2M7QA

Solution structure of tax1bp1 ubz1+2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
GPHMDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Tax1bp1 Ubz1+2 Provides Insight into Target Specificity and Adaptability
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Tax1-binding protein 1
total genus 20
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18112 Zn-C2H2_12 Autophagy receptor zinc finger-C2H2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.550 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2m7qA00
5AASA 2M7QA 4BMJA
chains in the Genus database with same CATH superfamily
5IT9C 2YRMA 4DV7E 4B3ME 1MEYC 5LLQA 4X9JA 1ZBQA 4JI5E 5KL3A 1X5WA 2EPKX 2EJ4A 3QG5C 3K6QA 2YRHA 4FK5C 4LF8E 2GHFA 5A6AA 3OMLA 2WBSA 1TF3A 4KZSA 4B3TE 3ADJA 2PRTA 4M9VC 2FGGA 1JK1A 2UUCE 3P1XA 4WXCA 3C6MA 2B9DA 2WZOA 5KL7A 3OTOE 2DIXA 1PDAA 2EOXA 1TN9A 4B3RE 2RSMA 1PKPA 1EH7A 2EOFA 2EOMA 5AC4A 1X6FA 1IQOA 2H36X 2HC5A 3ZOQB 4R2RA 3BF2A 4LF4E 1BBGA 2VF1A 1O0WA 2RTXA 1YFHA 3H09A 3J80C 1X6EA 1BB8A 5ADZA 4RH8A 3THOB 3HPSA 4X65E 2I9IA 2LUQA 5T6JA 2YTNA 2M4IA 2EM6A 1T4NA 2L3JA 4R2SA 2M1SA 1J26A 3EPJA 1A1GA 1XNRE 2M9AA 2N3HA 2BB8A 2ADRA 2EE8A 2R1FA 2Q8UA 2CSHA 2EOEA 2EN2A 2MC6A 1RMDA 2L33A 1YYOA 1AAYA 4BCAA 4ZYEA 2EMHA 4DV1E 1YYWA 2EM0A 3JU0A 1F2IG 2EOOA 1B69A 3HTXA 4LF5E 1QNTA 1X6HA 4LFCE 2ODRD 1N33E 1T38A 1N3GA 3LMLA 5TSEA 5LMNE 2VRDA 4M2ZA 1GQEA 2A25A 2EM9A 3C4BA 2EOZA 1ZBTA 2HJJA 2EPRA 2JY9A 2EWLA 3ADIA 2JOXA 2FTXB 2EM3A 1XMQE 2F8BA 1GTKA 1YZ9A 5A6BA 2K7IA 1UILA 2YTQA 4X66E 2F4VE 2CT1A 2J7JA 1A1IA 2YTIA 2M7QA 2EN4A 1UBDC 2EN6A 1DI2A 4WFTA 5IV8B 3BBGA 2EN7A 2KOUA 1WRJA 4JI8E 4WXDA 4GZNC 2EM7A 2EOSA 4X64E 2VQEE 3J7AG 4BC7A 4M0VA 2WBUA 3AUZA 4WPYA 3LLHA 4DV5E 4IS1C 2ENCA 2EPOA 4DV3E 2RPCA 4TUIA 2JP9A 4GKKE 2EPCA 5DNYA 4DR4E 4TUGA 2EORA 2NABA 4X62E 4O43A 2YTDA 4DR7E 2EPNA 2I13A 3THNA 1PJSA 2EMXA 2EPMX 1ZU1A 3IWBA 2EN8A 2V8QB 2BBGA 1KJKA 1UN6B 1BBOA 4JI1E 2GPIA 4R2EA 2LMZA 4R2QA 5KL6A 2YPNA 4R2AA 4KHPE 2EMBA 4P78A 3M99B 1IBLE 2YTPA 2EMYA 5A69A 2NUGA 3BGHA 4R2DA 2YTFA 