2M7QA

Solution structure of tax1bp1 ubz1+2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
GPHMDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Tax1bp1 Ubz1+2 Provides Insight into Target Specificity and Adaptability
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Tax1-binding protein 1
total genus 20
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18112 Zn-C2H2_12 Autophagy receptor zinc finger-C2H2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.550 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2m7qA00
2M7QA 5AASA 4BMJA
chains in the Genus database with same CATH superfamily
1FJGE 5ADZA 2EMKA 2BB8A 4R2QA 5A6BA 2YTFA 2RS6A 1EH7A 4O4KA 2EM4A 1YYKA 4DV4E 2YTOA 2V86A 2EPAA 2EMXA 2EQ3A 2DB2A 1X5WA 1T38A 1YSAC 5IXMB 4GZNC 4B3TE 2EOOA 4JI7E 3J80C 1J5EE 2MDGA 4IS1C 2UXDE 2EN6A 2JY9A 2EL4A 4WSPA 2RTXA 1KJKA 4M2ZA 2R1FA 4Q35B 4X66E 2H36X 4DR2E 1HNXE 3OMLA 5AE1A 4WPYA 1T4OA 3OTOE 4KZSA 5TSEA 3HQ1A 2YU5A 3JU0A 2LO3A 2EM3A 2MC6A 1T39A 2CTDA 1QNTA 1GTKA 1LLMC 2EPMX 4M30A 3ADLA 1N36E 1X6HA 4MLVA 4R2AA 5T6JA 4WX9A 1UILA 1A1JA 1PJTA 1ZU1A 1A1KA 4DMIA 4JI3E 2EOHA 1ZBTA 4MLQA 1J26A 2EN1A 1XMQE 2E5LE 3KZYA 1TN9A 4JI2E 2LUQA 2HC5A 2JR1A 2YSPA 4OOGC 5IWAE 1A1HA 2EMBA 4WSGA 2ENCA 3T1HE 1X48A 3VYYA 4JYAE 1N33E 1JK1A 2YTDA 4RHBB 2EQ1A 3EPLA 4X62E 2JVAA 1YYOA 5LMUE 2ADRA 4N4RB 3JAMC 2YSOA 4R2RA 1DGCA 4ZYGA 2N3HA 4ZYEA 2RQLA 2EOQA 1N3GA 2NABA 1TF3A 2EOFA 4TUGA 2EQ0A 2GHFA 2F8BA 4NXNE 4DV6E 3EPKA 4R2CA 1JK2A 4LFCE 1UHZA 3UK3C 3LLHA 5AASA 4B3RE 2UUBE 1SR9A 2BBGA 2EMIA 2KONA 1A1GA 1PJSA 2LJUA 2M9AA 1UBDC 4HEIA 4I8OA 4Q28A 1P47A 2JWOA 3TQMA 3HPZA 1F2IG 4BS9A 1RMDA 4L5NC 2EMHA 1YZ9A 4X65E 2VRDA 1TF6A 2EN4A 4DR5E 2K4VA 2B7VA 2V89A 2EN8A 4JI5E 1A1IA 1KYQA 1YYWA 2D9HA 2HGHA 2E1MA 2IHR1 2L92A 2EOEA 4R2EA 5KL7A 1X3CA 4DR6E 3F6HA 2EL6A 3BBGA 2EM5A 2YTJA 2L2KB 1EH6A 2CPNA 1I94E 1DQ3A 3ADJA 2EMCA 2YZTA 3F6GA 2EP3A 2EM6A 3RMPA 3IWCA 4DR4E 4P78A 4R2PA 2UUAE 2UXCE 4M0VA 4R8OA 5KL5A 5BR8E 1YUJA 5A6AA 1T4NA 3IWBA 4X9JA 1WXRA 2RS7A 4YHHE 4DV5E 4LF8E 1WHQA 4ZYDA 5AC4A 2EORA 