1MEYC

Crystal structure of a designed zinc finger protein bound to dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
83
structure length
83
Chain Sequence
EKPYKCPECGKSFSQSSNLQKHQRTHTGEKPYKCPECGKSFSQSSDLQKHQRTHTGEKPYKCPECGKSFSRSDHLSRHQRTHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A 2.2 A Resolution Crystal Structure of a Designed Zinc Finger Protein Bound to DNA
pubmed doi rcsb
molecule tags Transferase/dna
molecule keywords DNA (5'-D(*AP*TP*GP*AP*GP*GP*CP*AP*GP*AP*AP*CP*T)-3')
total genus 29
structure length 83
sequence length 83
chains with identical sequence F, G
ec nomenclature
pdb deposition date 1996-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1meyC03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1meyC01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1meyC02
2M9AA 2EL5A 2EOZA 1Z1BA 4IS1C 2YTJA 1A1JA 2ENHA 2MDGA 2LVHA 2EOHA 1AAYA 2DRPA 4X9JA 2PRTA 1JK2A 1X6EA 4R2EA 1A1HA 3EPHA 2LO3A 2YTNA 2DLKA 1ZU1A 2EL6A 2EM0A 2EM7A 2JPAA 1ZR9A 1LLMC 2EMBA 2EJ4A 2EMHA 5KL7A 2EN6A 1NCSA 2EMXA 2EOEA 4IJDA 1WJPA 2EPXA 2EPRA 2EL4A 2YRHA 5KL2A 5KL5A 2DGCA 3M99B 2GLIA 2ELYA 1BB8A 2EMYA 2EOJA 2YSOA 2YTFA 2EMLA 1X6HA 2HGHA 4R2RA 3EPLA 2E72A 2EMAA 2YU5A 2EPPA 4R2PA 2YSPA 4FK5C 4R2QA 1MEYC 1F2IG 4F6MA 4F2JC 2GHFA 1A1FA 2EM3A 3EPKA 2EPZA 2YTEA 1X5WA 2EM9A 2EOIA 2EOQA 2WCC3 2EOFA 2WBUA 1G2DC 2EN8A 2ENAA 1P47A 2BB8A 2EOOA 2EORA 2WBTA 2CSHA 2A25A 1A1LA 5KL3A 1TF6A 1A1KA 4R2AA 2EP3A 2EMGA 3MHSC 2EPAA 1A1GA 2YTGA 2EN2A 2EMIA 2J7JA 2RSIA 2EOYA 1X3CA 2JP9A 4M9VC 5KL4A 2EMZA 2NABA 2YTDA 4R2SA 2EMCA 1G2FC 4R2CA 3VHTB 2WBSA 2EN7A 2EQ3A 1KJKA 1B69A 2DMIA 3MHHC 2YRMA 2LT7A 2ELZA 1YUJA 1ZAAC 1YUIA 2EM8A 2EM2A 2CTDA 1UN6B 1TF3A 4R2DA 2LV2A 2EM6A 5KL6A 3EPJA 1JK1A 2D9HA 2CT1A 2EMFA 2YTIA 2R1FA 2YTOA 2VRDA 2ADRA 2EOMA 2DLQA 2MKNA 1BBOA 1YSAC 2EQ1A 2EOXA 2EPCA 2YRKA 4GZNC 2MKDA 2YTQA 2LCEA 1DGCA 3UK3C 2EOSA 2YU8A 2EM5A 4WSGA 2I13A 2EPUA 1A1IA 2EMWA 2EN3A 1RMDA 1TN9A 2EQ0A 2YTPA 1X6FA 1UBDC 2EN4A 2EN1A 4F6NA 2EE8A 2EM4A 2EMKA 2ENCA 2RPCA
