4X9JA

Egr-1 with doubly methylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
86
structure length
86
Chain Sequence
ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription regulator/dna
molecule keywords Early growth response protein 1
publication title Structural impact of complete CpG methylation within target DNA on specific complex formation of the inducible transcription factor Egr-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4x9jA00
2EN4A 2WCC3 2EOFA 2RSIA 1NCSA 2CSHA 2YU8A 2EL4A 4R2QA 1KJKA 2YTNA 2EPPA 3EPHA 1LLMC 2EMLA 1A1HA 2LV2A 2ELZA 2ELYA 2R1FA 1G2FC 2HGHA 1ZR9A 2EMYA 2EM8A 1JK1A 2YTJA 2JP9A 2EM3A 2EM0A 1A1LA 2DRPA 2EMZA 2YSPA 3MHSC 2EOMA 2EMGA 2EQ3A 2EM2A 4GZNC 4R2AA 2DLQA 2YTEA 1ZAAC 2JPAA 2WBUA 3EPJA 2LCEA 2LT7A 2EOOA 4FK5C 2CTDA 3EPLA 2EJ4A 2EOSA 2BB8A 5KL3A 2YRMA 2PRTA 2LVHA 4F6NA 4WSGA 2EN3A 3UK3C 2CT1A 2EPAA 2EM6A 2EOQA 2WBSA 1A1GA 1TN9A 1AAYA 2RPCA 2EMBA 4R2RA 2ENAA 2J7JA 2YTIA 4X9JA 2EL6A 2EPRA 4R2CA 2EPUA 5KL5A 2EMCA 2EP3A 1A1KA 2E72A 2EMFA 2YTDA 2ENHA 2YTGA 2EOJA 3VHTB 2GHFA 1UN6B 2EPXA 1RMDA 2EQ1A 2YRKA 2YSOA 2EOXA 2EMAA 2VRDA 2EOEA 2MKDA 2EM4A 2EMKA 1Z1BA 5KL2A 1X6FA 2EN1A 5KL6A 2DLKA 2EMHA 2A25A 1B69A 4IS1C 5KL4A 2YTOA 1DGCA 2WBTA 1P47A 1BB8A 2EORA 1TF6A 2YU5A 4F6MA 2EOIA 2YRHA 2MDGA 2DMIA 2EN7A 2M9AA 1UBDC 1A1IA 2ADRA 2EPZA 2NABA 2EE8A 2EOZA 4M9VC 2EOHA 3EPKA 1F2IG 2I13A 2D9HA 2EOYA 2EMIA 1BBOA 5KL7A 4IJDA 1YUJA 1X6HA 4F2JC 4R2EA 2EN2A 2EM9A 2LO3A 1X3CA 1A1FA 1MEYC 2EQ0A 2YTQA 2EL5A 2YTPA 2EM5A 3M99B 2EN8A 2YTFA 4R2DA 2EMXA 1WJPA 1YSAC 2DGCA 4R2SA 2EMWA 1X5WA 1ZU1A 2ENCA 2GLIA 2EN6A 1YUIA 2EM7A 2EPCA 1A1JA 2MKNA 1JK2A 1G2DC 3MHHC 1TF3A 1X6EA 4R2PA
chains in the Genus database with same CATH superfamily
