2LMZA

Solution nmr structure of the novel conotoxin im23a from conus imperialis
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
42
structure length
42
Chain Sequence
IPYCGQTGAECYSWCIKQDLSKDWCCDFVKDIRMNPPADKCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Conotoxin im17a
publication title A helical conotoxin from Conus imperialis has a novel cysteine framework and defiines a new superfamily
doi rcsb
source organism Conus imperialis
total genus 8
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2011-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.530 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2lmzA00
2LMZA
chains in the Genus database with same CATH superfamily
3KZZA 4JI2E 4FK5C 2R76A 4LF9E 1DI2A 1IMUA 3KZYA 2E72A 2CTDA 2YTDA 3H09A 2JYAA 3MHHC 3LLHA 2I13A 2YTEA 2YZTA 2L2MA 2E1MA 3FIGA 4GEQB 2ENHA 3OMLA 2MC6A 2Q8UA 3VYYA 4DV4E 2YTIA 1I94E 3C6KA 1T38A 3BGHA 2EMHA 2FV4B 1A1LA 2LV2A 4DV0E 2JOBA 3IWDA 5TSEA 4DR2E 1AH5A 1ZBQA 2V89A 1X6EA 1IBME 3OTOE 1J26A 5FLXC 4HTGA 2NUGA 1DQ3A 1UILA 3T1YE 2EM9A 4RH8A 4LFAE 2EM8A 2IHR1 2BBGA 2NA2A 2EL4A 4OX9E 4L5NC 4M2ZA 2RS6A 1XMOE 2V83A 4BMJA 5F3WA 2CSHA 3BIDA 4DV5E 3J7AG 4YHHE 1X49A 2EN2A 2EN4A 1DGCA 5CFFE 1L4SA 2EE8A 1IBLE 4B3RE 4F6NA 1A1FA 1TN9A 2B9DA 2UXCE 2EOJA 2WZOA 2EN7A 1FJGE 4N4RB 2EOYA 2ENCA 2HC5A 5BR8E 2L3CA 1ZU1A 2CT1A 5LLQA 4X66E 1UN6B 4F54A 4LU9A 4BHCA 2D9HA 4B3TE 1FKAE 4R2AA 2YTQA 4DR3E 3EQ1A 2EMXA 4JI8E 2DRPA 1TF3A 1KJKA 4RHBB 2NABA 1N33E 1EH6A 4P7DA 3ZOQB 2MDGA 3LMLA 3J7Yp 1ZR9A 1T4NA 4DR4E 4F6MA 5KL3A 2ENAA 3T1HE 2NUFA 3TQMA 4GKJE 1KYQA 1JK1A 1PJSA 4X64E 2EOMA 2EZ6A 1P47A 1IBKE 2M4IA 1SR9A 3L00A 4R2QA 2L2NA 3QG5C 1X3CA 2F4VE 4Q28A 1EH8A 2YU8A 1BBOA 4DR5E 5A69A 4DUZE 2YTFA 5KL4A 3AV0A 2ODRC 2V87A 2LVHA 4JI0E 2K7IA 4R2CA 3IWCA 4NZVA 2N8XA 2EOFA 1MEYC 3ADGA 1SFEA 4AQYE 3UK3C 2MKNA 3EPKA 2DB2A 5ADZA 1X47A 2YRKA 4Q35B 2JWOA 1ZAAC 1X6HA 1BBGA 2FGGA 2ADRA 2K4VA 1YPNA 4NXME 2HJJA 2DSYA 1X48A 2JXPA 5LMUE 3J80C 1A1KA 3THOB 2R1FA 2YT4A 5IT9C 1B69A 2EMWA 3KWRA 3RMPA 2LMZA 2EM3A 2B7TA 1YYKA 2V85A 2LE2A 1RC7A 