chains in the Genus database with same CATH superfamily
4DKKA 2EL5A 4IS1C 2HHHE 1A1JA 2JOBA 2LJUA 4L5NC 4DV5E 1STUA 1NEIA 4LF7E 1PJQA 1A1HA 2EPNA 2LO3A 2EM7A 1QU6A 1HR0E 2L92A 3KZYA 2EMHA 1NCSA 3THNA 2EOEA 1T38A 2CPNA 4LFAE 2YWQA 4MLVA 3TQMA 4LF5E 2EPRA 5A2QC 2EL4A 2L2NA 5KL2A 4O5GA 4KWYA 5AE1A 1GTKA 5AE3A 2RTXA 3T1YE 4DR5E 2GLIA 2ELYA 1X48A 1RQ0A 1IQOA 1BB8A 1YYKA 2EOJA 2YSOA 2YTFA 2E5LE 1X6HA 2HGHA 2H36X 4DMIA 5DNYA 3IWBA 3C4TA 2EPPA 2YSPA 3RMPA 1MGTA 2LE2A 4F6MA 3JTZA 3C6MA 4JI5E 1YYWA 3F6GA 2EM9A 1BBGA 4LF6E 2EOQA 1N32E 2EOFA 2HC5A 4JI2E 2ENAA 4F9AB 1T4NA 3ECRA 2BB8A 2WBTA 1AH5A 5CFFE 1A1KA 4R8OA 3J80C 4ZYDA 4WPYA 2UXCE 4BMJA 2EOYA 1IQSA 4M9VC 1UHZA 4DV7E 2JP9A 5KL4A 2EMCA 2V86A 3LLHA 3ZOQB 4BBYA 2EM8A 5BR8E 5ADZA 1UN6B 1TF3A 2NUFA 4YHHE 2CT1A 4BHBA 3OTOE 5AE2A 2DLQA 4AQYE 4DV0E 1FJGE 3ADLA 2EOXA 2WZOA 3JAMC 2L33A 2EPMX 1DGCA 2YU8A 3T1HE 3BBGA 2EWLA 2I13A 2V87A 1PKPA 2EMWA 1N3GA 3J7Yp 4K0KE 2UXBE 1RMDA 1XNRE 2RS7A 1TN9A 1XMQE 4DR4E 2B7VA 2KHXA 1X49A 4DUYE 2EOZA 2JYAA 5LLQA 3ADGA 2L2MA 2LVHA 1AAYA 5AC5A 1O0WA 2G7HA 1ZBQA 4P78A 4JI8E 2L2KB 2JOXA 2YTNA 1UILA 2EL6A 2EM0A 1EKZA 2EJ4A 4Q35B 4L8NA 2EMXA 4LF9E 1WJPA 2DSYA 1ZBTA 5KL5A 5A6BD 2B9DA 3THOB 2M4IA 2K7IA 4DV4E 2L3JA 2B3TB 3P1XA 4R2RA 2YU5A 4FK5C 2DMYA 2KONA 2L3CA 1MEYC 4F2JC 1HNZE 1HNWE 2K4VA 5LMUE 1GZ6A 1IBME 2YTEA 4DR3E 1EH8A 4JI0E 3EQ1A 1N36E 2UUAE 2WCC3 1P47A 2ZM6E 4LTYA 1WXRA 2JXPA 3C4BA 1A1LA 3K6QA 3MHSC 4RHBB 4M30A 1A1GA 4NXNE 2YTGA 1T4LB 2V85A 4JI4E 3BGHA 2YZTA 1G2FC 2YTDA 1N34E 1YZ9A 2WBSA 2DMIA 3MHHC 2EM2A 2CTDA 4WFTA 4KZSA 4O43A 2UUCE 2EM6A 2RSMA 3EPJA 1JK1A 4P7DA 1XNQE 2EMFA 1EH7A 3F6HA 3H09A 2NA2A 2LUQA 3QG5C 3AUZA 1BBOA 4BC7A 4GZNC 2LCEA 2EM5A 2MDRA 4WSGA 1J5EE 4BHCA 5TSEA 2R76A 4J8ZA 5A6BA 4LF4E 2EN4A 4JI1E 3J81C 2RS6A 2EM4A 2EMKA 2L8TA 2DIXA 4WX9A 2M9AA 4YY3E 3BIDA 1Z1BA 5AC4A 2ENHA 2MDGA 5IT9C 2LRSA 2DRPA 4BCAA 2RQLA 2PRTA 1X6EA 1HNXE 4DV1E 4X8WA 4Q28A 1ZR9A 5KL7A 4IJDA 4KHPE 2VQEE 2M7QA 4DR7E 2EPKX 2YRHA 2L6MA 5IV8B 2DB2A 4ZYGA 