2M7QA

Solution structure of tax1bp1 ubz1+2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
GPHMDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tax1-binding protein 1
publication title The Structure of Tax1bp1 Ubz1+2 Provides Insight into Target Specificity and Adaptability
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 20
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18112 Zn-C2H2_12 Autophagy receptor zinc finger-C2H2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.550 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2m7qA00
2M7QA 4BMJA 5AASA
chains in the Genus database with same CATH superfamily
3DJWA 2ADRA 4L5NC 2LO3A 2EL6A 3T1HE 3P1XA 3IWCA 2EOIA 1WRJA 1X49A 3THOB 5A6BD 4DR7E 2DSYA 1TF6A 2EPXA 4JI2E 2IHR1 3ADJA 2LV2A 2EOMA 3OTOE 1N34E 3ADGA 5LL6R 1DI2A 2EQ1A 4GKJE 1JK1A 2EPPA 2CT1A 2ENCA 1B69A 4F6NA 5LMUE 2FV4B 3RMPA 4O5GA 1YYOA 4TUGA 1PKPA 2FGGA 4LFAE 4I8OA 1N32E 1FJGE 1YZ9A 4R2DA 1DGCA 5KL6A 1YYWA 2EMZA 5KL4A 2EPRA 2L3CA 2EOXA 3MSWA 4LFBE 1YSAC 4DR6E 1BBOA 4O24A 1AAYA 2LBSB 2EOYA 2DB2A 1ZR9A 5KL2A 4DV1E 5KL3A 2DLKA 2K7IA 4ZYGA 1J5EE 1PJSA 4DR5E 2EPZA 1T4NA 2EMGA 4ZYHA 2EPLX 1BBGA 3DF6A 1ZAAC 5DNYA 2V8QB 2RS7A 1T4LB 2LVHA 2YRMA 2DGCA 4TUIA 2ELYA 2EN8A 4IJDA 2GHFA 2EOEA 4KHPE 2D9HA 4ZYEA 4ZYDA 4M9VC 1STUA 2HJJA 4RHBB 3BIDA 2UXBE 2EMCA 2K4VA 3AUZA 2L2KB 4JI7E 2VQEE 4DV0E 5F3WA 2LE2A 2WZOA 1EH7A 2YTOA 4M30A 5AC5A 2B7VA 2YTEA 4DV4E 1LLMC 4MLQA 1QNTA 2EWLA 1YUIA 1AH5A 2EOHA 2EE8A 2EMFA 2EOSA 4JI6E 4NXNE 2V87A 4LF6E 2EOOA 3J81C 1WJPA 2EM5A 2EM6A 2M1SA 3HXLA 4X62E 2MDRA 2B7TA 4B3TE 2J7JA 3LMLA 2CSHA 4LF8E 4AQYE 2UXDE 2YSOA 3BBGA 1HNWE 4R2QA 4WFTA 1WHQA 2MDGA 1L4SA 3VK6A 4BHCA 2ZM6E 1A1IA 2EMBA 3H09A 2EMIA 4GZNC 4DR4E 5T6JA 5CFFE 2JVAA 3T1YE 2EM8A 4X66E 3HTXA 1X5WA 1MGTA 5A6BA 1Z1BA 4P7DA 3ECRA 4IS1C 2LTSA 4L8NA 2YSPA 3C4TA 1XNQE 2N3HA 4DUYE 3ADLA 1P47A 1X47A 1GZ6A 2EPCA 1IBKE 4B3ME 4WYQB 3J80C 1F2IG 4JI1E 2L2MA 4F54A 5AASA 5IWAE 2EPKX 1G2FC 4JYAE 2EPAA 2KONA 4RH8A 2NUEA 5A2QC 1I94E 2YTFA 2CTDA 4DMIA 5IXMB 4X64E 4JI5E 3EQ1A 3AV0A 