1MEYC

Crystal structure of a designed zinc finger protein bound to dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
83
structure length
83
Chain Sequence
EKPYKCPECGKSFSQSSNLQKHQRTHTGEKPYKCPECGKSFSQSSDLQKHQRTHTGEKPYKCPECGKSFSRSDHLSRHQRTHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*AP*TP*GP*AP*GP*GP*CP*AP*GP*AP*AP*CP*T)-3')
publication title A 2.2 A Resolution Crystal Structure of a Designed Zinc Finger Protein Bound to DNA
pubmed doi rcsb
molecule tags Transferase/dna
total genus 29
structure length 83
sequence length 83
chains with identical sequence F, G
ec nomenclature
pdb deposition date 1996-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1meyC03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1meyC01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1meyC02
2EM2A 2MKDA 1A1HA 1A1KA 2EMYA 2EMKA 2CSHA 2DGCA 2MKNA 2JPAA 2EMCA 2WBTA 2YTPA 4R2CA 1ZAAC 1MEYC 2EN1A 3EPKA 5KL2A 4R2EA 2DLKA 2EN7A 1F2IG 2EM0A 3M99B 2EM7A 2EMLA 2EM4A 1X6EA 2EPRA 2EOXA 1G2FC 2EOSA 2EOYA 2EOEA 2EOFA 1X6HA 2YU5A 2EMAA 2MDGA 1A1GA 2YTQA 2EMBA 2EN6A 1RMDA 2EPUA 1WJPA 3EPJA 5KL4A 2DLQA 4X9JA 2ADRA 2EP3A 4GZNC 2GLIA 2YTFA 2M9AA 2EPXA 1G2DC 1LLMC 1YUIA 2WCC3 4WSGA 2YRKA 2EOIA 2EPZA 1TN9A 2YTOA 2YSPA 4IS1C 2ELZA 2YTNA 2EPPA 1B69A 2J7JA 1YSAC 1BB8A 3VHTB 3EPHA 2YRMA 4FK5C 4F6NA 2RSIA 4R2DA 2EN2A 2LT7A 1Z1BA 2EMFA 2EPCA 2WBSA 2E72A 1X5WA 2CTDA 2LO3A 2D9HA 2I13A 2YTEA 2EM9A 2R1FA 2EL4A 2PRTA 2EORA 2EN8A 2EN3A 2EMIA 2EM3A 2GHFA 4R2PA 2BB8A 1TF6A 1AAYA 2EM5A 1DGCA 2EMGA 5KL7A 2A25A 2EM8A 4R2RA 2DRPA 2ENHA 2JP9A 5KL6A 1TF3A 2EOHA 1A1FA 2ENCA 2EL5A 1KJKA 2NABA 4R2SA 2YU8A 1P47A 1YUJA 2YRHA 2EL6A 1UN6B 2EOQA 1A1IA 2EQ1A 2EE8A 2LVHA 4F6MA 4M9VC 2EOOA 2LCEA 2LV2A 4F2JC 1UBDC 2EQ3A 2YTDA 3MHHC 2YTGA 3MHSC 1A1JA 2WBUA 2YSOA 3UK3C 2EJ4A 2EMZA 2EPAA 2EOJA 1X6FA 2ENAA 1ZU1A 2EMHA 1JK1A 2EN4A 1A1LA 1X3CA 2YTIA 2VRDA 1ZR9A 2RPCA 1BBOA 2EMXA 4IJDA 2EOZA 1JK2A 5KL5A 2EOMA 2ELYA 5KL3A 4R2QA 2YTJA 2EM6A 2EMWA 2EQ0A 2DMIA 4R2AA 1NCSA 2HGHA 2CT1A 3EPLA