2EPOA 2L92A 2N3HA 4ZYEA 4DKKA 3ECRA 4HEIA 1PJTA 2EJ4A 2YU5A 3M99B 3IWBA 2EWLA 3HTXA 3F6HA 2EQ1A 2WBTA 2GLIA 3JTZA 2LUQA 2YTOA 4F9CB 4O5GA 2EQ0A 2EM2A 1HNZE 2B3TB 2EL6A 2EPRA 4JI1E 5KL2A 5A6BD 3BBGA 3J81C 4O24A 2YTGA 2YTPA 4O4KA 4R03A 4B3SE 5KL5A 2L8TA 2EOXA 2LUPB 4F9AB 4KZSA 4P78A 2UXBE 4DV6E 3EPHA 2N3GA 1T39A 4IJDA 2YTNA 2EPKX 2UXDE 4BS9A 2YRHA 2KHXA 2A25A 1YUIA 1A1JA 5IXMB 4R2RA 4DV2E 1XMQE 3VYXA 2JPAA 1STUA 2EOQA 3ADIA 2EMYA 2DLQA 4X65E 4ZYDA 2EOHA 4B3ME 4ZYGA 4MLQA 5AE1A 2VQFE 4LF6E 4K0KE 1IQSA 2I9IA 2RSMA 2EPNA 2EOEA 4JI4E 4F2JC 2M1SA 1JK2A 1WRJA 2B7VA 5A2QC 2YPNA 2EPAA 4WXCA 1IQOA 4DUYE 3HPSA 1T4LB 3K6QA 1N36E 4LF4E 3HXLA 2EPZA 2ELZA 2H36X 5T6JA 2M7QA 4JI6E 4O43A 1GQEA 1HNWE 4M9VC 1HNXE 2G7HA 2UUCE 2E5LE 3DF6A 4DR1E 1YUJA 2YSPA 1ZBTA 2EMZA 4JI7E 3P1XA 3C4BA 2UUBE 1YSAC 4WPYA 1A1IA 2MC5A 2EN8A 4LF5E 2RQLA 1T4OA 4BBYA 2EMCA 5AE3A 5A6JA 1X5WA 2EM7A 2L33A 3C6MA 3VHTB 2LBSB 2ZM6E 1J5EE 1XNRE 2EM0A 4R2SA 5IWAE 2EMAA 2LRSA 2EPCA 3F6GA 2RTXA 2DMYA 3AUZA 2RPCA 1RMDA 2EL5A 2LCEA 2RSIA 2LO3A 2YSOA 2JVAA 4WSGA 5AC4A 2VRDA 1F2IG 4KWYA 2WBSA 2JOXA 1WHQA 2DMIA 2EMGA 5KL6A 4JYAE 3BF2A 4DR6E 3MSWA 2LTSA 2NUEA 2EOZA 2EOSA 1PDAA 2WCC3 2UU9E 5KL7A 1GZ6A 2EMBA 4WXDA 2LJUA 2GHFA 4R2DA 2RS7A 2L6MA 1PKPA 4DV7E 4M0VA 3C4TA 1TF6A 4YY3E 3ADJA 2EQ3A 2EP3A 1EH7A 4ZYHA 2EN3A 4X62E 2EPPA 2EPUA 4WSPA 5AASA 2YRMA 2F8BA 2EMLA 4X9JA 2PRTA 4J8ZA 2VQEE 1LLMC 2EMIA 1EKZA 1NCSA 4R2PA 2DLKA 2DIXA 1QU6A 2J7JA 4LF7E 3HPZA 4JV5E 4NXNE 3EPJA 2EN1A 3DJWA 1G2FC 4R8OA 2VF1A 4I8OA 3ADLA 2BB8A 2EMKA 4WX9A 2MDRA 1Z1BA 1QNTA 2GPIA 5DNYA 1NEIA 4BCAA 2HGHA 2MKDA 4DMIA 4R2EA 1G2DC 4MLVA 4IS1C 1GTKA 1WJPA 5A6BA 2KOUA 4DV1E 3HQ1A 1MGTA 2EOIA 4LF8E 3JU0A 4LFCE 4OOGC 2V86A 1HR0E 1WHNA 2UUAE 1WXRA 4BC7A 2YTJA 4F9BB 2L3JA 4JI5E 2EMFA 2DGCA 4JI3E 1XNQE 4NHRA 5A6AA 4X8WA 2EORA 4TUGA 1YYOA 3THNA 3MHSC 5A6KA 1YYWA 2L2KB 1PJQA 4LTYA 1N32E 5LL6R 2JY9A 1X6FA 2LJHA 5AE2A 2EOOA 4WYQB 2VE7C 1A1GA 4L8NA 3EPLA 1BB8A 2JR1A 4DR7E 1YZ9A 1UBDC 2EM6A 2EM5A 2KONA 4BC9A 2EN6A 1UHZA 4DV3E 3VK6A 4M30A 4WFTA 2FTXB 5LMNE 1YFHA 4GZNC 1N34E 2EPMX 2M9AA 2JP9A 2V8QB 1AAYA 2HHHE 4KHPE 2YWQA 2EPXA 1N3GA 1A1HA 1O0WA 2V88A 2ODRD 2EPLX 2LT7A 3JAMC 2ELYA 4BHBA 5IV8B 2CPNA 2WBUA 2LTRA 5AC5A 1RQ0A 4GKKE 2EM4A 4LFBE 4TUIA