2RS6A 4WYQB 4DKKA 3DJWA 3T1YE 1NEIA 1FJGE 1J5EE 1X47A 2MKDA 3UK3C 1PJTA 4GEQB 4LF7E 4L8NA 5LMUE 2LV2A 1HNZE 1A1LA 4LFAE 4JI2E 2LO3A 2EM2A 2MDGA 2YTJA 2B3TB 1X48A 2EM4A 4I8OA 1DQ3A 4DR3E 2DRPA 2ZM6E 2V85A 2N3GA 4DV6E 1A1KA 2ELYA 4WSPA 4BBYA 2EMKA 4YY3E 4R2PA 1NCSA 2ENAA 4JV5E 4MLVA 2LTSA 4R8OA 4X8WA 3J81C 4P7DA 4F9AB 2DSYA 5BR8E 3EPKA 5FLXC 2EL6A 2NA2A 3L00A 4LTYA 2DMIA 2EL5A 1HR0E 2DLKA 4KWYA 1P47A 2EOQA 3ECRA 3F6HA 4M30A 2E1MA 2LJUA 2LTRA 2MKNA 2CPNA 2EMWA 2YZTA 1A1HA 1EKZA 2L6MA 3C6KA 2EMFA 3EQ1A 4BHBA 3IWCA 2HHHE 1YPNA 3F6GA 2YU5A 2YRKA 4LF6E 4NXNE 2LUPB 4DR6E 3ADLA 5A6BD 1YYKA 2V83A 2EPLX 2V86A 3HPZA 2B7VA 2YT4A 4OOGC 1TF6A 4JI4E 1IMUA 2EPXA 2JXPA 2EOJA 2L92A 5IXMB 1MGTA 1T39A 2EL4A 2LT7A 4DR1E 5AASA 5A6KA 5IWAE 2UUBE 2JVAA 2ODRC 5KL5A 4L5NC 2RQLA 4BMJA 4DV2E 2N8XA 2YWQA 4R2CA 2B7TA 3DF6A 1LLMC 4OX9E 3MSWA 1YUJA 4O4KA 1G2FC 5AE1A 5LL6R 4J8ZA 1X3CA 4F54A 1IQSA 1T4OA 2L2MA 4NZVA 5CFFE 2JYAA 2E5LE 1G2DC 1N34E 1RQ0A 4MLQA 4DMIA 2K4VA 2YSOA 4O5GA 3VYXA 2UXCE 1WHNA 5AC5A 4HTGA 2JOBA 2YTOA 4ZYGA 4K0KE 1JK2A 2HGHA 4JI0E 1HNWE 3VK6A 2L2KB 5A2QC 4NHRA 4ZYDA 3JTZA 2UU9E 4AQYE 2G7HA 2DMYA 5KL4A 3KZYA 1EH8A 4BS9A 2JWOA 2UXBE 4ZYHA 2VE7C 4DR5E 5AE3A 1WXRA 2JPAA 2EPAA 3HXLA 3MHHC 5F3WA 2EOYA 2EMAA 1FKAE 4JI3E 1T4LB 2UXDE 2IHR1 2LVHA 5A6JA 2EQ0A 2GLIA 2V87A 1WJPA 1DGCA 2LJHA 3MHSC 5AE2A 2V89A 1IBME 1Z1BA 4DR2E 1QU6A 2EP3A 2LRSA 2RS7A 4F2JC 4Q28A 4YHHE 3T1HE 2EN3A 4DV0E 2EN1A 3JAMC 2V88A 2DLQA 3J7Yp 2CTDA 1SR9A 3BIDA 1I94E 3AV0A 4JI7E 4IJDA 1YUIA 1ZR9A 2KONA 2ELZA 2EMCA 2MDRA 2YU8A 1N32E 4DUYE 3RMPA 5KL2A 1ZAAC 2ENHA 3KWRA 4WX9A 2EMIA 1SFEA 2EQ3A 2WBTA 3HQ1A 2DGCA 1EH6A 2EMLA 2EM8A 4GKJE 4F9BB 1A1JA 2EZ6A 1L4SA 1STUA 4F9CB 2EM5A 3C4TA 2L2NA 4BHCA 2NUFA 2YTGA 2LE2A 3IWDA 2EPUA 1N36E 2EMGA 4B3SE 1KYQA 2R76A 1XNQE 2EOHA 3KZZA 4DV4E 2JR1A 4NXME 2FV4B 4RHBB 2L8TA 2EPZA 1WHQA 3TQMA 2EOIA 4BC9A 4LF9E 2NUEA 1PJQA 1IBKE 4JYAE 3VHTB 2DB2A 2EPPA 2D9HA 4WSGA 4Q35B 2RSIA 1HNXE 2L3CA 4F6NA 3ADGA 2EMZA 2EQ1A 2YSPA 4N4RB 2UUAE 1X49A 1GZ6A 2VQFE 2LBSB 1AH5A 4LFBE 2WCC3 1RC7A 2YTEA 2E72A 1A1FA 4JI6E 3EPHA 4R03A 1YSAC 4HEIA 2LCEA 1XMOE 3FIGA 3VYYA 1UHZA 4DUZE 4F6MA 4LU9A 4O24A 2MC5A 2KHXA 3EPLA