4LF6E 3MHSC 4O43A 3EPHA 2MC5A 2YTNA 5KL6A 2EPRA 4JI1E 1YUIA 4AQYE 4BC9A 2B7TA 1N34E 5A6KA 2EPZA 2EMGA 2K7IA 2LRSA 3C6KA 2L6MA 2FTXB 2CSHA 4F9AB 2VQFE 3M99B 2EN7A 3VHTB 4RH8A 2EN2A 2EOMA 3HXLA 2FV4B 2EMYA 5FLXC 3QG5C 1EH8A 1BB8A 3VYXA 2YTEA 4LF4E 1MGTA 3KWRA 2DSYA 1ZBQA 2B3TB 1A1LA 4JI4E 4K0KE 4TUIA 2JOBA 5KL2A 1G2FC 3ZOQB 1STUA 4O24A 3EQ1A 4JI0E 1IMUA 4X8WA 1X6EA 2YWQA 2EL5A 4GKKE 2EE8A 2DLKA 4GEQB 3C4BA 4FK5C 2I13A 2YTPA 4F9BB 1X49A 5AC5A 4YY3E 2EMAA 5DNYA 4F6NA 2EPXA 4LF9E 3MHHC 1YPNA 2LCEA 4F2JC 2WBTA 2EPKX 2EOSA 2J7JA 3KZZA 1L4SA 4KWYA 2RPCA 4LFBE 2LMZA 2NUEA 2LV2A 1IBME 3DF6A 4DV0E 2ODRC 2VQEE 2M1SA 1IBKE 4DUYE 3ADIA 2EJ4A 1O0WA 2EM0A 4JI6E 5IT9C 3IWDA 3AUZA 2NUGA 4NZVA 2L2NA 2LJHA 4M9VC 2EOZA 2WZOA 4BHBA 4BCAA 2MDRA 4BBYA 2NUFA 2EPLX 4R2SA 3P1XA 3L00A 1IBLE 1QU6A 2HJJA 2Q8UA 2UUCE 5CFFE 1XNRE 1A1FA 5KL3A 2YTIA 2NA2A 1PDAA 3C4TA 3VK6A 4DV3E 2EM8A 2EN3A 2EPPA 2V87A 4BHCA 2E72A 4GKJE 2JOXA 1DI2A 5A6JA 3LMLA 1YFHA 1SFEA 1ZR9A 2EM2A 5IV8B 1RQ0A 3K6QA 3MSWA 4JI8E 2DLQA 3ADGA 1IQOA 1BBOA 2YRMA 4B3SE 3THOB 1FKAE 4NXME 4LU9A 2EOYA 4HTGA 4L8NA 3HPSA 2DRPA 1X47A 2LTRA 4BMJA 4J8ZA 5LLQA 4R03A 2ENAA 2G7HA 2VF1A 1T4LB 2KOUA 5LMNE 3ECRA 4DUZE 3BF2A 2RSIA 2YPNA 2V85A 1WJPA 2EMZA 2EPNA 2EMLA 1ZAAC 1X6FA 3BGHA 1EKZA 1GQEA 3JTZA 2EMFA 3AV0A 4ZYHA 2LE2A 2WBUA 4B3ME 2EPUA 2L3JA 1PKPA 2DIXA 2JYAA 2EMWA 2EOXA 2ZM6E 1NEIA 4WFTA 4IJDA 3C6MA 3T1YE 2LTSA 1UN6B 2EM7A 2UU9E 4JV5E 5AE3A 1G2DC 1AH5A 4BC7A 2GLIA 4LTYA 4DV2E 2M4IA 2YTGA 2F4VE 2WCC3 4KHPE 2YRHA 4WXDA 1HNZE 5KL4A 2ELZA 5A2QC 2YTQA 2JPAA 4DR3E 2ENHA 2B9DA 5A6BD 3EPJA 3H09A 1B69A 4DKKA 4R2DA 4X64E 4O5GA 5AE2A 1BBGA 1NCSA 3THNA 1WHNA 2GPIA 4NHRA 2YRKA 2M7QA 2V8QB 2UXBE 2N3GA 5A69A 4F6MA 4LF7E 2MKDA 1XNQE 1WRJA 2R76A 4OX9E 2DMYA 2JXPA 2ELYA 2MKNA 4DR7E 3J81C 1Z1BA 3DJWA 1HNWE 1XMOE 5LL6R 4DV1E 2A25A 2L33A 2LUPB 4LF5E 1N32E 1HR0E 2L8TA 2KHXA 2LBSB 2WBSA 2DGCA 2HHHE 4F54A 3HTXA 2V83A 2EPOA 4DV7E 2PRTA 2I9IA 2LVHA 2L3CA 2YT4A 3J7Yp 2RSMA 2N8XA 2V88A 2EOJA 1AAYA 4F9CB 5F3WA 2JP9A 1PJQA 2FGGA 1IQSA 2DMIA 2VE7C 1RC7A 2ODRD 2CT1A 1GZ6A 2LT7A 2EM9A 2YU8A 2EPCA 2EZ6A 2L2MA 1MEYC 4LFAE 3BIDA 2EOIA 4WXCA 4DR1E 2EWLA 4P7DA 3FIGA 4WYQB 3J7AG
