2M7QA

Solution structure of tax1bp1 ubz1+2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
b'GPHMDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tax1-binding protein 1
publication title The Structure of Tax1bp1 Ubz1+2 Provides Insight into Target Specificity and Adaptability
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 20
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18112 Zn-C2H2_12 Autophagy receptor zinc finger-C2H2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.550 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2m7qA00
2M7QA 5AASA 4BMJA
chains in the Genus database with same CATH superfamily
4LF8E 2EOSA 1N34E 1A1HA 4O24A 1YZ9A 1X48A 3KZYA 2HGHA 1IQSA 1YYOA 3T1HE 3VHTB 4DV5E 4B3SE 3VYYA 4NXME 2EN4A 5LLQA 1EKZA 2LRSA 2EPPA 2EMWA 3VYXA 4LF5E 1AH5A 2EN1A 1A1JA 2LO3A 1XNQE 4IJDA 2GPIA 4BHCA 4MLVA 2EMIA 1YSAC 2EP3A 2ENAA 3JTZA 1B69A 2WBUA 2EM4A 3T1YE 3EPHA 2I13A 2JOBA 2EORA 2YWQA 3LMLA 4JI7E 3ZOQB 4O4KA 1A1KA 3DJWA 2EM2A 4R2QA 1STUA 2VQEE 2ODRC 4J8ZA 2JR1A 2R1FA 3J80C 1BBOA 2MDRA 4K0KE 1JK1A 4NXNE 1A1FA 2RTXA 4BBYA 2FV4B 2LTSA 2LUQA 3VK6A 1DGCA 3KZZA 2L2KB 1KJKA 3BBGA 2F8BA 4BCAA 1PJQA 2EMLA 2EN3A 2R76A 4DMIA 4AQYE 1MGTA 2MC6A 4R2AA 2V85A 4WXDA 2LE2A 5A6BA 2GHFA 4RHBB 3H09A 5A69A 4KWYA 1BBGA 5A2QC 4IS1C 5IWAE 1T4NA 2I9IA 1J26A 2LTRA 2KHXA 2EL6A 4WXCA 3C6KA 3JAMC 5AE3A 3BIDA 4DV6E 3IWDA 2E5LE 1UN6B 2NABA 4YY3E 2EMYA 5KL3A 2EOHA 2YRKA 2EN6A 5F3WA 4BMJA 4LTYA 2UXBE 2EL5A 2YTDA 2G7HA 2EM6A 2YT4A 2N3GA 3EQ1A 2DB2A 2CPNA 4GKKE 1RQ0A 1TF6A 3ADJA 4LFBE 4ZYEA 5A6JA 1XNRE 4R2DA 2BB8A 2RS6A 2M7QA 4WYQB 4DR6E 2WCC3 4LF4E 2UXCE 4DUYE 4DR3E 4LU9A 2EOYA 2JXPA 2MDGA 2NA2A 2MKNA 2L6MA 1YFHA 2YTFA 3KWRA 2CTDA 2M4IA 4X9JA 4F6NA 2VE7C 2DMYA 1X3CA 2EMKA 2JWOA 5IV8B 2YSOA 5AC5A 1EH7A 3HPZA 1TN9A 4JI3E 2FTXB 3F6HA 1RMDA 1GTKA 1NEIA 4Q35B 2EOXA 4JI6E 2WBTA 2EMCA 2EPMX 4M30A 2RS7A 3C4BA 4P7DA 2WZOA 3K6QA 4BHBA 4M2ZA 1N32E 1IMUA 4X65E 2YRMA 4BC7A 1YUIA 5LMUE 1IBLE 3J7AG 4R2CA 1WJPA 1N3GA 2EPXA 2ODRD 2EMFA 2EPNA 1L4SA 4OOGC 4JI5E 1F2IG 2YTOA 4KZSA 4DKKA 