2V8QB 3JAMC 5AASA 4DV5E 4DR1E 4JI4E 2JOXA 3LLHA 4DUZE 4DKKA 4GKKE 4F9CB 1IBME 1O0WA 2L8TA 3J7AG 2ODRC 3OTOE 2NA2A 2V88A 2L2KB 3DJWA 3HQ1A 1ZBTA 2L6MA 4M0VA 5IT9C 5F3WA 1N36E 4B3ME 4K0KE 1HNZE 4X62E 5A2QC 2LUQA 2M7QA 4LF7E 4NXME 4DR3E 2DSYA 2JWOA 4BCAA 4LFBE 5ADZA 1J26A 4DV4E 1X49A 5DNYA 2F8BA 2UU9E 3T1YE 4JI2E 2LMZA 4Q28A 4R8OA 2RS7A 1ZBQA 1IBLE 2B7TA 2UUCE 2KOUA 2E1MA 4OX9E 1X47A 2UUBE 1PKPA 4WSPA 3IWBA 1QU6A 3IWCA 4KZSA 4DV0E 4WFTA 2H36X 1HNWE 2B9DA 1WHNA 2LTRA 5IWAE 4DUYE 2L33A 4B3TE 2B3TB 2K4VA 2L92A 4BC7A 2NUFA 4F9BB 2UXDE 2ODRD 2NUEA 1GQEA 3OMLA 4OOGC 4LF6E 4J8ZA 4R03A 4DR5E 4JI5E 4JI0E 4F9AB 2LE2A 4DV7E 2ZM6E 4BMJA 1WXRA 1FKAE 5LMUE 1N32E 2DMYA 2JOBA 2G7HA 5LMNE 2N3HA 3K6QA 2FGGA 1T4OA 4DR7E 4TUGA 4BBYA 2L3JA 3JTZA 2UUAE 1YZ9A 3ZOQB 3C4TA 2B7VA 4JI3E 4DR4E 3VYYA 1X48A 2LRSA 3HPZA 3IWDA 4JI1E 3RMPA 4DR2E 4JI7E 4JI8E 4DR6E 1UILA 2HHHE 3MSWA 1WHQA 3HPSA 1J5EE 2YZTA 3JU0A 2IHR1 1EKZA 1HR0E 4LF4E 2LTSA 2RS6A 2LJHA 5T6JA 4JI6E 2F4VE 2V87A 4JV5E 1XNQE 2FTXB 4DV1E 2VQFE 4DV2E 1T4LB 2CPNA 4X8WA 2UXBE 2M4IA 1HNXE 2JY9A 3F6HA 4LF5E 2DIXA 5AE1A 2WZOA 2LBSB 3F6GA 2UXCE 4LF9E 4BC9A 4X65E 4M2ZA 4NXNE 2MC5A 2KONA 4GEQB 4YY3E 3ADGA 3T1HE 4DV6E 1YYWA 1DI2A 3ADLA 1UHZA 4M30A 1RQ0A 3AV0A 2YT4A 4LU9A 4P78A 4JYAE 2RTXA 3ADIA 4AQYE 1IBKE 1N34E 2N3GA 2M1SA 2V83A 2VF1A 3HTXA 2V89A 2V86A 2L2MA 5AE2A 4I8OA 4WPYA 2VE7C 3DF6A 5BR8E 4X64E 1RC7A 4BS9A 3FIGA 2MC6A 1DQ3A 4YHHE 3C4BA 4TUIA 1YYOA 1FJGE 3VYXA 3J80C 4B3RE 4GKJE 4P7DA 2NUGA 2EWLA 2VQEE 5AE3A 1XMQE 3HXLA 4X66E 2E5LE 4LFAE 1SR9A 2V85A 4LTYA 2RSMA 5CFFE 3P1XA 4DMIA 3ADJA 3LMLA 2MDRA 2L3CA 4B3SE 1XNRE 2EZ6A 4KHPE 2KHXA 2LUPB 5LL6R 4WYQB 3J7Yp 1N33E 4L8NA 5FLXC 4L5NC 1T4NA 1GZ6A 1XMOE 3AUZA 2DB2A 4DV3E 1YYKA 3VK6A 1I94E 2JVAA 2L2NA 3KWRA 2JR1A 2FV4B 4LF8E 3H09A 3J81C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M7Q A;  5AAS A;  4BMJ A; 
#chains in the Genus database with same CATH topology
