1MEYC

Crystal structure of a designed zinc finger protein bound to dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
83
structure length
83
Chain Sequence
EKPYKCPECGKSFSQSSNLQKHQRTHTGEKPYKCPECGKSFSQSSDLQKHQRTHTGEKPYKCPECGKSFSRSDHLSRHQRTHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A 2.2 A Resolution Crystal Structure of a Designed Zinc Finger Protein Bound to DNA
pubmed doi rcsb
molecule tags Transferase/dna
molecule keywords DNA (5'-D(*AP*TP*GP*AP*GP*GP*CP*AP*GP*AP*AP*CP*T)-3')
total genus 29
structure length 83
sequence length 83
chains with identical sequence F, G
ec nomenclature
pdb deposition date 1996-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1meyC03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1meyC01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1meyC02
1LLMC 2EMAA 2EMXA 5KL2A 4R2PA 2EQ3A 1TF6A 1ZR9A 2YRMA 2YRKA 2EL4A 2EN1A 2MKNA 2J7JA 2EPZA 2M9AA 1TF3A 4IS1C 1ZAAC 4GZNC 2EM7A 1X6EA 2YSOA 1X5WA 2YTEA 5KL7A 2JPAA 2EMHA 2EMYA 2EN4A 2WBUA 2EOJA 1TN9A 2YU5A 2EMZA 2NABA 2EM3A 2DRPA 2EMFA 2LT7A 2EMGA 1A1IA 1WJPA 2YTJA 1F2IG 2EOZA 2YRHA 1AAYA 2GHFA 2ENAA 2I13A 2EN6A 2A25A 2LO3A 4WSGA 2EPXA 4R2AA 2DLKA 2YTOA 3EPKA 1A1GA 5KL6A 2EOMA 2LCEA 1Z1BA 1NCSA 2EPRA 1RMDA 2DMIA 1A1KA 1A1LA 2HGHA 1YUIA 2WCC3 2CTDA 2EOEA 4R2QA 2EMBA 2EM9A 2EOFA 2EM5A 2EE8A 1JK2A 4FK5C 2YU8A 2YSPA 3VHTB 1UBDC 2EM8A 3EPHA 2EMLA 2EOSA 2EOXA 2EOYA 1BB8A 3EPLA 2WBTA 2PRTA 2EP3A 1A1FA 4R2SA 3UK3C 1YSAC 2ADRA 2EOHA 4R2CA 2EQ0A 1ZU1A 1B69A 2R1FA 2EM4A 1G2DC 2EOQA 1X6FA 2EPAA 4F6NA 2EN7A 2YTPA 1X6HA 2DGCA 4X9JA 2WBSA 4R2RA 1UN6B 2MDGA 1X3CA 2EMIA 2EPUA 1DGCA 2YTGA 1MEYC 1BBOA 4F2JC 2EORA 2GLIA 2YTDA 4F6MA 2ENCA 2DLQA 2MKDA 2YTNA 2RSIA 4R2DA 2ELYA 2EOIA 2CT1A 2RPCA 3MHHC 2EN3A 2YTIA 4IJDA 2EQ1A 2EL5A 2D9HA 3EPJA 5KL3A 2ENHA 1KJKA 2LV2A 1A1JA 2EM2A 4M9VC 2CSHA 2EPPA 5KL5A 2ELZA 2EMWA 5KL4A 2EOOA 2BB8A 2EL6A 4R2EA 2EM6A 2VRDA 1YUJA 2JP9A 3M99B 2EPCA 2EN8A 2EMKA 2EJ4A 3MHSC 2YTQA 2EN2A 2YTFA 1P47A 2LVHA 1JK1A 2EM0A 1G2FC 2E72A 1A1HA 2EMCA