chains in the Genus database with same CATH topology
1ZBQA 1UHZA 2B3TB 4JI4E 5ADZA 3LLHA 1FJGE 5AASA 4TUIA 4B3RE 2JOBA 4K0KE 1EKZA 3ZOQB 2UUBE 1STUA 1SR9A 2KONA 1GQEA 2RS6A 4JI0E 3JTZA 4X8WA 3AV0A 1YYKA 4I8OA 4Q28A 4DV4E 4GKKE 2LE2A 2JWOA 4B3ME 2V86A 4GEQB 3C4BA 2L3JA 3HPZA 1PKPA 2DIXA 2DB2A 4BS9A 2ZM6E 4F9BB 4L5NC 1X49A 4WFTA 1YZ9A 3T1YE 4B3TE 2LTSA 4YY3E 4X65E 4JI7E 5DNYA 3J80C 2UU9E 4LF9E 4JV5E 4DR5E 1J5EE 5AE3A 4BC7A 2K4VA 2B7VA 2V89A 4LTYA 4DV2E 4JI5E 2UXDE 2M4IA 2JY9A 2F4VE 4WSPA 1YYWA 2RTXA 4M2ZA 4X66E 4KHPE 2H36X 4LFBE 2LMZA 4DR2E 2NUEA 1HNXE 2E1MA 2IHR1 2L92A 3OMLA 5AE1A 4WPYA 1HNZE 1T4OA 3OTOE 4KZSA 1IBME 4DR6E 3F6HA 3DF6A 4DV0E 2ODRC 3HQ1A 3JU0A 5A2QC 2M1SA 2VQEE 4DUYE 1IBKE 3ADIA 2MC6A 1O0WA 2L2KB 4DR3E 4JI6E 2B9DA 5IT9C 3IWDA 3AUZA 2CPNA 3H09A 4M30A 2NUGA 4DKKA 1I94E 1DQ3A 3ADJA 3ADLA 4X64E 2YZTA 1HNWE 3F6GA 1N36E 2L2NA 2LJHA 5AE2A 1WHNA 2WZOA 4BCAA 2M7QA 2MDRA 2V8QB 4BBYA 2NUFA 2UXBE 2N3GA 3P1XA 3RMPA 3IWCA 5T6JA 1QU6A 1UILA 1IBLE 2UUCE 4P78A 2UUAE 4LF7E 1XNQE 2UXCE 5CFFE 4M0VA 4R8OA 4DMIA 1XNRE 4OX9E 4JI3E 1ZBTA 2DMYA 5BR8E 1J26A 1XMQE 2E5LE 4LFCE 4DR7E 3J7AG 1T4NA 2NA2A 3IWBA 3J81C 1WXRA 3DJWA 2LUQA 2RS7A 2JR1A 1XMOE 3C4TA 4OOGC 3VK6A 4YHHE 5LL6R 5IWAE 4DV1E 2L33A 4DV3E 4DV5E 2LUPB 4LF5E 4LF8E 2V87A 1N32E 1WHQA 1HR0E 3T1HE 2JOXA 4GKJE 2L8TA 2KHXA 2LBSB 1DI2A 3LMLA 2HHHE 1X48A 4LF6E 3VYYA 4F54A 3HTXA 4JYAE 1N33E 2MC5A 2V83A 4JI1E 1RQ0A 4X62E 4DV7E 4AQYE 3K6QA 3MSWA 2JVAA 4JI8E 1YYOA 2L3CA 4BC9A 2B7TA 5LMUE 1N34E 3ADGA 3JAMC 2YT4A 3J7Yp 2LRSA 2RSMA 2L6MA 4B3SE 2FTXB 2V88A 4F9AB 2VQFE 4JI2E 2N3HA 1FKAE 4F9CB 4NXME 5F3WA 4LU9A 4L8NA 2FGGA 3HPSA 2VE7C 1X47A 2LTRA 2ODRD 4BMJA 1RC7A 4J8ZA 4R03A 3HXLA 1GZ6A 2G7HA 2VF1A 1T4LB 4TUGA 2FV4B 2EZ6A 2KOUA 2L2MA 2F8BA 4LFAE 5FLXC 5LMNE 4NXNE 4DUZE 4DV6E 4DR1E 2EWLA 4P7DA 2V85A 3VYXA 4LF4E 3FIGA 4DR4E 4WYQB 3KWRA 2DSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M7Q A;  5AAS A;  4BMJ A; 
