2LMZA

Solution nmr structure of the novel conotoxin im23a from conus imperialis
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
42
structure length
42
Chain Sequence
IPYCGQTGAECYSWCIKQDLSKDWCCDFVKDIRMNPPADKCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A helical conotoxin from Conus imperialis has a novel cysteine framework and defiines a new superfamily
doi rcsb
source organism Conus imperialis
molecule tags Toxin
molecule keywords Conotoxin im17a
total genus 8
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2011-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.530 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2lmzA00
2LMZA
chains in the Genus database with same CATH superfamily
4Q35B 3QG5C 4JI4E 1HNZE 4O43A 3VYXA 3IWBA 3T1HE 1T38A 1NEIA 2YTPA 4DR1E 4GKKE 2EM0A 1YFHA 4JI5E 4B3RE 2EMXA 2EM8A 2KONA 1QNTA 4MLVA 4LF8E 2V87A 4KWYA 4M2ZA 2LBSB 2JWOA 2NUEA 2EOYA 2KOUA 2LE2A 2LCEA 4F6NA 1GQEA 4WFTA 4DV1E 2GHFA 2EN8A 4NHRA 4DR5E 2EPLX 2ENHA 2JOBA 2F4VE 1L4SA 2YRMA 1DI2A 2UU9E 4MLQA 2M9AA 5KL3A 3TQMA 2EOJA 1A1KA 2UXCE 3DJWA 2EOZA 2EM7A 4I8OA 2BB8A 1TF6A 1GTKA 4LU9A 4Q28A 1MEYC 3ADJA 2K4VA 2EL4A 2EPPA 2ODRC 2PRTA 1BB8A 2EMHA 3HQ1A 1N33E 1T39A 4JI8E 2E5LE 2RPCA 1WRJA 1NCSA 2DLKA 4R2AA 1ZR9A 2EMBA 4X66E 3BBGA 2NUFA 2L3CA 2YRHA 2RQLA 4X62E 3C4BA 2RSMA 2YPNA 4JYAE 2L33A 4X65E 4NZVA 1X48A 3P1XA 2K7IA 2EPAA 2HJJA 4M30A 1J26A 2YSPA 2J7JA 1WHQA 5A6KA 5AC5A 4L8NA 3EPJA 2EOSA 1EKZA 2LRSA 2EMLA 4B3SE 2B9DA 4X9JA 4DV3E 4DR7E 2EPKX 4TUGA 4BS9A 4F9BB 2DB2A 3MSWA 2EL5A 2VQFE 3C6KA 2H36X 5KL6A 1BBGA 3IWCA 2RSIA 2EMGA 1T4NA 2MC6A 2R1FA 4YY3E 3VK6A 2EPXA 4R2SA 2N3GA 1RC7A 2ODRD 2DSYA 2FGGA 1X3CA 5A2QC 4R8OA 3BIDA 2LV2A 4DV6E 4LFCE 4GKJE 2YTIA 3F6GA 3EPLA 4NXNE 2EM6A 2YTJA 4GEQB 1G2FC 5AE1A 4OX9E 4TUIA 1YSAC 1KJKA 3C4TA 3F6HA 4AQYE 2YTGA 5IT9C 2JR1A 2EQ3A 5A6JA 2YTOA 3ADIA 2YTQA 4N4RB 2EOIA 2CSHA 4LF5E 4OOGC 2LTSA 2HC5A 4R2EA 4BBYA 2EN3A 2VE7C 