chains in the Genus database with same CATH topology
5F3WA 5IT9C 3LMLA 5LMNE 4M2ZA 4I8OA 4DV7E 1DQ3A 1FKAE 4B3ME 4JI3E 1GQEA 4DR3E 1T4LB 2UXDE 2IHR1 2ZM6E 3C4BA 2V85A 2N3GA 4DV6E 1ZBTA 4WSPA 4BBYA 4YY3E 1ZBQA 2JY9A 2EWLA 3ADIA 2V87A 2JOXA 4JI5E 2LTSA 2FTXB 4R8OA 4X8WA 4P7DA 3J81C 1XMQE 2F8BA 4F9AB 2LJHA 2DSYA 5BR8E 5FLXC 1YZ9A 5AE2A 2V89A 1IBME 2NA2A 3K6QA 4DR2E 1QU6A 2LRSA 2RS7A 1UILA 4LF8E 4X66E 3OMLA 4Q28A 4YHHE 4KZSA 4DV0E 3T1HE 4LTYA 2F4VE 3JAMC 4B3TE 2V88A 3J7Yp 1SR9A 1I94E 1HR0E 2M7QA 3AV0A 4JI7E 3ADJA 3F6HA 4M30A 2E1MA 2LTRA 2KONA 1DI2A 4WFTA 2CPNA 2FGGA 2MDRA 2YZTA 2UUCE 1EKZA 3P1XA 2KOUA 4JI8E 4JV5E 1N32E 4X64E 2VQEE 3J7AG 2L6MA 3OTOE 2B9DA 2WZOA 4M0VA 4BC7A 4DUYE 3AUZA 2DIXA 4WPYA 3LLHA 4DV5E 4B3RE 3RMPA 2RSMA 1PKPA 3IWCA 3KWRA 3F6GA 2HHHE 4LF6E 4NXNE 4DV3E 4DR6E 2LUPB 3ADLA 2H36X 4TUIA 1YYKA 2V83A 4GKKE 3HPZA 2V86A 2B7VA 2YT4A 4OOGC 3HQ1A 3ZOQB 4JI4E 5DNYA 4DR4E 4TUGA 4LF4E 2L92A 4X62E 4GKJE 4DR7E 4F9BB 2VF1A 1O0WA 2RTXA 5AASA 4DR1E 2EZ6A 3H09A 1STUA 5IWAE 2UUBE 2JVAA 2ODRC 4F9CB 3J80C 3C4TA 2L2NA 4L5NC 5ADZA 3HPSA 3IWBA 4BMJA 4X65E 2LE2A 2V8QB 3IWDA 2LUQA 4DV2E 5T6JA 1N36E 2B7TA 3DF6A 4B3SE 4JI1E 3MSWA 4OX9E 2M4IA 1XNQE 2LMZA 5AE1A 5LL6R 4DV4E 1T4NA 2JR1A 2L3JA 4J8ZA 4F54A 2M1SA 1T4OA 2FV4B 2L8TA 4NXME 2L2MA 5CFFE 1WHQA 4BC9A 2NUEA 4LF9E 1J26A 2E5LE 1IBKE 4KHPE 4JYAE 4P78A 1IBLE 2DB2A 1N34E 1RQ0A 4DMIA 2K4VA 1XNRE 3VYXA 2UXCE 2NUGA 1WHNA 2N3HA 2JOBA 2RS6A 1HNXE 4WYQB 4DKKA 3DJWA 2L3CA 4K0KE 3T1YE 1FJGE 2MC6A 1J5EE 4JI0E 1HNWE 3ADGA 3VK6A 1X47A 2L33A 2L2KB 1YYOA 1X49A 5A2QC 2UUAE 1GZ6A 3JTZA 4BCAA 2VQFE 2LBSB 4LFBE 4DV1E 2UU9E 4GEQB 4AQYE 1RC7A 4LF7E 2G7HA 4L8NA 2DMYA 5LMUE 3JU0A 1HNZE 2NUFA 4JI6E 4R03A 1YYWA 4LFAE 4JI2E 4BS9A 2JWOA 1XMOE 2UXBE 3HTXA 3FIGA 2VE7C 3VYYA 4LF5E 4DR5E 4LFCE 1UHZA 2ODRD 4DUZE 1N33E 5AE3A 1WXRA 4LU9A 2B3TB 1X48A 2MC5A 2KHXA 3HXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AAS A;  2M7Q A;  4BMJ A; 