chains in the Genus database with same CATH superfamily
1LLMC 2LTSA 4R2PA 4JI0E 2EN1A 2J7JA 4TUGA 2EM7A 1WRJA 5CFFE 1IBLE 2YSOA 1X5WA 4Q28A 2JPAA 2M7QA 1UHZA 3C4BA 5AC5A 2HHHE 4N4RB 2NABA 4AQYE 2EM3A 4JI1E 2JOBA 1WJPA 4LF9E 3F6GA 4BS9A 1AH5A 5DNYA 4BCAA 1AAYA 2I13A 2EN6A 4KHPE 4DMIA 3AUZA 2L2KB 1GQEA 1HNZE 2B7TA 2V83A 1DQ3A 3LLHA 2N3GA 1A1KA 1YZ9A 2EZ6A 1BBGA 2NA2A 3JTZA 4OOGC 4R2QA 2EM9A 2EOFA 3C6KA 4ZYHA 4LF6E 1JK2A 4FK5C 4LF5E 3T1HE 1UBDC 5A6AA 5IT9C 5TSEA 2EMLA 1IBME 2WZOA 5A6JA 4R2SA 3UK3C 1YSAC 2ADRA 2ODRD 2N8XA 2DSYA 3ADIA 1MGTA 4LTYA 1N36E 1IBKE 2VQFE 1X6HA 1STUA 2DMYA 2M1SA 4YY3E 2ODRC 1UN6B 2V89A 2DB2A 2LJUA 2EORA 3K6QA 1XNRE 4LF7E 4LFBE 2ENCA 2RSIA 4DR7E 3THOB 2RPCA 2EN3A 4BC7A 2RS7A 2CPNA 3ECRA 3P1XA 2V86A 3BBGA 2KONA 5KL5A 1T4OA 2RTXA 4DR6E 4JI3E 2BB8A 2EL6A 4R2EA 2LMZA 4DUYE 1YFHA 2JVAA 4DR2E 1J5EE 3MHSC 2EN2A 5FLXC 2L8TA 4GEQB 2E72A 4WX9A 2EMCA 2WCC3 1HR0E 2V85A 2V8QB 1TF6A 1ZR9A 1WXRA 4DV2E 2YRMA 2MKNA 1IQSA 4L8NA 4GZNC 3IWCA 4X62E 4ZYDA 3ZOQB 2LBSB 4B3ME 2EOJA 2V87A 4O4KA 2YU5A 1X49A 3ADJA 2R76A 2EMFA 4DR5E 3LMLA 4JV5E 2YTJA 4X64E 2EOZA 2YRHA 4DV6E 2A25A 4R2AA 4GKJE 2KOUA 3VYYA 1A1GA 2EOMA 1Z1BA 2JOXA 4KZSA 3AV0A 2EPRA 1IMUA 1A1LA 2HGHA 4DV3E 4BHBA 4MLVA 4WSPA 2Q8UA 1RC7A 1UILA 2EOEA 2EMBA 2EPNA 2UUBE 3C6MA 2LJHA 2NUGA 4WYQB 2KHXA 2EM8A 3EPHA 2EOYA 2EOXA 3J7AG 1PJQA 1YYOA 3BIDA 1N34E 3HPZA 3J7Yp 4R2CA 1ZBTA 4LFCE 2UXBE 5IV8B 2R1FA 1ZBQA 3BF2A 1PJTA 2EPAA 4HEIA 2L3JA 4JI4E 4WPYA 4B3TE 4R2RA 2MDGA 1X3CA 4OX9E 4JI5E 2YTGA 1WHNA 1MEYC 1X48A 2L6MA 4O5GA 4F6MA 1YYKA 2EOIA 2CT1A 4BMJA 2EPKX 2D9HA 4WXCA 2NUFA 4YHHE 3QG5C 2EM2A 2HC5A 4M9VC 2EPPA 3IWBA 4LFAE 3HXLA 4M0VA 4F9CB 4ZYGA 2EM6A 4HTGA 1EKZA 4DR3E 1X47A 4NZVA 4MLQA 4DR4E 1PJSA 2YTQA 2YTFA 1P47A 2LVHA 1XMOE 4NXME 4L5NC 1XMQE 2LUPB 3MSWA 1YYWA 1QNTA 5KL2A 2E5LE 2YRKA 2EL4A 2EWLA 2EPZA 3J81C 4F9AB 5AC4A 1N32E 1TF3A 3RMPA 2F8BA 3H09A 4RHBB 1X6EA 2YTEA 4P78A 2EMHA 2EMYA 2WBUA 1TN9A 4X66E 2EMZA 4DKKA 2EMGA 1YPNA 4DV0E 2LUQA 1A1IA 1L4SA 1F2IG 