2LMZA

Solution nmr structure of the novel conotoxin im23a from conus imperialis
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
42
structure length
42
Chain Sequence
b'IPYCGQTGAECYSWCIKQDLSKDWCCDFVKDIRMNPPADKCP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conotoxin im17a
publication title A helical conotoxin from Conus imperialis has a novel cysteine framework and defiines a new superfamily
doi rcsb
source organism Conus imperialis
molecule tags Toxin
total genus 8
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2011-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.530 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2lmzA00
2LMZA
chains in the Genus database with same CATH superfamily
2NUGA 3T1HE 3OTOE 1QU6A 2EZ6A 3ZOQB 3UK3C 1N32E 4DMIA 2EMWA 1X5WA 1X6HA 4R8OA 2CPNA 1YPNA 1FKAE 2L2KB 4YY3E 4R2PA 2EL6A 2FTXB 4BMJA 1DGCA 5AC4A 5F3WA 2DLKA 1TF3A 2L8TA 1HNZE 3HPZA 4X66E 1JK2A 4BS9A 2EMBA 2EM2A 4WXDA 2HC5A 3EPJA 3MHSC 2JP9A 4I8OA 1DI2A 4X65E 4X64E 5DNYA 2EM6A 2YTFA 2YRMA 2LVHA 4DV5E 2B3TB 2JYAA 1XMQE 2UXDE 2V86A 1DQ3A 4M2ZA 4DV7E 2R76A 4LFCE 1EH7A 4R03A 1MGTA 2RSIA 4X8WA 4R2DA 2YU8A 3C4TA 2V83A 2ZM6E 2UUCE 1BB8A 3VK6A 3LMLA 1X47A 2K7IA 2EMXA 4R2CA 1X6EA 4WFTA 1T4LB 1GQEA 2VRDA 1GTKA 2EPLX 2ELZA 2WZOA 2UXBE 2NABA 4GZNC 3BF2A 2RS6A 1RMDA 4MLVA 2F8BA 4IS1C 1N34E 1IQSA 1X3CA 1A1LA 1JK1A 1FJGE 1PJQA 3JTZA 4M30A 2EN2A 2EOHA 5IV8B 4F6NA 1WRJA 4J8ZA 4WPYA 2V8QB 5A6BA 3L00A 2EPOA 2VQFE 2BBGA 4WYQB 4LF7E 4ZYDA 2YRHA 4P78A 1IBLE 3TQMA 4BC9A 5KL2A 4F54A 2YTJA 2UU9E 5AE3A 2B7VA 2J7JA 4F9CB 2EOYA 3EPKA 2EPKX 4RH8A 1ZAAC 4RHBB 2WCC3 1X49A 2UUAE 2JY9A 4O24A 4DV6E 2DSYA 1YUJA 2EPZA 2GLIA 4OX9E 3QG5C 2K4VA 4LF9E 5BR8E 2EWLA 5A6AA 1G2DC 1B69A 1O0WA 3VYYA 4LF6E 2JVAA 2LJHA 4LFBE 2DRPA 2EPCA 4GKKE 2LCEA 2EMLA 2JOXA 2CSHA 1J5EE 1IBKE 5LMNE 2EM4A 3IWDA 1ZR9A 2EMAA 2EP3A 3THOB 2WBUA 4FK5C 2EOIA 3K6QA 4JV5E 2EM3A 2L2MA 2LRSA 2LTSA 1STUA 2ENHA 2N8XA 4B3SE 2GHFA 2EM8A 2YU5A 4WXCA 4DUYE 5AE1A 4YHHE 1T38A 1NCSA 1SR9A 4JI1E 3BBGA 5A69A 3J81C 2EN8A 4DKKA 3MSWA 2ENAA 5A6KA 1MEYC 