#chains in the Genus database with same CATH topology
 5IT9 C;  2YRM A;  4DV7 E;  4B3M E;  1MEY C;  5LLQ A;  4X9J A;  1ZBQ A;  4JI5 E;  5KL3 A;  1X5W A;  2EPK X;  2EJ4 A;  3QG5 C;  3K6Q A;  2YRH A;  4FK5 C;  4LF8 E;  2GHF A;  5A6A A;  3OML A;  2WBS A;  1TF3 A;  4KZS A;  4B3T E;  3ADJ A;  2PRT A;  4M9V C;  2FGG A;  1JK1 A;  2UUC E;  3P1X A;  4WXC A;  3C6M A;  2B9D A;  2WZO A;  5KL7 A;  3OTO E;  2DIX A;  1PDA A;  2EOX A;  1TN9 A;  4B3R E;  2RSM A;  1PKP A;  1EH7 A;  2EOF A;  2EOM A;  5AC4 A;  1X6F A;  1IQO A;  2H36 X;  2HC5 A;  3ZOQ B;  4R2R A;  3BF2 A;  4LF4 E;  1BBG A;  2VF1 A;  1O0W A;  2RTX A;  1YFH A;  3H09 A;  3J80 C;  1X6E A;  1BB8 A;  5ADZ A;  4RH8 A;  3THO B;  3HPS A;  4X65 E;  2I9I A;  2LUQ A;  5T6J A;  2YTN A;  2M4I A;  2EM6 A;  1T4N A;  2L3J A;  4R2S A;  2M1S A;  1J26 A;  3EPJ A;  1A1G A;  1XNR E;  2M9A A;  2N3H A;  2BB8 A;  2ADR A;  2EE8 A;  2R1F A;  2Q8U A;  2CSH A;  2EOE A;  2EN2 A;  2MC6 A;  1RMD A;  2L33 A;  1YYO A;  1AAY A;  4BCA A;  4ZYE A;  2EMH A;  4DV1 E;  1YYW A;  2EM0 A;  3JU0 A;  1F2I G;  2EOO A;  1B69 A;  3HTX A;  4LF5 E;  1QNT A;  1X6H A;  4LFC E;  2ODR D;  1N33 E;  1T38 A;  1N3G A;  3LML A;  5TSE A;  5LMN E;  2VRD A;  4M2Z A;  1GQE A;  2A25 A;  2EM9 A;  3C4B A;  2EOZ A;  1ZBT A;  2HJJ A;  2EPR A;  2JY9 A;  2EWL A;  3ADI A;  2JOX A;  2FTX B;  2EM3 A;  1XMQ E;  2F8B A;  1GTK A;  1YZ9 A;  5A6B A;  2K7I A;  1UIL A;  2YTQ A;  4X66 E;  2F4V E;  2CT1 A;  2J7J A;  1A1I A;  2YTI A;  2M7Q A;  2EN4 A;  1UBD C;  2EN6 A;  1DI2 A;  4WFT A;  5IV8 B;  3BBG A;  2EN7 A;  2KOU A;  1WRJ A;  4JI8 E;  4WXD A;  4GZN C;  2EM7 A;  2EOS A;  4X64 E;  2VQE E;  3J7A G;  4BC7 A;  4M0V A;  2WBU A;  3AUZ A;  4WPY A;  3LLH A;  4DV5 E;  4IS1 C;  2ENC A;  2EPO A;  4DV3 E;  2RPC A;  4TUI A;  2JP9 A;  4GKK E;  2EPC A;  5DNY A;  4DR4 E;  4TUG A;  2EOR A;  2NAB A;  4X62 E;  4O43 A;  2YTD A;  4DR7 E;  2EPN A;  2I13 A;  3THN A;  1PJS A;  2EMX A;  2EPM X;  1ZU1 A;  3IWB A;  2EN8 A;  2V8Q B;  2BBG A;  1KJK A;  1UN6 B;  1BBO A;  4JI1 E;  2GPI A;  4R2E A;  2LMZ A;  4R2Q A;  5KL6 A;  2YPN A;  4R2A