chains in the Genus database with same CATH topology
4X65E 2VQEE 4JI2E 4B3ME 4LF9E 1DI2A 5AE1A 2VQFE 4LF6E 1EKZA 4K0KE 4DR5E 4DUZE 3H09A 2DIXA 1QU6A 2RSMA 4LF7E 3AV0A 2ODRC 2V87A 3HPZA 3LLHA 4JI4E 4JI0E 2M1SA 4JV5E 4NXNE 2YZTA 2L2MA 2B7VA 2E1MA 3IWCA 5A2QC 3FIGA 3DJWA 4GEQB 3ADGA 4DUYE 3HPSA 3OMLA 4R8OA 2MC6A 4AQYE 3VYYA 4DV4E 2VF1A 4I8OA 2DB2A 1T4LB 1I94E 3ADLA 3K6QA 5ADZA 1N36E 2FV4B 4LF4E 1X47A 2MDRA 3HXLA 2H36X 5T6JA 2M7QA 4DV0E 4JI6E 2JWOA 5DNYA 1GQEA 4BCAA 1HNWE 4DMIA 2JOBA 3IWDA 4DR2E 1HNXE 2G7HA 2UUCE 2KOUA 4DV1E 1ZBQA 2V89A 3HQ1A 2FGGA 4GKJE 2K4VA 1IBME 4NXME 3OTOE 2E5LE 3DF6A 5FLXC 4DR1E 4LF8E 1J26A 3JU0A 2DSYA 1X48A 5LMUE 2NUGA 4LFCE 1DQ3A 1UILA 3J80C 3T1YE 1ZBTA 4OOGC 2V86A 1HR0E 4LFAE 1WHNA 2IHR1 4JI7E 2UUAE 2YT4A 3P1XA 3C4BA 4BC7A 4F9BB 1WXRA 2L3JA 3KWRA 3RMPA 5IT9C 2UUBE 4JI5E 2LMZA 4WPYA 2NA2A 2B7TA 1YYKA 4JI3E 2MC5A 2V85A 4LF5E 4OX9E 1T4OA 4L5NC 2RS6A 4M2ZA 1XNQE 2LE2A 1XMOE 4BBYA 5AE3A 2V83A 4BMJA 1RC7A 5F3WA 4X8WA 4TUGA 2L33A 1YYOA 2LBSB 2L92A 2N3HA 2ZM6E 1YYWA 1J5EE 1XNRE 4DKKA 4DV5E 3J7AG 2L2KB 4LTYA 5IWAE 4YHHE 1X49A 2LRSA 1N32E 3IWBA 3F6GA 2RTXA 2JY9A 2LJHA 5LL6R 2EWLA 5AE2A 5CFFE 2DMYA 3AUZA 3HTXA 1IBLE 4B3RE 3F6HA 4WYQB 2VE7C 2B9DA 4L8NA 2UXCE 3JTZA 2WZOA 2LUQA 4F9CB 1FJGE 2JR1A 5BR8E 2JVAA 2L3CA 1YZ9A 4DR7E 2JOXA 4X66E 1WHQA 2KONA 1HNZE 2B3TB 4BC9A 4F54A 4LU9A 4JI1E 3J81C 4JYAE 1UHZA 4B3TE 4DR6E 3MSWA 2LTSA 4DV3E 1FKAE 4DR3E 2NUEA 3VK6A 4M30A 4JI8E 4WFTA 2FTXB 4R03A 5LMNE 4B3SE 1N34E 1N33E 2L8TA 2UU9E 4P7DA 3ZOQB 1GZ6A 2V8QB 3LMLA 3J7Yp 2HHHE 4KHPE 2LUPB 2UXBE 1T4NA 4KZSA 4P78A 2RS7A 4F9AB 2L6MA 4DR4E 3T1HE 1O0WA 1PKPA 2V88A 4DV6E 2ODRD 4DV7E 2NUFA 4M0VA 3C4TA 2N3GA 3JAMC 2UXDE 4YY3E 4BS9A 3ADJA 4X64E 2KHXA 2CPNA 2EZ6A 1IBKE 2M4IA 1SR9A 2LTRA 1RQ0A 4X62E 5AASA 2L2NA 4WSPA 4DV2E 1XMQE 2F4VE 3VYXA 4GKKE 4LFBE 4Q28A 2F8BA 1STUA 4TUIA 3ADIA 4J8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LMZ A; 