4JI6E 2RSIA 1YYOA 3MSWA 3BBGA 1WHNA 3ECRA 4MLVA 1N32E 2L3JA 1A1HA 3ADIA 2R1FA 2HGHA 4DR1E 2LTRA 2EM0A 2N8XA 4GEQB 2YSPA 2EOMA 2EMGA 4Q35B 4BHBA 2YPNA 1ZAAC 4O24A 2DIXA 2V85A 2LCEA 2LT7A 2YZTA 4F9AB 4FK5C 1RQ0A 2EJ4A 2BB8A 3ADJA 4B3TE 2LVHA 4F6NA 1STUA 2CT1A 4DKKA 3KWRA 2WBSA 1IMUA 2NUEA 2MC6A 2RPCA 3LMLA 5LMUE 2YTIA 2V87A 4JI0E 5IT9C 4R2CA 5KL5A 2EP3A 5LL6R 4NXME 2EMFA 2ENHA 3FIGA 4NXNE 2GHFA 4X65E 4DV2E 1FKAE 4NZVA 3F6GA 2YRKA 5AC5A 2RSMA 5A6JA 4F54A 2FTXB 2EM4A 2M1SA 4JV5E 2EMKA 4BMJA 4YY3E 4TUGA 1Z1BA 1L4SA 2EN1A 1J5EE 2LE2A 2LBSB 4BS9A 2DLKA 1T4OA 2WZOA 4F9CB 4IS1C 4JI2E 1DGCA 1P47A 2VF1A 4LF9E 4F6MA 4GKJE 3C6KA 1A1IA 3F6HA 4JI7E 1IBKE 3C4BA 4TUIA 1BBOA 4RH8A 3THNA 5KL7A 5A6BA 2LMZA 1X6HA 5BR8E 2RS6A 4WYQB 4DV3E 2EQ0A 2YTQA 3HQ1A 2EM5A 3M99B 2EMXA 1QU6A 2UXBE 1WJPA 4DV4E 1YSAC 3BGHA 4X62E 2JXPA 5AC4A 4LFAE 1HNXE 1SFEA 1N36E 4LFCE 4HEIA 1A1JA 1J26A 1G2DC 4LF7E 3MHHC 2HJJA 4R2PA 2EZ6A 2CPNA 1NCSA 2YU8A 2UUBE 4JI3E 3K6QA 1QNTA 2EL4A 3VYXA 4LTYA 2YTNA 4KZSA 3EPHA 4M2ZA 3JTZA 4L8NA 4B3RE 2ELYA 2JP9A 4OOGC 3THOB 1HNZE 4P7DA 1YYKA 4GZNC 2EM2A 4O4KA 1UILA 2DLQA 4B3SE 2YTEA 2JPAA 3EPJA 1X49A 3EPLA 3T1YE 2EN3A 2EPAA 3HXLA 4L5NC 2B9DA 1A1GA 5AE3A 1AAYA 2LJUA 4R2RA 2ENAA 3T1HE 2EPRA 4F9BB 2EPUA 2IHR1 2EMCA 1A1KA 1T4NA 2E72A 2YWQA 3HPSA 1FJGE 4X8WA 3LLHA 2YTGA 1UN6B 1HNWE 2NA2A 1T4LB 2EQ1A 2RS7A 3IWDA 2EMAA 2LTSA 1MGTA 5A69A 2EOEA 2MC5A 2EPNA 5KL2A 4K0KE 1X6FA 4BHCA 2N3GA 5F3WA 4NHRA 2EMHA 3IWBA 3J7Yp 5AE1A 1O0WA 2EPMX 1TF6A 2EPKX 4LU9A 2L2KB 2YU5A 3VYYA 2DSYA 2M9AA 2L6MA 2NUGA 2FGGA 3EPKA 3J80C 2D9HA 1YPNA 2JYAA 3OTOE 2EOYA 2V86A 4KHPE 4DR3E 4J8ZA 3AV0A 4F2JC 2LO3A 2G7HA 1ZBTA 1X3CA 1UHZA 2UUCE 3HTXA 2EL5A 2YTPA 4ZYHA 4Q28A 5AASA 1N3GA 2EMWA 1X5WA 2EN6A 2RQLA 4GKKE 1X48A 4DV1E 2EWLA 1IQOA 4BBYA 4DR4E 2V83A 2LRSA 2WCC3 2R76A 2EOFA 2CSHA 1EH6A 1XNRE 4R2QA 1KJKA 4OX9E 3ADLA 2EPPA 4M0VA 1LLMC 2EMLA 2ODRD 3QG5C 2LV2A 2L3CA 2ELZA 1ZR9A 2EMYA 1JK1A 2YTJA 1N34E 1A1LA 2UUAE 4DR2E 2DRPA 2EMZA 2N3HA 5CFFE 4DV7E 2JY9A 4R2AA 3J7AG 3EQ1A 1XMQE 2WBUA 2YRMA 2Q8UA 3UK3C 1SR9A 1HR0E 1TN9A 2KONA 2GPIA 2J7JA 4X9JA 2EL6A 4LFBE 2LJHA 2JOXA 5A6KA 2KHXA 1BBGA 2YTDA 2DMYA 2EPXA 1X47A 2L33A 4DR5E 2UU9E 2VRDA 2ZM6E 2MKDA 1YYWA 1GQEA 3RMPA 