A;  4KHP E;  2EMB A;  4P78 A;  3M99 B;  1IBL E;  2YTP A;  2EMY A;  5A69 A;  2NUG A;  3BGH A;  4R2D A;  2YTF A;  2RS6 A;  4WYQ B;  4DKK A;  3DJW A;  3T1Y E;  1NEI A;  1FJG E;  1J5E E;  1X47 A;  2MKD A;  3UK3 C;  1PJT A;  4GEQ B;  4LF7 E;  4L8N A;  5LMU E;  2LV2 A;  1HNZ E;  1A1L A;  4LFA E;  4JI2 E;  2LO3 A;  2EM2 A;  2MDG A;  2YTJ A;  2B3T B;  1X48 A;  2EM4 A;  4I8O A;  1DQ3 A;  4DR3 E;  2DRP A;  2ZM6 E;  2V85 A;  2N3G A;  4DV6 E;  1A1K A;  2ELY A;  4WSP A;  4BBY A;  2EMK A;  4YY3 E;  4R2P A;  1NCS A;  2ENA A;  4JV5 E;  4MLV A;  2LTS A;  4R8O A;  4X8W A;  3J81 C;  4P7D A;  4F9A B;  2DSY A;  5BR8 E;  3EPK A;  5FLX C;  2EL6 A;  2NA2 A;  3L00 A;  4LTY A;  2DMI A;  2EL5 A;  1HR0 E;  2DLK A;  4KWY A;  1P47 A;  2EOQ A;  3ECR A;  3F6H A;  4M30 A;  2E1M A;  2LJU A;  2LTR A;  2MKN A;  2CPN A;  2EMW A;  2YZT A;  1A1H A;  1EKZ A;  2L6M A;  3C6K A;  2EMF A;  3EQ1 A;  4BHB A;  3IWC A;  2HHH E;  1YPN A;  3F6G A;  2YU5 A;  2YRK A;  4LF6 E;  4NXN E;  2LUP B;  4DR6 E;  3ADL A;  5A6B D;  1YYK A;  2V83 A;  2EPL X;  2V86 A;  3HPZ A;  2B7V A;  2YT4 A;  4OOG C;  1TF6 A;  4JI4 E;  1IMU A;  2EPX A;  2JXP A;  2EOJ A;  2L92 A;  5IXM B;  1MGT A;  1T39 A;  2EL4 A;  2LT7 A;  4DR1 E;  5AAS A;  5A6K A;  5IWA E;  2UUB E;  2JVA A;  2ODR C;  5KL5 A;  4L5N C;  2RQL A;  4BMJ A;  4DV2 E;  2N8X A;  2YWQ A;  4R2C A;  2B7T A;  3DF6 A;  1LLM C;  4OX9 E;  3MSW A;  1YUJ A;  4O4K A;  1G2F C;  5AE1 A;  5LL6 R;  4J8Z A;  1X3C A;  4F54 A;  1IQS A;  1T4O A;  2L2M A;  4NZV A;  5CFF E;  2JYA A;  2E5L E;  1G2D C;  1N34 E;  1RQ0 A;  4MLQ A;  4DMI A;  2K4V A;  2YSO A;  4O5G A;  3VYX A;  2UXC E;  1WHN A;  5AC5 A;  4HTG A;  2JOB A;  2YTO A;  4ZYG A;  4K0K E;  1JK2 A;  2HGH A;  4JI0 E;  1HNW E;  3VK6 A;  2L2K B;  5A2Q C;  4NHR A;  4ZYD A;  3JTZ A;  2UU9 E;  4AQY E;  2G7H A;  2DMY A;  5KL4 A;  3KZY A;  1EH8 A;  4BS9 A;  2JWO A;  2UXB E;  4ZYH A;  2VE7 C;  4DR5 E;  5AE3 A;  1WXR A;  2JPA A;  2EPA A;  3HXL A;  3MHH C;  5F3W A;  2EOY A;  2EMA A;  1FKA E;  4JI3 E;  1T4L B;  2UXD E;  2IHR 1;  2LVH A;  5A6J A;  2EQ0 A;  