3BGHA 4OX9E 4KZSA 4LF9E 4BMJA 2JY9A 2FTXB 2JYAA 3OMLA 4HTGA 1X48A 1T4OA 4YY3E 4DR2E 4LU9A 2EM7A 5A69A 3ZOQB 2YT4A 2EM3A 1A1KA 2EMWA 1G2DC 1T38A 3EPLA 2YU5A 1A1JA 3K6QA 1O0WA 1ZBTA 5AE1A 1UN6B 5KL5A 1EH6A 3IWDA 2NUFA 2YTJA 4WXCA 2JWOA 4R2AA 1JK2A 1UBDC 2YTQA 1DQ3A 4BBYA 4GEQB 1IQOA 3HQ1A 5ADZA 5IT9C 2EPUA 1BB8A 2L33A 2YTDA 4O4KA 5A6AA 2F8BA 2WBUA 2LRSA 2MKNA 2JPAA 2RSMA 4BCAA 1WXRA 4JI0E 3KZYA 1X6FA 4WSGA 4BS9A 1TF3A 3UK3C 2EN1A 2EMLA 2UXCE 2LMZA 2CPNA 2RS6A 1PDAA 3MHSC 4GKKE 2VF1A 2H36X 1HNZE 4JI8E 3ADIA 2EOZA 2GPIA 3JTZA 2N3GA 2B3TB 2VE7C 1XMQE 4JI3E 2EQ3A 2V85A 2EM0A 1TN9A 2EM2A 2HGHA 3QG5C 2RQLA 1PJQA 2E1MA 2EORA 3C6MA 3MHHC 4R03A 5BR8E 2ENAA 2KOUA 2EMXA 3EPJA 1RC7A 4JV5E 2R76A 4P78A 4R2RA 2L8TA 2EP3A 4R2PA 2VQFE 1MEYC 4YHHE 2DLQA 2ODRD 4WX9A 2EZ6A 2NA2A 3L00A 1GTKA 2EOQA 2EPNA 2JOXA 1A1GA 2EN3A 2EOFA 3C4BA 4KWYA 4N4RB 2MC6A 4R2CA 2EL5A 1N36E 4DV2E 5AE3A 2KHXA 1RMDA 1EH8A 2YWQA 2HHHE 4NXME 2EPOA 5LMNE 1HR0E 2JXPA 4LF5E 3HPZA 3FIGA 4X9JA 2LJUA 2EMYA 1QU6A 2EPMX 4NHRA 4J8ZA 2JOBA 1A1LA 1GQEA 2L2NA 2YRKA 1NEIA 2I9IA 1PJTA 2NABA 2ODRC 2ENHA 1N33E 2YZTA 2V83A 4R2EA 4BC9A 2PRTA 2LUQA 2RPCA 4DUZE 2A25A 3J7Yp 2I13A 4DV7E 1IBME 4DR1E 2YPNA 3JU0A 1ZU1A 2YTGA 1RQ0A 1YFHA 1KJKA 4DV6E 1FKAE 5TSEA 2HC5A 4LTYA 2EN2A 1HNXE 4X65E 2EQ0A 2WCC3 2LJHA 2LT7A 2E5LE 1IQSA 2EM9A 3VHTB 1X6HA 4WPYA 2DRPA 1WHNA 3M99B 2VRDA 2EMAA 1X3CA 2G7HA 4O43A 1X6EA 2LUPB 4DR3E 4F6MA 4DV5E 2V89A 2L6MA 3KWRA 3F6HA 4R8OA 3EPKA 2ELZA 2Q8UA 2BBGA 2EJ4A 1A1FA 2YTNA 4LF4E 3TQMA 3C6KA 2YTPA 4HEIA 3VYXA 2M7QA 4MLVA 4JI4E 1YUJA 3THNA 4K0KE 2DIXA 2E72A 4Q28A 5AC4A 3F6GA 1UHZA 2N8XA 4F2JC 2EOJA 4B3SE 2EN7A 3J7AG 4F9CB 1NCSA 2YU8A 2UUAE 2NUGA 1J26A 2EN6A 2UUCE 4FK5C 3VYYA 4LF7E 2EN4A 1A1HA 1XNRE 4R2SA 4WXDA 5A6KA 2DMYA 2MC5A 5LLQA 2M4IA 2L92A 1UILA 4M2ZA 2MKDA 2JR1A 2V86A 2EM4A 5AE2A 5IV8B 2YRHA 3BF2A 1KYQA 5A6JA 2EMHA 2RSIA 2LTRA 4F9BB 2JP9A 1XMOE 2BB8A 4M0VA 3KZZA 4NZVA 2GLIA 2L3JA 1SR9A 3LLHA 4Q35B 1IBLE 2DMIA 2M9AA 3EPHA 4X8WA 2B9DA 2WBSA 4B3RE 1T39A 4F9AB 2UU9E 2UUBE 4DV3E 3IWBA 4WSPA 2WBTA 1SFEA 2V88A 2R1FA 5KL7A 1EKZA 4LFCE 4BC7A 3JAMC 2YTIA 5FLXC 2LCEA 2EMKA 1YPNA 1N3GA 2F4VE 4BHBA 1YYKA 4DKKA 4OOGC 1ZBQA 1IMUA 2EL4A 3HPSA 2RTXA