2L6MA 1A1GA 3MHHC 2L2KB 2DGCA 2LJHA 4F9AB 4JI2E 3KZZA 2V83A 2F8BA 1XNQE 4J8ZA 4JI7E 1YUJA 1B69A 2YTFA 5LL6R 5CFFE 2FTXB 5TSEA 2HHHE 5A6AA 2B7TA 1N3GA 2UXBE 2EN2A 1ZBTA 3J80C 4JI1E 1X49A 2IHR1 1YZ9A 5A6BA 1AAYA 2EPRA 4ZYDA 1X6HA 2WCC3 4IS1C 2EP3A 1N36E 2V85A 2NA2A 2EPOA 1A1JA 4WX9A 5AE2A 2VQEE 3THNA 4FK5C 2EN7A 4BHCA 5KL7A 1O0WA 3LLHA 4DV2E 1HR0E 2EOMA 2UUCE 4L5NC 2EOXA 1QU6A 3DF6A 1X47A 3UK3C 1PJTA 3J81C 5IXMB 2WBUA 4X8WA 2LUQA 3THOB 4DV4E 2WBSA 1IQSA 2B3TB 3RMPA 1SR9A 2L8TA 2MDRA 2UUAE 2EOQA 4DR2E 4JI0E 2BBGA 1FJGE 3AUZA 2JXPA 2Q8UA 2L2MA 5T6JA 5DNYA 2NABA 5LMNE 4KHPE 1IBLE 2UUBE 2LTRA 1WJPA 5ADZA 1KYQA 2EZ6A 2M4IA 2LVHA 2V86A 2LT7A 1A1FA 2EM2A 4DMIA 2EPZA 2EMIA 4RHBB 2YSOA 2WBTA 1SFEA 2MC5A 1EH8A 4LTYA 1ZAAC 4B3TE 2YU5A 1G2DC 3EPHA 3ZOQB 1IBME 1T4OA 3ADGA 2YTDA 2JY9A 5IV8B 4KZSA 2DIXA 3EQ1A 2I9IA 2EM3A 2GPIA 2EPUA 4DUZE 2DMIA 4R2QA 1T4LB 2YTNA 2EORA 1HNWE 1YYOA 2V89A 2YTEA 5AC4A 1ZBQA 2A25A 4ZYGA 4LF4E 2RS6A 2VF1A 4O4KA 3JAMC 1GZ6A 2EQ1A 4BMJA 4P7DA 1XMQE 1HNXE 2JPAA 2EOHA 2EMAA 1PDAA 3VYYA 1A1IA 1F2IG 1AH5A 1WHNA 4LFAE 3IWDA 1N34E 5AE3A 2EM4A 2EL6A 2EOEA 2GLIA 1EH6A 4LFBE 2WZOA 5LLQA 4LF6E 2CT1A 4WSPA 2V8QB 1X6EA 2M1SA 2E1MA 4R03A 2CPNA 2YT4A 1N32E 2EN4A 2D9HA 1PKPA 2YU8A 2ELYA 4WSGA 4F9CB 3OTOE 5FLXC 4DV0E 3HPSA 4R2PA 5LMUE 2ENAA 3JU0A 4DV5E 1Z1BA 4WYQB 4BCAA 4M0VA 4NXME 2N3HA 1LLMC 4R2CA 2EJ4A 4YHHE 2EWLA 4DR4E 2MKNA 2RS7A 4IJDA 2EMCA 1A1HA 2VRDA 2I13A 2L3JA 2EOOA 5F3WA 3LMLA 2EMZA 4RH8A 2EPCA 2RTXA 1YYKA 3H09A 3OMLA 1UILA 2MKDA 4K0KE 4R2RA 2DLQA 5KL2A 4DV7E 2EMWA 1P47A 1EH7A 2LUPB 2JP9A 4ZYEA 3KWRA 2JYAA 4M9VC 1YUIA 2EMKA 4JI6E 1X6FA 3M99B 2CTDA 1UBDC 3AV0A 4DR3E 2NUGA 4LF9E 4DUYE 3J7AG 1UN6B 2DMYA 1J5EE 4HEIA 4R2DA 2LJUA 5A6BD 3FIGA 1A1LA 2EQ0A 2L2NA 5KL5A 4F6MA 1DQ3A 1IMUA 2EM9A 3HTXA 3JTZA 2EMYA 1XNRE 3ECRA 1ZU1A 2JOXA 2B7VA 2N8XA 2KHXA 3C6MA 2EM5A 4WXDA 2G7HA 4JI3E 3HPZA 1WXRA 1IQOA 2ELZA 1RQ0A 1RMDA 3T1YE 2ENCA 2MDGA 4GZNC 5KL4A 4F2JC 