#chains in the Genus database with same CATH topology
 3KZZ A;  4JI2 E;  4FK5 C;  2R76 A;  4LF9 E;  1DI2 A;  1IMU A;  3KZY A;  2E72 A;  2CTD A;  2YTD A;  3H09 A;  2JYA A;  3MHH C;  3LLH A;  2I13 A;  2YTE A;  2YZT A;  2L2M A;  2E1M A;  3FIG A;  4GEQ B;  2ENH A;  3OML A;  2MC6 A;  2Q8U A;  3VYY A;  4DV4 E;  2YTI A;  1I94 E;  3C6K A;  1T38 A;  3BGH A;  2EMH A;  2FV4 B;  1A1L A;  2LV2 A;  4DV0 E;  2JOB A;  3IWD A;  5TSE A;  4DR2 E;  1AH5 A;  1ZBQ A;  2V89 A;  1X6E A;  1IBM E;  3OTO E;  1J26 A;  5FLX C;  4HTG A;  2NUG A;  1DQ3 A;  1UIL A;  3T1Y E;  2EM9 A;  4RH8 A;  4LFA E;  2EM8 A;  2IHR 1;  2BBG A;  2NA2 A;  2EL4 A;  4OX9 E;  4L5N C;  4M2Z A;  2RS6 A;  1XMO E;  2V83 A;  4BMJ A;  5F3W A;  2CSH A;  3BID A;  4DV5 E;  3J7A G;  4YHH E;  1X49 A;  2EN2 A;  2EN4 A;  1DGC A;  5CFF E;  1L4S A;  2EE8 A;  1IBL E;  4B3R E;  4F6N A;  1A1F A;  1TN9 A;  2B9D A;  2UXC E;  2EOJ A;  2WZO A;  2EN7 A;  1FJG E;  4N4R B;  2EOY A;  2ENC A;  2HC5 A;  5BR8 E;  2L3C A;  1ZU1 A;  2CT1 A;  5LLQ A;  4X66 E;  1UN6 B;  4F54 A;  4LU9 A;  4BHC A;  2D9H A;  4B3T E;  1FKA E;  4R2A A;  2YTQ A;  4DR3 E;  3EQ1 A;  2EMX A;  4JI8 E;  2DRP A;  1TF3 A;  1KJK A;  4RHB B;  2NAB A;  1N33 E;  1EH6 A;  4P7D A;  3ZOQ B;  2MDG A;  3LML A;  3J7Y p;  1ZR9 A;  1T4N A;  4DR4 E;  4F6M A;  5KL3 A;  2ENA A;  3T1H E;  2NUF A;  3TQM A;  4GKJ E;  1KYQ A;  1JK1 A;  1PJS A;  4X64 E;  2EOM A;  2EZ6 A;  1P47 A;  1IBK E;  2M4I A;  1SR9 A;  3L00 A;  4R2Q A;  2L2N A;  3QG5 C;  1X3C A;  2F4V E;  4Q28 A;  1EH8 A;  2YU8 A;  1BBO A;  4DR5 E;  5A69 A;  4DUZ E;  2YTF A;  5KL4 A;  3AV0 A;  2ODR C;  2V87 A;  2LVH A;  4JI0 E;  2K7I A;  4R2C A;  3IWC A;  4NZV A;  2N8X A;  2EOF A;  1MEY C;  3ADG A;  1SFE A;  4AQY E;  3UK3 C;  2MKN A;  3EPK A;  2DB2 A;  5ADZ A;  1X47 A;  2YRK A;  4Q35 B;  2JWO A;  1ZAA C;  1X6H A;  1BBG A;  2FGG A;  2ADR A;  2K4V A;  1YPN A;  4NXM E;  2HJJ A;  2DSY A;  1X48 A;  2JXP A;  5LMU E;  3J80 C;  1A1K A;  3THO B;  2R1F A;  2YT4 A;  5IT9 C;  1B69 A;  2EMW A;  3KWR A;  3RMP A;  2LMZ A;  2EM3 A;  2B7T A;  1YYK