2M7QA

Solution structure of tax1bp1 ubz1+2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
GPHMDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tax1-binding protein 1
publication title The Structure of Tax1bp1 Ubz1+2 Provides Insight into Target Specificity and Adaptability
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 20
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18112 Zn-C2H2_12 Autophagy receptor zinc finger-C2H2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.550 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2m7qA00
2M7QA 4BMJA 5AASA
chains in the Genus database with same CATH superfamily
2IHR1 1WXRA 4J8ZA 4R8OA 1WJPA 2YTJA 3J80C 2CSHA 2NUGA 2WCC3 4WXDA 4DR6E 1O0WA 4BBYA 2FGGA 2DMYA 4ZYEA 2EPXA 2EM3A 2MKDA 2FV4B 3MHSC 4JYAE 1Z1BA 2BB8A 1TF3A 4M30A 4X65E 4RH8A 4L5NC 4GEQB 1YYOA 4WXCA 2RSMA 3L00A 5IWAE 1P47A 2HGHA 1J26A 3EQ1A 2RSIA 3F6GA 1ZBTA 1QU6A 1PJSA 4IJDA 2NUFA 4JV5E 1SR9A 4LF8E 1GZ6A 2YTFA 3H09A 4X64E 1GQEA 2FTXB 1TN9A 4JI3E 1A1LA 2EE8A 2JP9A 4LFBE 4BC7A 1HNZE 2EMZA 2M7QA 5IV8B 2GPIA 2L92A 2ENAA 3IWCA 3HQ1A 1WHNA 2L2KB 2L8TA 4GKKE 4HEIA 2EOSA 2LJUA 1X48A 3BF2A 2LT7A 4GZNC 3T1YE 2PRTA 1ZAAC 4R2EA 1T4OA 5CFFE 1YFHA 2EN1A 1RQ0A 1ZU1A 4AQYE 2YU8A 2GHFA 1A1FA 4DV1E 3C4BA 2EP3A 1PJQA 1PKPA 1YZ9A 5LLQA 2EOFA 3OMLA 3T1HE 4N4RB 2LMZA 2B3TB 1RMDA 2EN2A 2EMYA 3THOB 1N32E 2EL6A 5A2QC 1X49A 2EMKA 5KL4A 3FIGA 2RPCA 2UXCE 2EM4A 1X5WA 3ZOQB 3RMPA 4ZYDA 1EKZA 1A1KA 2UUAE 2L6MA 2EORA 2DMIA 3MHHC 5F3WA 2V86A 2EPUA 2WBTA 4DR3E 4R2DA 2YTEA 2MDGA 1ZR9A 2YSPA 2A25A 2MC6A 1X6FA 1UILA 4LF7E 4F9AB 3ADIA 2VRDA 2NA2A 1YYKA 3ADLA 4Q28A 2YTPA 3DF6A 3IWDA 4DV5E 4OX9E 2ELZA 2JOBA 2V88A 4DUYE 1BB8A 2EOQA 4GKJE 1EH8A 5KL7A 4X66E 2UUBE 2JXPA 2KONA 2RS7A 1DQ3A 5A6AA 3JU0A 1T38A 2EPRA 1IBLE 4KHPE 2EMXA 2EM5A 4K0KE 2DB2A 1IBME 4JI8E 4LF6E 1NEIA 4WX9A 2EL5A 2B7VA 2EPOA 4O5GA 2EN6A 4I8OA 2YRHA 2LJHA 4WPYA 4YHHE 2EOMA 4BC9A 3AUZA 2EM6A 4DUZE 1TF6A 4DR4E 2EPNA 3J81C 2EM8A 1GTKA 2RQLA 2CPNA 4F9BB 5KL3A 4IS1C 4JI4E 1AH5A 2EMWA 1KJKA 5KL6A 2G7HA 2K7IA 2JOXA 