2F8BA 3KZYA 5KL6A 2A25A 1EH8A 2K4VA 4LF5E 1RC7A 2JR1A 2EOIA 2YRHA 2MDGA 1XNQE 2EN7A 1UBDC 5IXMB 4M30A 2NABA 4M9VC 4RHBB 4WX9A 1F2IG 1NEIA 4R8OA 3ZOQB 5A6BD 3C4TA 2JOBA 2L8TA 4IJDA 4HTGA 2LUPB 1YUJA 4R2EA 2EN2A 4WPYA 2EM9A 4N4RB 5LLQA 2M4IA 5TSEA 4O43A 1IBLE 2KOUA 2UXDE 2MDRA 4R2DA 4WXDA 2DGCA 4R2SA 1WHQA 2ENCA 4BCAA 1ZU1A 2GLIA 4AQYE 1YUIA 1AH5A 4DUZE 3P1XA 5IV8B 3AUZA 4DUYE 2MKNA 1JK2A 3JAMC 1ZBQA 3BIDA 4LF6E 5ADZA 2EN4A 4MLQA 3TQMA 2VQEE 5A2QC 4LF8E 4BC7A 3JU0A 4ZYEA 4DR7E 1G2FC 2B7VA 2EM8A 2EM3A 4JI8E 4BC9A 5LMNE 1GTKA 1N33E 4DR6E 1PDAA 1GZ6A 5DNYA 4WFTA 1EKZA 3MHSC 2EQ3A 1WXRA 4DV5E 1DQ3A 4KWYA 1EH7A 2V88A 2HHHE 2JVAA 2EOOA 4JI1E 2CTDA 5FLXC 3IWCA 2VQFE 2EOSA 2UXCE 5KL3A 2PRTA 2E5LE 4WSGA 1I94E 2JWOA 2EM6A 2EPOA 2VE7C 2EOQA 2BBGA 1DI2A 2LUQA 4WSPA 2EMBA 2ODRC 2HC5A 1XMOE 5T6JA 1WRJA 4O5GA 2I9IA 4WXCA 1IQSA 2EOJA 3VHTB 1T39A 1RMDA 4B3ME 1PKPA 2YT4A 4I8OA 4JI5E 2YSOA 2EOXA 3J81C 4LF4E 1PJQA 2RTXA 5AE2A 2L2NA 2V89A 4JI4E 1YZ9A 1KYQA 2L2MA 1B69A 3BF2A 3OMLA 2EPLX 3DF6A 5KL4A 2YTOA 1T38A 2WBTA 2NUFA 1BB8A 2EORA 2V8QB 1IBME 2B3TB 4P78A 5A6AA 2DMIA 2ADRA 2EPZA 2EE8A 2EOZA 5IWAE 2EOHA 3C6MA 2I13A 2E1MA 3VK6A 2B7TA 2L92A 2EMIA 2FV4B 4ZYGA 2H36X 4R03A 1PJTA 2F4VE 3L00A 1A1FA 1MEYC 2EN8A 2YTFA 3DJWA 3ADGA 3KZZA 4X66E 2K7IA 4ZYDA 2EM7A 4YHHE 2DB2A 1PJSA 2EPCA 4DV6E 4X64E 1YFHA 4JYAE 3H09A 2M7QA 3HPZA 4DV0E 4DMIA 1TF3A 1X6EA
chains in the Genus database with same CATH topology
2EN4A 2WCC3 2EOFA 2RSIA 1NCSA 2CSHA 2YU8A 2EL4A 4R2QA 1KJKA 2YTNA 2EPPA 3EPHA 1LLMC 2EMLA 1A1HA 2LV2A 2ELZA 2ELYA 2R1FA 1G2FC 2HGHA 1ZR9A 2EMYA 2EM8A 1JK1A 2YTJA 2JP9A 2EM3A 2EM0A 1A1LA 2DRPA 2EMZA 2YSPA 3MHSC 2EOMA 2EMGA 2EQ3A 2EM2A 4GZNC 4R2AA 2DLQA 2YTEA 1ZAAC 2JPAA 2WBUA 3EPJA 2LCEA 2LT7A 2EOOA 4FK5C 2CTDA 3EPLA 2EJ4A 2EOSA 2BB8A 5KL3A 2YRMA 2PRTA 2LVHA 4F6NA 4WSGA 2EN3A 3UK3C 2CT1A 2EPAA 2EM6A 2EOQA 2WBSA 1A1GA 1TN9A 1AAYA 2RPCA 2EMBA 4R2RA 2ENAA 2J7JA 2YTIA 4X9JA 2EL6A 2EPRA 4R2CA 2EPUA 5KL5A 2EMCA 2EP3A 