 2V8Q B;  4WX9 A;  4GKK E;  4NHR A;  2EOM A;  3J7A G;  4R2R A;  3MHH C;  2CSH A;  4M0V A;  4K0K E;  1LLM C;  2WBT A;  1T39 A;  1QNT A;  1UBD C;  2EPZ A;  2EMY A;  2DSY A;  2JWO A;  4BCA A;  2GPI A;  5ADZ A;  2YWQ A;  1J26 A;  2F8B A;  3T1Y E;  4Q28 A;  2RS7 A;  5IXM B;  1IBL E;  2E1M A;  5KL5 A;  2DMI A;  1PKP A;  3IWB A;  3IWC A;  4KZS A;  2N8X A;  2EL4 A;  2EOQ A;  1HNW E;  2LTR A;  5IWA E;  2YRK A;  2K4V A;  4BC7 A;  5A69 A;  3BF2 A;  2EOI A;  2EPN A;  4OOG C;  4JI5 E;  4JI0 E;  2R1F A;  5LMU E;  2DMY A;  1A1I A;  5LMN E;  2MKN A;  3EPH A;  3K6Q A;  3M99 B;  1EH6 A;  1YZ9 A;  2EPC A;  3C4T A;  4JI3 E;  4WXD A;  2EMK A;  3HPZ A;  2ENC A;  4DR6 E;  4JI7 E;  2K7I A;  5AC5 A;  2EPO A;  1HR0 E;  3HPS A;  4LF4 E;  2DRP A;  4JI6 E;  3THN A;  4JV5 E;  4R2C A;  2FTX B;  1PJQ A;  2EE8 A;  2CPN A;  1T4L B;  1MEY C;  2UXB E;  1HNX E;  2EN8 A;  2BB8 A;  2DIX A;  5AE1 A;  2RPC A;  4NXN E;  3MHS C;  4YY3 E;  3ADG A;  3T1H E;  3KZZ A;  1DI2 A;  3ADL A;  1UHZ A;  4P78 A;  2YT4 A;  4JYA E;  2RTX A;  3ADI A;  1UN6 B;  2LCE A;  1IBK E;  2BBG A;  4BHC A;  2YTI A;  2V89 A;  2YTE A;  4I8O A;  3DF6 A;  1RC7 A;  1DQ3 A;  3C4B A;  3C6M A;  4RHB B;  3J80 C;  2EWL A;  1PJS A;  3HXL A;  2RSM A;  1X6H A;  5CFF E;  1T38 A;  1YUI A;  4R2D A;  3KZY A;  1XNR E;  4O24 A;  2EM0 A;  4IS1 C;  5LLQ A;  1B69 A;  2DLQ A;  2EPK X;  4LFC E;  2EQ1 A;  2EM7 A;  2MKD A;  4DKK A;  1A1F A;  4F9C B;  1IBM E;  3EPJ A;  1IQO A;  4WXC A;  3OTO E;  2V88 A;  3DJW A;  3HQ1 A;  2L6M A;  4O4K A;  4X62 E;  1BBO A;  1AH5 A;  2YTQ A;  2M7Q A;  4DR3 E;  2LVH A;  4WSG A;  4DV4 E;  5DNY A;  2UU9 E;  4JI2 E;  4X9J A;  4R8O A;  2B7T A;  2KOU A;  2UUB E;  4MLV A;  1P47 A;  1QU6 A;  4DV0 E;  1BBG A;  2L33 A;  2B3T B;  2UXD E;  2EOJ A;  2DLK A;  1EH7 A;  2EPL X;  2YTG A;  5KL3 A;  2ZM6 E;  2CTD A;  1RMD A;  4BMJ A;  1WXR A;  2ENA A;  2N3H A;  2FGG A;  4DR7 E;  1KYQ A;  5KL4 A;  4BBY A;  3JTZ A;  4RH8 A;  4R2S A;  2E72 A;  2EQ3 A;  2ELY A;  3BBG A;  4R2E A;  3UK3 C;  1G2D C;  4ZYG A;  1A1G A;  1SFE A;  5A6B A;  2EN2 A;  2IHR 1;  2EN7 A;  2LTS A;  4O5G A;  2F4V E;  2V87 A;  2EN3 A;  1XNQ E;  