2EPMX 1PJTA 1STUA 2ENCA 2CT1A 2LRSA 1EH6A 2EN8A 2E5LE 1I94E 3HPSA 5A6BA 4DR5E 3KWRA 3HTXA 2DRPA 3VHTB 2V89A 2VE7C 2YRMA 3QG5C 2EOYA 4KZSA 2KHXA 5AC4A 1HNWE 3VK6A 4X62E 1WHQA 2YSOA 4BHCA 2ODRD 2V87A 4R2RA 4JI2E 2VQFE 3BIDA 2MC5A 1N34E 3TQMA 1B69A 5DNYA 1X6EA 1A1JA 2EPCA 2UU9E 4O24A 5AC5A 2WBSA 4R2AA 2ZM6E 4M9VC 1G2DC 1N33E 4WSPA 2LCEA 2ENHA 3VYYA 3C6KA 2CTDA 5BR8E 5T6JA 2BBGA 2B7TA 5TSEA 2EPPA 1NCSA 4L8NA 2LO3A 4ZYGA 3P1XA 3KZYA 4DV7E 5A6BD 2EOOA 2EPZA 3C4TA 1MEYC 2YT4A 3IWBA 4LF4E 2EOHA 4DV2E 4DKKA 1IQSA 3LMLA 4FK5C 3JTZA 4WSGA 2EOIA 3OTOE 2EWLA 4JI0E 2V8QB 4DMIA 4DR2E 1T4LB 1XNQE 4KWYA 2V85A 4NXNE 3BBGA 2UXDE 3HXLA 1A1IA 2F8BA 2LUPB 2EQ0A 4F54A 2EQ3A 4OOGC 2M1SA 4ZYHA 3EPKA 4B3TE 4TUGA 4R2SA 5LMUE 1SFEA 2UXBE 4JI5E 2E1MA 2EMBA 2YWQA 2EOJA 4BCAA 2JR1A 1YUJA 4LFAE 2EMHA 2YU5A 3EPHA 4R2CA 4B3ME 5A69A 4DV3E 4NXME 2DSYA 3J7AG 1J5EE 1JK1A 3ECRA 2EPKX 3J7Yp 2EM0A 4R2PA 2DIXA 3C6MA 1A1HA 1UBDC 3EPJA 1YUIA 4NHRA 2LVHA 2D9HA 1X47A 2L2MA 4O43A 1HNXE 1XNRE 2JVAA 2V83A 2EMLA 3MSWA 4M0VA 4X8WA 5AE1A 1RC7A 4P7DA 3BGHA 1N36E 2NABA 2LUQA 4B3RE 2DLKA 4MLQA 2MKNA 4HTGA 4R03A 4X9JA 4LF9E 2WBUA 4P78A 2RS6A 2B9DA 2EN4A 1IBKE 4JI1E 5LMNE 4BS9A 2HHHE 1IQOA 3THNA 2DLQA 2L2NA 2R1FA 3JAMC 4LF5E 1WRJA 1A1GA 4YY3E 1QNTA 2YZTA 4RHBB 2VF1A 2EMAA 2EM9A 3M99B 1DGCA 1YYWA 2JY9A 2EMIA 4NZVA 1N3GA 2YRKA 1AAYA 2EM2A 4DV4E 2ODRC 2I9IA 1UHZA 2E72A 1EH7A 1X3CA 4JI6E 2YTDA 1ZBQA 4LFCE 2M9AA 2K4VA 3EPLA 2EMFA 1HR0E 2ADRA 4WYQB 1JK2A 2JYAA 5KL2A 1YPNA 2F4VE 5AASA 2LE2A 3K6QA 1BBOA 1XMOE 2JWOA 2EN3A 2EPLX 5KL5A 2YTGA 2HJJA 4F2JC 4O4KA 2VQEE 5A6KA 2N8XA 5FLXC 2ELYA 2EMCA 1T39A 2N3GA 2L33A 5AE3A 1G2FC 4B3SE 1KYQA 2L3JA 1L4SA 4BHBA 2WZOA 5IT9C 2KOUA 1F2IG 2LTSA 1PDAA 4M2ZA 4F9CB 2YTNA 1FJGE 2EN7A 2LV2A 2J7JA 2MDRA 3HPZA 4BMJA 2EOZA 2EMGA 4Q35B 2R76A 3AV0A 3KZZA 5LL6R 2H36X 2YTOA 5ADZA 2EOEA 2EQ1A 4DV0E 4DV6E 1BBGA 2EOXA 2YPNA 4F6MA 2EL4A 2EM7A 2DGCA 3DJWA 2HC5A 2YTQA 4F6NA 4MLVA 1DI2A 4DR7E 4TUIA 1T4NA 3F6HA 5AE2A 1YSAC 1MGTA 4LU9A 2UUCE 2N3HA 2NUEA 2YTIA 4DR1E 3ADGA 2I13A 5A6JA 2L3CA 1IMUA 5IXMB 3ADJA 4LTYA 1FKAE 2GLIA 4WFTA 3LLHA 1UN6B 4JI7E 2EPAA 2RTXA 1X6HA 4R2QA 3UK3C 2Q8UA 2EJ4A 1XMQE 2LTRA 1LLMC 3VYXA 2JPAA 2LBSB 2EZ6A 2M4IA