2EPNA 2EMFA 4HTGA 4P78A 1JK2A 1I94E 3MHSC 2ZM6E 2JVAA 2YRKA 4B3ME 3ADLA 3BF2A 1PJSA 4BHBA 3HXLA 3K6QA 2EOFA 4DKKA 1YPNA 1JK1A 1X5WA 2R76A 2LMZA 1FKAE 2DRPA 1MGTA 2V88A 4WXCA 3BGHA 1XMOE 2HGHA 2ADRA 2FV4B 4WPYA 1TN9A 2YWQA 2EPMX 2UXDE 4BC9A 1STUA 2E72A 1YYWA 2M7QA 4O5GA 4LF7E 2EN1A 4BC7A 4JV5E 4F54A 2LO3A 4DR6E 2YZTA 2L92A 4ZYHA 3L00A 4X64E 3VHTB 1IBKE 3KZYA 5A69A 5AASA 1UHZA 2EN6A 4O24A 2EE8A 5IWAE 3J7Yp 3EPKA 1DGCA 1TF3A 5BR8E 1BBOA 1PJQA
chains in the Genus database with same CATH topology
4K0KE 1T4NA 2MC6A 1SR9A 4YY3E 2L8TA 2MDRA 3RMPA 3VK6A 4JI4E 1HNZE 2N3GA 2UUAE 1RC7A 4DV7E 2ODRD 4DR2E 3VYXA 2DSYA 4JI0E 2FGGA 1FJGE 3AUZA 3IWBA 5A2QC 4R8OA 3T1HE 2L2MA 5T6JA 5DNYA 2LUPB 3JAMC 4DV6E 4LFCE 4GKJE 3F6GA 5LMNE 4DR1E 4GKKE 4NXNE 4KHPE 3KWRA 4JI5E 1IBLE 4B3RE 2UUBE 2LTRA 2KONA 5ADZA 4LF8E 4GEQB 2V87A 4JI6E 2EZ6A 2M4IA 4M2ZA 5AE1A 4OX9E 2LBSB 2JWOA 2V86A 2NUEA 4TUIA 2KOUA 2LE2A 3AV0A 3C4TA 4DR3E 4DMIA 1GQEA 3F6HA 4WFTA 4DV1E 4AQYE 5IT9C 2NUGA 4LF9E 2JR1A 4DUYE 2MC5A 3J7AG 2DMYA 4LTYA 1J5EE 4DR5E 3ADIA 4B3TE 2JOBA 3FIGA 4LF5E 4OOGC 2F4VE 3ZOQB 1IBME 1T4OA 2LTSA 3ADGA 1DI2A 4BBYA 2UU9E 2VE7C 2L2NA 2JY9A 4KZSA 2DIXA 1DQ3A 2L6MA 4DUZE 1T4LB 3HTXA 2L2KB 2UXCE 1HNWE 3JTZA 1YYOA 3DJWA 1XNRE 2V89A 2JOXA 2B7VA 2LJHA 1ZBQA 4I8OA 2KHXA 4F9AB 4JI2E 2V83A 4LF4E 2F8BA 2RS6A 2VF1A 1XNQE 2G7HA 1GZ6A 3HPZA 4J8ZA 4LU9A 4Q28A 1RQ0A 4JI7E 4P7DA 4BMJA 1WXRA 3T1YE 1XMQE 3ADJA 2K4VA 5LL6R 2ODRC 1HNXE 5CFFE 3VYYA 4P78A 1I94E 2FTXB 3HQ1A 2ZM6E 1N33E 1WHNA 2JVAA 4LFAE 3IWDA 4JI8E 2E5LE 2HHHE 1N34E 5BR8E 4B3ME 3ADLA 2B7TA 5AE3A 2UXBE 4LFBE 3HXLA 3K6QA 2WZOA 4DKKA 4X66E 4LF6E 1ZBTA 3J80C 4JI1E 1X49A 2IHR1 2LMZA 1YZ9A 4WSPA 2V8QB 1FKAE 2M1SA 2E1MA 4R03A 2CPNA 2V88A 2YT4A 1XMOE 2NUFA 2FV4B 4WPYA 2L3CA 1N32E 1N36E 1PKPA 2V85A 2NA2A 3C4BA 4X62E 2UXDE 2RSMA 4JYAE 4BC9A 2L33A 4X65E 1STUA 2VQEE 4F9CB 5AE2A 3OTOE 2M7QA 1YYWA 1X48A 4JI3E 5FLXC 4DV0E 3HPSA 5LMUE 4LF7E 1O0WA 3LLHA 4DV2E 