A;  2V85 A;  2LE2 A;  1RC7 A;  2EPO A;  2L92 A;  2N3H A;  4ZYE A;  4DKK A;  3ECR A;  4HEI A;  1PJT A;  2EJ4 A;  2YU5 A;  3M99 B;  3IWB A;  2EWL A;  3HTX A;  3F6H A;  2EQ1 A;  2WBT A;  2GLI A;  3JTZ A;  2LUQ A;  2YTO A;  4F9C B;  4O5G A;  2EQ0 A;  2EM2 A;  1HNZ E;  2B3T B;  2EL6 A;  2EPR A;  4JI1 E;  5KL2 A;  5A6B D;  3BBG A;  3J81 C;  4O24 A;  2YTG A;  2YTP A;  4O4K A;  4R03 A;  4B3S E;  5KL5 A;  2L8T A;  2EOX A;  2LUP B;  4F9A B;  4KZS A;  4P78 A;  2UXB E;  4DV6 E;  3EPH A;  2N3G A;  1T39 A;  4IJD A;  2YTN A;  2EPK X;  2UXD E;  4BS9 A;  2YRH A;  2KHX A;  2A25 A;  1YUI A;  1A1J A;  5IXM B;  4R2R A;  4DV2 E;  1XMQ E;  3VYX A;  2JPA A;  1STU A;  2EOQ A;  3ADI A;  2EMY A;  2DLQ A;  4X65 E;  4ZYD A;  2EOH A;  4B3M E;  4ZYG A;  4MLQ A;  5AE1 A;  2VQF E;  4LF6 E;  4K0K E;  1IQS A;  2I9I A;  2RSM A;  2EPN A;  2EOE A;  4JI4 E;  4F2J C;  2M1S A;  1JK2 A;  1WRJ A;  2B7V A;  5A2Q C;  2YPN A;  2EPA A;  4WXC A;  1IQO A;  4DUY E;  3HPS A;  1T4L B;  3K6Q A;  1N36 E;  4LF4 E;  3HXL A;  2EPZ A;  2ELZ A;  2H36 X;  5T6J A;  2M7Q A;  4JI6 E;  4O43 A;  1GQE A;  1HNW E;  4M9V C;  1HNX E;  2G7H A;  2UUC E;  2E5L E;  3DF6 A;  4DR1 E;  1YUJ A;  2YSP A;  1ZBT A;  2EMZ A;  4JI7 E;  3P1X A;  3C4B A;  2UUB E;  1YSA C;  4WPY A;  1A1I A;  2MC5 A;  2EN8 A;  4LF5 E;  2RQL A;  1T4O A;  4BBY A;  2EMC A;  5AE3 A;  5A6J A;  1X5W A;  2EM7 A;  2L33 A;  3C6M A;  3VHT B;  2LBS B;  2ZM6 E;  1J5E E;  1XNR E;  2EM0 A;  4R2S A;  5IWA E;  2EMA A;  2LRS A;  2EPC A;  3F6G A;  2RTX A;  2DMY A;  3AUZ A;  2RPC A;  1RMD A;  2EL5 A;  2LCE A;  2RSI A;  2LO3 A;  2YSO A;  2JVA A;  4WSG A;  5AC4 A;  2VRD A;  1F2I G;  4KWY A;  2WBS A;  2JOX A;  1WHQ A;  2DMI A;  2EMG A;  5KL6 A;  4JYA E;  3BF2 A;  4DR6 E;  3MSW A;  2LTS A;  2NUE A;  2EOZ A;  2EOS A;  1PDA A;  2WCC 3;  2UU9 E;  5KL7 A;  1GZ6 A;  2EMB A;  4WXD A;  2LJU A;  2GHF A;  4R2D A;  2RS7 A;  2L6M A;  1PKP A;  4DV7 E;  4M0V A;  3C4T A;  1TF6 A;  4YY3 E;  3ADJ A;  2EQ3 A;  2EP3 A;  1EH7 A;  4ZYH A;  2EN3 A;  4X62 E;  2EPP A;  2EPU A;  4WSP A;  5AAS A;  2YRM A;  2F8B A;  