2JYAA 1N33E 1PKPA 3OMLA 2K4VA 2UXDE 4WSGA 2EPXA 4DV4E 2H36X 2K7IA 2VQEE 3JU0A 3JAMC 1T39A 1FKAE 2LTRA 5LL6R 2LE2A 2V88A 4DUZE 1YUIA 2B3TB 5IWAE 2CTDA 4NXNE 4BHCA 2VE7C 4K0KE 2EE8A 4BC9A 1EH7A 1BB8A 2L3CA 4I8OA 2PRTA 1SFEA 1A1FA 3HPSA 5A69A 4Q35B 3HTXA 2E1MA 2VF1A 5AASA 1ZU1A 1B69A 3KZZA 1N3GA 1WHQA 1O0WA 4P7DA 1QU6A 2EM4A 2JXPA 5A6BA 1G2DC 3J80C 4JI6E 2EN7A 4GKKE 2UUCE 2WBSA 4DR1E 4DV5E 2FV4B 2EMIA 1DGCA 4RH8A 4F2JC 2GLIA 2YTDA 2M4IA 2MKDA 3FIGA 2YTNA 4R2DA 2ELYA 3C4TA 4NHRA 3HQ1A 4B3SE 1NEIA 4IJDA 2FGGA 2EQ1A 3BGHA 5KL3A 1RQ0A 5F3WA 5LLQA 4LU9A 4F9BB 5A2QC 5KL4A 2EOOA 1GTKA 2JP9A 1XNQE 4ZYEA 5T6JA 2EN8A 1EH6A 4JI7E 3TQMA 2YZTA 2JY9A 1SR9A 2EM0A 3IWDA 2YT4A 2MC6A 1FJGE 1A1HA 2EMAA 2EMXA 2GPIA 2EQ3A 2NUEA 3THNA 2M9AA 4IS1C 1ZAAC 2IHR1 5KL7A 2EN4A 2UU9E 4WFTA 4TUIA 2DRPA 2ZM6E 2LT7A 4J8ZA 3L00A 5BR8E 2GHFA 2ENAA 2LO3A 2LRSA 1DI2A 2EPLX 2DLKA 2YTOA 3EPKA 5KL6A 2UUAE 2LCEA 3ADLA 2RQLA 1NCSA 4R03A 1RMDA 2DMIA 2I9IA 2UXCE 3DJWA 4JYAE 3VYXA 2RSMA 2RS6A 2L2MA 2EM5A 2B7VA 2N3HA 4BBYA 2YU8A 2YSPA 3VHTB 2EOSA 4WXDA 5AE1A 3EPLA 2DIXA 2WBTA 4F54A 1HNWE 2G7HA 1IQOA 1GZ6A 2EP3A 4M2ZA 2JR1A 2EPMX 3ADGA 1T38A 4LF8E 2EOHA 2EQ0A 2L2NA 2MC5A 2EOQA 1X6FA 4LF4E 4O24A 4F6NA 2L33A 2YTPA 4R8OA 2DGCA 4X9JA 1T4LB 4M30A 2EPUA 1I94E 1BBOA 3F6HA 3KWRA 2L92A 4KWYA 3KZYA 2HJJA 4X65E 2DLQA 4JI2E 2F4VE 2YWQA 2B9DA 3MHHC 2YTIA 2EL5A 3EPJA 2ENHA 1KJKA 2LV2A 3T1YE 5LMUE 1A1JA 4DV7E 2CSHA 4O43A 4JI8E 1J26A 5ADZA 3VK6A 2ELZA 2EMWA 2JWOA 1KYQA 5AE3A 3EQ1A 2VRDA 1YUJA 2BBGA 1EH8A 3M99B 2EPCA 2EMKA 5LMNE 2FTXB 3DF6A 2EJ4A 5IXMB 1HNXE 2MDRA 2YPNA 3OTOE 1PDAA 1JK1A 4DV1E 5AE2A 1G2FC 2EPOA 5A6KA 5A6BD 4X8WA 4B3RE 1T4NA
chains in the Genus database with same CATH topology
1LLMC 2EMAA 2EMXA 5KL2A 4R2PA 2EQ3A 1TF6A 1ZR9A 2YRMA 2YRKA 2EL4A 2EN1A 2MKNA 2J7JA 2EPZA 2M9AA 1TF3A 4IS1C 1ZAAC 4GZNC 2EM7A 1X6EA 2YSOA 1X5WA 2YTEA 5KL7A 2JPAA 2EMHA 2EMYA 2EN4A 2WBUA 2EOJA 1TN9A 2YU5A 2EMZA 2NABA 2EM3A 2DRPA 2EMFA 2LT7A 2EMGA 1A1IA 1WJPA 2YTJA 1F2IG 2EOZA 2YRHA 1AAYA 2GHFA 2ENAA 