1MEYC

Crystal structure of a designed zinc finger protein bound to dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
83
structure length
83
Chain Sequence
EKPYKCPECGKSFSQSSNLQKHQRTHTGEKPYKCPECGKSFSQSSDLQKHQRTHTGEKPYKCPECGKSFSRSDHLSRHQRTHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA (5'-D(*AP*TP*GP*AP*GP*GP*CP*AP*GP*AP*AP*CP*T)-3')
publication title A 2.2 A Resolution Crystal Structure of a Designed Zinc Finger Protein Bound to DNA
pubmed doi rcsb
total genus 29
structure length 83
sequence length 83
chains with identical sequence F, G
ec nomenclature
pdb deposition date 1996-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1meyC03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1meyC01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1meyC02
2GLIA 2ENHA 4F2JC 5KL2A 1BBOA 2EMGA 2EM8A 4R2CA 2EP3A 1X6FA 2YTNA 1A1LA 3EPLA 3MHSC 5KL3A 2EOFA 2LO3A 1X6EA 4R2DA 2JP9A 2ELYA 2EMWA 2EMYA 1RMDA 1LLMC 1MEYC 1B69A 2EMIA 2EOJA 2EM2A 2ENAA 2EOSA 2YTOA 2PRTA 2EM0A 1JK2A 2HGHA 2YU5A 2WCC3 4IS1C 2EN6A 1UBDC 2EN1A 2D9HA 1YSAC 1ZU1A 2EMFA 2LCEA 2EMBA 3EPHA 2MKDA 2EPRA 2EPCA 2EN8A 4M9VC 2EOMA 2WBUA 2YTFA 1P47A 4IJDA 1A1GA 1ZAAC 2EOXA 3VHTB 2YTPA 1AAYA 1NCSA 4R2QA 2EMHA 2EMXA 2JPAA 5KL6A 2BB8A 2CT1A 2EQ1A 2EPUA 1TN9A 2ELZA 5KL4A 2RSIA 3M99B 2EM5A 3EPKA 2DLQA 2LT7A 2YRMA 2EQ0A 1X3CA 2EN7A 4R2EA 2EOHA 4F6NA 2CSHA 2EM9A 4R2PA 1X6HA 1JK1A 2A25A 1YUIA 4FK5C 2EL4A 2YSPA 2EOQA 2MDGA 1G2DC 2ENCA 2EPAA 4R2AA 2YU8A 2EM7A 2LV2A 1Z1BA 1TF6A 1A1FA 2DLKA 2EM4A 4GZNC 1X5WA 4F6MA 2EMCA 2EPPA 2ADRA 2DGCA 5KL7A 4R2SA 2DRPA 1ZR9A 1A1KA 2EN3A 2EMAA 1F2IG 2YTEA 2E72A 2YTDA 2EMLA 2EM6A 2EOOA 2EOYA 2I13A 4X9JA 2EMKA 2EN2A 2EJ4A 2LVHA 2WBTA 1A1IA 1DGCA 1WJPA 2VRDA 2J7JA 2YTQA 1YUJA 2EOIA 4R2RA 4WSGA 5KL5A 2CTDA 2EL6A 2EL5A 2EPXA 2EPZA 2M9AA 2YRKA 2EE8A 3EPJA 1UN6B 2MKNA 2WBSA 2YTGA 2EN4A 2YTIA 2EMZA 2RPCA 1KJKA 3UK3C 2EQ3A 2DMIA 2GHFA 2R1FA 1G2FC 3MHHC 2EOZA 2NABA 2YTJA 2EOEA 2EM3A 2YSOA 1A1JA 1BB8A 2YRHA 1TF3A 2EORA 1A1HA