1Z1B A;  4F6M A;  1YFH A;  1AAY A;  2JY9 A;  5A6K A;  5TSE A;  3F6G A;  2EL5 A;  4GEQ B;  1A1L A;  4O43 A;  1ZR9 A;  4M30 A;  1X3C A;  2EM3 A;  2EM9 A;  2N3G A;  2VF1 A;  2EJ4 A;  3HTX A;  2I13 A;  2JXP A;  2L2M A;  2EOO A;  4WPY A;  2VE7 C;  5BR8 E;  3FIG A;  5A6J A;  2ADR A;  4TUI A;  2EP3 A;  1FJG E;  4GKJ E;  1WRJ A;  2GLI A;  5AE3 A;  2E5L E;  4LFA E;  1SR9 A;  1ZU1 A;  4N4R B;  4ZYD A;  3VHT B;  1A1H A;  2EOY A;  2EOX A;  3P1X A;  3LML A;  2MDR A;  4KHP E;  2EQ0 A;  5LL6 R;  2NAB A;  4L8N A;  5FLX C;  2EMW A;  4DV3 E;  2DB2 A;  1ZAA C;  2JVA A;  2L2N A;  4JI1 E;  4LF8 E;  3H09 A;  3J81 C;  1NEI A;  1STU A;  2YTN A;  1TF3 A;  3JAM C;  4DV5 E;  3LLH A;  1X6E A;  4DUZ E;  2L8T A;  2NA2 A;  2L2K B;  2I9I A;  5IT9 C;  1N36 E;  5A2Q C;  2LUQ A;  4NXM E;  2HC5 A;  3L00 A;  1X49 A;  1TF6 A;  2EL6 A;  2EPA A;  5KL2 A;  2PRT A;  2UUC E;  1JK2 A;  4OX9 E;  2YTO A;  1YSA C;  2EOS A;  2EM4 A;  2EOF A;  2B9D A;  1WHN A;  4B3T E;  4DUY E;  2L92 A;  2EM5 A;  2ODR D;  1GQE A;  4J8Z A;  4R03 A;  4DR5 E;  4F9A B;  4R2P A;  2EM2 A;  2LE2 A;  1GTK A;  5A6A A;  2YPN A;  2JOB A;  2G7H A;  4TUG A;  2YRH A;  2VRD A;  5KL6 A;  4HTG A;  2B7V A;  2EPX A;  4KWY A;  4DR4 E;  3VYY A;  2YTJ A;  3IWD A;  2ELZ A;  1X5W A;  3RMP A;  1PDA A;  4GZN C;  1BB8 A;  1WHQ A;  2EMH A;  2YZT A;  3JU0 A;  1J5E E;  1EKZ A;  2EOE A;  2LJH A;  2YTF A;  5T6J A;  4DV1 E;  2A25 A;  4DV2 E;  4ZYH A;  4X8W A;  2EOZ A;  2LO3 A;  2M4I A;  1PJT A;  2EPM X;  3BGH A;  3F6H A;  2RQL A;  2UXC E;  4BC9 A;  4X65 E;  4M2Z A;  2Q8U A;  1IQS A;  2WBS A;  3AV0 A;  1NCS A;  4LU9 A;  4F2J C;  4AQY E;  2EML A;  1N34 E;  2M1S A;  4R2A A;  3EPL A;  2JP9 A;  2EN6 A;  1EH8 A;  4BS9 A;  3VYX A;  4B3R E;  1A1K A;  2YU8 A;  2NUG A;  1YUJ A;  2EPU A;  2EM6 A;  1MGT A;  1XMQ E;  2EM8 A;  2V85 A;  3ADJ A;  2L3C A;  2LUP B;  4WYQ B;  1N33 E;  4L5N C;  1XMO E;  2JPA A;  3KWR A;  2EMX A;  2DGC A;  4F54 A;  3TQM A;  5AAS A;  4DR1 E;  2EMC A;  4JI4 E;  2JOX A;  1O0W A;  5KL7 A;  2ODR C;  1ZBT A;  5F3W A;  