2I13A 2EN6A 2A25A 2LO3A 4WSGA 2EPXA 4R2AA 2DLKA 2YTOA 3EPKA 1A1GA 5KL6A 2EOMA 2LCEA 1Z1BA 1NCSA 2EPRA 1RMDA 2DMIA 1A1KA 1A1LA 2HGHA 1YUIA 2WCC3 2CTDA 2EOEA 4R2QA 2EMBA 2EM9A 2EOFA 2EM5A 2EE8A 1JK2A 4FK5C 2YU8A 2YSPA 3VHTB 1UBDC 2EM8A 3EPHA 2EMLA 2EOSA 2EOXA 2EOYA 1BB8A 3EPLA 2WBTA 2PRTA 2EP3A 1A1FA 4R2SA 3UK3C 1YSAC 2ADRA 2EOHA 4R2CA 2EQ0A 1ZU1A 1B69A 2R1FA 2EM4A 1G2DC 2EOQA 1X6FA 2EPAA 4F6NA 2EN7A 2YTPA 1X6HA 2DGCA 4X9JA 2WBSA 4R2RA 1UN6B 2MDGA 1X3CA 2EMIA 2EPUA 1DGCA 2YTGA 1MEYC 1BBOA 4F2JC 2EORA 2GLIA 2YTDA 4F6MA 2ENCA 2DLQA 2MKDA 2YTNA 2RSIA 4R2DA 2ELYA 2EOIA 2CT1A 2RPCA 3MHHC 2EN3A 2YTIA 4IJDA 2EQ1A 2EL5A 2D9HA 3EPJA 5KL3A 2ENHA 1KJKA 2LV2A 1A1JA 2EM2A 4M9VC 2CSHA 2EPPA 5KL5A 2ELZA 2EMWA 5KL4A 2EOOA 2BB8A 2EL6A 4R2EA 2EM6A 2VRDA 1YUJA 2JP9A 3M99B 2EPCA 2EN8A 2EMKA 2EJ4A 3MHSC 2YTQA 2EN2A 2YTFA 1P47A 2LVHA 1JK1A 2EM0A 1G2FC 2E72A 1A1HA 2EMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LLM C;  2EMA A;  2EMX A;  5KL2 A;  4R2P A;  2EQ3 A;  1TF6 A;  1ZR9 A;  2YRM A;  2YRK A;  2EL4 A;  2EN1 A;  2MKN A;  2J7J A;  2EPZ A;  2M9A A;  1TF3 A;  4IS1 C;  1ZAA C;  4GZN C;  2EM7 A;  1X6E A;  2YSO A;  1X5W A;  2YTE A;  5KL7 A;  2JPA A;  2EMH A;  2EMY A;  2EN4 A;  2WBU A;  2EOJ A;  1TN9 A;  2YU5 A;  2EMZ A;  2NAB A;  2EM3 A;  2DRP A;  2EMF A;  2LT7 A;  2EMG A;  1A1I A;  1WJP A;  2YTJ A;  1F2I G;  2EOZ A;  2YRH A;  1AAY A;  2GHF A;  2ENA A;  2I13 A;  2EN6 A;  2A25 A;  2LO3 A;  4WSG A;  2EPX A;  4R2A A;  2DLK A;  2YTO A;  3EPK A;  1A1G A;  5KL6 A;  2EOM A;  2LCE A;  1Z1B A;  1NCS A;  2EPR A;  1RMD A;  2DMI A;  1A1K A;  1A1L A;  2HGH A;  1YUI A;  2WCC 3;  2CTD A;  2EOE A;  4R2Q A;  2EMB A;  2EM9 A;  2EOF A;  2EM5 A;  2EE8 A;  1JK2 A;  4FK5 C;  2YU8 A;  2YSP A;  3VHT B;  1UBD C;  2EM8 A;  3EPH A;  2EML A;  2EOS A;  2EOX A;  2EOY A;  1BB8 A;  3EPL A;  2WBT A;  2PRT A;  2EP3 A;  1A1F A;  4R2S A;  3UK3 C;  1YSA C;  2ADR A;  2EOH A;  4R2C A;  2EQ0 A;  1ZU1 A;  1B69 A;  2R1F A;  2EM4 A;  1G2D C;  2EOQ A;  1X6F A;  2EPA A;  4F6N A;  