chains in the Genus database with same CATH superfamily
2EMYA 1PJTA 5A6BD 2DGCA 1HNZE 4LF9E 2EMCA 3BBGA 3AV0A 5F3WA 2LTSA 2F4VE 1ZAAC 1YPNA 1MEYC 4NHRA 3EPKA 1I94E 2ZM6E 4DR5E 4R2EA 1N3GA 1F2IG 2M1SA 1N33E 2BBGA 4DR7E 2RSMA 4P7DA 5AE2A 4DV0E 2K4VA 4F9AB 4OX9E 4M30A 2EOEA 5AASA 4DMIA 2KONA 3JU0A 2EN6A 2M4IA 4X66E 1RMDA 4M2ZA 1G2DC 4JI4E 2WCC3 2EOIA 1DI2A 1HNXE 2EPPA 2LRSA 3EPHA 2B7TA 2VQEE 2I13A 2EL4A 4LF7E 5AC4A 2EM3A 2GHFA 2F8BA 4BHCA 2BB8A 5AE3A 1TF6A 4BC9A 4LF8E 4F9CB 2EM5A 2RQLA 4LFCE 2EMGA 4X8WA 3THNA 2EM8A 4X64E 2DRPA 3ADLA 2RTXA 5KL6A 1TF3A 1A1FA 1FKAE 2EL5A 1UHZA 1IBME 1P47A 2YRHA 3F6GA 1PKPA 2EOQA 4K0KE 2LVHA 4JI6E 2EZ6A 2EOOA 2LV2A 4F2JC 2G7HA 4YY3E 2EQ3A 1UILA 2YSOA 4L8NA 2EJ4A 2DIXA 4ZYDA 2MC6A 2EOJA 1X6FA 2ENAA 2NUFA 2LJUA 1EH7A 1ZU1A 2EMHA 3HXLA 4ZYGA 3IWBA 2RS7A 1X3CA 5IV8B 1A1LA 4JYAE 2RPCA 2L3JA 4DV6E 2EOZA 4OOGC 4BCAA 5KL5A 4X62E 5A69A 4R2QA 4DR3E 1ZBTA 2EQ0A 2VQFE 2JOXA 2CT1A 3DF6A 2EM2A 1A1HA 2EMKA 4Q28A 2CSHA 2YWQA 5LMNE 2WZOA 2WBTA 4BS9A 2YTPA 4R2CA 2EN1A 2V88A 5KL2A 2EN7A 1X47A 3BIDA 4DKKA 2ODRD 5CFFE 2L3CA 3J81C 4B3RE 4ZYEA 4DUZE 4B3ME 1IMUA 3J80C 2EPKX 2Q8UA 1SR9A 2YU5A 1WXRA 2MDGA 1WRJA 2YTQA 2N3HA 1WJPA 1PDAA 2RS6A 2JVAA 4X9JA 4HEIA 2ADRA 4GZNC 2GLIA 5DNYA 1N32E 1RC7A 2EPXA 1LLMC 4I8OA 4WSGA 4WXCA 4B3TE 4IS1C 1T4NA 4GKJE 2J7JA 1BB8A 4FK5C 5LLQA 2RSIA 3HPSA 2E72A 2JR1A 2FTXB 5A6JA 4LF6E 2YT4A 4WFTA 4LF5E 3TQMA 2R1FA 4RH8A 2VE7C 2EN8A 2EN3A 1YYOA 4F54A 4MLVA 3J7AG 5LMUE 4LFAE 1IQSA 4DV4E 4JI8E 2EOHA 1N36E 2LJHA 1SFEA 1KJKA 4KHPE 1XNQE 1ZBQA 2YU8A 4KWYA 2EL6A 2JOBA 2EPLX 3ADIA 1A1IA 3ADJA 2EE8A 3C6KA 4GEQB 1N34E 2LTRA 4DR4E 4YHHE 3MHHC 3MHSC 4P78A 1A1JA 3UK3C 1EH8A 2UUAE 4B3SE 4RHBB 4MLQA 2UU9E 2B7VA 2K7IA 3KWRA 1ZR9A 4IJDA 2EOMA 2N8XA 2DMIA 1NCSA 3THOB 3EPLA 4DV3E 2MKDA 2LUPB 4LF4E 1A1KA 5A6BA 2MKNA 3KZYA 3KZZA 3L00A 5T6JA 1PJSA 3MSWA 4LTYA 2V86A 2DLKA 2LMZA 1YZ9A 3FIGA 3HPZA 1X6EA 1G2FC 2EOSA 1X6HA 1NEIA 2JWOA 5KL4A 3ECRA 5A2QC 4WYQB 2EP3A 2UUBE 1IBKE 2YTFA 1EH6A 2FGGA 2M9AA 1BBGA 2YRKA 