1A1KA 2E72A 2EMFA 2YTDA 2ENHA 2YTGA 2EOJA 3VHTB 2GHFA 1UN6B 2EPXA 1RMDA 2EQ1A 2YRKA 2YSOA 2EOXA 2EMAA 2VRDA 2EOEA 2MKDA 2EM4A 2EMKA 1Z1BA 5KL2A 1X6FA 2EN1A 5KL6A 2DLKA 2EMHA 2A25A 1B69A 4IS1C 5KL4A 2YTOA 1DGCA 2WBTA 1P47A 1BB8A 2EORA 1TF6A 2YU5A 4F6MA 2EOIA 2YRHA 2MDGA 2DMIA 2EN7A 2M9AA 1UBDC 1A1IA 2ADRA 2EPZA 2NABA 2EE8A 2EOZA 4M9VC 2EOHA 3EPKA 1F2IG 2I13A 2D9HA 2EOYA 2EMIA 1BBOA 5KL7A 4IJDA 1YUJA 1X6HA 4F2JC 4R2EA 2EN2A 2EM9A 2LO3A 1X3CA 1A1FA 1MEYC 2EQ0A 2YTQA 2EL5A 2YTPA 2EM5A 3M99B 2EN8A 2YTFA 4R2DA 2EMXA 1WJPA 1YSAC 2DGCA 4R2SA 2EMWA 1X5WA 1ZU1A 2ENCA 2GLIA 2EN6A 1YUIA 2EM7A 2EPCA 1A1JA 2MKNA 1JK2A 1G2DC 3MHHC 1TF3A 1X6EA 4R2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN4 A;  2WCC 3;  2EOF A;  2RSI A;  1NCS A;  2CSH A;  2YU8 A;  2EL4 A;  4R2Q A;  1KJK A;  2YTN A;  2EPP A;  3EPH A;  1LLM C;  2EML A;  1A1H A;  2LV2 A;  2ELZ A;  2ELY A;  2R1F A;  1G2F C;  2HGH A;  1ZR9 A;  2EMY A;  2EM8 A;  1JK1 A;  2YTJ A;  2JP9 A;  2EM3 A;  2EM0 A;  1A1L A;  2DRP A;  2EMZ A;  2YSP A;  3MHS C;  2EOM A;  2EMG A;  2EQ3 A;  2EM2 A;  4GZN C;  4R2A A;  2DLQ A;  2YTE A;  1ZAA C;  2JPA A;  2WBU A;  3EPJ A;  2LCE A;  2LT7 A;  2EOO A;  4FK5 C;  2CTD A;  3EPL A;  2EJ4 A;  2EOS A;  2BB8 A;  5KL3 A;  2YRM A;  2PRT A;  2LVH A;  4F6N A;  4WSG A;  2EN3 A;  3UK3 C;  2CT1 A;  2EPA A;  2EM6 A;  2EOQ A;  2WBS A;  1A1G A;  1TN9 A;  1AAY A;  2RPC A;  2EMB A;  4R2R A;  2ENA A;  2J7J A;  2YTI A;  4X9J A;  2EL6 A;  2EPR A;  4R2C A;  2EPU A;  5KL5 A;  2EMC A;  2EP3 A;  1A1K A;  2E72 A;  2EMF A;  2YTD A;  2ENH A;  2YTG A;  2EOJ A;  3VHT B;  2GHF A;  1UN6 B;  2EPX A;  1RMD A;  2EQ1 A;  2YRK A;  2YSO A;  2EOX A;  2EMA A;  2VRD A;  2EOE A;  2MKD A;  2EM4 A;  2EMK A;  1Z1B A;  5KL2 A;  1X6F A;  2EN1 A;  5KL6 A;  2DLK A;  2EMH A;  2A25 A;  1B69 A;  4IS1 C;  5KL4 A;  2YTO A;  1DGC A;  2WBT A;  1P47 A;  1BB8 A;  2EOR A;  1TF6 A;  2YU5 A;  4F6M A;  2EOI A;  2YRH A;  2MDG A;  2DMI A;  2EN7 A;  2M9A A;  1UBD C;  1A1I