#chains in the Genus database with same CATH topology
 1FJG E;  5ADZ A;  2EMK A;  2BB8 A;  4R2Q A;  5A6B A;  2YTF A;  2RS6 A;  1EH7 A;  4O4K A;  2EM4 A;  1YYK A;  4DV4 E;  2YTO A;  2V86 A;  2EPA A;  2EMX A;  2EQ3 A;  2DB2 A;  1X5W A;  1T38 A;  1YSA C;  5IXM B;  4GZN C;  4B3T E;  2EOO A;  4JI7 E;  3J80 C;  1J5E E;  2MDG A;  4IS1 C;  2UXD E;  2EN6 A;  2JY9 A;  2EL4 A;  4WSP A;  2RTX A;  1KJK A;  4M2Z A;  2R1F A;  4Q35 B;  4X66 E;  2H36 X;  4DR2 E;  1HNX E;  3OML A;  5AE1 A;  4WPY A;  1T4O A;  3OTO E;  4KZS A;  5TSE A;  3HQ1 A;  2YU5 A;  3JU0 A;  2LO3 A;  2EM3 A;  2MC6 A;  1T39 A;  2CTD A;  1QNT A;  1GTK A;  1LLM C;  2EPM X;  4M30 A;  3ADL A;  1N36 E;  1X6H A;  4MLV A;  4R2A A;  5T6J A;  4WX9 A;  1UIL A;  1A1J A;  1PJT A;  1ZU1 A;  1A1K A;  4DMI A;  4JI3 E;  2EOH A;  1ZBT A;  4MLQ A;  1J26 A;  2EN1 A;  1XMQ E;  2E5L E;  3KZY A;  1TN9 A;  4JI2 E;  2LUQ A;  2HC5 A;  2JR1 A;  2YSP A;  4OOG C;  5IWA E;  1A1H A;  2EMB A;  4WSG A;  2ENC A;  3T1H E;  1X48 A;  3VYY A;  4JYA E;  1N33 E;  1JK1 A;  2YTD A;  4RHB B;  2EQ1 A;  3EPL A;  4X62 E;  2JVA A;  1YYO A;  5LMU E;  2ADR A;  4N4R B;  3JAM C;  2YSO A;  4R2R A;  1DGC A;  4ZYG A;  2N3H A;  4ZYE A;  2RQL A;  2EOQ A;  1N3G A;  2NAB A;  1TF3 A;  2EOF A;  4TUG A;  2EQ0 A;  2GHF A;  2F8B A;  4NXN E;  4DV6 E;  3EPK A;  4R2C A;  1JK2 A;  4LFC E;  1UHZ A;  3UK3 C;  3LLH A;  5AAS A;  4B3R E;  2UUB E;  1SR9 A;  2BBG A;  2EMI A;  2KON A;  1A1G A;  1PJS A;  2LJU A;  2M9A A;  1UBD C;  4HEI A;  4I8O A;  4Q28 A;  1P47 A;  2JWO A;  3TQM A;  3HPZ A;  1F2I G;  4BS9 A;  1RMD A;  4L5N C;  2EMH A;  1YZ9 A;  4X65 E;  2VRD A;  1TF6 A;  2EN4 A;  4DR5 E;  2K4V A;  2B7V A;  2V89 A;  2EN8 A;  4JI5 E;  1A1I A;  1KYQ A;  1YYW A;  2D9H A;  2HGH A;  2E1M A;  2IHR 1;  2L92 A;  2EOE A;  4R2E A;  5KL7 A;  1X3C A;  4DR6 E;  3F6H A;  2EL6 A;  3BBG A;  2EM5 A;  2YTJ A;  2L2K B;  1EH6 A;  2CPN A;  1I94 E;  1DQ3 A;  3ADJ A;  2EMC A;  2YZT A;  3F6G A;  2EP3 A;  2EM6 A;  3RMP A;  3IWC A;  4DR4 E;  4P78 A;  4R2P A;  2UUA E;  2UXC E;  4M0V A;  4R8O A;  5KL5 A;  5BR8 E;  1YUJ A;  5A6A