3P1XA 3JU0A 4BC7A 4M30A 4DV5E 1HR0E 4F54A 2UUCE 4L5NC 4WYQB 4JV5E 1J26A 1QU6A 3DF6A 1X47A 4M0VA 4BCAA 4DR6E 4NXME 1WHQA 2N3HA 2YZTA 2L92A 4L8NA 1EKZA 2LRSA 4B3SE 2B9DA 4DR7E 4YHHE 3J81C 2EWLA 4DV3E 3OMLA 4DR4E 4TUGA 4BS9A 2RS7A 4F9BB 2DB2A 3MSWA 2L3JA 2VQFE 4X8WA 2LUQA 4X64E 5F3WA 3LMLA 1IBKE 2H36X 4DV4E 2RTXA 1YYKA 3J7Yp 3H09A 1UHZA 5AASA 5IWAE 3IWCA 1UILA 2B3TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LMZ A; 
#chains in the Genus database with same CATH topology
 4Q35 B;  3QG5 C;  4JI4 E;  1HNZ E;  4O43 A;  3VYX A;  3IWB A;  3T1H E;  1T38 A;  1NEI A;  2YTP A;  4DR1 E;  4GKK E;  2EM0 A;  1YFH A;  4JI5 E;  4B3R E;  2EMX A;  2EM8 A;  2KON A;  1QNT A;  4MLV A;  4LF8 E;  2V87 A;  4KWY A;  4M2Z A;  2LBS B;  2JWO A;  2NUE A;  2EOY A;  2KOU A;  2LE2 A;  2LCE A;  4F6N A;  1GQE A;  4WFT A;  4DV1 E;  2GHF A;  2EN8 A;  4NHR A;  4DR5 E;  2EPL X;  2ENH A;  2JOB A;  2F4V E;  1L4S A;  2YRM A;  1DI2 A;  2UU9 E;  4MLQ A;  2M9A A;  5KL3 A;  3TQM A;  2EOJ A;  1A1K A;  2UXC E;  3DJW A;  2EOZ A;  2EM7 A;  4I8O A;  2BB8 A;  1TF6 A;  1GTK A;  4LU9 A;  4Q28 A;  1MEY C;  3ADJ A;  2K4V A;  2EL4 A;  2EPP A;  2ODR C;  2PRT A;  1BB8 A;  2EMH A;  3HQ1 A;  1N33 E;  1T39 A;  4JI8 E;  2E5L E;  2RPC A;  1WRJ A;  1NCS A;  2DLK A;  4R2A A;  1ZR9 A;  2EMB A;  4X66 E;  3BBG A;  2NUF A;  2L3C A;  2YRH A;  2RQL A;  4X62 E;  3C4B A;  2RSM A;  2YPN A;  4JYA E;  2L33 A;  4X65 E;  4NZV A;  1X48 A;  3P1X A;  2K7I A;  2EPA A;  2HJJ A;  4M30 A;  1J26 A;  2YSP A;  2J7J A;  1WHQ A;  5A6K A;  5AC5 A;  4L8N A;  3EPJ A;  2EOS A;  1EKZ A;  2LRS A;  2EML A;  4B3S E;  2B9D A;  4X9J A;  4DV3 E;  4DR7 E;  2EPK X;  4TUG A;  4BS9 A;  4F9B B;  2DB2 A;  3MSW A;  2EL5 A;  2VQF E;  3C6K A;  2H36 X;  5KL6 A;  1BBG A;  3IWC A;  2RSI A;  2EMG A;  1T4N A;  2MC6 A;  2R1F A;  4YY3 E;  3VK6 A;  2EPX A;  4R2S A;  2N3G A;  1RC7 A;  2ODR D;  2DSY A;  2FGG A;  1X3C A;  5A2Q C;  4R8O A;  3BID A;  2LV2 A;  4DV6 