chains in the Genus database with same CATH topology
2IHR1 2B7TA 1WXRA 4J8ZA 4R8OA 2JY9A 1YYWA 2MC6A 3J80C 4L8NA 1UILA 2NUGA 3P1XA 4LF7E 4F9AB 4DV7E 3ADIA 2NA2A 1YYKA 4DV4E 2ODRC 3ADLA 4Q28A 3C4TA 1UHZA 3DF6A 3IWDA 4DV5E 4OX9E 4DR6E 1O0WA 2YT4A 3IWBA 2V88A 2JOBA 4BBYA 4LF4E 4DV2E 4DKKA 4JI6E 3LMLA 2FGGA 4DUYE 1ZBQA 2DMYA 3JTZA 4LFCE 2K4VA 3OTOE 4GKJE 2EWLA 4JI0E 2FV4B 1HR0E 2V8QB 4DMIA 4X66E 4DR2E 1T4LB 2UUBE 1XNQE 4JYAE 2KONA 2RS7A 4WYQB 2V85A 1DQ3A 4NXNE 3JU0A 4M30A 3HXLA 2UXDE 4X65E 2F8BA 4L5NC 1IBLE 4KHPE 2F4VE 2LUPB 4K0KE 2DB2A 1IBME 4GEQB 4JI8E 5AASA 2LE2A 3K6QA 1YYOA 4LF6E 2RSMA 1XMOE 2JWOA 5IWAE 1J26A 4F54A 2B7VA 4OOGC 2M1SA 2VQEE 4I8OA 3F6GA 1ZBTA 1QU6A 4TUGA 5FLXC 2NUFA 4B3TE 2LJHA 1SR9A 4WPYA 4JV5E 4YHHE 5LMUE 4LF8E 1GZ6A 3H09A 4BC9A 4X64E 1GQEA 2FTXB 2N3GA 2L33A 3AUZA 2E1MA 5AE3A 4DUZE 4JI3E 4JI5E 4DR4E 3J81C 2UXBE 4B3SE 4BCAA 2JR1A 2L3JA 4LFBE 2CPNA 4BC7A 5IT9C 2WZOA 1HNZE 2KOUA 2M7QA 4LFAE 2LTSA 4F9BB 4M2ZA 2L92A 4F9CB 4JI4E 1FJGE 3IWCA 3HQ1A 1WHNA 2G7HA 2L2KB 2MDRA 4B3ME 2L8TA 3HPZA 4BMJA 4DV3E 4NXME 4GKKE 2DSYA 2JOXA 3J7AG 1J5EE 1X48A 1STUA 3J7Yp 3AV0A 2LRSA 5LL6R 3T1YE 2H36X 2E5LE 1T4OA 2DIXA 3HPSA 1I94E 5CFFE 4DR5E 5ADZA 3KWRA 3HTXA 1RQ0A 2V89A 4DV0E 2VE7C 4DV6E 4AQYE 4KZSA 4DV1E 2KHXA 1X47A 1HNWE 3C4BA 3DJWA 2L2MA 1HNXE 3VK6A 1XNRE 1DI2A 4X62E 4DR7E 1PKPA 1T4NA 1WHQA 2JVAA 3F6HA 4TUIA 5AE2A 2V83A 1YZ9A 3MSWA 4M0VA 2ODRD 3OMLA 4X8WA 4P7DA 2V87A 5AE1A 3T1HE 1RC7A 1N36E 4JI2E 4LU9A 2LUQA 2VQFE 2UUCE 4B3RE 2LMZA 4R03A 2B3TB 2MC5A 2N3HA 4LF9E 2NUEA 4DR1E 3ADGA 1N34E 1N32E 4P78A 2RS6A 2B9DA 1IBKE 2L3CA 5A2QC 1X49A 5DNYA 3ADJA 3FIGA 2UU9E 4JI1E 2UXCE 5LMNE 3RMPA 4LTYA 3ZOQB 1FKAE 1EKZA 4WFTA 4BS9A 2HHHE 2UUAE 2L6MA 3LLHA 4JI7E 2ZM6E 2RTXA 2L2NA 3JAMC 5F3WA 2LTRA 4WSPA 1XMQE 4LF5E 2V86A 3VYXA 1N33E 4YY3E 3VYYA 5BR8E 2LBSB 2EZ6A 4DR3E 2YZTA 2M4IA 5T6JA 2VF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M7Q A;  4BMJ A;  5AAS A; 