2GLI A;  2V87 A;  1WJP A;  1DGC A;  2LJH A;  3MHS C;  5AE2 A;  2V89 A;  1IBM E;  1Z1B A;  4DR2 E;  1QU6 A;  2EP3 A;  2LRS A;  2RS7 A;  4F2J C;  4Q28 A;  4YHH E;  3T1H E;  2EN3 A;  4DV0 E;  2EN1 A;  3JAM C;  2V88 A;  2DLQ A;  3J7Y p;  2CTD A;  1SR9 A;  3BID A;  1I94 E;  3AV0 A;  4JI7 E;  4IJD A;  1YUI A;  1ZR9 A;  2KON A;  2ELZ A;  2EMC A;  2MDR A;  2YU8 A;  1N32 E;  4DUY E;  3RMP A;  5KL2 A;  1ZAA C;  2ENH A;  3KWR A;  4WX9 A;  2EMI A;  1SFE A;  2EQ3 A;  2WBT A;  3HQ1 A;  2DGC A;  1EH6 A;  2EML A;  2EM8 A;  4GKJ E;  4F9B B;  1A1J A;  2EZ6 A;  1L4S A;  1STU A;  4F9C B;  2EM5 A;  3C4T A;  2L2N A;  4BHC A;  2NUF A;  2YTG A;  2LE2 A;  3IWD A;  2EPU A;  1N36 E;  2EMG A;  4B3S E;  1KYQ A;  2R76 A;  1XNQ E;  2EOH A;  3KZZ A;  4DV4 E;  2JR1 A;  4NXM E;  2FV4 B;  4RHB B;  2L8T A;  2EPZ A;  1WHQ A;  3TQM A;  2EOI A;  4BC9 A;  4LF9 E;  2NUE A;  1PJQ A;  1IBK E;  4JYA E;  3VHT B;  2DB2 A;  2EPP A;  2D9H A;  4WSG A;  4Q35 B;  2RSI A;  1HNX E;  2L3C A;  4F6N A;  3ADG A;  2EMZ A;  2EQ1 A;  2YSP A;  4N4R B;  2UUA E;  1X49 A;  1GZ6 A;  2VQF E;  2LBS B;  1AH5 A;  4LFB E;  2WCC 3;  1RC7 A;  2YTE A;  2E72 A;  1A1F A;  4JI6 E;  3EPH A;  4R03 A;  1YSA C;  4HEI A;  2LCE A;  1XMO E;  3FIG A;  3VYY A;  1UHZ A;  4DUZ E;  4F6M A;  4LU9 A;  4O24 A;  2MC5 A;  2KHX A;  3EPL A; 
#chains in the Genus database with same CATH homology
 5F3W A;  5IT9 C;  3LML A;  5LMN E;  4M2Z A;  4I8O A;  4DV7 E;  1DQ3 A;  1FKA E;  4B3M E;  4JI3 E;  1GQE A;  4DR3 E;  1T4L B;  2UXD E;  2IHR 1;  2ZM6 E;  3C4B A;  2V85 A;  2N3G A;  4DV6 E;  1ZBT A;  4WSP A;  4BBY A;  4YY3 E;  1ZBQ A;  2JY9 A;  2EWL A;  3ADI A;  2V87 A;  2JOX A;  4JI5 E;  2LTS A;  2FTX B;  4R8O A;  4X8W A;  4P7D A;  3J81 C;  1XMQ E;  2F8B A;  4F9A B;  2LJH A;  2DSY A;  5BR8 E;  5FLX C;  1YZ9 A;  5AE2 A;  2V89 A;  1IBM E;  2NA2 A;  3K6Q A;  4DR2 E;  1QU6 A;  2LRS A;  2RS7 A;  1UIL A;  4LF8 E;  4X66 E;  3OML A;  4Q28 A;  4YHH E;  4KZS A;  4DV0 E;  3T1H E;  4LTY A;  2F4V E;  3JAM C;  4B3T E;  2V88 A;  3J7Y p;  1SR9 A;  1I94 E;  1HR0 E;  2M7Q A;  3AV0 A;  