2EML A;  4X9J A;  2PRT A;  4J8Z A;  2VQE E;  1LLM C;  2EMI A;  1EKZ A;  1NCS A;  4R2P A;  2DLK A;  2DIX A;  1QU6 A;  2J7J A;  4LF7 E;  3HPZ A;  4JV5 E;  4NXN E;  3EPJ A;  2EN1 A;  3DJW A;  1G2F C;  4R8O A;  2VF1 A;  4I8O A;  3ADL A;  2BB8 A;  2EMK A;  4WX9 A;  2MDR A;  1Z1B A;  1QNT A;  2GPI A;  5DNY A;  1NEI A;  4BCA A;  2HGH A;  2MKD A;  4DMI A;  4R2E A;  1G2D C;  4MLV A;  4IS1 C;  1GTK A;  1WJP A;  5A6B A;  2KOU A;  4DV1 E;  3HQ1 A;  1MGT A;  2EOI A;  4LF8 E;  3JU0 A;  4LFC E;  4OOG C;  2V86 A;  1HR0 E;  1WHN A;  2UUA E;  1WXR A;  4BC7 A;  2YTJ A;  4F9B B;  2L3J A;  4JI5 E;  2EMF A;  2DGC A;  4JI3 E;  1XNQ E;  4NHR A;  5A6A A;  4X8W A;  2EOR A;  4TUG A;  1YYO A;  3THN A;  3MHS C;  5A6K A;  1YYW A;  2L2K B;  1PJQ A;  4LTY A;  1N32 E;  5LL6 R;  2JY9 A;  1X6F A;  2LJH A;  5AE2 A;  2EOO A;  4WYQ B;  2VE7 C;  1A1G A;  4L8N A;  3EPL A;  1BB8 A;  2JR1 A;  4DR7 E;  1YZ9 A;  1UBD C;  2EM6 A;  2EM5 A;  2KON A;  4BC9 A;  2EN6 A;  1UHZ A;  4DV3 E;  3VK6 A;  4M30 A;  4WFT A;  2FTX B;  5LMN E;  1YFH A;  4GZN C;  1N34 E;  2EPM X;  2M9A A;  2JP9 A;  2V8Q B;  1AAY A;  2HHH E;  4KHP E;  2YWQ A;  2EPX A;  1N3G A;  1A1H A;  1O0W A;  2V88 A;  2ODR D;  2EPL X;  2LT7 A;  3JAM C;  2ELY A;  4BHB A;  5IV8 B;  2CPN A;  2WBU A;  2LTR A;  5AC5 A;  1RQ0 A;  4GKK E;  2EM4 A;  4LFB E;  4TUI A; 
#chains in the Genus database with same CATH homology
 4X65 E;  2VQE E;  4JI2 E;  4B3M E;  4LF9 E;  1DI2 A;  5AE1 A;  2VQF E;  4LF6 E;  1EKZ A;  4K0K E;  4DR5 E;  4DUZ E;  3H09 A;  2DIX A;  1QU6 A;  2RSM A;  4LF7 E;  3AV0 A;  2ODR C;  2V87 A;  3HPZ A;  3LLH A;  4JI4 E;  4JI0 E;  2M1S A;  4JV5 E;  4NXN E;  2YZT A;  2L2M A;  2B7V A;  2E1M A;  3IWC A;  5A2Q C;  3FIG A;  3DJW A;  4GEQ B;  3ADG A;  4DUY E;  3HPS A;  3OML A;  4R8O A;  2MC6 A;  4AQY E;  3VYY A;  4DV4 E;  2VF1 A;  4I8O A;  2DB2 A;  1T4L B;  1I94 E;  3ADL A;  3K6Q A;  5ADZ A;  1N36 E;  2FV4 B;  4LF4 E;  1X47 A;  2MDR A;  3HXL A;  2H36 X;  5T6J A;  2M7Q A;  4DV0 E;  4JI6 E;  2JWO A;  5DNY A;  1GQE A;  4BCA A;  1HNW E;  4DMI A;  2JOB A;  3IWD A;  4DR2 