#chains in the Genus database with same CATH topology
 2IHR 1;  1WXR A;  4J8Z A;  4R8O A;  1WJP A;  2YTJ A;  3J80 C;  2CSH A;  2NUG A;  2WCC 3;  4WXD A;  4DR6 E;  1O0W A;  4BBY A;  2FGG A;  2DMY A;  4ZYE A;  2EPX A;  2EM3 A;  2MKD A;  2FV4 B;  3MHS C;  4JYA E;  1Z1B A;  2BB8 A;  1TF3 A;  4M30 A;  4X65 E;  4RH8 A;  4L5N C;  4GEQ B;  1YYO A;  4WXC A;  2RSM A;  3L00 A;  5IWA E;  1P47 A;  2HGH A;  1J26 A;  3EQ1 A;  2RSI A;  3F6G A;  1ZBT A;  1QU6 A;  1PJS A;  4IJD A;  2NUF A;  4JV5 E;  1SR9 A;  4LF8 E;  1GZ6 A;  2YTF A;  3H09 A;  4X64 E;  1GQE A;  2FTX B;  1TN9 A;  4JI3 E;  1A1L A;  2EE8 A;  2JP9 A;  4LFB E;  4BC7 A;  1HNZ E;  2EMZ A;  2M7Q A;  5IV8 B;  2GPI A;  2L92 A;  2ENA A;  3IWC A;  3HQ1 A;  1WHN A;  2L2K B;  2L8T A;  4GKK E;  4HEI A;  2EOS A;  2LJU A;  1X48 A;  3BF2 A;  2LT7 A;  4GZN C;  3T1Y E;  2PRT A;  1ZAA C;  4R2E A;  1T4O A;  5CFF E;  1YFH A;  2EN1 A;  1RQ0 A;  1ZU1 A;  4AQY E;  2YU8 A;  2GHF A;  1A1F A;  4DV1 E;  3C4B A;  2EP3 A;  1PJQ A;  1PKP A;  1YZ9 A;  5LLQ A;  2EOF A;  3OML A;  3T1H E;  4N4R B;  2LMZ A;  2B3T B;  1RMD A;  2EN2 A;  2EMY A;  3THO B;  1N32 E;  2EL6 A;  5A2Q C;  1X49 A;  2EMK A;  5KL4 A;  3FIG A;  2RPC A;  2UXC E;  2EM4 A;  1X5W A;  3ZOQ B;  3RMP A;  4ZYD A;  1EKZ A;  1A1K A;  2UUA E;  2L6M A;  2EOR A;  2DMI A;  3MHH C;  5F3W A;  2V86 A;  2EPU A;  2WBT A;  4DR3 E;  4R2D A;  2YTE A;  2MDG A;  1ZR9 A;  2YSP A;  2A25 A;  2MC6 A;  1X6F A;  1UIL A;  4LF7 E;  4F9A B;  3ADI A;  2VRD A;  2NA2 A;  1YYK A;  3ADL A;  4Q28 A;  2YTP A;  3DF6 A;  3IWD A;  4DV5 E;  4OX9 E;  2ELZ A;  2JOB A;  2V88 A;  4DUY E;  1BB8 A;  2EOQ A;  4GKJ E;  1EH8 A;  5KL7 A;  4X66 E;  2UUB E;  2JXP A;  2KON A;  2RS7 A;  1DQ3 A;  5A6A A;  3JU0 A;  1T38 A;  2EPR A;  1IBL E;  4KHP E;  2EMX A;  2EM5 A;  4K0K E;  2DB2 A;  1IBM E;  4JI8 E;  4LF6 E;  1NEI A;  4WX9 A;  2EL5 A;  2B7V A;  2EPO A;  4O5G A;  2EN6 A;  4I8O A;  2YRH A;  2LJH A;  4WPY A;  4YHH E;  2EOM A;  4BC9 A;  3AUZ A;  2EM6 A;  4DUZ E;  1TF6 A;  4DR4 E;  2EPN A;  3J81 C;  2EM8 A;  1GTK A;  2RQL A;  2CPN A;  4F9B B;  