4JI7 E;  3ADJ A;  3F6H A;  4M30 A;  2E1M A;  2LTR A;  2KON A;  1DI2 A;  4WFT A;  2CPN A;  2FGG A;  2MDR A;  2YZT A;  2UUC E;  1EKZ A;  3P1X A;  2KOU A;  4JI8 E;  4JV5 E;  1N32 E;  4X64 E;  2VQE E;  3J7A G;  2L6M A;  3OTO E;  2B9D A;  2WZO A;  4M0V A;  4BC7 A;  4DUY E;  3AUZ A;  2DIX A;  4WPY A;  3LLH A;  4DV5 E;  4B3R E;  3RMP A;  2RSM A;  1PKP A;  3IWC A;  3KWR A;  3F6G A;  2HHH E;  4LF6 E;  4NXN E;  4DV3 E;  4DR6 E;  2LUP B;  3ADL A;  2H36 X;  4TUI A;  1YYK A;  2V83 A;  4GKK E;  3HPZ A;  2V86 A;  2B7V A;  2YT4 A;  4OOG C;  3HQ1 A;  3ZOQ B;  4JI4 E;  5DNY A;  4DR4 E;  4TUG A;  4LF4 E;  2L92 A;  4X62 E;  4GKJ E;  4DR7 E;  4F9B B;  2VF1 A;  1O0W A;  2RTX A;  5AAS A;  4DR1 E;  2EZ6 A;  3H09 A;  1STU A;  5IWA E;  2UUB E;  2JVA A;  2ODR C;  4F9C B;  3J80 C;  3C4T A;  2L2N A;  4L5N C;  5ADZ A;  3HPS A;  3IWB A;  4BMJ A;  4X65 E;  2LE2 A;  2V8Q B;  3IWD A;  2LUQ A;  4DV2 E;  5T6J A;  1N36 E;  2B7T A;  3DF6 A;  4B3S E;  4JI1 E;  3MSW A;  4OX9 E;  2M4I A;  1XNQ E;  2LMZ A;  5AE1 A;  5LL6 R;  4DV4 E;  1T4N A;  2JR1 A;  2L3J A;  4J8Z A;  4F54 A;  2M1S A;  1T4O A;  2FV4 B;  2L8T A;  4NXM E;  2L2M A;  5CFF E;  1WHQ A;  4BC9 A;  2NUE A;  4LF9 E;  1J26 A;  2E5L E;  1IBK E;  4KHP E;  4JYA E;  4P78 A;  1IBL E;  2DB2 A;  1N34 E;  1RQ0 A;  4DMI A;  2K4V A;  1XNR E;  3VYX A;  2UXC E;  2NUG A;  1WHN A;  2N3H A;  2JOB A;  2RS6 A;  1HNX E;  4WYQ B;  4DKK A;  3DJW A;  2L3C A;  4K0K E;  3T1Y E;  1FJG E;  2MC6 A;  1J5E E;  4JI0 E;  1HNW E;  3ADG A;  3VK6 A;  1X47 A;  2L33 A;  2L2K B;  1YYO A;  1X49 A;  5A2Q C;  2UUA E;  1GZ6 A;  3JTZ A;  4BCA A;  2VQF E;  2LBS B;  4LFB E;  4DV1 E;  2UU9 E;  4GEQ B;  4AQY E;  1RC7 A;  4LF7 E;  2G7H A;  4L8N A;  2DMY A;  5LMU E;  3JU0 A;  1HNZ E;  2NUF A;  4JI6 E;  4R03 A;  1YYW A;  4LFA E;  4JI2 E;  4BS9 A;  2JWO A;  1XMO E;  2UXB E;  3HTX A;  3FIG A;  2VE7 C;  3VYY A;  4LF5 E;  4DR5 E;  4LFC E;  1UHZ A;  2ODR D;  4DUZ E;  1N33 E;  5AE3 A;  1WXR A;  4LU9 A;  2B3T B;  1X48 A;  2MC5 A;  2KHX A;  3HXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...