chains in the Genus database with same CATH topology
2F8BA 4JI6E 3DJWA 4NXNE 2V87A 4L5NC 4LTYA 4LF6E 1HNXE 2LRSA 4X65E 2LJHA 3J81C 3T1HE 3P1XA 3IWCA 2E5LE 2RSMA 1X49A 4BCAA 4DR7E 1WXRA 4WPYA 2M1SA 2DSYA 4JI0E 3HXLA 1WHNA 2MDRA 4BS9A 4X62E 4JI2E 2B7TA 2IHR1 4B3TE 3ADJA 2G7HA 2UXCE 3OTOE 2LMZA 2CPNA 2RS6A 3LMLA 4LF8E 4GKKE 2LUPB 2VF1A 4AQYE 3ADGA 2H36X 4DR3E 1N34E 2UXDE 5LL6R 1HNZE 1DI2A 1HNWE 4JI8E 3ADIA 4WFTA 4DV5E 2V89A 2N3GA 2B3TB 1WHQA 2L6MA 2VE7C 3JTZA 3KWRA 1XMQE 4JI3E 4GKJE 2V85A 3VK6A 3F6HA 4R8OA 2ZM6E 3H09A 4LF4E 4DR4E 3VYXA 5LMUE 2E1MA 4R03A 2FV4B 5T6JA 5BR8E 2JVAA 5CFFE 2M7QA 3RMPA 1YYOA 4JI4E 3T1YE 2KOUA 4X66E 4TUGA 3HTXA 4K0KE 1RC7A 1PKPA 2DIXA 2FGGA 4Q28A 4LFAE 4JV5E 4I8OA 3F6GA 4P7DA 1FJGE 1UHZA 4P78A 1N32E 2L8TA 1YZ9A 2LTSA 4L8NA 4B3SE 1YYWA 3C4TA 1XNQE 2VQFE 1FKAE 3J7AG 2N3HA 4F9CB 4YHHE 2UUAE 2NUGA 1J26A 2L3CA 4DUYE 2UUCE 3ADLA 2ODRD 3VYYA 1X47A 4LF7E 1GZ6A 2EZ6A 2NA2A 1IBKE 3MSWA 1XNRE 4LFBE 4B3ME 2JOXA 4WYQB 3J80C 2DMYA 2MC5A 2L2MA 3C4BA 2M4IA 4F54A 5AASA 5IWAE 2L92A 4JI1E 4DR6E 4JYAE 2KONA 2MC6A 1UILA 2LBSB 4M2ZA 5A2QC 1I94E 2NUEA 2JR1A 2DB2A 1N36E 4DV2E 5AE3A 2KHXA 2V86A 5AE2A 4DMIA 4X64E 4DV1E 4JI5E 2HHHE 4NXME 3AV0A 1J5EE 5LMNE 4DR5E 1T4NA 2LTRA 4F9BB 3DF6A 1HR0E 4OX9E 4KZSA 5DNYA 1XMOE 4LF5E 3HPZA 4M0VA 2V8QB 4BMJA 3FIGA 2JY9A 2RS7A 4LF9E 1T4LB 2FTXB 3OMLA 2L3JA 1SR9A 3LLHA 4TUIA 1QU6A 1X48A 1T4OA 1IBLE 4YY3E 4DR2E 4J8ZA 4LU9A 2JOBA 1GQEA 4X8WA 4KHPE 2B9DA 2L2NA 4B3RE 3ZOQB 2YT4A 4F9AB 2UU9E 2UUBE 4DV3E 3IWBA 2ODRC 4WSPA 1STUA 2V88A 2K4VA 2UXBE 1N33E 2YZTA 3AUZA 1O0WA 1ZBTA 3K6QA 2L2KB 4JI7E 2V83A 5AE1A 2VQEE 1EKZA 4BC9A 4DV0E 3IWDA 5F3WA 2LUQA 2NUFA 4DUZE 4LFCE 2LE2A 2WZOA 4M30A 4BC7A 3JAMC 5FLXC 2JWOA 2B7VA 3J7Yp 4DV7E 1IBME 4DR1E 4DV4E 2F4VE 3JU0A 1DQ3A 1YYKA 4BBYA 4DKKA 2EWLA 4GEQB 4OOGC 1ZBQA 1RQ0A 3HQ1A 5ADZA 5IT9C 3HPSA 4DV6E 2L33A 2RTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M7Q A;  4BMJ A;  5AAS A; 