3BIDA 5T6JA 1A1KA 1J26A 3THNA 4R2QA 3EPHA 2HHHE 5KL6A 4F2JC 4JI4E 2N3HA 4DR7E 2EN6A 4DR2E 2WBSA 2LO3A 2YTDA 1YYWA 2GPIA 2MKDA 4NZVA 2EORA 2ELYA 2YPNA 2M7QA 3M99B 4ZYGA 2L33A 1LLMC 4M0VA 5TSEA 4DR4E 4O4KA 5AE2A 4DUZE 1X6FA 1UN6B 1ZBQA 3C4BA 2ENCA 4DV3E 3KWRA 1KJKA 1WHNA 4MLQA 2BB8A 4K0KE 3LLHA 2E5LE 2JR1A 4LU9A 2V88A 1A1GA 4BBYA 2EOOA 2RPCA 2LT7A 3HQ1A 1PKPA 4JYAE 1YYOA 2KONA 1HR0E 1ZU1A 2L6MA 4F9BB 3J7AG 2DMYA 4DV1E 4O5GA 1TF6A 4TUGA 2JWOA 1EH6A 5ADZA 2LUQA 5A2QC 4HEIA 4KHPE 4F6MA 1TN9A 2PRTA 3EQ1A 4ZYHA 2EM5A 2I13A 1N33E 2EN3A 1T4NA 1QNTA 1F2IG 4DV0E 5KL5A 4R2RA 1HNWE 1XMOE 2EMGA 5AC5A 2YTEA 4Q28A 3HTXA 1Z1BA 4WX9A 1GZ6A 2E1MA 4DR3E 5A6BD 2EL4A 3ECRA 2LTRA 3H09A 2EOFA 1XNRE 5AASA 1AAYA 1T4OA 4BC7A 1PDAA 2YTIA 2UUBE 2EOMA 2DMIA 2B9DA 2YTPA 4JI5E 2EM7A 1I94E 2EQ3A 2EOQA 2EQ0A 2YT4A 2YRKA 2EMFA 2EMYA 3J80C 3VHTB 2MC5A 2EPXA 4NXNE 4BHBA 2B7TA 2EMZA 4BCAA 2YTGA 1NEIA 4B3RE 1IQOA 2EN4A 5KL3A 3T1YE 3AUZA 2EN7A 1A1FA 2JOBA 2EMIA 2EM9A 3DF6A 2F4VE 4HTGA 2V87A 3DJWA 2ODRC 1EH8A 2M1SA 3MHHC 3JU0A 2M9AA 2ADRA 1YUIA 4Q35B 4NHRA 1G2FC 2L92A 1UBDC 2YSPA 2LV2A 1L4SA 2RS7A 4L8NA 1A1HA 4B3ME 2RQLA 5LL6R 2MDGA 2EOJA 2CT1A 3VYXA 2HGHA 2YWQA 3AV0A 5CFFE 2FGGA 1WHQA 2EPUA 2ODRD 4R2EA 3KZZA 3HXLA 4KZSA 2EPNA 3KZYA 4TUIA 2EJ4A 2KHXA 2YTNA 2EL5A 1P47A 2EMHA 4P7DA 2EE8A 3IWCA 1A1IA 4LF5E 2JXPA 4LF8E 4BHCA 2D9HA 4AQYE 2EM0A 2EPMX 2E72A 1HNXE 5FLXC 4NXME 2EQ1A 4M9VC 2L3CA 2UXCE 2HJJA 4B3TE 4JI3E 4DR6E 5IWAE 3ADJA 2EN1A 2KOUA 2RTXA 3RMPA 2EPPA 2YSOA 3HPSA 1N36E 4LF4E 4X9JA 2MC6A 3IWBA 1IMUA 4F9AB 5KL7A 2N3GA 1YZ9A 4WSGA 2LJUA 5A6JA 3EPLA 2I9IA 4ZYEA 3ADIA 1PJTA 4JI0E 3F6GA 2LMZA 4IJDA 3ADGA 2DLQA 3ADLA 4JI7E 4JI8E 4DR5E 1ZBTA 1RQ0A 2VQEE 1BBGA 1PJSA 2VE7C 2DB2A 2FV4B 4N4RB 2NA2A 2LE2A 4L5NC 2MKNA 2EOSA 1IBME 2H36X 4WSPA 3C6KA 2EOEA 3F6HA 3J7Yp 4LFAE 2V89A 2DIXA 4O43A 2LUPB 3BGHA 2A25A 2R1FA 4LTYA 1SFEA 3C6MA 1UHZA 5LMUE 4KWYA 2LBSB 4JI2E 3P1XA 1YYKA 2YTQA 1N3GA 4DV4E 5IT9C 1XNQE 3FIGA 2MDRA 2EMCA 2V85A 2G7HA 4X62E 2EOXA 2EMKA 2RSMA 2VF1A 3OMLA 1WXRA 4R2SA 2L3JA 5IXMB 4DR1E 4DV2E 4GEQB 2JPAA 4GKJE 1KYQA 1AH5A 3JAMC 4R2AA 2IHR1 1BBOA 2WBTA 1YFHA 2YTOA 5LLQA 2M4IA 2DGCA 2EOZA 2L2NA 1EKZA 2Q8UA 1T39A 2EPRA 1RC7A 1WJPA 2YZTA 2EPAA 1UILA 4JI6E 4OOGC 1A1JA 2NUFA 1X48A 2NUEA 2CTDA 5KL4A 1YSAC