2LBSB 2EPOA 2EPZA 4WPYA 2YTOA 2YSPA 5BR8E 2YTNA 4NXNE 2NA2A 3F6HA 4R03A 1YSAC 3P1XA 4O5GA 2E1MA 3VHTB 4LFBE 1WHNA 4F6NA 2HJJA 4R2DA 2EN2A 2LT7A 1Z1BA 2EMFA 2WBSA 2LO3A 2YZTA 4F9BB 4O43A 2N3GA 2L8TA 2HHHE 1YYWA 2D9HA 4JI7E 2EM9A 3HQ1A 3T1HE 2PRTA 1XNRE 2EPMX 1STUA 2IHR1 2EMIA 1KYQA 1O0WA 1DQ3A 4TUIA 1X49A 4AQYE 5KL7A 2A25A 2VF1A 4LU9A 4O24A 4DUYE 4GKKE 2ENCA 2V85A 2NUEA 4R2SA 2DB2A 2EQ1A 4F6MA 4M9VC 2LCEA 4DR1E 2V8QB 2LE2A 5LL6R 4BHBA 2WBUA 3BGHA 5IT9C 3DJWA 1MGTA 2EMZA 3OMLA 4ZYHA 2L33A 1JK1A 4JI2E 2VRDA 1WHQA 3C4TA 2B9DA 2EPNA 3BF2A 2UUCE 2NUGA 2ELYA 1QU6A 5IWAE 5AC5A 2YTJA 1X48A 2EMWA 4R2AA 1XMOE 3JTZA 2HGHA 3LMLA 2I9IA 4TUGA 2R76A 4BMJA 2JY9A 2JPAA 4DV7E 3K6QA 3VYYA 3AUZA 5A6KA 2FV4B 2B3TB 1HNWE 2EWLA 4NXME 5IXMB 1GZ6A 2EM0A 3M99B 2EM7A 1T38A 2JXPA 2EMLA 1XMQE 2KOUA 2EM4A 4L5NC 3RMPA 1EKZA 2EPRA 2EOXA 3ADGA 2E5LE 2EOYA 5ADZA 4JI0E 2EOFA 2EMAA 1A1GA 4M0VA 2EMBA 2EPUA 5TSEA 3EPJA 2DLQA 3OTOE 2UXDE 5A6AA 2MDRA 4Q35B 2UXBE 4JV5E 3J7Yp 1T4OA 1YUIA 4JI5E 3H09A 1TN9A 2ELZA 3IWDA 1B69A 4HTGA 2YRMA 4DV5E 3IWCA 2MC5A 2EPCA 2V83A 1X5WA 1YYKA 4N4RB 2CTDA 4DR6E 2KHXA 4NZVA 1GQEA 3HTXA 2YTEA 4DV2E 1IQOA 3C6MA 2L6MA 2EORA 4WX9A 1RQ0A 1AH5A 4J8ZA 3C4BA 4R2PA 1HR0E 4BC7A 1IBLE 1AAYA 4BBYA 2GPIA 1DGCA 1YFHA 2YPNA 2V87A 3EQ1A 4R2RA 1QNTA 2ENHA 2JP9A 4R8OA 3VYXA 5FLXC 2UXCE 2L92A 4JI3E 1T4LB 3ZOQB 2NABA 2L2NA 4DR2E 3T1YE 2H36X 1YUJA 1J26A 1UN6B 3QG5C 3VK6A 2DSYA 2V89A 4KZSA 1UBDC 4X65E 4WSPA 1GTKA 2YTDA 5AE1A 3JAMC 2L2KB 2YTGA 3LLHA 2L2MA 2M7QA 4WXDA 2EPAA 2HC5A 1PJQA 1T39A 2EN4A 4JI1E 4O4KA 2YTIA 2ODRC 1BBOA 2EMXA 1JK2A 1J5EE 2LUQA 5KL3A 2CPNA 2DMYA 2EM6A 2JYAA 1L4SA 4DV1E 1FJGE
chains in the Genus database with same CATH topology
2EM2A 2MKDA 1A1HA 1A1KA 2EMYA 2EMKA 2CSHA 2DGCA 2MKNA 2JPAA 2EMCA 2WBTA 2YTPA 4R2CA 1ZAAC 1MEYC 2EN1A 3EPKA 5KL2A 4R2EA 2DLKA 2EN7A 1F2IG 2EM0A 3M99B 2EM7A 2EMLA 2EM4A 1X6EA 2EPRA 2EOXA 1G2FC 2EOSA 2EOYA 2EOEA 2EOFA 1X6HA 2YU5A 2EMAA 2MDGA 1A1GA 2YTQA 2EMBA 2EN6A 1RMDA 2EPUA 1WJPA 3EPJA 5KL4A 2DLQA 4X9JA 