2EN7 A;  2YTP A;  1X6H A;  2DGC A;  4X9J A;  2WBS A;  4R2R A;  1UN6 B;  2MDG A;  1X3C A;  2EMI A;  2EPU A;  1DGC A;  2YTG A;  1MEY C;  1BBO A;  4F2J C;  2EOR A;  2GLI A;  2YTD A;  4F6M A;  2ENC A;  2DLQ A;  2MKD A;  2YTN A;  2RSI A;  4R2D A;  2ELY A;  2EOI A;  2CT1 A;  2RPC A;  3MHH C;  2EN3 A;  2YTI A;  4IJD A;  2EQ1 A;  2EL5 A;  2D9H A;  3EPJ A;  5KL3 A;  2ENH A;  1KJK A;  2LV2 A;  1A1J A;  2EM2 A;  4M9V C;  2CSH A;  2EPP A;  5KL5 A;  2ELZ A;  2EMW A;  5KL4 A;  2EOO A;  2BB8 A;  2EL6 A;  4R2E A;  2EM6 A;  2VRD A;  1YUJ A;  2JP9 A;  3M99 B;  2EPC A;  2EN8 A;  2EMK A;  2EJ4 A;  3MHS C;  2YTQ A;  2EN2 A;  2YTF A;  1P47 A;  2LVH A;  1JK1 A;  2EM0 A;  1G2F C;  2E72 A;  1A1H A;  2EMC A; 
#chains in the Genus database with same CATH topology
 1LLM C;  2LTS A;  4R2P A;  4JI0 E;  2EN1 A;  2J7J A;  4TUG A;  2EM7 A;  1WRJ A;  5CFF E;  1IBL E;  2YSO A;  1X5W A;  4Q28 A;  2JPA A;  2M7Q A;  1UHZ A;  3C4B A;  5AC5 A;  2HHH E;  4N4R B;  2NAB A;  4AQY E;  2EM3 A;  4JI1 E;  2JOB A;  1WJP A;  4LF9 E;  3F6G A;  4BS9 A;  1AH5 A;  5DNY A;  4BCA A;  1AAY A;  2I13 A;  2EN6 A;  4KHP E;  4DMI A;  3AUZ A;  2L2K B;  1GQE A;  1HNZ E;  2B7T A;  2V83 A;  1DQ3 A;  3LLH A;  2N3G A;  1A1K A;  1YZ9 A;  2EZ6 A;  1BBG A;  2NA2 A;  3JTZ A;  4OOG C;  4R2Q A;  2EM9 A;  2EOF A;  3C6K A;  4ZYH A;  4LF6 E;  1JK2 A;  4FK5 C;  4LF5 E;  3T1H E;  1UBD C;  5A6A A;  5IT9 C;  5TSE A;  2EML A;  1IBM E;  2WZO A;  5A6J A;  4R2S A;  3UK3 C;  1YSA C;  2ADR A;  2ODR D;  2N8X A;  2DSY A;  3ADI A;  1MGT A;  4LTY A;  1N36 E;  1IBK E;  2VQF E;  1X6H A;  1STU A;  2DMY A;  2M1S A;  4YY3 E;  2ODR C;  1UN6 B;  2V89 A;  2DB2 A;  2LJU A;  2EOR A;  3K6Q A;  1XNR E;  4LF7 E;  4LFB E;  2ENC A;  2RSI A;  4DR7 E;  3THO B;  2RPC A;  2EN3 A;  4BC7 A;  2RS7 A;  2CPN A;  3ECR A;  3P1X A;  2V86 A;  3BBG A;  2KON A;  5KL5 A;  1T4O A;  2RTX A;  4DR6 E;  4JI3 E;  2BB8 A;  2EL6 A;  4R2E A;  2LMZ A;  4DUY E;  1YFH A;  2JVA A;  4DR2 E;  1J5E E;  3MHS C;  2EN2 A;  5FLX C;  2L8T A;  4GEQ B;  2E72 A;  