2UUBE 3M99B 4BC9A 4DR2E 2V83A 2EMLA 2E72A 2BBGA 4R2QA 1IBKE 2LMZA 3EPKA 1PDAA 2EPZA 2NUGA 1XMOE 2EPOA 3HTXA 2YPNA 1SFEA 4X62E 1RC7A 2EN8A 4GEQB 4O24A 2EOOA 2EORA 3L00A 2CSHA 4LFCE 5A6KA 2EPLX 2ODRC 2A25A 1TF6A 4R2AA 1GQEA 4WXCA 2LUPB 3J7AG 2EN2A 2EMIA 2J7JA 4HTGA 4DR6E 2EQ3A 1PJTA 3OMLA 2V89A 4JI7E 2M1SA 1N33E 2YRMA 2KOUA 2ELZA 2MC6A 4WYQB 3HXLA 2VQFE 4NHRA 3VK6A 4R2DA 2LV2A 4B3RE 2N3GA 2LTRA 3VYYA 3HQ1A 2JY9A 5KL6A 1YFHA 4B3SE 5A69A 4JV5E 2YTIA 1YYOA 2R1FA 2YTOA 2VRDA 4NXME 2ADRA 5LL6R 2MKNA 1YSAC 2EQ1A 1IBLE 3IWCA 1L4SA 2EPCA 4MLQA 2VF1A 2Q8UA 1EH6A 1KYQA 3UK3C 2EOSA 4M2ZA 5T6JA 4OX9E 2EN3A 5A6AA 2E1MA 2EQ0A 2YTPA 1X6FA 4R03A 4B3TE 4F9BB 4JI6E 4DV6E 2EE8A 4OOGC 4X65E 2YTJA 2EOHA 4X9JA 4N4RB 1PJSA 1WHNA 2I9IA 4DV2E 3ADJA 1JK2A 2LTSA 4R2EA 3EPHA 2N3HA 2DLKA 1DI2A 1ZU1A 2UXDE 2JPAA 1LLMC 2EMBA 4M0VA 5AASA 2EN6A 4LU9A 2EPXA 3DF6A 2FGGA 4O4KA 3DJWA 4ZYHA 2ODRD 4JI3E 1SR9A 2UU9E 5LMNE 3C6KA 2DGCA 1DQ3A 2NUEA 3KZZA 2F8BA 4ZYEA 4DR1E 2EMYA 2LBSB 1YPNA 3EPLA 2EMAA 3FIGA 5FLXC 2LJHA 4R2PA 2EZ6A 2B7TA 1F2IG 2GHFA 1A1FA 3VYXA 2EM3A 2GPIA 4HEIA 2HJJA 4X66E 1T4OA 2VE7C 4LF8E 3ADIA 2F4VE 1X5WA 2EOIA 2FTXB 3LMLA 2WBUA 1G2DC 4JYAE 2MC5A 2JR1A 4TUGA 4F9CB 1J26A 3IWDA 5KL3A 1I94E 1WHQA 2EP3A 2EMGA 2EPAA 3HPZA 1X47A 2RSIA 3BF2A 4LFBE 1X3CA 2EMZA 2NABA 4R2SA 4R2CA 3VHTB 3MSWA 2EN7A 1KJKA 4GKJE 4RH8A 1B69A 1YUJA 2IHR1 2LT7A 2JWOA 1YUIA 1ZAAC 4WSPA 4DUZE 3JU0A 4WXDA 3HPSA 4I8OA 1T39A 2FV4B 2V8QB 2D9HA 3KWRA 1QNTA 1IMUA 4BS9A 4DV3E 4TUIA 3AV0A 2EOMA 4F54A 4X64E 2JVAA 2YRKA 2MKDA 2YTQA 5F3WA 5IXMB 2N8XA 1FKAE 2V88A 4B3ME 2EPUA 1A1IA 4NZVA 5IWAE 4GKKE 1UBDC 2EN1A 4F6NA 5A6JA 2YT4A 1WRJA 2ENCA 2RPCA
chains in the Genus database with same CATH topology
2M9AA 2EL5A 2EOZA 1Z1BA 4IS1C 2YTJA 1A1JA 2ENHA 2MDGA 2LVHA 2EOHA 1AAYA 2DRPA 4X9JA 2PRTA 1JK2A 1X6EA 4R2EA 1A1HA 3EPHA 2LO3A 2YTNA 2DLKA 1ZU1A 2EL6A 2EM0A 2EM7A 2JPAA 1ZR9A 1LLMC 2EMBA 2EJ4A 2EMHA 5KL7A 2EN6A 1NCSA 2EMXA 2EOEA 4IJDA 1WJPA 2EPXA 2EPRA 2EL4A 2YRHA 5KL2A 5KL5A 2DGCA 3M99B 2GLIA 2ELYA 