chains in the Genus database with same CATH superfamily
4M30A 1AH5A 1PJQA 4ZYGA 4L5NC 4DMIA 5KL2A 4F9AB 5BR8E 2LUQA 3THNA 4R2CA 2YTNA 3ADIA 2Q8UA 1EH8A 3KZZA 2NUFA 5KL3A 2LO3A 1WHQA 1HNZE 2HHHE 5AE1A 1T38A 2EOJA 4X66E 2YTOA 1N36E 4R8OA 4X8WA 2YPNA 1PDAA 2WCC3 2EZ6A 1UBDC 2JR1A 4KWYA 2EN1A 3BIDA 1FKAE 2EMBA 1NEIA 2MKDA 1QNTA 2EN8A 2F4VE 1P47A 2MDRA 4IJDA 1ZAAC 4DR7E 3ZOQB 4NXNE 5AASA 2EMHA 5IWAE 1ZBQA 5A6AA 3F6HA 4JI7E 2RSIA 2LT7A 4DR2E 2YRMA 2K7IA 4BMJA 4R2EA 2EOHA 2E1MA 1HR0E 2EM9A 4NHRA 1EH7A 1IBME 2EWLA 1GZ6A 2JWOA 2EL4A 2YSPA 1G2DC 3LLHA 5AE3A 2EM7A 4ZYHA 1TF6A 3C6KA 2EM4A 1X5WA 3ADGA 1X49A 2EPPA 1XNQE 4DKKA 4GKJE 1I94E 2VQEE 1X48A 2BBGA 2L2MA 4LF7E 4R2SA 2DRPA 4LFAE 4F9BB 5LMUE 2JOXA 2YTEA 5A2QC 2EMLA 4WFTA 4DR6E 2EOYA 2I13A 2EN2A 2EJ4A 3HXLA 4YHHE 2DSYA 2YTQA 2EOIA 2M4IA 1HNWE 1QU6A 4Q35B 1MGTA 2HC5A 2V87A 2EL6A 5AC5A 2EE8A 5F3WA 2WBSA 1DQ3A 2EN4A 1KJKA 1YYOA 4BHBA 3AUZA 2LRSA 3C4TA 5A6JA 2YSOA 2RTXA 3IWBA 4DV2E 5IT9C 2YRHA 3ECRA 2B3TB 1IQOA 5T6JA 3K6QA 5IV8B 2GLIA 5A69A 2N8XA 5FLXC 4F2JC 2B7VA 4P78A 1BBOA 2RSMA 2EM8A 2EP3A 1SR9A 4R2DA 1X6EA 2L3CA 2EMWA 2JP9A 3MSWA 2MC5A 1LLMC 1MEYC 4M2ZA 3AV0A 4WXCA 4X65E 4LF8E 2PRTA 2FTXB 4NZVA 2EM0A 2HGHA 2I9IA 3BBGA 4B3TE 1UHZA 1SFEA 2EPNA 2EPCA 1IBLE 3QG5C 2WBUA 2YTFA 2B9DA 5DNYA 3VHTB 4KHPE 1NCSA 4TUIA 4GEQB 2CT1A 2EPUA 2FGGA 2R76A 3J7AG 5KL4A 2ODRC 2E5LE 2V88A 1T4LB 4F6NA 1YZ9A 4NXME 4O24A 4ZYEA 2EPOA 2UUBE 4JI8E 4DV7E 2L3JA 2MDGA 2ENCA 2V86A 4R2AA 2YU8A 4DR1E 1IMUA 3T1YE 1Z1BA 1T4NA 3EQ1A 2DLKA 3IWDA 2ADRA 4DV4E 4WX9A 3L00A 4ZYDA 1ZR9A 2EN3A 2HJJA 1IQSA 2E72A 2EM6A 2EPKX 5A6KA 1A1IA 2LVHA 2V8QB 1EH6A 2H36X 2YT4A 4DV6E 1YUJA 4R2RA 5KL5A 2CTDA 1PJTA 4DR3E 2YRKA 1UN6B 4OOGC 2MKNA 2YTGA 2M1SA 2EMZA 3HPZA 3ADJA 4WXDA 1XNRE 1G2FC 2EOZA 2RQLA 2EOEA 4B3SE 1N34E 2LMZA 2JPAA 1WHNA 2K4VA 2LTSA 5TSEA 2KOUA 1IBKE 3RMPA 2YZTA 4DUYE 2NA2A 2EMGA 1BBGA 1X6FA 4MLQA 2DB2A 2N3HA 1WRJA 3VYXA 1A1LA 4BS9A 2ELYA 3JTZA 3J81C 1B69A 4WSPA 2EOSA 4LF4E 3ADLA 2LTRA 4MLVA 5AE2A 4AQYE 2V89A 4O4KA 1JK2A 4IS1C 