5KL3 A;  4IS1 C;  4JI4 E;  1AH5 A;  2EMW A;  1KJK A;  5KL6 A;  2G7H A;  2K7I A;  2JOX A;  2EPM X;  1PJT A;  1STU A;  2ENC A;  2CT1 A;  2LRS A;  1EH6 A;  2EN8 A;  2E5L E;  1I94 E;  3HPS A;  5A6B A;  4DR5 E;  3KWR A;  3HTX A;  2DRP A;  3VHT B;  2V89 A;  2VE7 C;  2YRM A;  3QG5 C;  2EOY A;  4KZS A;  2KHX A;  5AC4 A;  1HNW E;  3VK6 A;  4X62 E;  1WHQ A;  2YSO A;  4BHC A;  2ODR D;  2V87 A;  4R2R A;  4JI2 E;  2VQF E;  3BID A;  2MC5 A;  1N34 E;  3TQM A;  1B69 A;  5DNY A;  1X6E A;  1A1J A;  2EPC A;  2UU9 E;  4O24 A;  5AC5 A;  2WBS A;  4R2A A;  2ZM6 E;  4M9V C;  1G2D C;  1N33 E;  4WSP A;  2LCE A;  2ENH A;  3VYY A;  3C6K A;  2CTD A;  5BR8 E;  5T6J A;  2BBG A;  2B7T A;  5TSE A;  2EPP A;  1NCS A;  4L8N A;  2LO3 A;  4ZYG A;  3P1X A;  3KZY A;  4DV7 E;  5A6B D;  2EOO A;  2EPZ A;  3C4T A;  1MEY C;  2YT4 A;  3IWB A;  4LF4 E;  2EOH A;  4DV2 E;  4DKK A;  1IQS A;  3LML A;  4FK5 C;  3JTZ A;  4WSG A;  2EOI A;  3OTO E;  2EWL A;  4JI0 E;  2V8Q B;  4DMI A;  4DR2 E;  1T4L B;  1XNQ E;  4KWY A;  2V85 A;  4NXN E;  3BBG A;  2UXD E;  3HXL A;  1A1I A;  2F8B A;  2LUP B;  2EQ0 A;  4F54 A;  2EQ3 A;  4OOG C;  2M1S A;  4ZYH A;  3EPK A;  4B3T E;  4TUG A;  4R2S A;  5LMU E;  1SFE A;  2UXB E;  4JI5 E;  2E1M A;  2EMB A;  2YWQ A;  2EOJ A;  4BCA A;  2JR1 A;  1YUJ A;  4LFA E;  2EMH A;  2YU5 A;  3EPH A;  4R2C A;  4B3M E;  5A69 A;  4DV3 E;  4NXM E;  2DSY A;  3J7A G;  1J5E E;  1JK1 A;  3ECR A;  2EPK X;  3J7Y p;  2EM0 A;  4R2P A;  2DIX A;  3C6M A;  1A1H A;  1UBD C;  3EPJ A;  1YUI A;  4NHR A;  2LVH A;  2D9H A;  1X47 A;  2L2M A;  4O43 A;  1HNX E;  1XNR E;  2JVA A;  2V83 A;  2EML A;  3MSW A;  4M0V A;  4X8W A;  5AE1 A;  1RC7 A;  4P7D A;  3BGH A;  1N36 E;  2NAB A;  2LUQ A;  4B3R E;  2DLK A;  4MLQ A;  2MKN A;  4HTG A;  4R03 A;  4X9J A;  4LF9 E;  2WBU A;  4P78 A;  2RS6 A;  2B9D A;  2EN4 A;  1IBK E;  4JI1 E;  5LMN E;  4BS9 A;  2HHH E;  1IQO A;  3THN A;  2DLQ A;  2L2N A;  2R1F A;  3JAM C;  4LF5 E;  1WRJ A;  1A1G A;  4YY3 E;  1QNT A;  2YZT A;  4RHB B;  2VF1 A;  2EMA A;  2EM9 A;  3M99 B;  1DGC A;  1YYW A;  2JY9 A;  2EMI A;  4NZV