4B3M E;  1HNZ E;  5AC4 A;  2EMZ A;  2EN4 A;  4LF7 E;  2J7J A;  4LFB E;  2JYA A;  2YSO A;  2HGH A;  2LMZ A;  2EMG A;  2EPR A;  2YU5 A;  1ZBQ A;  2ENH A;  1X47 A;  2D9H A;  4WSP A;  2CT1 A;  2H36 X;  4WFT A;  4ZYE A;  3C6K A;  1IMU A;  1TN9 A;  2NUF A;  2LV2 A;  2YSP A;  4F9B B;  1DGC A;  4F6N A;  2NUE A;  3OML A;  4LF6 E;  4M9V C;  2RSI A;  4DV7 E;  2EMA A;  1FKA E;  3EQ1 A;  2EOR A;  2LT7 A;  1N32 E;  2EPP A;  1WJP A;  2YTD A;  1T4O A;  2L3J A;  2UUA E;  1L4S A;  3ZOQ B;  2R76 A;  3QG5 C;  5IV8 B;  2YTP A;  4Q35 B;  4MLQ A;  1X48 A;  2LRS A;  2EOH A;  2EN1 A;  4DR2 E;  2EMB A;  4JI8 E;  2WCC 3;  1UIL A;  2HHH E;  2M9A A;  3MSW A;  2EMF A;  2RS6 A;  2HJJ A;  2VQF E;  2GHF A;  2YRM A;  4LF5 E;  2WZO A;  2LBS B;  1KJK A;  1A1J A;  4LF9 E;  2MC5 A;  2KON A;  4IJD A;  2LJU A;  4DV6 E;  1YYW A;  1RQ0 A;  4R2Q A;  4BHB A;  4NZV A;  3BID A;  2V83 A;  2EMI A;  2V86 A;  2WBU A;  5AE2 A;  1YPN A;  4X64 E;  3THO B;  1F2I G;  4HEI A;  2MC6 A;  4YHH E;  2MDG A;  1YYO A;  4P7D A;  3EPK A;  1G2F C;  1N3G A;  2VQE E;  3ECR A;  4X66 E;  4LTY A;  1X6F A;  4FK5 C;  4DMI A;  2EZ6 A;  4B3S E;  5A6B D;  2KHX A;  3J7Y p;  1T4N A;  1GZ6 A;  3AUZ A;  1YYK A;  3VK6 A;  1JK1 A;  1I94 E;  2JR1 A;  2FV4 B; 
#chains in the Genus database with same CATH homology
 4F54 A;  4LFC E;  1STU A;  2V8Q B;  3JAM C;  5AAS A;  4DV5 E;  4DR1 E;  4JI4 E;  2JOX A;  3LLH A;  4DUZ E;  4DKK A;  4GKK E;  4F9C B;  1IBM E;  1O0W A;  2L8T A;  3J7A G;  2ODR C;  3OTO E;  2NA2 A;  2V88 A;  2L2K B;  3DJW A;  3HQ1 A;  1ZBT A;  2L6M A;  4M0V A;  5IT9 C;  5F3W A;  1N36 E;  4B3M E;  4K0K E;  1HNZ E;  4X62 E;  5A2Q C;  2LUQ A;  2M7Q A;  4LF7 E;  4NXM E;  4DR3 E;  2DSY A;  2JWO A;  4BCA A;  4LFB E;  5ADZ A;  1J26 A;  4DV4 E;  1X49 A;  5DNY A;  2F8B A;  2UU9 E;  3T1Y E;  4JI2 E;  2LMZ A;  4Q28 A;  4R8O A;  2RS7 A;  1ZBQ A;  1IBL E;  2B7T A;  2UUC E;  2KOU A;  2E1M A;  4OX9 E;  1X47 A;  2UUB E;  1PKP A;  4WSP A;  3IWB A;  1QU6 A;  3IWC A;  4KZS A;  4DV0 E;  4WFT A;  2H36 X;  1HNW E;  2B9D A;  