4WX9 A;  2EMC A;  2WCC 3;  1HR0 E;  2V85 A;  2V8Q B;  1TF6 A;  1ZR9 A;  1WXR A;  4DV2 E;  2YRM A;  2MKN A;  1IQS A;  4L8N A;  4GZN C;  3IWC A;  4X62 E;  4ZYD A;  3ZOQ B;  2LBS B;  4B3M E;  2EOJ A;  2V87 A;  4O4K A;  2YU5 A;  1X49 A;  3ADJ A;  2R76 A;  2EMF A;  4DR5 E;  3LML A;  4JV5 E;  2YTJ A;  4X64 E;  2EOZ A;  2YRH A;  4DV6 E;  2A25 A;  4R2A A;  4GKJ E;  2KOU A;  3VYY A;  1A1G A;  2EOM A;  1Z1B A;  2JOX A;  4KZS A;  3AV0 A;  2EPR A;  1IMU A;  1A1L A;  2HGH A;  4DV3 E;  4BHB A;  4MLV A;  4WSP A;  2Q8U A;  1RC7 A;  1UIL A;  2EOE A;  2EMB A;  2EPN A;  2UUB E;  3C6M A;  2LJH A;  2NUG A;  4WYQ B;  2KHX A;  2EM8 A;  3EPH A;  2EOY A;  2EOX A;  3J7A G;  1PJQ A;  1YYO A;  3BID A;  1N34 E;  3HPZ A;  3J7Y p;  4R2C A;  1ZBT A;  4LFC E;  2UXB E;  5IV8 B;  2R1F A;  1ZBQ A;  3BF2 A;  1PJT A;  2EPA A;  4HEI A;  2L3J A;  4JI4 E;  4WPY A;  4B3T E;  4R2R A;  2MDG A;  1X3C A;  4OX9 E;  4JI5 E;  2YTG A;  1WHN A;  1MEY C;  1X48 A;  2L6M A;  4O5G A;  4F6M A;  1YYK A;  2EOI A;  2CT1 A;  4BMJ A;  2EPK X;  2D9H A;  4WXC A;  2NUF A;  4YHH E;  3QG5 C;  2EM2 A;  2HC5 A;  4M9V C;  2EPP A;  3IWB A;  4LFA E;  3HXL A;  4M0V A;  4F9C B;  4ZYG A;  2EM6 A;  4HTG A;  1EKZ A;  4DR3 E;  1X47 A;  4NZV A;  4MLQ A;  4DR4 E;  1PJS A;  2YTQ A;  2YTF A;  1P47 A;  2LVH A;  1XMO E;  4NXM E;  4L5N C;  1XMQ E;  2LUP B;  3MSW A;  1YYW A;  1QNT A;  5KL2 A;  2E5L E;  2YRK A;  2EL4 A;  2EWL A;  2EPZ A;  3J81 C;  4F9A B;  5AC4 A;  1N32 E;  1TF3 A;  3RMP A;  2F8B A;  3H09 A;  4RHB B;  1X6E A;  2YTE A;  4P78 A;  2EMH A;  2EMY A;  2WBU A;  1TN9 A;  4X66 E;  2EMZ A;  4DKK A;  2EMG A;  1YPN A;  4DV0 E;  2LUQ A;  1A1I A;  1L4S A;  1F2I G;  2JYA A;  1N33 E;  1PKP A;  3OML A;  2K4V A;  2UXD E;  4WSG A;  2EPX A;  4DV4 E;  2H36 X;  2K7I A;  2VQE E;  3JU0 A;  3JAM C;  1T39 A;  1FKA E;  2LTR A;  5LL6 R;  2LE2 A;  2V88 A;  4DUZ E;  1YUI A;  2B3T B;  5IWA E;  2CTD A;  4NXN E;  4BHC A;  2VE7 C;  4K0K E;  2EE8 A;  4BC9 A;  1EH7 A;  1BB8 A;  2L3C A;  4I8O A;  2PRT A;  1SFE A;  1A1F A;  