3C4BA 2EN6A 4J8ZA 4JYAE 2EMFA 2JY9A 3F6GA 2B7TA 3TQMA 4F54A 3P1XA 4R2QA 5LLQA 4DV1E 4LFCE 4BC9A 2EMXA 4JI3E 2EQ1A 2JYAA 2ELZA 3EPKA 2L8TA 3M99B 2RS7A 4LU9A 2JXPA 2EQ0A 1X3CA 5A6BA 2EN7A 2V85A 4O43A 4R2PA 3HQ1A 1X6HA 3VYYA 2LE2A 2F8BA 4BC7A 4BCAA 1YUIA 4JI5E 4FK5C 3C6MA 2EPAA 1L4SA 4LF5E 4HTGA 4OX9E 3BF2A 1A1FA 1YYKA 3JU0A 4YY3E 5IXMB 4GZNC 1KYQA 2EMCA 2L33A 2DGCA 2EMAA 2VE7C 2EPMX 2CPNA 2YTDA 2EOOA 4KZSA 4L8NA 3LMLA 1WJPA 1RC7A 2NUEA 2VRDA 2J7JA 4WSGA 3JAMC 3HPSA 4DV0E 2L92A 4HEIA 2YTIA 3UK3C 4DR5E 2LBSB 2M7QA 4X62E 4LFBE 2NABA 2YTJA 4RHBB 2NUGA 1BB8A 2ZM6E 5AC4A 4DUZE 2EORA 1N3GA 1A1HA 4BBYA 2UUCE 2ENHA 3OMLA 4JI0E 2KONA 2G7HA 4O5GA 4F9CB 4WYQB 1FJGE 3EPLA 3MHSC 3T1HE 2EOFA 2EMYA 1RMDA 1YFHA 4DR4E 2L2NA 2LJUA 2EMIA 1N32E 2EM2A 2ENAA 5CFFE 1PKPA 2WZOA 2LJHA 2N3GA 1J26A 2DIXA 1UILA 3J7Yp 3HTXA 2YU5A 4B3RE 3THOB 2D9HA 1YSAC 1ZU1A 1RQ0A 2LCEA 3EPHA 2VF1A 2EPRA 3KZYA 1J5EE 2VQFE 3IWCA 4TUGA 4LF6E 2V83A 1WXRA 4M9VC 2EOMA 3DJWA 4DV3E 1A1GA 2EOXA 2YTPA 1X47A 4R03A 1T39A 1AAYA 2YWQA 1XMQE 5KL6A 1O0WA 2BB8A 2FV4B 1GTKA 4LTYA 1DI2A 3FIGA 2DMYA 1TN9A 2EM5A 4K0KE 2DLQA 1STUA 5A6BD 4BHCA 2IHR1 3OTOE 4B3ME 2L2KB 1GQEA 2CSHA 2UXCE 5LL6R 4JI2E 3BGHA 1JK1A 2A25A 4WPYA 2GPIA 1ZBTA 2EPLX 2RS6A 3DF6A 2UXBE 2EOQA 2LV2A 4RH8A 2L6MA 2UUAE 4P7DA 4F6MA 5ADZA 2ODRD 5KL7A 2JVAA 4JI4E 1A1KA 4JV5E 3J80C 1F2IG 4GKKE 4DV5E 4X64E 4JI6E 4X9JA 2EMKA 2KHXA 2WBTA 1DGCA 4I8OA 1YPNA 1HNXE 1PJSA 1N33E 2LUPB 3H09A 2UXDE 4N4RB 5LMNE 4JI1E 2EL5A 2EPXA 2EPZA 2M9AA 4M0VA 3EPJA 1EKZA 2RPCA 2EQ3A 2JOBA 2DMIA 2GHFA 2UU9E 2R1FA 3KWRA 3VK6A 3MHHC 2MC6A 4LF9E 1T4OA 1YYWA 4Q28A 2EM3A 1XMOE 1A1JA 1TF3A
chains in the Genus database with same CATH topology
2GLIA 2ENHA 4F2JC 5KL2A 1BBOA 2EMGA 2EM8A 4R2CA 2EP3A 1X6FA 2YTNA 1A1LA 3EPLA 3MHSC 5KL3A 2EOFA 2LO3A 1X6EA 4R2DA 2JP9A 2ELYA 2EMWA 2EMYA 1RMDA 1LLMC 1MEYC 1B69A 2EMIA 2EOJA 2EM2A 2ENAA 2EOSA 2YTOA 2PRTA 2EM0A 1JK2A 2HGHA 2YU5A 2WCC3 4IS1C 2EN6A 1UBDC 2EN1A 2D9HA 1YSAC 1ZU1A 2EMFA 2LCEA 2EMBA 3EPHA 2MKDA 2EPRA 2EPCA 