#chains in the Genus database with same CATH topology
 3DJW A;  2ADR A;  4L5N C;  2LO3 A;  2EL6 A;  3T1H E;  3P1X A;  3IWC A;  2EOI A;  1WRJ A;  1X49 A;  3THO B;  5A6B D;  4DR7 E;  2DSY A;  1TF6 A;  2EPX A;  4JI2 E;  2IHR 1;  3ADJ A;  2LV2 A;  2EOM A;  3OTO E;  1N34 E;  3ADG A;  5LL6 R;  1DI2 A;  2EQ1 A;  4GKJ E;  1JK1 A;  2EPP A;  2CT1 A;  2ENC A;  1B69 A;  4F6N A;  5LMU E;  2FV4 B;  3RMP A;  4O5G A;  1YYO A;  4TUG A;  1PKP A;  2FGG A;  4LFA E;  4I8O A;  1N32 E;  1FJG E;  1YZ9 A;  4R2D A;  1DGC A;  5KL6 A;  1YYW A;  2EMZ A;  5KL4 A;  2EPR A;  2L3C A;  2EOX A;  3MSW A;  4LFB E;  1YSA C;  4DR6 E;  1BBO A;  4O24 A;  1AAY A;  2LBS B;  2EOY A;  2DB2 A;  1ZR9 A;  5KL2 A;  4DV1 E;  5KL3 A;  2DLK A;  2K7I A;  4ZYG A;  1J5E E;  1PJS A;  4DR5 E;  2EPZ A;  1T4N A;  2EMG A;  4ZYH A;  2EPL X;  1BBG A;  3DF6 A;  1ZAA C;  5DNY A;  2V8Q B;  2RS7 A;  1T4L B;  2LVH A;  2YRM A;  2DGC A;  4TUI A;  2ELY A;  2EN8 A;  4IJD A;  2GHF A;  2EOE A;  4KHP E;  2D9H A;  4ZYE A;  4ZYD A;  4M9V C;  1STU A;  2HJJ A;  4RHB B;  3BID A;  2UXB E;  2EMC A;  2K4V A;  3AUZ A;  2L2K B;  4JI7 E;  2VQE E;  4DV0 E;  5F3W A;  2LE2 A;  2WZO A;  1EH7 A;  2YTO A;  4M30 A;  5AC5 A;  2B7V A;  2YTE A;  4DV4 E;  1LLM C;  4MLQ A;  1QNT A;  2EWL A;  1YUI A;  1AH5 A;  2EOH A;  2EE8 A;  2EMF A;  2EOS A;  4JI6 E;  4NXN E;  2V87 A;  4LF6 E;  2EOO A;  3J81 C;  1WJP A;  2EM5 A;  2EM6 A;  2M1S A;  3HXL A;  4X62 E;  2MDR A;  2B7T A;  4B3T E;  2J7J A;  3LML A;  2CSH A;  4LF8 E;  4AQY E;  2UXD E;  2YSO A;  3BBG A;  1HNW E;  4R2Q A;  4WFT A;  1WHQ A;  2MDG A;  1L4S A;  3VK6 A;  4BHC A;  2ZM6 E;  1A1I A;  2EMB A;  3H09 A;  2EMI A;  4GZN C;  4DR4 E;  5T6J A;  5CFF E;  2JVA A;  3T1Y E;  2EM8 A;  4X66 E;  3HTX A;  1X5W A;  1MGT A;  5A6B A;  1Z1B A;  4P7D A;  3ECR A;  4IS1 C;  2LTS A;  4L8N A;  2YSP A;  3C4T A;  1XNQ E;  2N3H A;  4DUY E;  3ADL A;  1P47 A;  1X47 A;  1GZ6 A;  2EPC A;  1IBK E;  4B3M E;  4WYQ B;  3J80 C;  1F2I G;  4JI1 E;  2L2M A;  4F54 A;  5AAS A;  5IWA E;  2EPK X;  1G2F C;  4JYA E;  2EPA A;  2KON A;  4RH8 A;  2NUE A;  