A;  1T4N A;  3IWB A;  4X9J A;  1WXR A;  2RS7 A;  4YHH E;  4DV5 E;  4LF8 E;  1WHQ A;  4ZYD A;  5AC4 A;  2EOR A;  4LF6 E;  3MHS C;  4O43 A;  3EPH A;  2MC5 A;  2YTN A;  5KL6 A;  2EPR A;  4JI1 E;  1YUI A;  4AQY E;  4BC9 A;  2B7T A;  1N34 E;  5A6K A;  2EPZ A;  2EMG A;  2K7I A;  2LRS A;  3C6K A;  2L6M A;  2FTX B;  2CSH A;  4F9A B;  2VQF E;  3M99 B;  2EN7 A;  3VHT B;  4RH8 A;  2EN2 A;  2EOM A;  3HXL A;  2FV4 B;  2EMY A;  5FLX C;  3QG5 C;  1EH8 A;  1BB8 A;  3VYX A;  2YTE A;  4LF4 E;  1MGT A;  3KWR A;  2DSY A;  1ZBQ A;  2B3T B;  1A1L A;  4JI4 E;  4K0K E;  4TUI A;  2JOB A;  5KL2 A;  1G2F C;  3ZOQ B;  1STU A;  4O24 A;  3EQ1 A;  4JI0 E;  1IMU A;  4X8W A;  1X6E A;  2YWQ A;  2EL5 A;  4GKK E;  2EE8 A;  2DLK A;  4GEQ B;  3C4B A;  4FK5 C;  2I13 A;  2YTP A;  4F9B B;  1X49 A;  5AC5 A;  4YY3 E;  2EMA A;  5DNY A;  4F6N A;  2EPX A;  4LF9 E;  3MHH C;  1YPN A;  2LCE A;  4F2J C;  2WBT A;  2EPK X;  2EOS A;  2J7J A;  3KZZ A;  1L4S A;  4KWY A;  2RPC A;  4LFB E;  2LMZ A;  2NUE A;  2LV2 A;  1IBM E;  3DF6 A;  4DV0 E;  2ODR C;  2VQE E;  2M1S A;  1IBK E;  4DUY E;  3ADI A;  2EJ4 A;  1O0W A;  2EM0 A;  4JI6 E;  5IT9 C;  3IWD A;  3AUZ A;  2NUG A;  4NZV A;  2L2N A;  2LJH A;  4M9V C;  2EOZ A;  2WZO A;  4BHB A;  4BCA A;  2MDR A;  4BBY A;  2NUF A;  2EPL X;  4R2S A;  3P1X A;  3L00 A;  1IBL E;  1QU6 A;  2HJJ A;  2Q8U A;  2UUC E;  5CFF E;  1XNR E;  1A1F A;  5KL3 A;  2YTI A;  2NA2 A;  1PDA A;  3C4T A;  3VK6 A;  4DV3 E;  2EM8 A;  2EN3 A;  2EPP A;  2V87 A;  4BHC A;  2E72 A;  4GKJ E;  2JOX A;  1DI2 A;  5A6J A;  3LML A;  1YFH A;  1SFE A;  1ZR9 A;  2EM2 A;  5IV8 B;  1RQ0 A;  3K6Q A;  3MSW A;  4JI8 E;  2DLQ A;  3ADG A;  1IQO A;  1BBO A;  2YRM A;  4B3S E;  3THO B;  1FKA E;  4NXM E;  4LU9 A;  2EOY A;  4HTG A;  4L8N A;  3HPS A;  2DRP A;  1X47 A;  2LTR A;  4BMJ A;  4J8Z A;  5LLQ A;  4R03 A;  2ENA A;  2G7H A;  2VF1 A;  1T4L B;  2KOU A;  5LMN E;  3ECR A;  4DUZ E;  3BF2 A;  2RSI A;  2YPN A;  2V85 A;  1WJP A;  2EMZ A;  2EPN A;  2EML A;  1ZAA C;  1X6F A;  3BGH A;  1EKZ A;  1GQE A;  3JTZ A;  2EMF A;  3AV0 A;  4ZYH A;  