2ADRA 2EP3A 4GZNC 2GLIA 2YTFA 2M9AA 2EPXA 1G2DC 1LLMC 1YUIA 2WCC3 4WSGA 2YRKA 2EOIA 2EPZA 1TN9A 2YTOA 2YSPA 4IS1C 2ELZA 2YTNA 2EPPA 1B69A 2J7JA 1YSAC 1BB8A 3VHTB 3EPHA 2YRMA 4FK5C 4F6NA 2RSIA 4R2DA 2EN2A 2LT7A 1Z1BA 2EMFA 2EPCA 2WBSA 2E72A 1X5WA 2CTDA 2LO3A 2D9HA 2I13A 2YTEA 2EM9A 2R1FA 2EL4A 2PRTA 2EORA 2EN8A 2EN3A 2EMIA 2EM3A 2GHFA 4R2PA 2BB8A 1TF6A 1AAYA 2EM5A 1DGCA 2EMGA 5KL7A 2A25A 2EM8A 4R2RA 2DRPA 2ENHA 2JP9A 5KL6A 1TF3A 2EOHA 1A1FA 2ENCA 2EL5A 1KJKA 2NABA 4R2SA 2YU8A 1P47A 1YUJA 2YRHA 2EL6A 1UN6B 2EOQA 1A1IA 2EQ1A 2EE8A 2LVHA 4F6MA 4M9VC 2EOOA 2LCEA 2LV2A 4F2JC 1UBDC 2EQ3A 2YTDA 3MHHC 2YTGA 3MHSC 1A1JA 2WBUA 2YSOA 3UK3C 2EJ4A 2EMZA 2EPAA 2EOJA 1X6FA 2ENAA 1ZU1A 2EMHA 1JK1A 2EN4A 1A1LA 1X3CA 2YTIA 2VRDA 1ZR9A 2RPCA 1BBOA 2EMXA 4IJDA 2EOZA 1JK2A 5KL5A 2EOMA 2ELYA 5KL3A 4R2QA 2YTJA 2EM6A 2EMWA 2EQ0A 2DMIA 4R2AA 1NCSA 2HGHA 2CT1A 3EPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EM2 A;  2MKD A;  1A1H A;  1A1K A;  2EMY A;  2EMK A;  2CSH A;  2DGC A;  2MKN A;  2JPA A;  2EMC A;  2WBT A;  2YTP A;  4R2C A;  1ZAA C;  1MEY C;  2EN1 A;  3EPK A;  5KL2 A;  4R2E A;  2DLK A;  2EN7 A;  1F2I G;  2EM0 A;  3M99 B;  2EM7 A;  2EML A;  2EM4 A;  1X6E A;  2EPR A;  2EOX A;  1G2F C;  2EOS A;  2EOY A;  2EOE A;  2EOF A;  1X6H A;  2YU5 A;  2EMA A;  2MDG A;  1A1G A;  2YTQ A;  2EMB A;  2EN6 A;  1RMD A;  2EPU A;  1WJP A;  3EPJ A;  5KL4 A;  2DLQ A;  4X9J A;  2ADR A;  2EP3 A;  4GZN C;  2GLI A;  2YTF A;  2M9A A;  2EPX A;  1G2D C;  1LLM C;  1YUI A;  2WCC 3;  4WSG A;  2YRK A;  2EOI A;  2EPZ A;  1TN9 A;  2YTO A;  2YSP A;  4IS1 C;  2ELZ A;  2YTN A;  2EPP A;  1B69 A;  2J7J A;  1YSA C;  1BB8 A;  3VHT B;  3EPH A;  2YRM A;  4FK5 C;  4F6N A;  2RSI A;  4R2D A;  2EN2 A;  2LT7 A;  1Z1B A;  2EMF A;  2EPC A;  2WBS A;  2E72 A;  1X5W A;  2CTD A;  2LO3 A;  2D9H A;  2I13 A;  2YTE A;  2EM9 A;  2R1F A;  2EL4 A;  2PRT A;  2EOR A;  2EN8 A;  2EN3 A;  2EMI A;  2EM3 A;  2GHF A;  4R2P A;  2BB8 A;  1TF6 A;  1AAY A;  2EM5 A;  1DGC A;  2EMG A;  5KL7 A;  2A25 A;  2EM8 