E;  4LFC E;  4GKJ E;  2YTI A;  3F6G A;  3EPL A;  4NXN E;  2EM6 A;  2YTJ A;  4GEQ B;  1G2F C;  5AE1 A;  4OX9 E;  4TUI A;  1YSA C;  1KJK A;  3C4T A;  3F6H A;  4AQY E;  2YTG A;  5IT9 C;  2JR1 A;  2EQ3 A;  5A6J A;  2YTO A;  3ADI A;  2YTQ A;  4N4R B;  2EOI A;  2CSH A;  4LF5 E;  4OOG C;  2LTS A;  2HC5 A;  4R2E A;  4BBY A;  2EN3 A;  2VE7 C;  2L6M A;  1A1G A;  3MHH C;  2L2K B;  2DGC A;  2LJH A;  4F9A B;  4JI2 E;  3KZZ A;  2V83 A;  2F8B A;  1XNQ E;  4J8Z A;  4JI7 E;  1YUJ A;  1B69 A;  2YTF A;  5LL6 R;  5CFF E;  2FTX B;  5TSE A;  2HHH E;  5A6A A;  2B7T A;  1N3G A;  2UXB E;  2EN2 A;  1ZBT A;  3J80 C;  4JI1 E;  1X49 A;  2IHR 1;  1YZ9 A;  5A6B A;  1AAY A;  2EPR A;  4ZYD A;  1X6H A;  2WCC 3;  4IS1 C;  2EP3 A;  1N36 E;  2V85 A;  2NA2 A;  2EPO A;  1A1J A;  4WX9 A;  5AE2 A;  2VQE E;  3THN A;  4FK5 C;  2EN7 A;  4BHC A;  5KL7 A;  1O0W A;  3LLH A;  4DV2 E;  1HR0 E;  2EOM A;  2UUC E;  4L5N C;  2EOX A;  1QU6 A;  3DF6 A;  1X47 A;  3UK3 C;  1PJT A;  3J81 C;  5IXM B;  2WBU A;  4X8W A;  2LUQ A;  3THO B;  4DV4 E;  2WBS A;  1IQS A;  2B3T B;  3RMP A;  1SR9 A;  2L8T A;  2MDR A;  2UUA E;  2EOQ A;  4DR2 E;  4JI0 E;  2BBG A;  1FJG E;  3AUZ A;  2JXP A;  2Q8U A;  2L2M A;  5T6J A;  5DNY A;  2NAB A;  5LMN E;  4KHP E;  1IBL E;  2UUB E;  2LTR A;  1WJP A;  5ADZ A;  1KYQ A;  2EZ6 A;  2M4I A;  2LVH A;  2V86 A;  2LT7 A;  1A1F A;  2EM2 A;  4DMI A;  2EPZ A;  2EMI A;  4RHB B;  2YSO A;  2WBT A;  1SFE A;  2MC5 A;  1EH8 A;  4LTY A;  1ZAA C;  4B3T E;  2YU5 A;  1G2D C;  3EPH A;  3ZOQ B;  1IBM E;  1T4O A;  3ADG A;  2YTD A;  2JY9 A;  5IV8 B;  4KZS A;  2DIX A;  3EQ1 A;  2I9I A;  2EM3 A;  2GPI A;  2EPU A;  4DUZ E;  2DMI A;  4R2Q A;  1T4L B;  2YTN A;  2EOR A;  1HNW E;  1YYO A;  2V89 A;  2YTE A;  5AC4 A;  1ZBQ A;  2A25 A;  4ZYG A;  4LF4 E;  2RS6 A;  2VF1 A;  4O4K A;  3JAM C;  1GZ6 A;  2EQ1 A;  4BMJ A;  4P7D A;  1XMQ E;  1HNX E;  2JPA A;  2EOH A;  2EMA A;  1PDA A;  3VYY A;  1A1I A;  1F2I G;  1AH5 A;  1WHN