2EN8A 4M9VC 2EOMA 2WBUA 2YTFA 1P47A 4IJDA 1A1GA 1ZAAC 2EOXA 3VHTB 2YTPA 1AAYA 1NCSA 4R2QA 2EMHA 2EMXA 2JPAA 5KL6A 2BB8A 2CT1A 2EQ1A 2EPUA 1TN9A 2ELZA 5KL4A 2RSIA 3M99B 2EM5A 3EPKA 2DLQA 2LT7A 2YRMA 2EQ0A 1X3CA 2EN7A 4R2EA 2EOHA 4F6NA 2CSHA 2EM9A 4R2PA 1X6HA 1JK1A 2A25A 1YUIA 4FK5C 2EL4A 2YSPA 2EOQA 2MDGA 1G2DC 2ENCA 2EPAA 4R2AA 2YU8A 2EM7A 2LV2A 1Z1BA 1TF6A 1A1FA 2DLKA 2EM4A 4GZNC 1X5WA 4F6MA 2EMCA 2EPPA 2ADRA 2DGCA 5KL7A 4R2SA 2DRPA 1ZR9A 1A1KA 2EN3A 2EMAA 1F2IG 2YTEA 2E72A 2YTDA 2EMLA 2EM6A 2EOOA 2EOYA 2I13A 4X9JA 2EMKA 2EN2A 2EJ4A 2LVHA 2WBTA 1A1IA 1DGCA 1WJPA 2VRDA 2J7JA 2YTQA 1YUJA 2EOIA 4R2RA 4WSGA 5KL5A 2CTDA 2EL6A 2EL5A 2EPXA 2EPZA 2M9AA 2YRKA 2EE8A 3EPJA 1UN6B 2MKNA 2WBSA 2YTGA 2EN4A 2YTIA 2EMZA 2RPCA 1KJKA 3UK3C 2EQ3A 2DMIA 2GHFA 2R1FA 1G2FC 3MHHC 2EOZA 2NABA 2YTJA 2EOEA 2EM3A 2YSOA 1A1JA 1BB8A 2YRHA 1TF3A 2EORA 1A1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GLI A;  2ENH A;  4F2J C;  5KL2 A;  1BBO A;  2EMG A;  2EM8 A;  4R2C A;  2EP3 A;  1X6F A;  2YTN A;  1A1L A;  3EPL A;  3MHS C;  5KL3 A;  2EOF A;  2LO3 A;  1X6E A;  4R2D A;  2JP9 A;  2ELY A;  2EMW A;  2EMY A;  1RMD A;  1LLM C;  1MEY C;  1B69 A;  2EMI A;  2EOJ A;  2EM2 A;  2ENA A;  2EOS A;  2YTO A;  2PRT A;  2EM0 A;  1JK2 A;  2HGH A;  2YU5 A;  2WCC 3;  4IS1 C;  2EN6 A;  1UBD C;  2EN1 A;  2D9H A;  1YSA C;  1ZU1 A;  2EMF A;  2LCE A;  2EMB A;  3EPH A;  2MKD A;  2EPR A;  2EPC A;  2EN8 A;  4M9V C;  2EOM A;  2WBU A;  2YTF A;  1P47 A;  4IJD A;  1A1G A;  1ZAA C;  2EOX A;  3VHT B;  2YTP A;  1AAY A;  1NCS A;  4R2Q A;  2EMH A;  2EMX A;  2JPA A;  5KL6 A;  2BB8 A;  2CT1 A;  2EQ1 A;  2EPU A;  1TN9 A;  2ELZ A;  5KL4 A;  2RSI A;  3M99 B;  2EM5 A;  3EPK A;  2DLQ A;  2LT7 A;  2YRM A;  2EQ0 A;  1X3C A;  2EN7 A;  4R2E A;  2EOH A;  4F6N A;  2CSH A;  2EM9 A;  4R2P A;  1X6H A;  1JK1 A;  2A25 A;  1YUI A;  4FK5 C;  2EL4 A;  2YSP A;  2EOQ A;  2MDG A;  1G2D C;  2ENC A;  2EPA A;  4R2A A;  2YU8 A;  2EM7 A;  2LV2 A;  1Z1B A;  1TF6 A;  1A1F A;  2DLK A;  2EM4 A;  4GZN C;  1X5W A;  