1HR0E 2EQ3A 4R2RA 4DR7E 4F54A 3C6MA 3LLHA 2EWLA 2MKDA 2MC5A 2DRPA 2NUFA 1SFEA 2LJUA 2EPKX 3IWBA 4YHHE 1GQEA 1EH6A 2KONA 5ADZA 1JK2A 2NUGA 3L00A 1YYWA 1IBME 2RPCA 2EZ6A 1A1GA 3P1XA 2M9AA 4R2EA 4L5NC 3ADLA 4RH8A 2V83A 4DV1E 1PJSA 4O43A 2YU5A 1YPNA 2UU9E 1TF3A 4GZNC 4WX9A 2EQ0A 2L33A 4R2PA 1ZR9A 2JY9A 4F9BB 1BB8A 2DIXA 1X6FA 3HPSA 4Q28A 2LMZA 2HJJA 4NZVA 4KHPE 3BF2A 3FIGA 1XMOE 3UK3C 2EPZA 3HQ1A 4F9CB 2JYAA 2VQFE 1HNWE 3DF6A 2WBSA 2EPCA 2LJHA 1N36E 3EPLA 2BBGA 3ADGA 5DNYA 2L2NA 1UHZA 2EOJA 3RMPA 2EPLX 2RSIA 2UXDE 1IQOA 2EM5A 2B3TB 4LF6E 2EMGA 2VF1A 1A1IA 1G2FC 2YRHA 2EOQA 4GKJE 2B9DA 2EOEA 5KL7A 1X5WA 2JP9A 5AE1A 3IWCA 2YTEA 1PDAA 2DMIA 1P47A 3AUZA 2ELYA 1O0WA 3HTXA 4DV3E 4JI4E 2RQLA 4B3RE 2NUEA 3EPJA 1A1LA 4DR1E 2EOFA 4DV4E 2L3JA 2DLQA 4I8OA 2YZTA 4DV7E 1FKAE 2K4VA 1X6EA 1ZAAC 1DQ3A 1WRJA 2ADRA 4HEIA 4N4RB 1SR9A 5KL5A 2YU8A 2B7TA 4O5GA 2EM8A 3HXLA 4L8NA 4HTGA 1X47A 4X62E 4JI2E 1PJTA 3M99B 2YTNA 1QNTA 1I94E 3J7Yp 1DI2A 4X8WA 5IT9C 4M9VC 2EE8A 1HNXE 2EMXA 2EOIA 2EPUA 3EPKA 2DSYA 1YUJA 4JV5E 2V89A 1KYQA 4MLQA 2LV2A 2ENCA 2E72A 2EOMA 3MHSC 5KL2A 2L3CA 1IBKE 4TUGA 2YTGA 1LLMC 2K7IA 2EL4A 4NHRA 2EN7A 2J7JA 1EH8A 2KOUA 4LFAE 1YYKA 5AE2A 2EN2A 2EPAA 1WHQA 5A6AA 4F6MA 3F6GA 3ADIA 5FLXC 5TSEA 2ENHA 2ELZA 3QG5C 2LT7A 1N33E 3C4TA 4GEQB 2LUPB 4ZYHA 5CFFE 2YTJA 4B3TE 3TQMA 2V8QB 5KL4A 2EPOA 2YSPA 2LBSB 1WXRA 2FGGA 2YTPA 1XMQE 3JU0A 2LCEA 1GZ6A 2A25A 2EM9A 4ZYDA 2N8XA 4JI1E 1UILA 2VRDA 3THOB 4DR2E 5LMNE 4LFCE 1FJGE 4M0VA 3MHHC 2YTIA 4WFTA 1T4LB 2UUAE 4DR5E 1T4OA 4B3ME 1ZU1A 4R2SA 4JI8E 2EPRA 3OTOE 2HC5A 3J81C 2UUBE 1UBDC 2V86A 4OX9E 5KL6A 3ECRA 2IHR1 5AASA 4F2JC 4DV2E 1Z1BA 2V88A 2YTQA 2YPNA 2ZM6E 5LL6R 2N3HA 1T39A 5AC4A 2EM7A 2EOOA 2PRTA 5T6JA 2JPAA 2EM3A 2D9HA 1X49A 4WSGA 4BS9A 4X66E 4WSPA 1ZBQA 3MSWA 2CSHA 5IXMB 4LF7E 2M1SA 2LVHA 2L2MA 2RSMA 4DR4E 2HHHE 4DV0E 2EJ4A 2DLKA 2EMZA 4R8OA 2GLIA 4P78A 1J5EE 2EMAA 2L8TA 1ZBTA 4LF9E 4X64E 1T38A 1AAYA 2DGCA 2UUCE 1MEYC 2EOZA 4FK5C 2EN8A 1NCSA 2L92A 2JOXA 3OMLA 4WPYA 4F9AB 3THNA 2JVAA 4DUZE 5BR8E 4JYAE 4BC9A 1HNZE 4TUIA 2EMHA 2EQ1A 1PKPA 4ZYGA 4R03A 2F4VE 2V87A 1G2DC 1X6HA 2H36X 2CT1A 1QU6A 4JI0E 5A6KA 2EM0A 1WHNA 3AV0A 2EMBA 1RC7A 2E1MA 2Q8UA 2B7VA 5A6BD 3BGHA