chains in the Genus database with same CATH topology
3ADJA 5BR8E 2EWLA 4LF9E 2NUGA 4KHPE 3T1HE 2KOUA 1QU6A 2RTXA 3OTOE 2EZ6A 3RMPA 3ZOQB 1O0WA 1N32E 3VYYA 3HPSA 4DMIA 4LF6E 1N33E 1N36E 1T4NA 2JVAA 4LF4E 2LJHA 4LFBE 2MC6A 2CPNA 3IWBA 4R8OA 4GKKE 4DV0E 1FKAE 2L2KB 4F9AB 2JOXA 1HNWE 2N3GA 4YY3E 1YZ9A 1XMOE 1J5EE 2FTXB 1IBKE 5LMNE 4BMJA 5F3WA 3IWDA 4Q28A 3HTXA 2L8TA 1HNZE 3ADIA 3HPZA 1GZ6A 4X66E 4BS9A 2E1MA 4JI0E 4DR3E 3F6GA 2LMZA 3K6QA 2LTRA 3H09A 3ADGA 4JV5E 1XNRE 3ADLA 4JI7E 2L2MA 4I8OA 1ZBTA 4JI8E 5AASA 1T4OA 4X65E 4X64E 4DR5E 2LRSA 1RQ0A 2LTSA 4BC7A 5DNYA 2VQEE 2UUBE 1STUA 4DV5E 4B3SE 2B3TB 2B9DA 4JI5E 1I94E 1XMQE 4DUYE 2UXDE 2VE7C 2DB2A 5AE1A 2V86A 1DQ3A 4M2ZA 4YHHE 2YT4A 4DV7E 2FV4B 2NA2A 4LFCE 1SR9A 2LE2A 4L5NC 3J80C 5A2QC 4JI1E 4R03A 2MC5A 4NXNE 4X8WA 3J81C 3C4TA 2H36X 2V83A 3MSWA 4DKKA 2ZM6E 1IBME 4WSPA 2B7TA 2UUCE 4BCAA 3F6HA 3J7Yp 4LFAE 4B3RE 2V89A 2DIXA 3VK6A 5T6JA 3LMLA 1X47A 1J26A 2LUPB 4WFTA 1T4LB 1GQEA 3T1YE 4LTYA 3AUZA 2HHHE 1UHZA 2WZOA 2N3HA 2JOBA 5LMUE 4JI4E 4DR7E 3DF6A 4DR2E 2F4VE 2UXBE 2V87A 2LBSB 3DJWA 2ODRC 2M1SA 3P1XA 4JI2E 1YYKA 1YYWA 3JU0A 2RS6A 4DV4E 5IT9C 2F8BA 2L92A 1N34E 3FIGA 1XNQE 2MDRA 2V85A 2G7HA 2RS7A 4X62E 2RSMA 2VF1A 4L8NA 3OMLA 1WXRA 5LL6R 4B3ME 1FJGE 4M30A 3JTZA 3VYXA 2M7QA 2L3JA 2L33A 4DR1E 4M0VA 4DV2E 4DR4E 5AE2A 4J8ZA 3AV0A 4WPYA 2V8QB 2FGGA 1WHQA 5CFFE 2ODRD 1ZBQA 4DUZE 2VQFE 4GEQB 3HXLA 3C4BA 4KZSA 4GKJE 4DV3E 3KWRA 4TUIA 4WYQB 1WHNA 3JAMC 2KHXA 4LF7E 4P78A 4K0KE 1IBLE 3LLHA 2E5LE 4BC9A 2JR1A 2IHR1 4DR6E 4LU9A 4F54A 2V88A 1DI2A 2UU9E 4P7DA 2M4IA 2B7VA 4BBYA 4F9CB 5AE3A 3IWCA 4LF5E 3HQ1A 1PKPA 4LF8E 2L2NA 4B3TE 4JYAE 1YYOA 1EKZA 4AQYE 2KONA 1RC7A 1HR0E 2YZTA 1HNXE 2L6MA 4F9BB 1X49A 5FLXC 2UUAE 3J7AG 1UILA 2DMYA 2JY9A 4OOGC 4DV1E 4DV6E 4JI6E 2DSYA 2NUFA 4NXME 1X48A 4TUGA 2NUEA 2JWOA 2L3CA 2UXCE 4JI3E 5ADZA 4OX9E 2LUQA 2K4VA 5IWAE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LMZ A; 