1BB8A 2EMYA 2EOJA 2YSOA 2YTFA 2EMLA 1X6HA 2HGHA 4R2RA 3EPLA 2E72A 2EMAA 2YU5A 2EPPA 4R2PA 2YSPA 4FK5C 4R2QA 1MEYC 1F2IG 4F6MA 4F2JC 2GHFA 1A1FA 2EM3A 3EPKA 2EPZA 2YTEA 1X5WA 2EM9A 2EOIA 2EOQA 2WCC3 2EOFA 2WBUA 1G2DC 2EN8A 2ENAA 1P47A 2BB8A 2EOOA 2EORA 2WBTA 2CSHA 2A25A 1A1LA 5KL3A 1TF6A 1A1KA 4R2AA 2EP3A 2EMGA 3MHSC 2EPAA 1A1GA 2YTGA 2EN2A 2EMIA 2J7JA 2RSIA 2EOYA 1X3CA 2JP9A 4M9VC 5KL4A 2EMZA 2NABA 2YTDA 4R2SA 2EMCA 1G2FC 4R2CA 3VHTB 2WBSA 2EN7A 2EQ3A 1KJKA 1B69A 2DMIA 3MHHC 2YRMA 2LT7A 2ELZA 1YUJA 1ZAAC 1YUIA 2EM8A 2EM2A 2CTDA 1UN6B 1TF3A 4R2DA 2LV2A 2EM6A 5KL6A 3EPJA 1JK1A 2D9HA 2CT1A 2EMFA 2YTIA 2R1FA 2YTOA 2VRDA 2ADRA 2EOMA 2DLQA 2MKNA 1BBOA 1YSAC 2EQ1A 2EOXA 2EPCA 2YRKA 4GZNC 2MKDA 2YTQA 2LCEA 1DGCA 3UK3C 2EOSA 2YU8A 2EM5A 4WSGA 2I13A 2EPUA 1A1IA 2EMWA 2EN3A 1RMDA 1TN9A 2EQ0A 2YTPA 1X6FA 1UBDC 2EN4A 2EN1A 4F6NA 2EE8A 2EM4A 2EMKA 2ENCA 2RPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M9A A;  2EL5 A;  2EOZ A;  1Z1B A;  4IS1 C;  2YTJ A;  1A1J A;  2ENH A;  2MDG A;  2LVH A;  2EOH A;  1AAY A;  2DRP A;  4X9J A;  2PRT A;  1JK2 A;  1X6E A;  4R2E A;  1A1H A;  3EPH A;  2LO3 A;  2YTN A;  2DLK A;  1ZU1 A;  2EL6 A;  2EM0 A;  2EM7 A;  2JPA A;  1ZR9 A;  1LLM C;  2EMB A;  2EJ4 A;  2EMH A;  5KL7 A;  2EN6 A;  1NCS A;  2EMX A;  2EOE A;  4IJD A;  1WJP A;  2EPX A;  2EPR A;  2EL4 A;  2YRH A;  5KL2 A;  5KL5 A;  2DGC A;  3M99 B;  2GLI A;  2ELY A;  1BB8 A;  2EMY A;  2EOJ A;  2YSO A;  2YTF A;  2EML A;  1X6H A;  2HGH A;  4R2R A;  3EPL A;  2E72 A;  2EMA A;  2YU5 A;  2EPP A;  4R2P A;  2YSP A;  4FK5 C;  4R2Q A;  1MEY C;  1F2I G;  4F6M A;  4F2J C;  2GHF A;  1A1F A;  2EM3 A;  3EPK A;  2EPZ A;  2YTE A;  1X5W A;  2EM9 A;  2EOI A;  2EOQ A;  2WCC 3;  2EOF A;  2WBU A;  1G2D C;  2EN8 A;  2ENA A;  1P47 A;  2BB8 A;  2EOO A;  2EOR A;  2WBT A;  2CSH A;  2A25 A;  1A1L A;  5KL3 A;  1TF6 A;  1A1K A;  4R2A A;  2EP3 A;  2EMG A;  3MHS C;  2EPA A;  1A1G A;  2YTG A;  2EN2 A;  2EMI A;  2J7J A;  2RSI A;  2EOY A;  1X3C A;  2JP9 A;  4M9V C;  5KL4 A;  2EMZ A;  