3HPS A;  5A69 A;  4Q35 B;  3HTX A;  2E1M A;  2VF1 A;  5AAS A;  1ZU1 A;  1B69 A;  3KZZ A;  1N3G A;  1WHQ A;  1O0W A;  4P7D A;  1QU6 A;  2EM4 A;  2JXP A;  5A6B A;  1G2D C;  3J80 C;  4JI6 E;  2EN7 A;  4GKK E;  2UUC E;  2WBS A;  4DR1 E;  4DV5 E;  2FV4 B;  2EMI A;  1DGC A;  4RH8 A;  4F2J C;  2GLI A;  2YTD A;  2M4I A;  2MKD A;  3FIG A;  2YTN A;  4R2D A;  2ELY A;  3C4T A;  4NHR A;  3HQ1 A;  4B3S E;  1NEI A;  4IJD A;  2FGG A;  2EQ1 A;  3BGH A;  5KL3 A;  1RQ0 A;  5F3W A;  5LLQ A;  4LU9 A;  4F9B B;  5A2Q C;  5KL4 A;  2EOO A;  1GTK A;  2JP9 A;  1XNQ E;  4ZYE A;  5T6J A;  2EN8 A;  1EH6 A;  4JI7 E;  3TQM A;  2YZT A;  2JY9 A;  1SR9 A;  2EM0 A;  3IWD A;  2YT4 A;  2MC6 A;  1FJG E;  1A1H A;  2EMA A;  2EMX A;  2GPI A;  2EQ3 A;  2NUE A;  3THN A;  2M9A A;  4IS1 C;  1ZAA C;  2IHR 1;  5KL7 A;  2EN4 A;  2UU9 E;  4WFT A;  4TUI A;  2DRP A;  2ZM6 E;  2LT7 A;  4J8Z A;  3L00 A;  5BR8 E;  2GHF A;  2ENA A;  2LO3 A;  2LRS A;  1DI2 A;  2EPL X;  2DLK A;  2YTO A;  3EPK A;  5KL6 A;  2UUA E;  2LCE A;  3ADL A;  2RQL A;  1NCS A;  4R03 A;  1RMD A;  2DMI A;  2I9I A;  2UXC E;  3DJW A;  4JYA E;  3VYX A;  2RSM A;  2RS6 A;  2L2M A;  2EM5 A;  2B7V A;  2N3H A;  4BBY A;  2YU8 A;  2YSP A;  3VHT B;  2EOS A;  4WXD A;  5AE1 A;  3EPL A;  2DIX A;  2WBT A;  4F54 A;  1HNW E;  2G7H A;  1IQO A;  1GZ6 A;  2EP3 A;  4M2Z A;  2JR1 A;  2EPM X;  3ADG A;  1T38 A;  4LF8 E;  2EOH A;  2EQ0 A;  2L2N A;  2MC5 A;  2EOQ A;  1X6F A;  4LF4 E;  4O24 A;  4F6N A;  2L33 A;  2YTP A;  4R8O A;  2DGC A;  4X9J A;  1T4L B;  4M30 A;  2EPU A;  1I94 E;  1BBO A;  3F6H A;  3KWR A;  2L92 A;  4KWY A;  3KZY A;  2HJJ A;  4X65 E;  2DLQ A;  4JI2 E;  2F4V E;  2YWQ A;  2B9D A;  3MHH C;  2YTI A;  2EL5 A;  3EPJ A;  2ENH A;  1KJK A;  2LV2 A;  3T1Y E;  5LMU E;  1A1J A;  4DV7 E;  2CSH A;  4O43 A;  4JI8 E;  1J26 A;  5ADZ A;  3VK6 A;  2ELZ A;  2EMW A;  2JWO A;  1KYQ A;  5AE3 A;  3EQ1 A;  2VRD A;  1YUJ A;  2BBG A;  1EH8 A;  3M99 B;  2EPC A;  2EMK A;  5LMN E;  2FTX B;  3DF6 A;  2EJ4 A;  5IXM B;  1HNX E;  2MDR A;  2YPN A;  3OTO E;  1PDA A;  1JK1 A;  4DV1 E;  5AE2 A;  1G2F C;  2EPO A;  5A6K A;  5A6B D;  4X8W A;  4B3R E;  1T4N A; 