#chains in the Genus database with same CATH topology
 2NUG A;  3T1H E;  3OTO E;  1QU6 A;  2EZ6 A;  3ZOQ B;  3UK3 C;  1N32 E;  4DMI A;  2EMW A;  1X5W A;  1X6H A;  4R8O A;  2CPN A;  1YPN A;  1FKA E;  2L2K B;  4YY3 E;  4R2P A;  2EL6 A;  2FTX B;  4BMJ A;  1DGC A;  5AC4 A;  5F3W A;  2DLK A;  1TF3 A;  2L8T A;  1HNZ E;  3HPZ A;  4X66 E;  1JK2 A;  4BS9 A;  2EMB A;  2EM2 A;  4WXD A;  2HC5 A;  3EPJ A;  3MHS C;  2JP9 A;  4I8O A;  1DI2 A;  4X65 E;  4X64 E;  5DNY A;  2EM6 A;  2YTF A;  2YRM A;  2LVH A;  4DV5 E;  2B3T B;  2JYA A;  1XMQ E;  2UXD E;  2V86 A;  1DQ3 A;  4M2Z A;  4DV7 E;  2R76 A;  4LFC E;  1EH7 A;  4R03 A;  1MGT A;  2RSI A;  4X8W A;  4R2D A;  2YU8 A;  3C4T A;  2V83 A;  2ZM6 E;  2UUC E;  1BB8 A;  3VK6 A;  3LML A;  1X47 A;  2K7I A;  2EMX A;  4R2C A;  1X6E A;  4WFT A;  1T4L B;  1GQE A;  2VRD A;  1GTK A;  2EPL X;  2ELZ A;  2WZO A;  2UXB E;  2NAB A;  4GZN C;  3BF2 A;  2RS6 A;  1RMD A;  4MLV A;  2F8B A;  4IS1 C;  1N34 E;  1IQS A;  1X3C A;  1A1L A;  1JK1 A;  1FJG E;  1PJQ A;  3JTZ A;  4M30 A;  2EN2 A;  2EOH A;  5IV8 B;  4F6N A;  1WRJ A;  4J8Z A;  4WPY A;  2V8Q B;  5A6B A;  3L00 A;  2EPO A;  2VQF E;  2BBG A;  4WYQ B;  4LF7 E;  4ZYD A;  2YRH A;  4P78 A;  1IBL E;  3TQM A;  4BC9 A;  5KL2 A;  4F54 A;  2YTJ A;  2UU9 E;  5AE3 A;  2B7V A;  2J7J A;  4F9C B;  2EOY A;  3EPK A;  2EPK X;  4RH8 A;  1ZAA C;  4RHB B;  2WCC 3;  1X49 A;  2UUA E;  2JY9 A;  4O24 A;  4DV6 E;  2DSY A;  1YUJ A;  2EPZ A;  2GLI A;  4OX9 E;  3QG5 C;  2K4V A;  4LF9 E;  5BR8 E;  2EWL A;  5A6A A;  1G2D C;  1B69 A;  1O0W A;  3VYY A;  4LF6 E;  2JVA A;  2LJH A;  4LFB E;  2DRP A;  2EPC A;  4GKK E;  2LCE A;  2EML A;  2JOX A;  2CSH A;  1J5E E;  1IBK E;  5LMN E;  2EM4 A;  3IWD A;  1ZR9 A;  2EMA A;  2EP3 A;  3THO B;  2WBU A;  4FK5 C;  2EOI A;  3K6Q A;  4JV5 E;  2EM3 A;  2L2M A;  2LRS A;  2LTS A;  1STU A;  2ENH A;  2N8X A;  4B3S E;  2GHF A;  2EM8 A;  2YU5 A;  4WXC A;  4DUY E;  5AE1 A;  4YHH E;  1T38 A;  1NCS A;  1SR9 A;  4JI1 E;  3BBG A;  5A69 A;  3J81 C;  2EN8 A;  4DKK A;  3MSW A;  2ENA A;  5A6K A;  1MEY