2NAB A;  2YTD A;  4R2S A;  2EMC A;  1G2F C;  4R2C A;  3VHT B;  2WBS A;  2EN7 A;  2EQ3 A;  1KJK A;  1B69 A;  2DMI A;  3MHH C;  2YRM A;  2LT7 A;  2ELZ A;  1YUJ A;  1ZAA C;  1YUI A;  2EM8 A;  2EM2 A;  2CTD A;  1UN6 B;  1TF3 A;  4R2D A;  2LV2 A;  2EM6 A;  5KL6 A;  3EPJ A;  1JK1 A;  2D9H A;  2CT1 A;  2EMF A;  2YTI A;  2R1F A;  2YTO A;  2VRD A;  2ADR A;  2EOM A;  2DLQ A;  2MKN A;  1BBO A;  1YSA C;  2EQ1 A;  2EOX A;  2EPC A;  2YRK A;  4GZN C;  2MKD A;  2YTQ A;  2LCE A;  1DGC A;  3UK3 C;  2EOS A;  2YU8 A;  2EM5 A;  4WSG A;  2I13 A;  2EPU A;  1A1I A;  2EMW A;  2EN3 A;  1RMD A;  1TN9 A;  2EQ0 A;  2YTP A;  1X6F A;  1UBD C;  2EN4 A;  2EN1 A;  4F6N A;  2EE8 A;  2EM4 A;  2EMK A;  2ENC A;  2RPC A; 
#chains in the Genus database with same CATH topology
 4DKK A;  2EL5 A;  4IS1 C;  2HHH E;  1A1J A;  2JOB A;  2LJU A;  4L5N C;  4DV5 E;  1STU A;  1NEI A;  4LF7 E;  1PJQ A;  1A1H A;  2EPN A;  2LO3 A;  2EM7 A;  1QU6 A;  1HR0 E;  2L92 A;  3KZY A;  2EMH A;  1NCS A;  3THN A;  2EOE A;  1T38 A;  2CPN A;  4LFA E;  2YWQ A;  4MLV A;  3TQM A;  4LF5 E;  2EPR A;  5A2Q C;  2EL4 A;  2L2N A;  5KL2 A;  4O5G A;  4KWY A;  5AE1 A;  1GTK A;  5AE3 A;  2RTX A;  3T1Y E;  4DR5 E;  2GLI A;  2ELY A;  1X48 A;  1RQ0 A;  1IQO A;  1BB8 A;  1YYK A;  2EOJ A;  2YSO A;  2YTF A;  2E5L E;  1X6H A;  2HGH A;  2H36 X;  4DMI A;  5DNY A;  3IWB A;  3C4T A;  2EPP A;  2YSP A;  3RMP A;  1MGT A;  2LE2 A;  4F6M A;  3JTZ A;  3C6M A;  4JI5 E;  1YYW A;  3F6G A;  2EM9 A;  1BBG A;  4LF6 E;  2EOQ A;  1N32 E;  2EOF A;  2HC5 A;  4JI2 E;  2ENA A;  4F9A B;  1T4N A;  3ECR A;  2BB8 A;  2WBT A;  1AH5 A;  5CFF E;  1A1K A;  4R8O A;  3J80 C;  4ZYD A;  4WPY A;  2UXC E;  4BMJ A;  2EOY A;  1IQS A;  4M9V C;  1UHZ A;  4DV7 E;  2JP9 A;  5KL4 A;  2EMC A;  2V86 A;  3LLH A;  3ZOQ B;  4BBY A;  2EM8 A;  5BR8 E;  5ADZ A;  1UN6 B;  1TF3 A;  2NUF A;  4YHH E;  2CT1 A;  4BHB A;  3OTO E;  5AE2 A;  2DLQ A;  4AQY E;  4DV0 E;  1FJG E;  3ADL A;  2EOX A;  2WZO A;  3JAM C;  2L33 A;  2EPM X;  1DGC A;  2YU8 A;  3T1H E;  3BBG A;  