4F6M A;  2EMC A;  2EPP A;  2ADR A;  2DGC A;  5KL7 A;  4R2S A;  2DRP A;  1ZR9 A;  1A1K A;  2EN3 A;  2EMA A;  1F2I G;  2YTE A;  2E72 A;  2YTD A;  2EML A;  2EM6 A;  2EOO A;  2EOY A;  2I13 A;  4X9J A;  2EMK A;  2EN2 A;  2EJ4 A;  2LVH A;  2WBT A;  1A1I A;  1DGC A;  1WJP A;  2VRD A;  2J7J A;  2YTQ A;  1YUJ A;  2EOI A;  4R2R A;  4WSG A;  5KL5 A;  2CTD A;  2EL6 A;  2EL5 A;  2EPX A;  2EPZ A;  2M9A A;  2YRK A;  2EE8 A;  3EPJ A;  1UN6 B;  2MKN A;  2WBS A;  2YTG A;  2EN4 A;  2YTI A;  2EMZ A;  2RPC A;  1KJK A;  3UK3 C;  2EQ3 A;  2DMI A;  2GHF A;  2R1F A;  1G2F C;  3MHH C;  2EOZ A;  2NAB A;  2YTJ A;  2EOE A;  2EM3 A;  2YSO A;  1A1J A;  1BB8 A;  2YRH A;  1TF3 A;  2EOR A;  1A1H A; 
#chains in the Genus database with same CATH topology
 4M30 A;  1AH5 A;  1PJQ A;  4ZYG A;  4L5N C;  4DMI A;  5KL2 A;  4F9A B;  5BR8 E;  2LUQ A;  3THN A;  4R2C A;  2YTN A;  3ADI A;  2Q8U A;  1EH8 A;  3KZZ A;  2NUF A;  5KL3 A;  2LO3 A;  1WHQ A;  1HNZ E;  2HHH E;  5AE1 A;  1T38 A;  2EOJ A;  4X66 E;  2YTO A;  1N36 E;  4R8O A;  4X8W A;  2YPN A;  1PDA A;  2WCC 3;  2EZ6 A;  1UBD C;  2JR1 A;  4KWY A;  2EN1 A;  3BID A;  1FKA E;  2EMB A;  1NEI A;  2MKD A;  1QNT A;  2EN8 A;  2F4V E;  1P47 A;  2MDR A;  4IJD A;  1ZAA C;  4DR7 E;  3ZOQ B;  4NXN E;  5AAS A;  2EMH A;  5IWA E;  1ZBQ A;  5A6A A;  3F6H A;  4JI7 E;  2RSI A;  2LT7 A;  4DR2 E;  2YRM A;  2K7I A;  4BMJ A;  4R2E A;  2EOH A;  2E1M A;  1HR0 E;  2EM9 A;  4NHR A;  1EH7 A;  1IBM E;  2EWL A;  1GZ6 A;  2JWO A;  2EL4 A;  2YSP A;  1G2D C;  3LLH A;  5AE3 A;  2EM7 A;  4ZYH A;  1TF6 A;  3C6K A;  2EM4 A;  1X5W A;  3ADG A;  1X49 A;  2EPP A;  1XNQ E;  4DKK A;  4GKJ E;  1I94 E;  2VQE E;  1X48 A;  2BBG A;  2L2M A;  4LF7 E;  4R2S A;  2DRP A;  4LFA E;  4F9B B;  5LMU E;  2JOX A;  2YTE A;  5A2Q C;  2EML A;  4WFT A;  4DR6 E;  2EOY A;  2I13 A;  2EN2 A;  2EJ4 A;  3HXL A;  4YHH E;  2DSY A;  2YTQ A;  2EOI A;  2M4I A;  1HNW E;  1QU6 A;  4Q35 B;  1MGT A;  2HC5 A;  2V87 A;  2EL6 A;  5AC5 A;  2EE8 A;  5F3W A;  2WBS A;  1DQ3 A;  2EN4 A;  