E;  1HNX E;  2G7H A;  2UUC E;  2KOU A;  4DV1 E;  1ZBQ A;  2V89 A;  3HQ1 A;  2FGG A;  4GKJ E;  2K4V A;  1IBM E;  4NXM E;  3OTO E;  2E5L E;  3DF6 A;  5FLX C;  4DR1 E;  4LF8 E;  1J26 A;  3JU0 A;  2DSY A;  1X48 A;  5LMU E;  2NUG A;  4LFC E;  1DQ3 A;  1UIL A;  3J80 C;  3T1Y E;  1ZBT A;  4OOG C;  2V86 A;  1HR0 E;  4LFA E;  1WHN A;  2IHR 1;  4JI7 E;  2UUA E;  2YT4 A;  3P1X A;  3C4B A;  4BC7 A;  4F9B B;  1WXR A;  2L3J A;  3KWR A;  3RMP A;  5IT9 C;  2UUB E;  4JI5 E;  2LMZ A;  4WPY A;  2NA2 A;  2B7T A;  1YYK A;  4JI3 E;  2MC5 A;  2V85 A;  4LF5 E;  4OX9 E;  1T4O A;  4L5N C;  2RS6 A;  4M2Z A;  1XNQ E;  2LE2 A;  1XMO E;  4BBY A;  5AE3 A;  2V83 A;  4BMJ A;  1RC7 A;  5F3W A;  4X8W A;  4TUG A;  2L33 A;  1YYO A;  2LBS B;  2L92 A;  2N3H A;  2ZM6 E;  1YYW A;  1J5E E;  1XNR E;  4DKK A;  4DV5 E;  3J7A G;  2L2K B;  4LTY A;  5IWA E;  4YHH E;  1X49 A;  2LRS A;  1N32 E;  3IWB A;  3F6G A;  2RTX A;  2JY9 A;  2LJH A;  5LL6 R;  2EWL A;  5AE2 A;  5CFF E;  2DMY A;  3AUZ A;  3HTX A;  1IBL E;  4B3R E;  3F6H A;  4WYQ B;  2VE7 C;  2B9D A;  4L8N A;  2UXC E;  3JTZ A;  2WZO A;  2LUQ A;  4F9C B;  1FJG E;  2JR1 A;  5BR8 E;  2JVA A;  2L3C A;  1YZ9 A;  4DR7 E;  2JOX A;  4X66 E;  1WHQ A;  2KON A;  1HNZ E;  2B3T B;  4BC9 A;  4F54 A;  4LU9 A;  4JI1 E;  3J81 C;  4JYA E;  1UHZ A;  4B3T E;  4DR6 E;  3MSW A;  2LTS A;  4DV3 E;  1FKA E;  4DR3 E;  2NUE A;  3VK6 A;  4M30 A;  4JI8 E;  4WFT A;  2FTX B;  4R03 A;  5LMN E;  4B3S E;  1N34 E;  1N33 E;  2L8T A;  2UU9 E;  4P7D A;  3ZOQ B;  1GZ6 A;  2V8Q B;  3LML A;  3J7Y p;  2HHH E;  4KHP E;  2LUP B;  2UXB E;  1T4N A;  4KZS A;  4P78 A;  2RS7 A;  4F9A B;  2L6M A;  4DR4 E;  3T1H E;  1O0W A;  1PKP A;  2V88 A;  4DV6 E;  2ODR D;  4DV7 E;  2NUF A;  4M0V A;  3C4T A;  2N3G A;  3JAM C;  2UXD E;  4YY3 E;  4BS9 A;  3ADJ A;  4X64 E;  2KHX A;  2CPN A;  2EZ6 A;  1IBK E;  2M4I A;  1SR9 A;  2LTR A;  1RQ0 A;  4X62 E;  5AAS A;  2L2N A;  4WSP A;  4DV2 E;  1XMQ E;  2F4V E;  3VYX A;  4GKK E;  4LFB E;  4Q28 A;  2F8B A;  1STU A;  4TUI A;  3ADI A;  4J8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...