A;  2ADR A;  2EPZ A;  2NAB A;  2EE8 A;  2EOZ A;  4M9V C;  2EOH A;  3EPK A;  1F2I G;  2I13 A;  2D9H A;  2EOY A;  2EMI A;  1BBO A;  5KL7 A;  4IJD A;  1YUJ A;  1X6H A;  4F2J C;  4R2E A;  2EN2 A;  2EM9 A;  2LO3 A;  1X3C A;  1A1F A;  1MEY C;  2EQ0 A;  2YTQ A;  2EL5 A;  2YTP A;  2EM5 A;  3M99 B;  2EN8 A;  2YTF A;  4R2D A;  2EMX A;  1WJP A;  1YSA C;  2DGC A;  4R2S A;  2EMW A;  1X5W A;  1ZU1 A;  2ENC A;  2GLI A;  2EN6 A;  1YUI A;  2EM7 A;  2EPC A;  1A1J A;  2MKN A;  1JK2 A;  1G2D C;  3MHH C;  1TF3 A;  1X6E A;  4R2P A; 
#chains in the Genus database with same CATH topology
 4JI6 E;  2RSI A;  1YYO A;  3MSW A;  3BBG A;  1WHN A;  3ECR A;  4MLV A;  1N32 E;  2L3J A;  1A1H A;  3ADI A;  2R1F A;  2HGH A;  4DR1 E;  2LTR A;  2EM0 A;  2N8X A;  4GEQ B;  2YSP A;  2EOM A;  2EMG A;  4Q35 B;  4BHB A;  2YPN A;  1ZAA C;  4O24 A;  2DIX A;  2V85 A;  2LCE A;  2LT7 A;  2YZT A;  4F9A B;  4FK5 C;  1RQ0 A;  2EJ4 A;  2BB8 A;  3ADJ A;  4B3T E;  2LVH A;  4F6N A;  1STU A;  2CT1 A;  4DKK A;  3KWR A;  2WBS A;  1IMU A;  2NUE A;  2MC6 A;  2RPC A;  3LML A;  5LMU E;  2YTI A;  2V87 A;  4JI0 E;  5IT9 C;  4R2C A;  5KL5 A;  2EP3 A;  5LL6 R;  4NXM E;  2EMF A;  2ENH A;  3FIG A;  4NXN E;  2GHF A;  4X65 E;  4DV2 E;  1FKA E;  4NZV A;  3F6G A;  2YRK A;  5AC5 A;  2RSM A;  5A6J A;  4F54 A;  2FTX B;  2EM4 A;  2M1S A;  4JV5 E;  2EMK A;  4BMJ A;  4YY3 E;  4TUG A;  1Z1B A;  1L4S A;  2EN1 A;  1J5E E;  2LE2 A;  2LBS B;  4BS9 A;  2DLK A;  1T4O A;  2WZO A;  4F9C B;  4IS1 C;  4JI2 E;  1DGC A;  1P47 A;  2VF1 A;  4LF9 E;  4F6M A;  4GKJ E;  3C6K A;  1A1I A;  3F6H A;  4JI7 E;  1IBK E;  3C4B A;  4TUI A;  1BBO A;  4RH8 A;  3THN A;  5KL7 A;  5A6B A;  2LMZ A;  1X6H A;  5BR8 E;  2RS6 A;  4WYQ B;  4DV3 E;  2EQ0 A;  2YTQ A;  3HQ1 A;  2EM5 A;  3M99 B;  2EMX A;  1QU6 A;  2UXB E;  1WJP A;  4DV4 E;  1YSA C;  3BGH A;  4X62 E;  2JXP A;  5AC4 A;  4LFA E;  1HNX E;  1SFE A;  1N36 E;  4LFC E;  4HEI A;  1A1J A;  1J26 A;  1G2D C;  4LF7 E;  3MHH C;  2HJJ A;  4R2P