A;  4R2R A;  2DRP A;  2ENH A;  2JP9 A;  5KL6 A;  1TF3 A;  2EOH A;  1A1F A;  2ENC A;  2EL5 A;  1KJK A;  2NAB A;  4R2S A;  2YU8 A;  1P47 A;  1YUJ A;  2YRH A;  2EL6 A;  1UN6 B;  2EOQ A;  1A1I A;  2EQ1 A;  2EE8 A;  2LVH A;  4F6M A;  4M9V C;  2EOO A;  2LCE A;  2LV2 A;  4F2J C;  1UBD C;  2EQ3 A;  2YTD A;  3MHH C;  2YTG A;  3MHS C;  1A1J A;  2WBU A;  2YSO A;  3UK3 C;  2EJ4 A;  2EMZ A;  2EPA A;  2EOJ A;  1X6F A;  2ENA A;  1ZU1 A;  2EMH A;  1JK1 A;  2EN4 A;  1A1L A;  1X3C A;  2YTI A;  2VRD A;  1ZR9 A;  2RPC A;  1BBO A;  2EMX A;  4IJD A;  2EOZ A;  1JK2 A;  5KL5 A;  2EOM A;  2ELY A;  5KL3 A;  4R2Q A;  2YTJ A;  2EM6 A;  2EMW A;  2EQ0 A;  2DMI A;  4R2A A;  1NCS A;  2HGH A;  2CT1 A;  3EPL A; 
#chains in the Genus database with same CATH topology
 2EMY A;  1PJT A;  5A6B D;  2DGC A;  1HNZ E;  4LF9 E;  2EMC A;  3BBG A;  3AV0 A;  5F3W A;  2LTS A;  2F4V E;  1ZAA C;  1YPN A;  1MEY C;  4NHR A;  3EPK A;  1I94 E;  2ZM6 E;  4DR5 E;  4R2E A;  1N3G A;  1F2I G;  2M1S A;  1N33 E;  2BBG A;  4DR7 E;  2RSM A;  4P7D A;  5AE2 A;  4DV0 E;  2K4V A;  4F9A B;  4OX9 E;  4M30 A;  2EOE A;  5AAS A;  4DMI A;  2KON A;  3JU0 A;  2EN6 A;  2M4I A;  4X66 E;  1RMD A;  4M2Z A;  1G2D C;  4JI4 E;  2WCC 3;  2EOI A;  1DI2 A;  1HNX E;  2EPP A;  2LRS A;  3EPH A;  2B7T A;  2VQE E;  2I13 A;  2EL4 A;  4LF7 E;  5AC4 A;  2EM3 A;  2GHF A;  2F8B A;  4BHC A;  2BB8 A;  5AE3 A;  1TF6 A;  4BC9 A;  4LF8 E;  4F9C B;  2EM5 A;  2RQL A;  4LFC E;  2EMG A;  4X8W A;  3THN A;  2EM8 A;  4X64 E;  2DRP A;  3ADL A;  2RTX A;  5KL6 A;  1TF3 A;  1A1F A;  1FKA E;  2EL5 A;  1UHZ A;  1IBM E;  1P47 A;  2YRH A;  3F6G A;  1PKP A;  2EOQ A;  4K0K E;  2LVH A;  4JI6 E;  2EZ6 A;  2EOO A;  2LV2 A;  4F2J C;  2G7H A;  4YY3 E;  2EQ3 A;  1UIL A;  2YSO A;  4L8N A;  2EJ4 A;  2DIX A;  4ZYD A;  2MC6 A;  2EOJ A;  1X6F A;  2ENA A;  2NUF A;  2LJU A;  1EH7 A;  1ZU1 A;  2EMH A;  3HXL A;  4ZYG A;  3IWB A;  2RS7 A;  1X3C A;  5IV8 B;  1A1L A;  4JYA E;  2RPC A;  2L3J A;  4DV6 E;  2EOZ A;  4OOG C;  4BCA A;  5KL5 A;  4X62 E;  5A69 