1WHN A;  2LTR A;  5IWA E;  4DUY E;  2L33 A;  4B3T E;  2B3T B;  2K4V A;  2L92 A;  4BC7 A;  2NUF A;  4F9B B;  2UXD E;  2ODR D;  2NUE A;  1GQE A;  3OML A;  4OOG C;  4LF6 E;  4J8Z A;  4R03 A;  4DR5 E;  4JI5 E;  4JI0 E;  4F9A B;  2LE2 A;  4DV7 E;  2ZM6 E;  4BMJ A;  1WXR A;  1FKA E;  5LMU E;  1N32 E;  2DMY A;  2JOB A;  2G7H A;  5LMN E;  2N3H A;  3K6Q A;  2FGG A;  1T4O A;  4DR7 E;  4TUG A;  4BBY A;  2L3J A;  3JTZ A;  2UUA E;  1YZ9 A;  3ZOQ B;  3C4T A;  2B7V A;  4JI3 E;  4DR4 E;  3VYY A;  1X48 A;  2LRS A;  3HPZ A;  3IWD A;  4JI1 E;  3RMP A;  4DR2 E;  4JI7 E;  4JI8 E;  4DR6 E;  1UIL A;  2HHH E;  3MSW A;  1WHQ A;  3HPS A;  1J5E E;  2YZT A;  3JU0 A;  2IHR 1;  1EKZ A;  1HR0 E;  4LF4 E;  2LTS A;  2RS6 A;  2LJH A;  5T6J A;  4JI6 E;  2F4V E;  2V87 A;  4JV5 E;  1XNQ E;  2FTX B;  4DV1 E;  2VQF E;  4DV2 E;  1T4L B;  2CPN A;  4X8W A;  2UXB E;  2M4I A;  1HNX E;  2JY9 A;  3F6H A;  4LF5 E;  2DIX A;  5AE1 A;  2WZO A;  2LBS B;  3F6G A;  2UXC E;  4LF9 E;  4BC9 A;  4X65 E;  4M2Z A;  4NXN E;  2MC5 A;  2KON A;  4GEQ B;  4YY3 E;  3ADG A;  3T1H E;  4DV6 E;  1YYW A;  1DI2 A;  3ADL A;  1UHZ A;  4M30 A;  1RQ0 A;  3AV0 A;  2YT4 A;  4LU9 A;  4P78 A;  4JYA E;  2RTX A;  3ADI A;  4AQY E;  1IBK E;  1N34 E;  2N3G A;  2M1S A;  2V83 A;  2VF1 A;  3HTX A;  2V89 A;  2V86 A;  2L2M A;  5AE2 A;  4I8O A;  4WPY A;  2VE7 C;  3DF6 A;  5BR8 E;  4X64 E;  1RC7 A;  4BS9 A;  3FIG A;  2MC6 A;  1DQ3 A;  4YHH E;  3C4B A;  4TUI A;  1YYO A;  1FJG E;  3VYX A;  3J80 C;  4B3R E;  4GKJ E;  4P7D A;  2NUG A;  2EWL A;  2VQE E;  5AE3 A;  1XMQ E;  3HXL A;  4X66 E;  2E5L E;  4LFA E;  1SR9 A;  2V85 A;  4LTY A;  2RSM A;  5CFF E;  3P1X A;  4DMI A;  3ADJ A;  3LML A;  2MDR A;  2L3C A;  4B3S E;  1XNR E;  2EZ6 A;  4KHP E;  2KHX A;  2LUP B;  5LL6 R;  4WYQ B;  3J7Y p;  1N33 E;  4L8N A;  5FLX C;  4L5N C;  1T4N A;  1GZ6 A;  1XMO E;  3AUZ A;  2DB2 A;  4DV3 E;  1YYK A;  3VK6 A;  1I94 E;  2JVA A;  2L2N A;  3KWR A;  2JR1 A;  2FV4 B;  4LF8 E;  3H09 A;  3J81 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...