2LE2 A;  2WBU A;  4B3M E;  2EPU A;  2L3J A;  1PKP A;  2DIX A;  2JYA A;  2EMW A;  2EOX A;  2ZM6 E;  1NEI A;  4WFT A;  4IJD A;  3C6M A;  3T1Y E;  2LTS A;  1UN6 B;  2EM7 A;  2UU9 E;  4JV5 E;  5AE3 A;  1G2D C;  1AH5 A;  4BC7 A;  2GLI A;  4LTY A;  4DV2 E;  2M4I A;  2YTG A;  2F4V E;  2WCC 3;  4KHP E;  2YRH A;  4WXD A;  1HNZ E;  5KL4 A;  2ELZ A;  5A2Q C;  2YTQ A;  2JPA A;  4DR3 E;  2ENH A;  2B9D A;  5A6B D;  3EPJ A;  3H09 A;  1B69 A;  4DKK A;  4R2D A;  4X64 E;  4O5G A;  5AE2 A;  1BBG A;  1NCS A;  3THN A;  1WHN A;  2GPI A;  4NHR A;  2YRK A;  2M7Q A;  2V8Q B;  2UXB E;  2N3G A;  5A69 A;  4F6M A;  4LF7 E;  2MKD A;  1XNQ E;  1WRJ A;  2R76 A;  4OX9 E;  2DMY A;  2JXP A;  2ELY A;  2MKN A;  4DR7 E;  3J81 C;  1Z1B A;  3DJW A;  1HNW E;  1XMO E;  5LL6 R;  4DV1 E;  2A25 A;  2L33 A;  2LUP B;  4LF5 E;  1N32 E;  1HR0 E;  2L8T A;  2KHX A;  2LBS B;  2WBS A;  2DGC A;  2HHH E;  4F54 A;  3HTX A;  2V83 A;  2EPO A;  4DV7 E;  2PRT A;  2I9I A;  2LVH A;  2L3C A;  2YT4 A;  3J7Y p;  2RSM A;  2N8X A;  2V88 A;  2EOJ A;  1AAY A;  4F9C B;  5F3W A;  2JP9 A;  1PJQ A;  2FGG A;  1IQS A;  2DMI A;  2VE7 C;  1RC7 A;  2ODR D;  2CT1 A;  1GZ6 A;  2LT7 A;  2EM9 A;  2YU8 A;  2EPC A;  2EZ6 A;  2L2M A;  1MEY C;  4LFA E;  3BID A;  2EOI A;  4WXC A;  4DR1 E;  2EWL A;  4P7D A;  3FIG A;  4WYQ B;  3J7A G; 
#chains in the Genus database with same CATH homology
 1ZBQ A;  1UHZ A;  2B3T B;  4JI4 E;  5ADZ A;  3LLH A;  1FJG E;  5AAS A;  4TUI A;  4B3R E;  2JOB A;  4K0K E;  1EKZ A;  3ZOQ B;  2UUB E;  1STU A;  1SR9 A;  2KON A;  1GQE A;  2RS6 A;  4JI0 E;  3JTZ A;  4X8W A;  3AV0 A;  1YYK A;  4I8O A;  4Q28 A;  4DV4 E;  4GKK E;  2LE2 A;  2JWO A;  4B3M E;  2V86 A;  4GEQ B;  3C4B A;  2L3J A;  3HPZ A;  1PKP A;  2DIX A;  2DB2 A;  4BS9 A;  2ZM6 E;  4F9B B;  4L5N C;  1X49 A;  4WFT A;  1YZ9 A;  3T1Y E;  4B3T E;  2LTS A;  4YY3 E;  4X65 E;  4JI7 E;  5DNY A;  3J80 C;  2UU9 E;  4LF9 E;  4JV5 E;  4DR5 E;  1J5E E;  5AE3 A;  4BC7 A;  2K4V A;  2B7V A;  2V89 A;  4LTY A;  4DV2 E;  4JI5 E;  2UXD E;  2M4I A;  2JY9 A;  2F4V E;  4WSP A;  1YYW A;  2RTX A;  