1KJK A;  1YYO A;  4BHB A;  3AUZ A;  2LRS A;  3C4T A;  5A6J A;  2YSO A;  2RTX A;  3IWB A;  4DV2 E;  5IT9 C;  2YRH A;  3ECR A;  2B3T B;  1IQO A;  5T6J A;  3K6Q A;  5IV8 B;  2GLI A;  5A69 A;  2N8X A;  5FLX C;  4F2J C;  2B7V A;  4P78 A;  1BBO A;  2RSM A;  2EM8 A;  2EP3 A;  1SR9 A;  4R2D A;  1X6E A;  2L3C A;  2EMW A;  2JP9 A;  3MSW A;  2MC5 A;  1LLM C;  1MEY C;  4M2Z A;  3AV0 A;  4WXC A;  4X65 E;  4LF8 E;  2PRT A;  2FTX B;  4NZV A;  2EM0 A;  2HGH A;  2I9I A;  3BBG A;  4B3T E;  1UHZ A;  1SFE A;  2EPN A;  2EPC A;  1IBL E;  3QG5 C;  2WBU A;  2YTF A;  2B9D A;  5DNY A;  3VHT B;  4KHP E;  1NCS A;  4TUI A;  4GEQ B;  2CT1 A;  2EPU A;  2FGG A;  2R76 A;  3J7A G;  5KL4 A;  2ODR C;  2E5L E;  2V88 A;  1T4L B;  4F6N A;  1YZ9 A;  4NXM E;  4O24 A;  4ZYE A;  2EPO A;  2UUB E;  4JI8 E;  4DV7 E;  2L3J A;  2MDG A;  2ENC A;  2V86 A;  4R2A A;  2YU8 A;  4DR1 E;  1IMU A;  3T1Y E;  1Z1B A;  1T4N A;  3EQ1 A;  2DLK A;  3IWD A;  2ADR A;  4DV4 E;  4WX9 A;  3L00 A;  4ZYD A;  1ZR9 A;  2EN3 A;  2HJJ A;  1IQS A;  2E72 A;  2EM6 A;  2EPK X;  5A6K A;  1A1I A;  2LVH A;  2V8Q B;  1EH6 A;  2H36 X;  2YT4 A;  4DV6 E;  1YUJ A;  4R2R A;  5KL5 A;  2CTD A;  1PJT A;  4DR3 E;  2YRK A;  1UN6 B;  4OOG C;  2MKN A;  2YTG A;  2M1S A;  2EMZ A;  3HPZ A;  3ADJ A;  4WXD A;  1XNR E;  1G2F C;  2EOZ A;  2RQL A;  2EOE A;  4B3S E;  1N34 E;  2LMZ A;  2JPA A;  1WHN A;  2K4V A;  2LTS A;  5TSE A;  2KOU A;  1IBK E;  3RMP A;  2YZT A;  4DUY E;  2NA2 A;  2EMG A;  1BBG A;  1X6F A;  4MLQ A;  2DB2 A;  2N3H A;  1WRJ A;  3VYX A;  1A1L A;  4BS9 A;  2ELY A;  3JTZ A;  3J81 C;  1B69 A;  4WSP A;  2EOS A;  4LF4 E;  3ADL A;  2LTR A;  4MLV A;  5AE2 A;  4AQY E;  2V89 A;  4O4K A;  1JK2 A;  4IS1 C;  3C4B A;  2EN6 A;  4J8Z A;  4JYA E;  2EMF A;  2JY9 A;  3F6G A;  2B7T A;  3TQM A;  4F54 A;  3P1X A;  4R2Q A;  5LLQ A;  4DV1 E;  4LFC E;  4BC9 A;  2EMX A;  4JI3 E;  2EQ1 A;  2JYA A;  2ELZ A;  3EPK A;  2L8T A;  3M99 B;  2RS7 A;  4LU9 A;  2JXP A;  2EQ0 A;  1X3C A;  5A6B A;  2EN7 A;  2V85 A;  4O43 A;  4R2P A;  3HQ1 