C;  3BID A;  5T6J A;  1A1K A;  1J26 A;  3THN A;  4R2Q A;  3EPH A;  2HHH E;  5KL6 A;  4F2J C;  4JI4 E;  2N3H A;  4DR7 E;  2EN6 A;  4DR2 E;  2WBS A;  2LO3 A;  2YTD A;  1YYW A;  2GPI A;  2MKD A;  4NZV A;  2EOR A;  2ELY A;  2YPN A;  2M7Q A;  3M99 B;  4ZYG A;  2L33 A;  1LLM C;  4M0V A;  5TSE A;  4DR4 E;  4O4K A;  5AE2 A;  4DUZ E;  1X6F A;  1UN6 B;  1ZBQ A;  3C4B A;  2ENC A;  4DV3 E;  3KWR A;  1KJK A;  1WHN A;  4MLQ A;  2BB8 A;  4K0K E;  3LLH A;  2E5L E;  2JR1 A;  4LU9 A;  2V88 A;  1A1G A;  4BBY A;  2EOO A;  2RPC A;  2LT7 A;  3HQ1 A;  1PKP A;  4JYA E;  1YYO A;  2KON A;  1HR0 E;  1ZU1 A;  2L6M A;  4F9B B;  3J7A G;  2DMY A;  4DV1 E;  4O5G A;  1TF6 A;  4TUG A;  2JWO A;  1EH6 A;  5ADZ A;  2LUQ A;  5A2Q C;  4HEI A;  4KHP E;  4F6M A;  1TN9 A;  2PRT A;  3EQ1 A;  4ZYH A;  2EM5 A;  2I13 A;  1N33 E;  2EN3 A;  1T4N A;  1QNT A;  1F2I G;  4DV0 E;  5KL5 A;  4R2R A;  1HNW E;  1XMO E;  2EMG A;  5AC5 A;  2YTE A;  4Q28 A;  3HTX A;  1Z1B A;  4WX9 A;  1GZ6 A;  2E1M A;  4DR3 E;  5A6B D;  2EL4 A;  3ECR A;  2LTR A;  3H09 A;  2EOF A;  1XNR E;  5AAS A;  1AAY A;  1T4O A;  4BC7 A;  1PDA A;  2YTI A;  2UUB E;  2EOM A;  2DMI A;  2B9D A;  2YTP A;  4JI5 E;  2EM7 A;  1I94 E;  2EQ3 A;  2EOQ A;  2EQ0 A;  2YT4 A;  2YRK A;  2EMF A;  2EMY A;  3J80 C;  3VHT B;  2MC5 A;  2EPX A;  4NXN E;  4BHB A;  2B7T A;  2EMZ A;  4BCA A;  2YTG A;  1NEI A;  4B3R E;  1IQO A;  2EN4 A;  5KL3 A;  3T1Y E;  3AUZ A;  2EN7 A;  1A1F A;  2JOB A;  2EMI A;  2EM9 A;  3DF6 A;  2F4V E;  4HTG A;  2V87 A;  3DJW A;  2ODR C;  1EH8 A;  2M1S A;  3MHH C;  3JU0 A;  2M9A A;  2ADR A;  1YUI A;  4Q35 B;  4NHR A;  1G2F C;  2L92 A;  1UBD C;  2YSP A;  2LV2 A;  1L4S A;  2RS7 A;  4L8N A;  1A1H A;  4B3M E;  2RQL A;  5LL6 R;  2MDG A;  2EOJ A;  2CT1 A;  3VYX A;  2HGH A;  2YWQ A;  3AV0 A;  5CFF E;  2FGG A;  1WHQ A;  2EPU A;  2ODR D;  4R2E A;  3KZZ A;  3HXL A;  4KZS A;  2EPN A;  3KZY A;  4TUI A;  2EJ4 A;  2KHX A;  2YTN A;  2EL5 A;  1P47 A;  2EMH A;  4P7D A;  2EE8 A;  3IWC A;  1A1I A;  4LF5 E;  2JXP A;  4LF8 E;  4BHC A;  2D9H A;  4AQY E;  2EM0 A;  2EPM X;  2E72 A;  1HNX