A;  2EZ6 A;  2CPN A;  1NCS A;  2YU8 A;  2UUB E;  4JI3 E;  3K6Q A;  1QNT A;  2EL4 A;  3VYX A;  4LTY A;  2YTN A;  4KZS A;  3EPH A;  4M2Z A;  3JTZ A;  4L8N A;  4B3R E;  2ELY A;  2JP9 A;  4OOG C;  3THO B;  1HNZ E;  4P7D A;  1YYK A;  4GZN C;  2EM2 A;  4O4K A;  1UIL A;  2DLQ A;  4B3S E;  2YTE A;  2JPA A;  3EPJ A;  1X49 A;  3EPL A;  3T1Y E;  2EN3 A;  2EPA A;  3HXL A;  4L5N C;  2B9D A;  1A1G A;  5AE3 A;  1AAY A;  2LJU A;  4R2R A;  2ENA A;  3T1H E;  2EPR A;  4F9B B;  2EPU A;  2IHR 1;  2EMC A;  1A1K A;  1T4N A;  2E72 A;  2YWQ A;  3HPS A;  1FJG E;  4X8W A;  3LLH A;  2YTG A;  1UN6 B;  1HNW E;  2NA2 A;  1T4L B;  2EQ1 A;  2RS7 A;  3IWD A;  2EMA A;  2LTS A;  1MGT A;  5A69 A;  2EOE A;  2MC5 A;  2EPN A;  5KL2 A;  4K0K E;  1X6F A;  4BHC A;  2N3G A;  5F3W A;  4NHR A;  2EMH A;  3IWB A;  3J7Y p;  5AE1 A;  1O0W A;  2EPM X;  1TF6 A;  2EPK X;  4LU9 A;  2L2K B;  2YU5 A;  3VYY A;  2DSY A;  2M9A A;  2L6M A;  2NUG A;  2FGG A;  3EPK A;  3J80 C;  2D9H A;  1YPN A;  2JYA A;  3OTO E;  2EOY A;  2V86 A;  4KHP E;  4DR3 E;  4J8Z A;  3AV0 A;  4F2J C;  2LO3 A;  2G7H A;  1ZBT A;  1X3C A;  1UHZ A;  2UUC E;  3HTX A;  2EL5 A;  2YTP A;  4ZYH A;  4Q28 A;  5AAS A;  1N3G A;  2EMW A;  1X5W A;  2EN6 A;  2RQL A;  4GKK E;  1X48 A;  4DV1 E;  2EWL A;  1IQO A;  4BBY A;  4DR4 E;  2V83 A;  2LRS A;  2WCC 3;  2R76 A;  2EOF A;  2CSH A;  1EH6 A;  1XNR E;  4R2Q A;  1KJK A;  4OX9 E;  3ADL A;  2EPP A;  4M0V A;  1LLM C;  2EML A;  2ODR D;  3QG5 C;  2LV2 A;  2L3C A;  2ELZ A;  1ZR9 A;  2EMY A;  1JK1 A;  2YTJ A;  1N34 E;  1A1L A;  2UUA E;  4DR2 E;  2DRP A;  2EMZ A;  2N3H A;  5CFF E;  4DV7 E;  2JY9 A;  4R2A A;  3J7A G;  3EQ1 A;  1XMQ E;  2WBU A;  2YRM A;  2Q8U A;  3UK3 C;  1SR9 A;  1HR0 E;  1TN9 A;  2KON A;  2GPI A;  2J7J A;  4X9J A;  2EL6 A;  4LFB E;  2LJH A;  2JOX A;  5A6K A;  2KHX A;  1BBG A;  2YTD A;  2DMY A;  2EPX A;  1X47 A;  2L33 A;  4DR5 E;  2UU9 E;  2VRD A;  2ZM6 E;  2MKD A;  1YYW A;  1GQE A;  3RMP A;  2F8B A;  3KZY A;  5KL6 A;  2A25 