A;  4R2Q A;  4DR3 E;  1ZBT A;  2EQ0 A;  2VQF E;  2JOX A;  2CT1 A;  3DF6 A;  2EM2 A;  1A1H A;  2EMK A;  4Q28 A;  2CSH A;  2YWQ A;  5LMN E;  2WZO A;  2WBT A;  4BS9 A;  2YTP A;  4R2C A;  2EN1 A;  2V88 A;  5KL2 A;  2EN7 A;  1X47 A;  3BID A;  4DKK A;  2ODR D;  5CFF E;  2L3C A;  3J81 C;  4B3R E;  4ZYE A;  4DUZ E;  4B3M E;  1IMU A;  3J80 C;  2EPK X;  2Q8U A;  1SR9 A;  2YU5 A;  1WXR A;  2MDG A;  1WRJ A;  2YTQ A;  2N3H A;  1WJP A;  1PDA A;  2RS6 A;  2JVA A;  4X9J A;  4HEI A;  2ADR A;  4GZN C;  2GLI A;  5DNY A;  1N32 E;  1RC7 A;  2EPX A;  1LLM C;  4I8O A;  4WSG A;  4WXC A;  4B3T E;  4IS1 C;  1T4N A;  4GKJ E;  2J7J A;  1BB8 A;  4FK5 C;  5LLQ A;  2RSI A;  3HPS A;  2E72 A;  2JR1 A;  2FTX B;  5A6J A;  4LF6 E;  2YT4 A;  4WFT A;  4LF5 E;  3TQM A;  2R1F A;  4RH8 A;  2VE7 C;  2EN8 A;  2EN3 A;  1YYO A;  4F54 A;  4MLV A;  3J7A G;  5LMU E;  4LFA E;  1IQS A;  4DV4 E;  4JI8 E;  2EOH A;  1N36 E;  2LJH A;  1SFE A;  1KJK A;  4KHP E;  1XNQ E;  1ZBQ A;  2YU8 A;  4KWY A;  2EL6 A;  2JOB A;  2EPL X;  3ADI A;  1A1I A;  3ADJ A;  2EE8 A;  3C6K A;  4GEQ B;  1N34 E;  2LTR A;  4DR4 E;  4YHH E;  3MHH C;  3MHS C;  4P78 A;  1A1J A;  3UK3 C;  1EH8 A;  2UUA E;  4B3S E;  4RHB B;  4MLQ A;  2UU9 E;  2B7V A;  2K7I A;  3KWR A;  1ZR9 A;  4IJD A;  2EOM A;  2N8X A;  2DMI A;  1NCS A;  3THO B;  3EPL A;  4DV3 E;  2MKD A;  2LUP B;  4LF4 E;  1A1K A;  5A6B A;  2MKN A;  3KZY A;  3KZZ A;  3L00 A;  5T6J A;  1PJS A;  3MSW A;  4LTY A;  2V86 A;  2DLK A;  2LMZ A;  1YZ9 A;  3FIG A;  3HPZ A;  1X6E A;  1G2F C;  2EOS A;  1X6H A;  1NEI A;  2JWO A;  5KL4 A;  3ECR A;  5A2Q C;  4WYQ B;  2EP3 A;  2UUB E;  1IBK E;  2YTF A;  1EH6 A;  2FGG A;  2M9A A;  1BBG A;  2YRK A;  2LBS B;  2EPO A;  2EPZ A;  4WPY A;  2YTO A;  2YSP A;  5BR8 E;  2YTN A;  4NXN E;  2NA2 A;  3F6H A;  4R03 A;  1YSA C;  3P1X A;  4O5G A;  2E1M A;  3VHT B;  4LFB E;  1WHN A;  4F6N A;  2HJJ A;  4R2D A;  2EN2 A;  2LT7 A;  1Z1B A;  2EMF A;  2WBS A;  2LO3 A;  2YZT A;  4F9B B;  4O43 A;  2N3G A;  2L8T A;  2HHH E;  1YYW A;  2D9H A;  