2EWL A;  2I13 A;  2V87 A;  1PKP A;  2EMW A;  1N3G A;  3J7Y p;  4K0K E;  2UXB E;  1RMD A;  1XNR E;  2RS7 A;  1TN9 A;  1XMQ E;  4DR4 E;  2B7V A;  2KHX A;  1X49 A;  4DUY E;  2EOZ A;  2JYA A;  5LLQ A;  3ADG A;  2L2M A;  2LVH A;  1AAY A;  5AC5 A;  1O0W A;  2G7H A;  1ZBQ A;  4P78 A;  4JI8 E;  2L2K B;  2JOX A;  2YTN A;  1UIL A;  2EL6 A;  2EM0 A;  1EKZ A;  2EJ4 A;  4Q35 B;  4L8N A;  2EMX A;  4LF9 E;  1WJP A;  2DSY A;  1ZBT A;  5KL5 A;  5A6B D;  2B9D A;  3THO B;  2M4I A;  2K7I A;  4DV4 E;  2L3J A;  2B3T B;  3P1X A;  4R2R A;  2YU5 A;  4FK5 C;  2DMY A;  2KON A;  2L3C A;  1MEY C;  4F2J C;  1HNZ E;  1HNW E;  2K4V A;  5LMU E;  1GZ6 A;  1IBM E;  2YTE A;  4DR3 E;  1EH8 A;  4JI0 E;  3EQ1 A;  1N36 E;  2UUA E;  2WCC 3;  1P47 A;  2ZM6 E;  4LTY A;  1WXR A;  2JXP A;  3C4B A;  1A1L A;  3K6Q A;  3MHS C;  4RHB B;  4M30 A;  1A1G A;  4NXN E;  2YTG A;  1T4L B;  2V85 A;  4JI4 E;  3BGH A;  2YZT A;  1G2F C;  2YTD A;  1N34 E;  1YZ9 A;  2WBS A;  2DMI A;  3MHH C;  2EM2 A;  2CTD A;  4WFT A;  4KZS A;  4O43 A;  2UUC E;  2EM6 A;  2RSM A;  3EPJ A;  1JK1 A;  4P7D A;  1XNQ E;  2EMF A;  1EH7 A;  3F6H A;  3H09 A;  2NA2 A;  2LUQ A;  3QG5 C;  3AUZ A;  1BBO A;  4BC7 A;  4GZN C;  2LCE A;  2EM5 A;  2MDR A;  4WSG A;  1J5E E;  4BHC A;  5TSE A;  2R76 A;  4J8Z A;  5A6B A;  4LF4 E;  2EN4 A;  4JI1 E;  3J81 C;  2RS6 A;  2EM4 A;  2EMK A;  2L8T A;  2DIX A;  4WX9 A;  2M9A A;  4YY3 E;  3BID A;  1Z1B A;  5AC4 A;  2ENH A;  2MDG A;  5IT9 C;  2LRS A;  2DRP A;  4BCA A;  2RQL A;  2PRT A;  1X6E A;  1HNX E;  4DV1 E;  4X8W A;  4Q28 A;  1ZR9 A;  5KL7 A;  4IJD A;  4KHP E;  2VQE E;  2M7Q A;  4DR7 E;  2EPK X;  2YRH A;  2L6M A;  5IV8 B;  2DB2 A;  4ZYG A;  2UUB E;  3M99 B;  4BC9 A;  4DR2 E;  2V83 A;  2EML A;  2E72 A;  2BBG A;  4R2Q A;  1IBK E;  2LMZ A;  3EPK A;  1PDA A;  2EPZ A;  2NUG A;  1XMO E;  2EPO A;  3HTX A;  2YPN A;  1SFE A;  4X62 E;  1RC7 A;  2EN8 A;  4GEQ B;  4O24 A;  2EOO A;  2EOR A;  3L00 A;  2CSH A;  4LFC E;  5A6K A;  2EPL X;  2ODR C;  2A25 A;  1TF6 A;  4R2A A;  1GQE A;  4WXC A;  