A;  1EH8 A;  2K4V A;  4LF5 E;  1RC7 A;  2JR1 A;  2EOI A;  2YRH A;  2MDG A;  1XNQ E;  2EN7 A;  1UBD C;  5IXM B;  4M30 A;  2NAB A;  4M9V C;  4RHB B;  4WX9 A;  1F2I G;  1NEI A;  4R8O A;  3ZOQ B;  5A6B D;  3C4T A;  2JOB A;  2L8T A;  4IJD A;  4HTG A;  2LUP B;  1YUJ A;  4R2E A;  2EN2 A;  4WPY A;  2EM9 A;  4N4R B;  5LLQ A;  2M4I A;  5TSE A;  4O43 A;  1IBL E;  2KOU A;  2UXD E;  2MDR A;  4R2D A;  4WXD A;  2DGC A;  4R2S A;  1WHQ A;  2ENC A;  4BCA A;  1ZU1 A;  2GLI A;  4AQY E;  1YUI A;  1AH5 A;  4DUZ E;  3P1X A;  5IV8 B;  3AUZ A;  4DUY E;  2MKN A;  1JK2 A;  3JAM C;  1ZBQ A;  3BID A;  4LF6 E;  5ADZ A;  2EN4 A;  4MLQ A;  3TQM A;  2VQE E;  5A2Q C;  4LF8 E;  4BC7 A;  3JU0 A;  4ZYE A;  4DR7 E;  1G2F C;  2B7V A;  2EM8 A;  2EM3 A;  4JI8 E;  4BC9 A;  5LMN E;  1GTK A;  1N33 E;  4DR6 E;  1PDA A;  1GZ6 A;  5DNY A;  4WFT A;  1EKZ A;  3MHS C;  2EQ3 A;  1WXR A;  4DV5 E;  1DQ3 A;  4KWY A;  1EH7 A;  2V88 A;  2HHH E;  2JVA A;  2EOO A;  4JI1 E;  2CTD A;  5FLX C;  3IWC A;  2VQF E;  2EOS A;  2UXC E;  5KL3 A;  2PRT A;  2E5L E;  4WSG A;  1I94 E;  2JWO A;  2EM6 A;  2EPO A;  2VE7 C;  2EOQ A;  2BBG A;  1DI2 A;  2LUQ A;  4WSP A;  2EMB A;  2ODR C;  2HC5 A;  1XMO E;  5T6J A;  1WRJ A;  4O5G A;  2I9I A;  4WXC A;  1IQS A;  2EOJ A;  3VHT B;  1T39 A;  1RMD A;  4B3M E;  1PKP A;  2YT4 A;  4I8O A;  4JI5 E;  2YSO A;  2EOX A;  3J81 C;  4LF4 E;  1PJQ A;  2RTX A;  5AE2 A;  2L2N A;  2V89 A;  4JI4 E;  1YZ9 A;  1KYQ A;  2L2M A;  1B69 A;  3BF2 A;  3OML A;  2EPL X;  3DF6 A;  5KL4 A;  2YTO A;  1T38 A;  2WBT A;  2NUF A;  1BB8 A;  2EOR A;  2V8Q B;  1IBM E;  2B3T B;  4P78 A;  5A6A A;  2DMI A;  2ADR A;  2EPZ A;  2EE8 A;  2EOZ A;  5IWA E;  2EOH A;  3C6M A;  2I13 A;  2E1M A;  3VK6 A;  2B7T A;  2L92 A;  2EMI A;  2FV4 B;  4ZYG A;  2H36 X;  4R03 A;  1PJT A;  2F4V E;  3L00 A;  1A1F A;  1MEY C;  2EN8 A;  2YTF A;  3DJW A;  3ADG A;  3KZZ A;  4X66 E;  2K7I A;  4ZYD A;  2EM7 A;  4YHH E;  2DB2 A;  1PJS A;  2EPC A;  4DV6 E;  4X64 E;  1YFH A;  4JYA E;  3H09 A;  2M7Q A;  3HPZ A;  4DV0 E;  4DMI A;  1TF3 A;  1X6E A; 