5A2Q C;  1I94 E;  2YTF A;  2CTD A;  4DMI A;  5IXM B;  4X64 E;  4JI5 E;  3EQ1 A;  3AV0 A;  3BGH A;  4OX9 E;  4KZS A;  4LF9 E;  4BMJ A;  2JY9 A;  2FTX B;  2JYA A;  3OML A;  4HTG A;  1X48 A;  1T4O A;  4YY3 E;  4DR2 E;  4LU9 A;  2EM7 A;  5A69 A;  3ZOQ B;  2YT4 A;  2EM3 A;  1A1K A;  2EMW A;  1G2D C;  1T38 A;  3EPL A;  2YU5 A;  1A1J A;  3K6Q A;  1O0W A;  1ZBT A;  5AE1 A;  1UN6 B;  5KL5 A;  1EH6 A;  3IWD A;  2NUF A;  2YTJ A;  4WXC A;  2JWO A;  4R2A A;  1JK2 A;  1UBD C;  2YTQ A;  1DQ3 A;  4BBY A;  4GEQ B;  1IQO A;  3HQ1 A;  5ADZ A;  5IT9 C;  2EPU A;  1BB8 A;  2L33 A;  2YTD A;  4O4K A;  5A6A A;  2F8B A;  2WBU A;  2LRS A;  2MKN A;  2JPA A;  2RSM A;  4BCA A;  1WXR A;  4JI0 E;  3KZY A;  1X6F A;  4WSG A;  4BS9 A;  1TF3 A;  3UK3 C;  2EN1 A;  2EML A;  2UXC E;  2LMZ A;  2CPN A;  2RS6 A;  1PDA A;  3MHS C;  4GKK E;  2VF1 A;  2H36 X;  1HNZ E;  4JI8 E;  3ADI A;  2EOZ A;  2GPI A;  3JTZ A;  2N3G A;  2B3T B;  2VE7 C;  1XMQ E;  4JI3 E;  2EQ3 A;  2V85 A;  2EM0 A;  1TN9 A;  2EM2 A;  2HGH A;  3QG5 C;  2RQL A;  1PJQ A;  2E1M A;  2EOR A;  3C6M A;  3MHH C;  4R03 A;  5BR8 E;  2ENA A;  2KOU A;  2EMX A;  3EPJ A;  1RC7 A;  4JV5 E;  2R76 A;  4P78 A;  4R2R A;  2L8T A;  2EP3 A;  4R2P A;  2VQF E;  1MEY C;  4YHH E;  2DLQ A;  2ODR D;  4WX9 A;  2EZ6 A;  2NA2 A;  3L00 A;  1GTK A;  2EOQ A;  2EPN A;  2JOX A;  1A1G A;  2EN3 A;  2EOF A;  3C4B A;  4KWY A;  4N4R B;  2MC6 A;  4R2C A;  2EL5 A;  1N36 E;  4DV2 E;  5AE3 A;  2KHX A;  1RMD A;  1EH8 A;  2YWQ A;  2HHH E;  4NXM E;  2EPO A;  5LMN E;  1HR0 E;  2JXP A;  4LF5 E;  3HPZ A;  3FIG A;  4X9J A;  2LJU A;  2EMY A;  1QU6 A;  2EPM X;  4NHR A;  4J8Z A;  2JOB A;  1A1L A;  1GQE A;  2L2N A;  2YRK A;  1NEI A;  2I9I A;  1PJT A;  2NAB A;  2ODR C;  2ENH A;  1N33 E;  2YZT A;  2V83 A;  4R2E A;  4BC9 A;  2PRT A;  2LUQ A;  2RPC A;  4DUZ E;  2A25 A;  3J7Y p;  2I13 A;  4DV7 E;  1IBM E;  4DR1 E;  2YPN A;  3JU0 A;  1ZU1 A;  2YTG A;  1RQ0 A;  1YFH A;  1KJK A;  4DV6 E;  1FKA E;  5TSE A;  2HC5 A;  4LTY A;  2EN2 A;  1HNX E;  4X65 E;  2EQ0 A;  2WCC 3;  2LJH A;  2LT7 A;  2E5L E;  1IQS A;  2EM9 