chains in the Genus database with same CATH topology
5CFFE 5F3WA 4B3TE 4LF8E 2V8QB 1N34E 3FIGA 4BMJA 1XMOE 3HQ1A 4LTYA 1WXRA 4F9CB 1X48A 2LBSB 2FGGA 2VQFE 1XMQE 1YZ9A 3DF6A 1HNWE 2G7HA 3JU0A 1YYOA 1GZ6A 3T1HE 2YT4A 2N3GA 2LJHA 2DB2A 1N36E 4JI1E 2CPNA 4DV5E 1RQ0A 4B3SE 4GKKE 4B3RE 1UILA 3VYYA 3ADGA 3ADJA 5LMNE 4DR2E 4M0VA 4LFCE 4NXME 5DNYA 1FJGE 4LFBE 2L2NA 4WFTA 1T4LB 1UHZA 2UUAE 4DR5E 1EKZA 1T4OA 2LRSA 4B3ME 3RMPA 1XNRE 3VYXA 4JI8E 4LF5E 2UXDE 2RS6A 2M7QA 4WYQB 1XNQE 4DR6E 4LF4E 2B3TB 3OTOE 2UXCE 4DUYE 4DR3E 4LF6E 4LU9A 2VF1A 3J81C 2UUBE 2NA2A 2V86A 4OX9E 3JTZA 3T1YE 2L6MA 3KWRA 2JOBA 3LMLA 3ZOQB 4JI7E 2IHR1 4GKJE 2M4IA 2B9DA 2VE7C 3DJWA 2DMYA 2JWOA 1STUA 2VQEE 5AASA 4DV2E 3HPZA 5AE1A 2V88A 2ODRC 3IWCA 2ZM6E 4J8ZA 2JR1A 5LL6R 2N3HA 3J80C 4JI3E 2FTXB 3AUZA 3F6HA 2MDRA 1O0WA 5T6JA 3HTXA 4K0KE 4NXNE 4DV3E 1X49A 4BS9A 4X66E 2RTXA 4JI4E 4JI6E 4BBYA 2FV4B 4WSPA 4M30A 2LTSA 2RS7A 3C4BA 2LUQA 1ZBQA 3MSWA 4P7DA 2WZOA 3K6QA 4DR1E 3VK6A 2NUEA 4M2ZA 1N32E 4DV4E 2L3JA 2L2KB 4LF7E 2M1SA 2L2MA 4X65E 2RSMA 4I8OA 2YZTA 2HHHE 4DR4E 4DV7E 4DV0E 1FKAE 2F8BA 2K4VA 4BCAA 4BC7A 4R8OA 4P78A 1J5EE 5LMUE 1IBLE 3J7AG 1DQ3A 4DMIA 4AQYE 2L8TA 2MC6A 2ODRD 1SR9A 1ZBTA 2V85A 4LF9E 4OOGC 2LE2A 2B7TA 4JI5E 3HXLA 4L8NA 4X64E 4KZSA 1X47A 4DKKA 1HR0E 4X62E 4DR7E 4F54A 3LLHA 2UUCE 3H09A 4JI2E 2EWLA 2MC5A 2NUFA 2L92A 1I94E 2JOXA 3OMLA 3J7Yp 4WPYA 3IWBA 4F9AB 1DI2A 4X8WA 5A2QC 2JVAA 4DUZE 5BR8E 5IT9C 1HNXE 4YHHE 1GQEA 4JYAE 2DSYA 2KONA 5IWAE 2V89A 4JV5E 1T4NA 5ADZA 2NUGA 4BC9A 1HNZE 1J26A 1YYWA 1IBME 2LTRA 2KHXA 4TUIA 2EZ6A 3P1XA 2L3CA 1IBKE 4TUGA 4L5NC 1PKPA 3ADLA 4R03A 2F4VE 2V83A 2V87A 2KOUA 3JAMC 5AE3A 4DV1E 4LFAE 5AE2A 1YYKA 2H36X 4DV6E 1WHQA 1QU6A 3IWDA 2E5LE 2UU9E 4JI0E 4YY3E 3F6GA 3ADIA 1WHNA 5FLXC 3AV0A 2L33A 1RC7A 2JY9A 4F9BB 2UXBE 1N33E 2DIXA 2E1MA 3C4TA 3HPSA 2LMZA 4GEQB 4Q28A 2B7VA 2LUPB 4KHPE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M7Q A;  5AAS A;  4BMJ A; 