4M2Z A;  4X66 E;  4KHP E;  2H36 X;  4LFB E;  2LMZ A;  4DR2 E;  2NUE A;  1HNX E;  2E1M A;  2IHR 1;  2L92 A;  3OML A;  5AE1 A;  4WPY A;  1HNZ E;  1T4O A;  3OTO E;  4KZS A;  1IBM E;  4DR6 E;  3F6H A;  3DF6 A;  4DV0 E;  2ODR C;  3HQ1 A;  3JU0 A;  5A2Q C;  2M1S A;  2VQE E;  4DUY E;  1IBK E;  3ADI A;  2MC6 A;  1O0W A;  2L2K B;  4DR3 E;  4JI6 E;  2B9D A;  5IT9 C;  3IWD A;  3AUZ A;  2CPN A;  3H09 A;  4M30 A;  2NUG A;  4DKK A;  1I94 E;  1DQ3 A;  3ADJ A;  3ADL A;  4X64 E;  2YZT A;  1HNW E;  3F6G A;  1N36 E;  2L2N A;  2LJH A;  5AE2 A;  1WHN A;  2WZO A;  4BCA A;  2M7Q A;  2MDR A;  2V8Q B;  4BBY A;  2NUF A;  2UXB E;  2N3G A;  3P1X A;  3RMP A;  3IWC A;  5T6J A;  1QU6 A;  1UIL A;  1IBL E;  2UUC E;  4P78 A;  2UUA E;  4LF7 E;  1XNQ E;  2UXC E;  5CFF E;  4M0V A;  4R8O A;  4DMI A;  1XNR E;  4OX9 E;  4JI3 E;  1ZBT A;  2DMY A;  5BR8 E;  1J26 A;  1XMQ E;  2E5L E;  4LFC E;  4DR7 E;  3J7A G;  1T4N A;  2NA2 A;  3IWB A;  3J81 C;  1WXR A;  3DJW A;  2LUQ A;  2RS7 A;  2JR1 A;  1XMO E;  3C4T A;  4OOG C;  3VK6 A;  4YHH E;  5LL6 R;  5IWA E;  4DV1 E;  2L33 A;  4DV3 E;  4DV5 E;  2LUP B;  4LF5 E;  4LF8 E;  2V87 A;  1N32 E;  1WHQ A;  1HR0 E;  3T1H E;  2JOX A;  4GKJ E;  2L8T A;  2KHX A;  2LBS B;  1DI2 A;  3LML A;  2HHH E;  1X48 A;  4LF6 E;  3VYY A;  4F54 A;  3HTX A;  4JYA E;  1N33 E;  2MC5 A;  2V83 A;  4JI1 E;  1RQ0 A;  4X62 E;  4DV7 E;  4AQY E;  3K6Q A;  3MSW A;  2JVA A;  4JI8 E;  1YYO A;  2L3C A;  4BC9 A;  2B7T A;  5LMU E;  1N34 E;  3ADG A;  3JAM C;  2YT4 A;  3J7Y p;  2LRS A;  2RSM A;  2L6M A;  4B3S E;  2FTX B;  2V88 A;  4F9A B;  2VQF E;  4JI2 E;  2N3H A;  1FKA E;  4F9C B;  4NXM E;  5F3W A;  4LU9 A;  4L8N A;  2FGG A;  3HPS A;  2VE7 C;  1X47 A;  2LTR A;  2ODR D;  4BMJ A;  1RC7 A;  4J8Z A;  4R03 A;  3HXL A;  1GZ6 A;  2G7H A;  2VF1 A;  1T4L B;  4TUG A;  2FV4 B;  2EZ6 A;  2KOU A;  2L2M A;  2F8B A;  4LFA E;  5FLX C;  5LMN E;  4NXN E;  4DUZ E;  4DV6 E;  4DR1 E;  2EWL A;  4P7D A;  2V85 A;  3VYX A;  4LF4 E;  3FIG A;  4DR4 E;  4WYQ B;  3KWR A;  2DSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...