A;  1X6H A;  3VYY A;  2LE2 A;  2F8B A;  4BC7 A;  4BCA A;  1YUI A;  4JI5 E;  4FK5 C;  3C6M A;  2EPA A;  1L4S A;  4LF5 E;  4HTG A;  4OX9 E;  3BF2 A;  1A1F A;  1YYK A;  3JU0 A;  4YY3 E;  5IXM B;  4GZN C;  1KYQ A;  2EMC A;  2L33 A;  2DGC A;  2EMA A;  2VE7 C;  2EPM X;  2CPN A;  2YTD A;  2EOO A;  4KZS A;  4L8N A;  3LML A;  1WJP A;  1RC7 A;  2NUE A;  2VRD A;  2J7J A;  4WSG A;  3JAM C;  3HPS A;  4DV0 E;  2L92 A;  4HEI A;  2YTI A;  3UK3 C;  4DR5 E;  2LBS B;  2M7Q A;  4X62 E;  4LFB E;  2NAB A;  2YTJ A;  4RHB B;  2NUG A;  1BB8 A;  2ZM6 E;  5AC4 A;  4DUZ E;  2EOR A;  1N3G A;  1A1H A;  4BBY A;  2UUC E;  2ENH A;  3OML A;  4JI0 E;  2KON A;  2G7H A;  4O5G A;  4F9C B;  4WYQ B;  1FJG E;  3EPL A;  3MHS C;  3T1H E;  2EOF A;  2EMY A;  1RMD A;  1YFH A;  4DR4 E;  2L2N A;  2LJU A;  2EMI A;  1N32 E;  2EM2 A;  2ENA A;  5CFF E;  1PKP A;  2WZO A;  2LJH A;  2N3G A;  1J26 A;  2DIX A;  1UIL A;  3J7Y p;  3HTX A;  2YU5 A;  4B3R E;  3THO B;  2D9H A;  1YSA C;  1ZU1 A;  1RQ0 A;  2LCE A;  3EPH A;  2VF1 A;  2EPR A;  3KZY A;  1J5E E;  2VQF E;  3IWC A;  4TUG A;  4LF6 E;  2V83 A;  1WXR A;  4M9V C;  2EOM A;  3DJW A;  4DV3 E;  1A1G A;  2EOX A;  2YTP A;  1X47 A;  4R03 A;  1T39 A;  1AAY A;  2YWQ A;  1XMQ E;  5KL6 A;  1O0W A;  2BB8 A;  2FV4 B;  1GTK A;  4LTY A;  1DI2 A;  3FIG A;  2DMY A;  1TN9 A;  2EM5 A;  4K0K E;  2DLQ A;  1STU A;  5A6B D;  4BHC A;  2IHR 1;  3OTO E;  4B3M E;  2L2K B;  1GQE A;  2CSH A;  2UXC E;  5LL6 R;  4JI2 E;  3BGH A;  1JK1 A;  2A25 A;  4WPY A;  2GPI A;  1ZBT A;  2EPL X;  2RS6 A;  3DF6 A;  2UXB E;  2EOQ A;  2LV2 A;  4RH8 A;  2L6M A;  2UUA E;  4P7D A;  4F6M A;  5ADZ A;  2ODR D;  5KL7 A;  2JVA A;  4JI4 E;  1A1K A;  4JV5 E;  3J80 C;  1F2I G;  4GKK E;  4DV5 E;  4X64 E;  4JI6 E;  4X9J A;  2EMK A;  2KHX A;  2WBT A;  1DGC A;  4I8O A;  1YPN A;  1HNX E;  1PJS A;  1N33 E;  2LUP B;  3H09 A;  2UXD E;  4N4R B;  5LMN E;  4JI1 E;  2EL5 A;  2EPX A;  2EPZ A;  2M9A A;  4M0V A;  3EPJ A;  1EKZ A;  2RPC A;  2EQ3 A;  2JOB A;  2DMI A;  2GHF A;  2UU9 E;  2R1F A;  3KWR A;  3VK6 A;  3MHH C;  2MC6 A;  4LF9 E;  1T4O A;  1YYW A;  4Q28 A;  2EM3 A;  1XMO E;  1A1J A;  1TF3 A; 