A;  1N3G A;  2YRK A;  1AAY A;  2EM2 A;  4DV4 E;  2ODR C;  2I9I A;  1UHZ A;  2E72 A;  1EH7 A;  1X3C A;  4JI6 E;  2YTD A;  1ZBQ A;  4LFC E;  2M9A A;  2K4V A;  3EPL A;  2EMF A;  1HR0 E;  2ADR A;  4WYQ B;  1JK2 A;  2JYA A;  5KL2 A;  1YPN A;  2F4V E;  5AAS A;  2LE2 A;  3K6Q A;  1BBO A;  1XMO E;  2JWO A;  2EN3 A;  2EPL X;  5KL5 A;  2YTG A;  2HJJ A;  4F2J C;  4O4K A;  2VQE E;  5A6K A;  2N8X A;  5FLX C;  2ELY A;  2EMC A;  1T39 A;  2N3G A;  2L33 A;  5AE3 A;  1G2F C;  4B3S E;  1KYQ A;  2L3J A;  1L4S A;  4BHB A;  2WZO A;  5IT9 C;  2KOU A;  1F2I G;  2LTS A;  1PDA A;  4M2Z A;  4F9C B;  2YTN A;  1FJG E;  2EN7 A;  2LV2 A;  2J7J A;  2MDR A;  3HPZ A;  4BMJ A;  2EOZ A;  2EMG A;  4Q35 B;  2R76 A;  3AV0 A;  3KZZ A;  5LL6 R;  2H36 X;  2YTO A;  5ADZ A;  2EOE A;  2EQ1 A;  4DV0 E;  4DV6 E;  1BBG A;  2EOX A;  2YPN A;  4F6M A;  2EL4 A;  2EM7 A;  2DGC A;  3DJW A;  2HC5 A;  2YTQ A;  4F6N A;  4MLV A;  1DI2 A;  4DR7 E;  4TUI A;  1T4N A;  3F6H A;  5AE2 A;  1YSA C;  1MGT A;  4LU9 A;  2UUC E;  2N3H A;  2NUE A;  2YTI A;  4DR1 E;  3ADG A;  2I13 A;  5A6J A;  2L3C A;  1IMU A;  5IXM B;  3ADJ A;  4LTY A;  1FKA E;  2GLI A;  4WFT A;  3LLH A;  1UN6 B;  4JI7 E;  2EPA A;  2RTX A;  1X6H A;  4R2Q A;  3UK3 C;  2Q8U A;  2EJ4 A;  1XMQ E;  2LTR A;  1LLM C;  3VYX A;  2JPA A;  2LBS B;  2EZ6 A;  2M4I A; 
#chains in the Genus database with same CATH homology
 2IHR 1;  2B7T A;  1WXR A;  4J8Z A;  4R8O A;  2JY9 A;  1YYW A;  2MC6 A;  3J80 C;  4L8N A;  1UIL A;  2NUG A;  3P1X A;  4LF7 E;  4F9A B;  4DV7 E;  3ADI A;  2NA2 A;  1YYK A;  4DV4 E;  2ODR C;  3ADL A;  4Q28 A;  3C4T A;  1UHZ A;  3DF6 A;  3IWD A;  4DV5 E;  4OX9 E;  4DR6 E;  1O0W A;  2YT4 A;  3IWB A;  2V88 A;  2JOB A;  4BBY A;  4LF4 E;  4DV2 E;  4DKK A;  4JI6 E;  3LML A;  2FGG A;  4DUY E;  1ZBQ A;  2DMY A;  3JTZ A;  4LFC E;  2K4V A;  3OTO E;  4GKJ E;  2EWL A;  4JI0 E;  2FV4 B;  1HR0 E;  2V8Q B;  4DMI A;  4X66 E;  4DR2 E;  1T4L B;  2UUB E;  1XNQ E;  4JYA E;  2KON A;  2RS7 A;  4WYQ B;  2V85 A;  1DQ3 A;  4NXN E;  3JU0 A;  4M30 A;  3HXL A;  2UXD E;  4X65 E;  2F8B A;  4L5N