#chains in the Genus database with same CATH topology
 4LF8 E;  2EOS A;  1N34 E;  1A1H A;  4O24 A;  1YZ9 A;  1X48 A;  3KZY A;  2HGH A;  1IQS A;  1YYO A;  3T1H E;  3VHT B;  4DV5 E;  4B3S E;  3VYY A;  4NXM E;  2EN4 A;  5LLQ A;  1EKZ A;  2LRS A;  2EPP A;  2EMW A;  3VYX A;  4LF5 E;  1AH5 A;  2EN1 A;  1A1J A;  2LO3 A;  1XNQ E;  4IJD A;  2GPI A;  4BHC A;  4MLV A;  2EMI A;  1YSA C;  2EP3 A;  2ENA A;  3JTZ A;  1B69 A;  2WBU A;  2EM4 A;  3T1Y E;  3EPH A;  2I13 A;  2JOB A;  2EOR A;  2YWQ A;  3LML A;  4JI7 E;  3ZOQ B;  4O4K A;  1A1K A;  3DJW A;  2EM2 A;  4R2Q A;  1STU A;  2VQE E;  2ODR C;  4J8Z A;  2JR1 A;  2R1F A;  3J80 C;  1BBO A;  2MDR A;  4K0K E;  1JK1 A;  4NXN E;  1A1F A;  2RTX A;  4BBY A;  2FV4 B;  2LTS A;  2LUQ A;  3VK6 A;  1DGC A;  3KZZ A;  2L2K B;  1KJK A;  3BBG A;  2F8B A;  4BCA A;  1PJQ A;  2EML A;  2EN3 A;  2R76 A;  4DMI A;  4AQY E;  1MGT A;  2MC6 A;  4R2A A;  2V85 A;  4WXD A;  2LE2 A;  5A6B A;  2GHF A;  4RHB B;  3H09 A;  5A69 A;  4KWY A;  1BBG A;  5A2Q C;  4IS1 C;  5IWA E;  1T4N A;  2I9I A;  1J26 A;  2LTR A;  2KHX A;  2EL6 A;  4WXC A;  3C6K A;  3JAM C;  5AE3 A;  3BID A;  4DV6 E;  3IWD A;  2E5L E;  1UN6 B;  2NAB A;  4YY3 E;  2EMY A;  5KL3 A;  2EOH A;  2YRK A;  2EN6 A;  5F3W A;  4BMJ A;  4LTY A;  2UXB E;  2EL5 A;  2YTD A;  2G7H A;  2EM6 A;  2YT4 A;  2N3G A;  3EQ1 A;  2DB2 A;  2CPN A;  4GKK E;  1RQ0 A;  1TF6 A;  3ADJ A;  4LFB E;  4ZYE A;  5A6J A;  1XNR E;  4R2D A;  2BB8 A;  2RS6 A;  2M7Q A;  4WYQ B;  4DR6 E;  2WCC 3;  4LF4 E;  2UXC E;  4DUY E;  4DR3 E;  4LU9 A;  2EOY A;  2JXP A;  2MDG A;  2NA2 A;  2MKN A;  2L6M A;  1YFH A;  2YTF A;  3KWR A;  2CTD A;  2M4I A;  4X9J A;  4F6N A;  2VE7 C;  2DMY A;  1X3C A;  2EMK A;  2JWO A;  5IV8 B;  2YSO A;  5AC5 A;  1EH7 A;  3HPZ A;  1TN9 A;  4JI3 E;  2FTX B;  3F6H A;  1RMD A;  1GTK A;  1NEI A;  4Q35 B;  2EOX A;  4JI6 E;  2WBT A;  2EMC A;  2EPM X;  4M30 A;  2RS7 A;  3C4B A;  4P7D A;  2WZO A;  3K6Q A;  4BHB A;  4M2Z A;  1N32 E;  1IMU A;  4X65 E;  2YRM A;  4BC7 A;  1YUI A;  5LMU E;  1IBL E;  3J7A G;  4R2C A;  1WJP A;  1N3G A;  2EPX A;  