A;  4LFA E;  3IWD A;  1N34 E;  5AE3 A;  2EM4 A;  2EL6 A;  2EOE A;  2GLI A;  1EH6 A;  4LFB E;  2WZO A;  5LLQ A;  4LF6 E;  2CT1 A;  4WSP A;  2V8Q B;  1X6E A;  2M1S A;  2E1M A;  4R03 A;  2CPN A;  2YT4 A;  1N32 E;  2EN4 A;  2D9H A;  1PKP A;  2YU8 A;  2ELY A;  4WSG A;  4F9C B;  3OTO E;  5FLX C;  4DV0 E;  3HPS A;  4R2P A;  5LMU E;  2ENA A;  3JU0 A;  4DV5 E;  1Z1B A;  4WYQ B;  4BCA A;  4M0V A;  4NXM E;  2N3H A;  1LLM C;  4R2C A;  2EJ4 A;  4YHH E;  2EWL A;  4DR4 E;  2MKN A;  2RS7 A;  4IJD A;  2EMC A;  1A1H A;  2VRD A;  2I13 A;  2L3J A;  2EOO A;  5F3W A;  3LML A;  2EMZ A;  4RH8 A;  2EPC A;  2RTX A;  1YYK A;  3H09 A;  3OML A;  1UIL A;  2MKD A;  4K0K E;  4R2R A;  2DLQ A;  5KL2 A;  4DV7 E;  2EMW A;  1P47 A;  1EH7 A;  2LUP B;  2JP9 A;  4ZYE A;  3KWR A;  2JYA A;  4M9V C;  1YUI A;  2EMK A;  4JI6 E;  1X6F A;  3M99 B;  2CTD A;  1UBD C;  3AV0 A;  4DR3 E;  2NUG A;  4LF9 E;  4DUY E;  3J7A G;  1UN6 B;  2DMY A;  1J5E E;  4HEI A;  4R2D A;  2LJU A;  5A6B D;  3FIG A;  1A1L A;  2EQ0 A;  2L2N A;  5KL5 A;  4F6M A;  1DQ3 A;  1IMU A;  2EM9 A;  3HTX A;  3JTZ A;  2EMY A;  1XNR E;  3ECR A;  1ZU1 A;  2JOX A;  2B7V A;  2N8X A;  2KHX A;  3C6M A;  2EM5 A;  4WXD A;  2G7H A;  4JI3 E;  3HPZ A;  1WXR A;  1IQO A;  2ELZ A;  1RQ0 A;  1RMD A;  3T1Y E;  2ENC A;  2MDG A;  4GZN C;  5KL4 A;  4F2J C;  2EPN A;  2EMF A;  4HTG A;  4P78 A;  1JK2 A;  1I94 E;  3MHS C;  2ZM6 E;  2JVA A;  2YRK A;  4B3M E;  3ADL A;  3BF2 A;  1PJS A;  4BHB A;  3HXL A;  3K6Q A;  2EOF A;  4DKK A;  1YPN A;  1JK1 A;  1X5W A;  2R76 A;  2LMZ A;  1FKA E;  2DRP A;  1MGT A;  2V88 A;  4WXC A;  3BGH A;  1XMO E;  2HGH A;  2ADR A;  2FV4 B;  4WPY A;  1TN9 A;  2YWQ A;  2EPM X;  2UXD E;  4BC9 A;  1STU A;  2E72 A;  1YYW A;  2M7Q A;  4O5G A;  4LF7 E;  2EN1 A;  4BC7 A;  4JV5 E;  4F54 A;  2LO3 A;  4DR6 E;  2YZT A;  2L92 A;  4ZYH A;  3L00 A;  4X64 E;  3VHT B;  1IBK E;  3KZY A;  5A69 A;  5AAS A;  1UHZ A;  2EN6 A;  4O24 A;  2EE8 A;  5IWA E;  3J7Y p;  3EPK A;  1DGC A;  1TF3 A;  5BR8 E;  1BBO A;  1PJQ A; 