E;  5FLX C;  4NXM E;  2EQ1 A;  4M9V C;  2L3C A;  2UXC E;  2HJJ A;  4B3T E;  4JI3 E;  4DR6 E;  5IWA E;  3ADJ A;  2EN1 A;  2KOU A;  2RTX A;  3RMP A;  2EPP A;  2YSO A;  3HPS A;  1N36 E;  4LF4 E;  4X9J A;  2MC6 A;  3IWB A;  1IMU A;  4F9A B;  5KL7 A;  2N3G A;  1YZ9 A;  4WSG A;  2LJU A;  5A6J A;  3EPL A;  2I9I A;  4ZYE A;  3ADI A;  1PJT A;  4JI0 E;  3F6G A;  2LMZ A;  4IJD A;  3ADG A;  2DLQ A;  3ADL A;  4JI7 E;  4JI8 E;  4DR5 E;  1ZBT A;  1RQ0 A;  2VQE E;  1BBG A;  1PJS A;  2VE7 C;  2DB2 A;  2FV4 B;  4N4R B;  2NA2 A;  2LE2 A;  4L5N C;  2MKN A;  2EOS A;  1IBM E;  2H36 X;  4WSP A;  3C6K A;  2EOE A;  3F6H A;  3J7Y p;  4LFA E;  2V89 A;  2DIX A;  4O43 A;  2LUP B;  3BGH A;  2A25 A;  2R1F A;  4LTY A;  1SFE A;  3C6M A;  1UHZ A;  5LMU E;  4KWY A;  2LBS B;  4JI2 E;  3P1X A;  1YYK A;  2YTQ A;  1N3G A;  4DV4 E;  5IT9 C;  1XNQ E;  3FIG A;  2MDR A;  2EMC A;  2V85 A;  2G7H A;  4X62 E;  2EOX A;  2EMK A;  2RSM A;  2VF1 A;  3OML A;  1WXR A;  4R2S A;  2L3J A;  5IXM B;  4DR1 E;  4DV2 E;  4GEQ B;  2JPA A;  4GKJ E;  1KYQ A;  1AH5 A;  3JAM C;  4R2A A;  2IHR 1;  1BBO A;  2WBT A;  1YFH A;  2YTO A;  5LLQ A;  2M4I A;  2DGC A;  2EOZ A;  2L2N A;  1EKZ A;  2Q8U A;  1T39 A;  2EPR A;  1RC7 A;  1WJP A;  2YZT A;  2EPA A;  1UIL A;  4JI6 E;  4OOG C;  1A1J A;  2NUF A;  1X48 A;  2NUE A;  2CTD A;  5KL4 A;  1YSA C; 
#chains in the Genus database with same CATH homology
 3ADJ A;  5BR8 E;  2EWL A;  4LF9 E;  2NUG A;  4KHP E;  3T1H E;  2KOU A;  1QU6 A;  2RTX A;  3OTO E;  2EZ6 A;  3RMP A;  3ZOQ B;  1O0W A;  1N32 E;  3VYY A;  3HPS A;  4DMI A;  4LF6 E;  1N33 E;  1N36 E;  1T4N A;  2JVA A;  4LF4 E;  2LJH A;  4LFB E;  2MC6 A;  2CPN A;  3IWB A;  4R8O A;  4GKK E;  4DV0 E;  1FKA E;  2L2K B;  4F9A B;  2JOX A;  1HNW E;  2N3G A;  4YY3 E;  1YZ9 A;  1XMO E;  1J5E E;  2FTX B;  1IBK E;  5LMN E;  4BMJ A;  5F3W A;  3IWD A;  4Q28 A;  3HTX A;  2L8T A;  1HNZ E;  3ADI A;  3HPZ A;  1GZ6 A;  4X66 E;  4BS9 A;  2E1M A;  4JI0 E;  4DR3 E;  3F6G A;  2LMZ A;  3K6Q A;  2LTR A;  3H09 A;  3ADG A;  4JV5 E;  1XNR E;  3ADL A;  4JI7 E;  2L2M A;  4I8O A;  1ZBT