2ODR D;  2EMF A;  2EPN A;  1L4S A;  4OOG C;  4JI5 E;  1F2I G;  2YTO A;  4KZS A;  4DKK A;  1HR0 E;  2EQ3 A;  4R2R A;  4DR7 E;  4F54 A;  3C6M A;  3LLH A;  2EWL A;  2MKD A;  2MC5 A;  2DRP A;  2NUF A;  1SFE A;  2LJU A;  2EPK X;  3IWB A;  4YHH E;  1GQE A;  1EH6 A;  2KON A;  5ADZ A;  1JK2 A;  2NUG A;  3L00 A;  1YYW A;  1IBM E;  2RPC A;  2EZ6 A;  1A1G A;  3P1X A;  2M9A A;  4R2E A;  4L5N C;  3ADL A;  4RH8 A;  2V83 A;  4DV1 E;  1PJS A;  4O43 A;  2YU5 A;  1YPN A;  2UU9 E;  1TF3 A;  4GZN C;  4WX9 A;  2EQ0 A;  2L33 A;  4R2P A;  1ZR9 A;  2JY9 A;  4F9B B;  1BB8 A;  2DIX A;  1X6F A;  3HPS A;  4Q28 A;  2LMZ A;  2HJJ A;  4NZV A;  4KHP E;  3BF2 A;  3FIG A;  1XMO E;  3UK3 C;  2EPZ A;  3HQ1 A;  4F9C B;  2JYA A;  2VQF E;  1HNW E;  3DF6 A;  2WBS A;  2EPC A;  2LJH A;  1N36 E;  3EPL A;  2BBG A;  3ADG A;  5DNY A;  2L2N A;  1UHZ A;  2EOJ A;  3RMP A;  2EPL X;  2RSI A;  2UXD E;  1IQO A;  2EM5 A;  2B3T B;  4LF6 E;  2EMG A;  2VF1 A;  1A1I A;  1G2F C;  2YRH A;  2EOQ A;  4GKJ E;  2B9D A;  2EOE A;  5KL7 A;  1X5W A;  2JP9 A;  5AE1 A;  3IWC A;  2YTE A;  1PDA A;  2DMI A;  1P47 A;  3AUZ A;  2ELY A;  1O0W A;  3HTX A;  4DV3 E;  4JI4 E;  2RQL A;  4B3R E;  2NUE A;  3EPJ A;  1A1L A;  4DR1 E;  2EOF A;  4DV4 E;  2L3J A;  2DLQ A;  4I8O A;  2YZT A;  4DV7 E;  1FKA E;  2K4V A;  1X6E A;  1ZAA C;  1DQ3 A;  1WRJ A;  2ADR A;  4HEI A;  4N4R B;  1SR9 A;  5KL5 A;  2YU8 A;  2B7T A;  4O5G A;  2EM8 A;  3HXL A;  4L8N A;  4HTG A;  1X47 A;  4X62 E;  4JI2 E;  1PJT A;  3M99 B;  2YTN A;  1QNT A;  1I94 E;  3J7Y p;  1DI2 A;  4X8W A;  5IT9 C;  4M9V C;  2EE8 A;  1HNX E;  2EMX A;  2EOI A;  2EPU A;  3EPK A;  2DSY A;  1YUJ A;  4JV5 E;  2V89 A;  1KYQ A;  4MLQ A;  2LV2 A;  2ENC A;  2E72 A;  2EOM A;  3MHS C;  5KL2 A;  2L3C A;  1IBK E;  4TUG A;  2YTG A;  1LLM C;  2K7I A;  2EL4 A;  4NHR A;  2EN7 A;  2J7J A;  1EH8 A;  2KOU A;  4LFA E;  1YYK A;  5AE2 A;  2EN2 A;  2EPA A;  1WHQ A;  5A6A A;  4F6M A;  3F6G A;  3ADI A;  5FLX C;  5TSE A;  2ENH A;  2ELZ A;  3QG5 C;  2LT7 A;  1N33 E;  3C4T A;  4GEQ B;  2LUP B;  4ZYH A;  5CFF E;  2YTJ A;  4B3T E;  3TQM