2LUP B;  3J7A G;  2EN2 A;  2EMI A;  2J7J A;  4HTG A;  4DR6 E;  2EQ3 A;  1PJT A;  3OML A;  2V89 A;  4JI7 E;  2M1S A;  1N33 E;  2YRM A;  2KOU A;  2ELZ A;  2MC6 A;  4WYQ B;  3HXL A;  2VQF E;  4NHR A;  3VK6 A;  4R2D A;  2LV2 A;  4B3R E;  2N3G A;  2LTR A;  3VYY A;  3HQ1 A;  2JY9 A;  5KL6 A;  1YFH A;  4B3S E;  5A69 A;  4JV5 E;  2YTI A;  1YYO A;  2R1F A;  2YTO A;  2VRD A;  4NXM E;  2ADR A;  5LL6 R;  2MKN A;  1YSA C;  2EQ1 A;  1IBL E;  3IWC A;  1L4S A;  2EPC A;  4MLQ A;  2VF1 A;  2Q8U A;  1EH6 A;  1KYQ A;  3UK3 C;  2EOS A;  4M2Z A;  5T6J A;  4OX9 E;  2EN3 A;  5A6A A;  2E1M A;  2EQ0 A;  2YTP A;  1X6F A;  4R03 A;  4B3T E;  4F9B B;  4JI6 E;  4DV6 E;  2EE8 A;  4OOG C;  4X65 E;  2YTJ A;  2EOH A;  4X9J A;  4N4R B;  1PJS A;  1WHN A;  2I9I A;  4DV2 E;  3ADJ A;  1JK2 A;  2LTS A;  4R2E A;  3EPH A;  2N3H A;  2DLK A;  1DI2 A;  1ZU1 A;  2UXD E;  2JPA A;  1LLM C;  2EMB A;  4M0V A;  5AAS A;  2EN6 A;  4LU9 A;  2EPX A;  3DF6 A;  2FGG A;  4O4K A;  3DJW A;  4ZYH A;  2ODR D;  4JI3 E;  1SR9 A;  2UU9 E;  5LMN E;  3C6K A;  2DGC A;  1DQ3 A;  2NUE A;  3KZZ A;  2F8B A;  4ZYE A;  4DR1 E;  2EMY A;  2LBS B;  1YPN A;  3EPL A;  2EMA A;  3FIG A;  5FLX C;  2LJH A;  4R2P A;  2EZ6 A;  2B7T A;  1F2I G;  2GHF A;  1A1F A;  3VYX A;  2EM3 A;  2GPI A;  4HEI A;  2HJJ A;  4X66 E;  1T4O A;  2VE7 C;  4LF8 E;  3ADI A;  2F4V E;  1X5W A;  2EOI A;  2FTX B;  3LML A;  2WBU A;  1G2D C;  4JYA E;  2MC5 A;  2JR1 A;  4TUG A;  4F9C B;  1J26 A;  3IWD A;  5KL3 A;  1I94 E;  1WHQ A;  2EP3 A;  2EMG A;  2EPA A;  3HPZ A;  1X47 A;  2RSI A;  3BF2 A;  4LFB E;  1X3C A;  2EMZ A;  2NAB A;  4R2S A;  4R2C A;  3VHT B;  3MSW A;  2EN7 A;  1KJK A;  4GKJ E;  4RH8 A;  1B69 A;  1YUJ A;  2IHR 1;  2LT7 A;  2JWO A;  1YUI A;  1ZAA C;  4WSP A;  4DUZ E;  3JU0 A;  4WXD A;  3HPS A;  4I8O A;  1T39 A;  2FV4 B;  2V8Q B;  2D9H A;  3KWR A;  1QNT A;  1IMU A;  4BS9 A;  4DV3 E;  4TUI A;  3AV0 A;  2EOM A;  4F54 A;  4X64 E;  2JVA A;  2YRK A;  2MKD A;  2YTQ A;  5F3W A;  5IXM B;  2N8X A;  1FKA E;  2V88 A;  4B3M E;  2EPU A;  1A1I A;  4NZV A;  5IWA E;  4GKK E;  1UBD C;  2EN1 A;  4F6N A;  5A6J A;  2YT4 A;  1WRJ A;  2ENC A;  2RPC A; 