A;  3VHT B;  1X6H A;  4WPY A;  2DRP A;  1WHN A;  3M99 B;  2VRD A;  2EMA A;  1X3C A;  2G7H A;  4O43 A;  1X6E A;  2LUP B;  4DR3 E;  4F6M A;  4DV5 E;  2V89 A;  2L6M A;  3KWR A;  3F6H A;  4R8O A;  3EPK A;  2ELZ A;  2Q8U A;  2BBG A;  2EJ4 A;  1A1F A;  2YTN A;  4LF4 E;  3TQM A;  3C6K A;  2YTP A;  4HEI A;  3VYX A;  2M7Q A;  4MLV A;  4JI4 E;  1YUJ A;  3THN A;  4K0K E;  2DIX A;  2E72 A;  4Q28 A;  5AC4 A;  3F6G A;  1UHZ A;  2N8X A;  4F2J C;  2EOJ A;  4B3S E;  2EN7 A;  3J7A G;  4F9C B;  1NCS A;  2YU8 A;  2UUA E;  2NUG A;  1J26 A;  2EN6 A;  2UUC E;  4FK5 C;  3VYY A;  4LF7 E;  2EN4 A;  1A1H A;  1XNR E;  4R2S A;  4WXD A;  5A6K A;  2DMY A;  2MC5 A;  5LLQ A;  2M4I A;  2L92 A;  1UIL A;  4M2Z A;  2MKD A;  2JR1 A;  2V86 A;  2EM4 A;  5AE2 A;  5IV8 B;  2YRH A;  3BF2 A;  1KYQ A;  5A6J A;  2EMH A;  2RSI A;  2LTR A;  4F9B B;  2JP9 A;  1XMO E;  2BB8 A;  4M0V A;  3KZZ A;  4NZV A;  2GLI A;  2L3J A;  1SR9 A;  3LLH A;  4Q35 B;  1IBL E;  2DMI A;  2M9A A;  3EPH A;  4X8W A;  2B9D A;  2WBS A;  4B3R E;  1T39 A;  4F9A B;  2UU9 E;  2UUB E;  4DV3 E;  3IWB A;  4WSP A;  2WBT A;  1SFE A;  2V88 A;  2R1F A;  5KL7 A;  1EKZ A;  4LFC E;  4BC7 A;  3JAM C;  2YTI A;  5FLX C;  2LCE A;  2EMK A;  1YPN A;  1N3G A;  2F4V E;  4BHB A;  1YYK A;  4DKK A;  4OOG C;  1ZBQ A;  1IMU A;  2EL4 A;  3HPS A;  2RTX A; 
#chains in the Genus database with same CATH homology
 2F8B A;  4JI6 E;  3DJW A;  4NXN E;  2V87 A;  4L5N C;  4LTY A;  4LF6 E;  1HNX E;  2LRS A;  4X65 E;  2LJH A;  3J81 C;  3T1H E;  3P1X A;  3IWC A;  2E5L E;  2RSM A;  1X49 A;  4BCA A;  4DR7 E;  1WXR A;  4WPY A;  2M1S A;  2DSY A;  4JI0 E;  3HXL A;  1WHN A;  2MDR A;  4BS9 A;  4X62 E;  4JI2 E;  2B7T A;  2IHR 1;  4B3T E;  3ADJ A;  2G7H A;  2UXC E;  3OTO E;  2LMZ A;  2CPN A;  2RS6 A;  3LML A;  4LF8 E;  4GKK E;  2LUP B;  2VF1 A;  4AQY E;  3ADG A;  2H36 X;  4DR3 E;  1N34 E;  2UXD E;  5LL6 R;  1HNZ E;  1DI2 A;  1HNW E;  4JI8 E;  3ADI A;  4WFT A;  4DV5 E;  2V89 A;  2N3G A;  2B3T B;  1WHQ A;  2L6M A;  2VE7 C;  3JTZ A;  3KWR A;  1XMQ E;  4JI3 E;  4GKJ E;  2V85 A;  3VK6 A;  3F6H