A;  2V8Q B;  5KL4 A;  2EPO A;  2YSP A;  2LBS B;  1WXR A;  2FGG A;  2YTP A;  1XMQ E;  3JU0 A;  2LCE A;  1GZ6 A;  2A25 A;  2EM9 A;  4ZYD A;  2N8X A;  4JI1 E;  1UIL A;  2VRD A;  3THO B;  4DR2 E;  5LMN E;  4LFC E;  1FJG E;  4M0V A;  3MHH C;  2YTI A;  4WFT A;  1T4L B;  2UUA E;  4DR5 E;  1T4O A;  4B3M E;  1ZU1 A;  4R2S A;  4JI8 E;  2EPR A;  3OTO E;  2HC5 A;  3J81 C;  2UUB E;  1UBD C;  2V86 A;  4OX9 E;  5KL6 A;  3ECR A;  2IHR 1;  5AAS A;  4F2J C;  4DV2 E;  1Z1B A;  2V88 A;  2YTQ A;  2YPN A;  2ZM6 E;  5LL6 R;  2N3H A;  1T39 A;  5AC4 A;  2EM7 A;  2EOO A;  2PRT A;  5T6J A;  2JPA A;  2EM3 A;  2D9H A;  1X49 A;  4WSG A;  4BS9 A;  4X66 E;  4WSP A;  1ZBQ A;  3MSW A;  2CSH A;  5IXM B;  4LF7 E;  2M1S A;  2LVH A;  2L2M A;  2RSM A;  4DR4 E;  2HHH E;  4DV0 E;  2EJ4 A;  2DLK A;  2EMZ A;  4R8O A;  2GLI A;  4P78 A;  1J5E E;  2EMA A;  2L8T A;  1ZBT A;  4LF9 E;  4X64 E;  1T38 A;  1AAY A;  2DGC A;  2UUC E;  1MEY C;  2EOZ A;  4FK5 C;  2EN8 A;  1NCS A;  2L92 A;  2JOX A;  3OML A;  4WPY A;  4F9A B;  3THN A;  2JVA A;  4DUZ E;  5BR8 E;  4JYA E;  4BC9 A;  1HNZ E;  4TUI A;  2EMH A;  2EQ1 A;  1PKP A;  4ZYG A;  4R03 A;  2F4V E;  2V87 A;  1G2D C;  1X6H A;  2H36 X;  2CT1 A;  1QU6 A;  4JI0 E;  5A6K A;  2EM0 A;  1WHN A;  3AV0 A;  2EMB A;  1RC7 A;  2E1M A;  2Q8U A;  2B7V A;  5A6B D;  3BGH A; 
#chains in the Genus database with same CATH homology
 5CFF E;  5F3W A;  4B3T E;  4LF8 E;  2V8Q B;  1N34 E;  3FIG A;  4BMJ A;  1XMO E;  3HQ1 A;  4LTY A;  1WXR A;  4F9C B;  1X48 A;  2LBS B;  2FGG A;  2VQF E;  1XMQ E;  1YZ9 A;  3DF6 A;  1HNW E;  2G7H A;  3JU0 A;  1YYO A;  1GZ6 A;  3T1H E;  2YT4 A;  2N3G A;  2LJH A;  2DB2 A;  1N36 E;  4JI1 E;  2CPN A;  4DV5 E;  1RQ0 A;  4B3S E;  4GKK E;  4B3R E;  1UIL A;  3VYY A;  3ADG A;  3ADJ A;  5LMN E;  4DR2 E;  4M0V A;  4LFC E;  4NXM E;  5DNY A;  1FJG E;  4LFB E;  2L2N A;  4WFT A;  1T4L B;  1UHZ A;  2UUA E;  4DR5 E;  1EKZ A;  1T4O A;  2LRS A;  4B3M E;  3RMP A;  1XNR E;  3VYX A;  4JI8 E;  4LF5 E;  2UXD E;  2RS6 A;  2M7Q A;  4WYQ B;  1XNQ E;  4DR6 E;  4LF4 E;  2B3T B;  3OTO E;  2UXC