#chains in the Genus database with same CATH homology
 2M9A A;  2EL5 A;  2EOZ A;  1Z1B A;  4IS1 C;  2YTJ A;  1A1J A;  2ENH A;  2MDG A;  2LVH A;  2EOH A;  1AAY A;  2DRP A;  4X9J A;  2PRT A;  1JK2 A;  1X6E A;  4R2E A;  1A1H A;  3EPH A;  2LO3 A;  2YTN A;  2DLK A;  1ZU1 A;  2EL6 A;  2EM0 A;  2EM7 A;  2JPA A;  1ZR9 A;  1LLM C;  2EMB A;  2EJ4 A;  2EMH A;  5KL7 A;  2EN6 A;  1NCS A;  2EMX A;  2EOE A;  4IJD A;  1WJP A;  2EPX A;  2EPR A;  2EL4 A;  2YRH A;  5KL2 A;  5KL5 A;  2DGC A;  3M99 B;  2GLI A;  2ELY A;  1BB8 A;  2EMY A;  2EOJ A;  2YSO A;  2YTF A;  2EML A;  1X6H A;  2HGH A;  4R2R A;  3EPL A;  2E72 A;  2EMA A;  2YU5 A;  2EPP A;  4R2P A;  2YSP A;  4FK5 C;  4R2Q A;  1MEY C;  1F2I G;  4F6M A;  4F2J C;  2GHF A;  1A1F A;  2EM3 A;  3EPK A;  2EPZ A;  2YTE A;  1X5W A;  2EM9 A;  2EOI A;  2EOQ A;  2WCC 3;  2EOF A;  2WBU A;  1G2D C;  2EN8 A;  2ENA A;  1P47 A;  2BB8 A;  2EOO A;  2EOR A;  2WBT A;  2CSH A;  2A25 A;  1A1L A;  5KL3 A;  1TF6 A;  1A1K A;  4R2A A;  2EP3 A;  2EMG A;  3MHS C;  2EPA A;  1A1G A;  2YTG A;  2EN2 A;  2EMI A;  2J7J A;  2RSI A;  2EOY A;  1X3C A;  2JP9 A;  4M9V C;  5KL4 A;  2EMZ A;  2NAB A;  2YTD A;  4R2S A;  2EMC A;  1G2F C;  4R2C A;  3VHT B;  2WBS A;  2EN7 A;  2EQ3 A;  1KJK A;  1B69 A;  2DMI A;  3MHH C;  2YRM A;  2LT7 A;  2ELZ A;  1YUJ A;  1ZAA C;  1YUI A;  2EM8 A;  2EM2 A;  2CTD A;  1UN6 B;  1TF3 A;  4R2D A;  2LV2 A;  2EM6 A;  5KL6 A;  3EPJ A;  1JK1 A;  2D9H A;  2CT1 A;  2EMF A;  2YTI A;  2R1F A;  2YTO A;  2VRD A;  2ADR A;  2EOM A;  2DLQ A;  2MKN A;  1BBO A;  1YSA C;  2EQ1 A;  2EOX A;  2EPC A;  2YRK A;  4GZN C;  2MKD A;  2YTQ A;  2LCE A;  1DGC A;  3UK3 C;  2EOS A;  2YU8 A;  2EM5 A;  4WSG A;  2I13 A;  2EPU A;  1A1I A;  2EMW A;  2EN3 A;  1RMD A;  1TN9 A;  2EQ0 A;  2YTP A;  1X6F A;  1UBD C;  2EN4 A;  2EN1 A;  4F6N A;  2EE8 A;  2EM4 A;  2EMK A;  2ENC A;  2RPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...