#chains in the Genus database with same CATH homology
 2EN4 A;  2WCC 3;  2EOF A;  2RSI A;  1NCS A;  2CSH A;  2YU8 A;  2EL4 A;  4R2Q A;  1KJK A;  2YTN A;  2EPP A;  3EPH A;  1LLM C;  2EML A;  1A1H A;  2LV2 A;  2ELZ A;  2ELY A;  2R1F A;  1G2F C;  2HGH A;  1ZR9 A;  2EMY A;  2EM8 A;  1JK1 A;  2YTJ A;  2JP9 A;  2EM3 A;  2EM0 A;  1A1L A;  2DRP A;  2EMZ A;  2YSP A;  3MHS C;  2EOM A;  2EMG A;  2EQ3 A;  2EM2 A;  4GZN C;  4R2A A;  2DLQ A;  2YTE A;  1ZAA C;  2JPA A;  2WBU A;  3EPJ A;  2LCE A;  2LT7 A;  2EOO A;  4FK5 C;  2CTD A;  3EPL A;  2EJ4 A;  2EOS A;  2BB8 A;  5KL3 A;  2YRM A;  2PRT A;  2LVH A;  4F6N A;  4WSG A;  2EN3 A;  3UK3 C;  2CT1 A;  2EPA A;  2EM6 A;  2EOQ A;  2WBS A;  1A1G A;  1TN9 A;  1AAY A;  2RPC A;  2EMB A;  4R2R A;  2ENA A;  2J7J A;  2YTI A;  4X9J A;  2EL6 A;  2EPR A;  4R2C A;  2EPU A;  5KL5 A;  2EMC A;  2EP3 A;  1A1K A;  2E72 A;  2EMF A;  2YTD A;  2ENH A;  2YTG A;  2EOJ A;  3VHT B;  2GHF A;  1UN6 B;  2EPX A;  1RMD A;  2EQ1 A;  2YRK A;  2YSO A;  2EOX A;  2EMA A;  2VRD A;  2EOE A;  2MKD A;  2EM4 A;  2EMK A;  1Z1B A;  5KL2 A;  1X6F A;  2EN1 A;  5KL6 A;  2DLK A;  2EMH A;  2A25 A;  1B69 A;  4IS1 C;  5KL4 A;  2YTO A;  1DGC A;  2WBT A;  1P47 A;  1BB8 A;  2EOR A;  1TF6 A;  2YU5 A;  4F6M A;  2EOI A;  2YRH A;  2MDG A;  2DMI A;  2EN7 A;  2M9A A;  1UBD C;  1A1I A;  2ADR A;  2EPZ A;  2NAB A;  2EE8 A;  2EOZ A;  4M9V C;  2EOH A;  3EPK A;  1F2I G;  2I13 A;  2D9H A;  2EOY A;  2EMI A;  1BBO A;  5KL7 A;  4IJD A;  1YUJ A;  1X6H A;  4F2J C;  4R2E A;  2EN2 A;  2EM9 A;  2LO3 A;  1X3C A;  1A1F A;  1MEY C;  2EQ0 A;  2YTQ A;  2EL5 A;  2YTP A;  2EM5 A;  3M99 B;  2EN8 A;  2YTF A;  4R2D A;  2EMX A;  1WJP A;  1YSA C;  2DGC A;  4R2S A;  2EMW A;  1X5W A;  1ZU1 A;  2ENC A;  2GLI A;  2EN6 A;  1YUI A;  2EM7 A;  2EPC A;  1A1J A;  2MKN A;  1JK2 A;  1G2D C;  3MHH C;  1TF3 A;  1X6E A;  4R2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...