#chains in the Genus database with same CATH homology
 1LLM C;  2EMA A;  2EMX A;  5KL2 A;  4R2P A;  2EQ3 A;  1TF6 A;  1ZR9 A;  2YRM A;  2YRK A;  2EL4 A;  2EN1 A;  2MKN A;  2J7J A;  2EPZ A;  2M9A A;  1TF3 A;  4IS1 C;  1ZAA C;  4GZN C;  2EM7 A;  1X6E A;  2YSO A;  1X5W A;  2YTE A;  5KL7 A;  2JPA A;  2EMH A;  2EMY A;  2EN4 A;  2WBU A;  2EOJ A;  1TN9 A;  2YU5 A;  2EMZ A;  2NAB A;  2EM3 A;  2DRP A;  2EMF A;  2LT7 A;  2EMG A;  1A1I A;  1WJP A;  2YTJ A;  1F2I G;  2EOZ A;  2YRH A;  1AAY A;  2GHF A;  2ENA A;  2I13 A;  2EN6 A;  2A25 A;  2LO3 A;  4WSG A;  2EPX A;  4R2A A;  2DLK A;  2YTO A;  3EPK A;  1A1G A;  5KL6 A;  2EOM A;  2LCE A;  1Z1B A;  1NCS A;  2EPR A;  1RMD A;  2DMI A;  1A1K A;  1A1L A;  2HGH A;  1YUI A;  2WCC 3;  2CTD A;  2EOE A;  4R2Q A;  2EMB A;  2EM9 A;  2EOF A;  2EM5 A;  2EE8 A;  1JK2 A;  4FK5 C;  2YU8 A;  2YSP A;  3VHT B;  1UBD C;  2EM8 A;  3EPH A;  2EML A;  2EOS A;  2EOX A;  2EOY A;  1BB8 A;  3EPL A;  2WBT A;  2PRT A;  2EP3 A;  1A1F A;  4R2S A;  3UK3 C;  1YSA C;  2ADR A;  2EOH A;  4R2C A;  2EQ0 A;  1ZU1 A;  1B69 A;  2R1F A;  2EM4 A;  1G2D C;  2EOQ A;  1X6F A;  2EPA A;  4F6N A;  2EN7 A;  2YTP A;  1X6H A;  2DGC A;  4X9J A;  2WBS A;  4R2R A;  1UN6 B;  2MDG A;  1X3C A;  2EMI A;  2EPU A;  1DGC A;  2YTG A;  1MEY C;  1BBO A;  4F2J C;  2EOR A;  2GLI A;  2YTD A;  4F6M A;  2ENC A;  2DLQ A;  2MKD A;  2YTN A;  2RSI A;  4R2D A;  2ELY A;  2EOI A;  2CT1 A;  2RPC A;  3MHH C;  2EN3 A;  2YTI A;  4IJD A;  2EQ1 A;  2EL5 A;  2D9H A;  3EPJ A;  5KL3 A;  2ENH A;  1KJK A;  2LV2 A;  1A1J A;  2EM2 A;  4M9V C;  2CSH A;  2EPP A;  5KL5 A;  2ELZ A;  2EMW A;  5KL4 A;  2EOO A;  2BB8 A;  2EL6 A;  4R2E A;  2EM6 A;  2VRD A;  1YUJ A;  2JP9 A;  3M99 B;  2EPC A;  2EN8 A;  2EMK A;  2EJ4 A;  3MHS C;  2YTQ A;  2EN2 A;  2YTF A;  1P47 A;  2LVH A;  1JK1 A;  2EM0 A;  1G2F C;  2E72 A;  1A1H A;  2EMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...