E;  4DUY E;  4DR3 E;  4LF6 E;  4LU9 A;  2VF1 A;  3J81 C;  2UUB E;  2NA2 A;  2V86 A;  4OX9 E;  3JTZ A;  3T1Y E;  2L6M A;  3KWR A;  2JOB A;  3LML A;  3ZOQ B;  4JI7 E;  2IHR 1;  4GKJ E;  2M4I A;  2B9D A;  2VE7 C;  3DJW A;  2DMY A;  2JWO A;  1STU A;  2VQE E;  5AAS A;  4DV2 E;  3HPZ A;  5AE1 A;  2V88 A;  2ODR C;  3IWC A;  2ZM6 E;  4J8Z A;  2JR1 A;  5LL6 R;  2N3H A;  3J80 C;  4JI3 E;  2FTX B;  3AUZ A;  3F6H A;  2MDR A;  1O0W A;  5T6J A;  3HTX A;  4K0K E;  4NXN E;  4DV3 E;  1X49 A;  4BS9 A;  4X66 E;  2RTX A;  4JI4 E;  4JI6 E;  4BBY A;  2FV4 B;  4WSP A;  4M30 A;  2LTS A;  2RS7 A;  3C4B A;  2LUQ A;  1ZBQ A;  3MSW A;  4P7D A;  2WZO A;  3K6Q A;  4DR1 E;  3VK6 A;  2NUE A;  4M2Z A;  1N32 E;  4DV4 E;  2L3J A;  2L2K B;  4LF7 E;  2M1S A;  2L2M A;  4X65 E;  2RSM A;  4I8O A;  2YZT A;  2HHH E;  4DR4 E;  4DV7 E;  4DV0 E;  1FKA E;  2F8B A;  2K4V A;  4BCA A;  4BC7 A;  4R8O A;  4P78 A;  1J5E E;  5LMU E;  1IBL E;  3J7A G;  1DQ3 A;  4DMI A;  4AQY E;  2L8T A;  2MC6 A;  2ODR D;  1SR9 A;  1ZBT A;  2V85 A;  4LF9 E;  4OOG C;  2LE2 A;  2B7T A;  4JI5 E;  3HXL A;  4L8N A;  4X64 E;  4KZS A;  1X47 A;  4DKK A;  1HR0 E;  4X62 E;  4DR7 E;  4F54 A;  3LLH A;  2UUC E;  3H09 A;  4JI2 E;  2EWL A;  2MC5 A;  2NUF A;  2L92 A;  1I94 E;  2JOX A;  3OML A;  3J7Y p;  4WPY A;  3IWB A;  4F9A B;  1DI2 A;  4X8W A;  5A2Q C;  2JVA A;  4DUZ E;  5BR8 E;  5IT9 C;  1HNX E;  4YHH E;  1GQE A;  4JYA E;  2DSY A;  2KON A;  5IWA E;  2V89 A;  4JV5 E;  1T4N A;  5ADZ A;  2NUG A;  4BC9 A;  1HNZ E;  1J26 A;  1YYW A;  1IBM E;  2LTR A;  2KHX A;  4TUI A;  2EZ6 A;  3P1X A;  2L3C A;  1IBK E;  4TUG A;  4L5N C;  1PKP A;  3ADL A;  4R03 A;  2F4V E;  2V83 A;  2V87 A;  2KOU A;  3JAM C;  5AE3 A;  4DV1 E;  4LFA E;  5AE2 A;  1YYK A;  2H36 X;  4DV6 E;  1WHQ A;  1QU6 A;  3IWD A;  2E5L E;  2UU9 E;  4JI0 E;  4YY3 E;  3F6G A;  3ADI A;  1WHN A;  5FLX C;  3AV0 A;  2L33 A;  1RC7 A;  2JY9 A;  4F9B B;  2UXB E;  1N33 E;  2DIX A;  2E1M A;  3C4T A;  3HPS A;  2LMZ A;  4GEQ B;  4Q28 A;  2B7V A;  2LUP B;  4KHP E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...