4JI7 E;  2EM9 A;  3HQ1 A;  3T1H E;  2PRT A;  1XNR E;  2EPM X;  1STU A;  2IHR 1;  2EMI A;  1KYQ A;  1O0W A;  1DQ3 A;  4TUI A;  1X49 A;  4AQY E;  5KL7 A;  2A25 A;  2VF1 A;  4LU9 A;  4O24 A;  4DUY E;  4GKK E;  2ENC A;  2V85 A;  2NUE A;  4R2S A;  2DB2 A;  2EQ1 A;  4F6M A;  4M9V C;  2LCE A;  4DR1 E;  2V8Q B;  2LE2 A;  5LL6 R;  4BHB A;  2WBU A;  3BGH A;  5IT9 C;  3DJW A;  1MGT A;  2EMZ A;  3OML A;  4ZYH A;  2L33 A;  1JK1 A;  4JI2 E;  2VRD A;  1WHQ A;  3C4T A;  2B9D A;  2EPN A;  3BF2 A;  2UUC E;  2NUG A;  2ELY A;  1QU6 A;  5IWA E;  5AC5 A;  2YTJ A;  1X48 A;  2EMW A;  4R2A A;  1XMO E;  3JTZ A;  2HGH A;  3LML A;  2I9I A;  4TUG A;  2R76 A;  4BMJ A;  2JY9 A;  2JPA A;  4DV7 E;  3K6Q A;  3VYY A;  3AUZ A;  5A6K A;  2FV4 B;  2B3T B;  1HNW E;  2EWL A;  4NXM E;  5IXM B;  1GZ6 A;  2EM0 A;  3M99 B;  2EM7 A;  1T38 A;  2JXP A;  2EML A;  1XMQ E;  2KOU A;  2EM4 A;  4L5N C;  3RMP A;  1EKZ A;  2EPR A;  2EOX A;  3ADG A;  2E5L E;  2EOY A;  5ADZ A;  4JI0 E;  2EOF A;  2EMA A;  1A1G A;  4M0V A;  2EMB A;  2EPU A;  5TSE A;  3EPJ A;  2DLQ A;  3OTO E;  2UXD E;  5A6A A;  2MDR A;  4Q35 B;  2UXB E;  4JV5 E;  3J7Y p;  1T4O A;  1YUI A;  4JI5 E;  3H09 A;  1TN9 A;  2ELZ A;  3IWD A;  1B69 A;  4HTG A;  2YRM A;  4DV5 E;  3IWC A;  2MC5 A;  2EPC A;  2V83 A;  1X5W A;  1YYK A;  4N4R B;  2CTD A;  4DR6 E;  2KHX A;  4NZV A;  1GQE A;  3HTX A;  2YTE A;  4DV2 E;  1IQO A;  3C6M A;  2L6M A;  2EOR A;  4WX9 A;  1RQ0 A;  1AH5 A;  4J8Z A;  3C4B A;  4R2P A;  1HR0 E;  4BC7 A;  1IBL E;  1AAY A;  4BBY A;  2GPI A;  1DGC A;  1YFH A;  2YPN A;  2V87 A;  3EQ1 A;  4R2R A;  1QNT A;  2ENH A;  2JP9 A;  4R8O A;  3VYX A;  5FLX C;  2UXC E;  2L92 A;  4JI3 E;  1T4L B;  3ZOQ B;  2NAB A;  2L2N A;  4DR2 E;  3T1Y E;  2H36 X;  1YUJ A;  1J26 A;  1UN6 B;  3QG5 C;  3VK6 A;  2DSY A;  2V89 A;  4KZS A;  1UBD C;  4X65 E;  4WSP A;  1GTK A;  2YTD A;  5AE1 A;  3JAM C;  2L2K B;  2YTG A;  3LLH A;  2L2M A;  2M7Q A;  4WXD A;  2EPA A;  2HC5 A;  1PJQ A;  1T39 A;  2EN4 A;  4JI1 E;  4O4K A;  2YTI A;  2ODR C;  1BBO A;  2EMX A;  1JK2 A;  1J5E E;  2LUQ A;  5KL3 A;  2CPN A;  2DMY A;  2EM6 A;  2JYA A;  1L4S A;  4DV1 E;  1FJG E; 