A;  4R8O A;  2ZM6 E;  3H09 A;  4LF4 E;  4DR4 E;  3VYX A;  5LMU E;  2E1M A;  4R03 A;  2FV4 B;  5T6J A;  5BR8 E;  2JVA A;  5CFF E;  2M7Q A;  3RMP A;  1YYO A;  4JI4 E;  3T1Y E;  2KOU A;  4X66 E;  4TUG A;  3HTX A;  4K0K E;  1RC7 A;  1PKP A;  2DIX A;  2FGG A;  4Q28 A;  4LFA E;  4JV5 E;  4I8O A;  3F6G A;  4P7D A;  1FJG E;  1UHZ A;  4P78 A;  1N32 E;  2L8T A;  1YZ9 A;  2LTS A;  4L8N A;  4B3S E;  1YYW A;  3C4T A;  1XNQ E;  2VQF E;  1FKA E;  3J7A G;  2N3H A;  4F9C B;  4YHH E;  2UUA E;  2NUG A;  1J26 A;  2L3C A;  4DUY E;  2UUC E;  3ADL A;  2ODR D;  3VYY A;  1X47 A;  4LF7 E;  1GZ6 A;  2EZ6 A;  2NA2 A;  1IBK E;  3MSW A;  1XNR E;  4LFB E;  4B3M E;  2JOX A;  4WYQ B;  3J80 C;  2DMY A;  2MC5 A;  2L2M A;  3C4B A;  2M4I A;  4F54 A;  5AAS A;  5IWA E;  2L92 A;  4JI1 E;  4DR6 E;  4JYA E;  2KON A;  2MC6 A;  1UIL A;  2LBS B;  4M2Z A;  5A2Q C;  1I94 E;  2NUE A;  2JR1 A;  2DB2 A;  1N36 E;  4DV2 E;  5AE3 A;  2KHX A;  2V86 A;  5AE2 A;  4DMI A;  4X64 E;  4DV1 E;  4JI5 E;  2HHH E;  4NXM E;  3AV0 A;  1J5E E;  5LMN E;  4DR5 E;  1T4N A;  2LTR A;  4F9B B;  3DF6 A;  1HR0 E;  4OX9 E;  4KZS A;  5DNY A;  1XMO E;  4LF5 E;  3HPZ A;  4M0V A;  2V8Q B;  4BMJ A;  3FIG A;  2JY9 A;  2RS7 A;  4LF9 E;  1T4L B;  2FTX B;  3OML A;  2L3J A;  1SR9 A;  3LLH A;  4TUI A;  1QU6 A;  1X48 A;  1T4O A;  1IBL E;  4YY3 E;  4DR2 E;  4J8Z A;  4LU9 A;  2JOB A;  1GQE A;  4X8W A;  4KHP E;  2B9D A;  2L2N A;  4B3R E;  3ZOQ B;  2YT4 A;  4F9A B;  2UU9 E;  2UUB E;  4DV3 E;  3IWB A;  2ODR C;  4WSP A;  1STU A;  2V88 A;  2K4V A;  2UXB E;  1N33 E;  2YZT A;  3AUZ A;  1O0W A;  1ZBT A;  3K6Q A;  2L2K B;  4JI7 E;  2V83 A;  5AE1 A;  2VQE E;  1EKZ A;  4BC9 A;  4DV0 E;  3IWD A;  5F3W A;  2LUQ A;  2NUF A;  4DUZ E;  4LFC E;  2LE2 A;  2WZO A;  4M30 A;  4BC7 A;  3JAM C;  5FLX C;  2JWO A;  2B7V A;  3J7Y p;  4DV7 E;  1IBM E;  4DR1 E;  4DV4 E;  2F4V E;  3JU0 A;  1DQ3 A;  1YYK A;  4BBY A;  4DKK A;  2EWL A;  4GEQ B;  4OOG C;  1ZBQ A;  1RQ0 A;  3HQ1 A;  5ADZ A;  5IT9 C;  3HPS A;  4DV6 E;  2L33 A;  2RTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...