C;  1IBL E;  4KHP E;  2F4V E;  2LUP B;  4K0K E;  2DB2 A;  1IBM E;  4GEQ B;  4JI8 E;  5AAS A;  2LE2 A;  3K6Q A;  1YYO A;  4LF6 E;  2RSM A;  1XMO E;  2JWO A;  5IWA E;  1J26 A;  4F54 A;  2B7V A;  4OOG C;  2M1S A;  2VQE E;  4I8O A;  3F6G A;  1ZBT A;  1QU6 A;  4TUG A;  5FLX C;  2NUF A;  4B3T E;  2LJH A;  1SR9 A;  4WPY A;  4JV5 E;  4YHH E;  5LMU E;  4LF8 E;  1GZ6 A;  3H09 A;  4BC9 A;  4X64 E;  1GQE A;  2FTX B;  2N3G A;  2L33 A;  3AUZ A;  2E1M A;  5AE3 A;  4DUZ E;  4JI3 E;  4JI5 E;  4DR4 E;  3J81 C;  2UXB E;  4B3S E;  4BCA A;  2JR1 A;  2L3J A;  4LFB E;  2CPN A;  4BC7 A;  5IT9 C;  2WZO A;  1HNZ E;  2KOU A;  2M7Q A;  4LFA E;  2LTS A;  4F9B B;  4M2Z A;  2L92 A;  4F9C B;  4JI4 E;  1FJG E;  3IWC A;  3HQ1 A;  1WHN A;  2G7H A;  2L2K B;  2MDR A;  4B3M E;  2L8T A;  3HPZ A;  4BMJ A;  4DV3 E;  4NXM E;  4GKK E;  2DSY A;  2JOX A;  3J7A G;  1J5E E;  1X48 A;  1STU A;  3J7Y p;  3AV0 A;  2LRS A;  5LL6 R;  3T1Y E;  2H36 X;  2E5L E;  1T4O A;  2DIX A;  3HPS A;  1I94 E;  5CFF E;  4DR5 E;  5ADZ A;  3KWR A;  3HTX A;  1RQ0 A;  2V89 A;  4DV0 E;  2VE7 C;  4DV6 E;  4AQY E;  4KZS A;  4DV1 E;  2KHX A;  1X47 A;  1HNW E;  3C4B A;  3DJW A;  2L2M A;  1HNX E;  3VK6 A;  1XNR E;  1DI2 A;  4X62 E;  4DR7 E;  1PKP A;  1T4N A;  1WHQ A;  2JVA A;  3F6H A;  4TUI A;  5AE2 A;  2V83 A;  1YZ9 A;  3MSW A;  4M0V A;  2ODR D;  3OML A;  4X8W A;  4P7D A;  2V87 A;  5AE1 A;  3T1H E;  1RC7 A;  1N36 E;  4JI2 E;  4LU9 A;  2LUQ A;  2VQF E;  2UUC E;  4B3R E;  2LMZ A;  4R03 A;  2B3T B;  2MC5 A;  2N3H A;  4LF9 E;  2NUE A;  4DR1 E;  3ADG A;  1N34 E;  1N32 E;  4P78 A;  2RS6 A;  2B9D A;  1IBK E;  2L3C A;  5A2Q C;  1X49 A;  5DNY A;  3ADJ A;  3FIG A;  2UU9 E;  4JI1 E;  2UXC E;  5LMN E;  3RMP A;  4LTY A;  3ZOQ B;  1FKA E;  1EKZ A;  4WFT A;  4BS9 A;  2HHH E;  2UUA E;  2L6M A;  3LLH A;  4JI7 E;  2ZM6 E;  2RTX A;  2L2N A;  3JAM C;  5F3W A;  2LTR A;  4WSP A;  1XMQ E;  4LF5 E;  2V86 A;  3VYX A;  1N33 E;  4YY3 E;  3VYY A;  5BR8 E;  2LBS B;  2EZ6 A;  4DR3 E;  2YZT A;  2M4I A;  5T6J A;  2VF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...