#chains in the Genus database with same CATH homology
 2EM2 A;  2MKD A;  1A1H A;  1A1K A;  2EMY A;  2EMK A;  2CSH A;  2DGC A;  2MKN A;  2JPA A;  2EMC A;  2WBT A;  2YTP A;  4R2C A;  1ZAA C;  1MEY C;  2EN1 A;  3EPK A;  5KL2 A;  4R2E A;  2DLK A;  2EN7 A;  1F2I G;  2EM0 A;  3M99 B;  2EM7 A;  2EML A;  2EM4 A;  1X6E A;  2EPR A;  2EOX A;  1G2F C;  2EOS A;  2EOY A;  2EOE A;  2EOF A;  1X6H A;  2YU5 A;  2EMA A;  2MDG A;  1A1G A;  2YTQ A;  2EMB A;  2EN6 A;  1RMD A;  2EPU A;  1WJP A;  3EPJ A;  5KL4 A;  2DLQ A;  4X9J A;  2ADR A;  2EP3 A;  4GZN C;  2GLI A;  2YTF A;  2M9A A;  2EPX A;  1G2D C;  1LLM C;  1YUI A;  2WCC 3;  4WSG A;  2YRK A;  2EOI A;  2EPZ A;  1TN9 A;  2YTO A;  2YSP A;  4IS1 C;  2ELZ A;  2YTN A;  2EPP A;  1B69 A;  2J7J A;  1YSA C;  1BB8 A;  3VHT B;  3EPH A;  2YRM A;  4FK5 C;  4F6N A;  2RSI A;  4R2D A;  2EN2 A;  2LT7 A;  1Z1B A;  2EMF A;  2EPC A;  2WBS A;  2E72 A;  1X5W A;  2CTD A;  2LO3 A;  2D9H A;  2I13 A;  2YTE A;  2EM9 A;  2R1F A;  2EL4 A;  2PRT A;  2EOR A;  2EN8 A;  2EN3 A;  2EMI A;  2EM3 A;  2GHF A;  4R2P A;  2BB8 A;  1TF6 A;  1AAY A;  2EM5 A;  1DGC A;  2EMG A;  5KL7 A;  2A25 A;  2EM8 A;  4R2R A;  2DRP A;  2ENH A;  2JP9 A;  5KL6 A;  1TF3 A;  2EOH A;  1A1F A;  2ENC A;  2EL5 A;  1KJK A;  2NAB A;  4R2S A;  2YU8 A;  1P47 A;  1YUJ A;  2YRH A;  2EL6 A;  1UN6 B;  2EOQ A;  1A1I A;  2EQ1 A;  2EE8 A;  2LVH A;  4F6M A;  4M9V C;  2EOO A;  2LCE A;  2LV2 A;  4F2J C;  1UBD C;  2EQ3 A;  2YTD A;  3MHH C;  2YTG A;  3MHS C;  1A1J A;  2WBU A;  2YSO A;  3UK3 C;  2EJ4 A;  2EMZ A;  2EPA A;  2EOJ A;  1X6F A;  2ENA A;  1ZU1 A;  2EMH A;  1JK1 A;  2EN4 A;  1A1L A;  1X3C A;  2YTI A;  2VRD A;  1ZR9 A;  2RPC A;  1BBO A;  2EMX A;  4IJD A;  2EOZ A;  1JK2 A;  5KL5 A;  2EOM A;  2ELY A;  5KL3 A;  4R2Q A;  2YTJ A;  2EM6 A;  2EMW A;  2EQ0 A;  2DMI A;  4R2A A;  1NCS A;  2HGH A;  2CT1 A;  3EPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...