#chains in the Genus database with same CATH homology
 2GLI A;  2ENH A;  4F2J C;  5KL2 A;  1BBO A;  2EMG A;  2EM8 A;  4R2C A;  2EP3 A;  1X6F A;  2YTN A;  1A1L A;  3EPL A;  3MHS C;  5KL3 A;  2EOF A;  2LO3 A;  1X6E A;  4R2D A;  2JP9 A;  2ELY A;  2EMW A;  2EMY A;  1RMD A;  1LLM C;  1MEY C;  1B69 A;  2EMI A;  2EOJ A;  2EM2 A;  2ENA A;  2EOS A;  2YTO A;  2PRT A;  2EM0 A;  1JK2 A;  2HGH A;  2YU5 A;  2WCC 3;  4IS1 C;  2EN6 A;  1UBD C;  2EN1 A;  2D9H A;  1YSA C;  1ZU1 A;  2EMF A;  2LCE A;  2EMB A;  3EPH A;  2MKD A;  2EPR A;  2EPC A;  2EN8 A;  4M9V C;  2EOM A;  2WBU A;  2YTF A;  1P47 A;  4IJD A;  1A1G A;  1ZAA C;  2EOX A;  3VHT B;  2YTP A;  1AAY A;  1NCS A;  4R2Q A;  2EMH A;  2EMX A;  2JPA A;  5KL6 A;  2BB8 A;  2CT1 A;  2EQ1 A;  2EPU A;  1TN9 A;  2ELZ A;  5KL4 A;  2RSI A;  3M99 B;  2EM5 A;  3EPK A;  2DLQ A;  2LT7 A;  2YRM A;  2EQ0 A;  1X3C A;  2EN7 A;  4R2E A;  2EOH A;  4F6N A;  2CSH A;  2EM9 A;  4R2P A;  1X6H A;  1JK1 A;  2A25 A;  1YUI A;  4FK5 C;  2EL4 A;  2YSP A;  2EOQ A;  2MDG A;  1G2D C;  2ENC A;  2EPA A;  4R2A A;  2YU8 A;  2EM7 A;  2LV2 A;  1Z1B A;  1TF6 A;  1A1F A;  2DLK A;  2EM4 A;  4GZN C;  1X5W A;  4F6M A;  2EMC A;  2EPP A;  2ADR A;  2DGC A;  5KL7 A;  4R2S A;  2DRP A;  1ZR9 A;  1A1K A;  2EN3 A;  2EMA A;  1F2I G;  2YTE A;  2E72 A;  2YTD A;  2EML A;  2EM6 A;  2EOO A;  2EOY A;  2I13 A;  4X9J A;  2EMK A;  2EN2 A;  2EJ4 A;  2LVH A;  2WBT A;  1A1I A;  1DGC A;  1WJP A;  2VRD A;  2J7J A;  2YTQ A;  1YUJ A;  2EOI A;  4R2R A;  4WSG A;  5KL5 A;  2CTD A;  2EL6 A;  2EL5 A;  2EPX A;  2EPZ A;  2M9A A;  2YRK A;  2EE8 A;  3EPJ A;  1UN6 B;  2MKN A;  2WBS A;  2YTG A;  2EN4 A;  2YTI A;  2EMZ A;  2RPC A;  1KJK A;  3UK3 C;  2EQ3 A;  2DMI A;  2GHF A;  2R1F A;  1G2F C;  3MHH C;  2EOZ A;  2NAB A;  2YTJ A;  2EOE A;  2EM3 A;  2YSO A;  1A1J A;  1BB8 A;  2YRH A;  1TF3 A;  2EOR A;  1A1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...