A;  4JI8 E;  5AAS A;  1T4O A;  4X65 E;  4X64 E;  4DR5 E;  2LRS A;  1RQ0 A;  2LTS A;  4BC7 A;  5DNY A;  2VQE E;  2UUB E;  1STU A;  4DV5 E;  4B3S E;  2B3T B;  2B9D A;  4JI5 E;  1I94 E;  1XMQ E;  4DUY E;  2UXD E;  2VE7 C;  2DB2 A;  5AE1 A;  2V86 A;  1DQ3 A;  4M2Z A;  4YHH E;  2YT4 A;  4DV7 E;  2FV4 B;  2NA2 A;  4LFC E;  1SR9 A;  2LE2 A;  4L5N C;  3J80 C;  5A2Q C;  4JI1 E;  4R03 A;  2MC5 A;  4NXN E;  4X8W A;  3J81 C;  3C4T A;  2H36 X;  2V83 A;  3MSW A;  4DKK A;  2ZM6 E;  1IBM E;  4WSP A;  2B7T A;  2UUC E;  4BCA A;  3F6H A;  3J7Y p;  4LFA E;  4B3R E;  2V89 A;  2DIX A;  3VK6 A;  5T6J A;  3LML A;  1X47 A;  1J26 A;  2LUP B;  4WFT A;  1T4L B;  1GQE A;  3T1Y E;  4LTY A;  3AUZ A;  2HHH E;  1UHZ A;  2WZO A;  2N3H A;  2JOB A;  5LMU E;  4JI4 E;  4DR7 E;  3DF6 A;  4DR2 E;  2F4V E;  2UXB E;  2V87 A;  2LBS B;  3DJW A;  2ODR C;  2M1S A;  3P1X A;  4JI2 E;  1YYK A;  1YYW A;  3JU0 A;  2RS6 A;  4DV4 E;  5IT9 C;  2F8B A;  2L92 A;  1N34 E;  3FIG A;  1XNQ E;  2MDR A;  2V85 A;  2G7H A;  2RS7 A;  4X62 E;  2RSM A;  2VF1 A;  4L8N A;  3OML A;  1WXR A;  5LL6 R;  4B3M E;  1FJG E;  4M30 A;  3JTZ A;  3VYX A;  2M7Q A;  2L3J A;  2L33 A;  4DR1 E;  4M0V A;  4DV2 E;  4DR4 E;  5AE2 A;  4J8Z A;  3AV0 A;  4WPY A;  2V8Q B;  2FGG A;  1WHQ A;  5CFF E;  2ODR D;  1ZBQ A;  4DUZ E;  2VQF E;  4GEQ B;  3HXL A;  3C4B A;  4KZS A;  4GKJ E;  4DV3 E;  3KWR A;  4TUI A;  4WYQ B;  1WHN A;  3JAM C;  2KHX A;  4LF7 E;  4P78 A;  4K0K E;  1IBL E;  3LLH A;  2E5L E;  4BC9 A;  2JR1 A;  2IHR 1;  4DR6 E;  4LU9 A;  4F54 A;  2V88 A;  1DI2 A;  2UU9 E;  4P7D A;  2M4I A;  2B7V A;  4BBY A;  4F9C B;  5AE3 A;  3IWC A;  4LF5 E;  3HQ1 A;  1PKP A;  4LF8 E;  2L2N A;  4B3T E;  4JYA E;  1YYO A;  1EKZ A;  4AQY E;  2KON A;  1RC7 A;  1HR0 E;  2YZT A;  1HNX E;  2L6M A;  4F9B B;  1X49 A;  5FLX C;  2UUA E;  3J7A G;  1UIL A;  2DMY A;  2JY9 A;  4OOG C;  4DV1 E;  4DV6 E;  4JI6 E;  2DSY A;  2NUF A;  4NXM E;  1X48 A;  4TUG A;  2NUE A;  2JWO A;  2L3C A;  2UXC E;  4JI3 E;  5ADZ A;  4OX9 E;  2LUQ A;  2K4V A;  5IWA E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...