#chains in the Genus database with same CATH homology
 4K0K E;  1T4N A;  2MC6 A;  1SR9 A;  4YY3 E;  2L8T A;  2MDR A;  3RMP A;  3VK6 A;  4JI4 E;  1HNZ E;  2N3G A;  2UUA E;  1RC7 A;  4DV7 E;  2ODR D;  4DR2 E;  3VYX A;  2DSY A;  4JI0 E;  2FGG A;  1FJG E;  3AUZ A;  3IWB A;  5A2Q C;  4R8O A;  3T1H E;  2L2M A;  5T6J A;  5DNY A;  2LUP B;  3JAM C;  4DV6 E;  4LFC E;  4GKJ E;  3F6G A;  5LMN E;  4DR1 E;  4GKK E;  4NXN E;  4KHP E;  3KWR A;  4JI5 E;  1IBL E;  4B3R E;  2UUB E;  2LTR A;  2KON A;  5ADZ A;  4LF8 E;  4GEQ B;  2V87 A;  4JI6 E;  2EZ6 A;  2M4I A;  4M2Z A;  5AE1 A;  4OX9 E;  2LBS B;  2JWO A;  2V86 A;  2NUE A;  4TUI A;  2KOU A;  2LE2 A;  3AV0 A;  3C4T A;  4DR3 E;  4DMI A;  1GQE A;  3F6H A;  4WFT A;  4DV1 E;  4AQY E;  5IT9 C;  2NUG A;  4LF9 E;  2JR1 A;  4DUY E;  2MC5 A;  3J7A G;  2DMY A;  4LTY A;  1J5E E;  4DR5 E;  3ADI A;  4B3T E;  2JOB A;  3FIG A;  4LF5 E;  4OOG C;  2F4V E;  3ZOQ B;  1IBM E;  1T4O A;  2LTS A;  3ADG A;  1DI2 A;  4BBY A;  2UU9 E;  2VE7 C;  2L2N A;  2JY9 A;  4KZS A;  2DIX A;  1DQ3 A;  2L6M A;  4DUZ E;  1T4L B;  3HTX A;  2L2K B;  2UXC E;  1HNW E;  3JTZ A;  1YYO A;  3DJW A;  1XNR E;  2V89 A;  2JOX A;  2B7V A;  2LJH A;  1ZBQ A;  4I8O A;  2KHX A;  4F9A B;  4JI2 E;  2V83 A;  4LF4 E;  2F8B A;  2RS6 A;  2VF1 A;  1XNQ E;  2G7H A;  1GZ6 A;  3HPZ A;  4J8Z A;  4LU9 A;  4Q28 A;  1RQ0 A;  4JI7 E;  4P7D A;  4BMJ A;  1WXR A;  3T1Y E;  1XMQ E;  3ADJ A;  2K4V A;  5LL6 R;  2ODR C;  1HNX E;  5CFF E;  3VYY A;  4P78 A;  1I94 E;  2FTX B;  3HQ1 A;  2ZM6 E;  1N33 E;  1WHN A;  2JVA A;  4LFA E;  3IWD A;  4JI8 E;  2E5L E;  2HHH E;  1N34 E;  5BR8 E;  4B3M E;  3ADL A;  2B7T A;  5AE3 A;  2UXB E;  4LFB E;  3HXL A;  3K6Q A;  2WZO A;  4DKK A;  4X66 E;  4LF6 E;  1ZBT A;  3J80 C;  4JI1 E;  1X49 A;  2IHR 1;  2LMZ A;  1YZ9 A;  4WSP A;  2V8Q B;  1FKA E;  2M1S A;  2E1M A;  4R03 A;  2CPN A;  2V88 A;  2YT4 A;  1XMO E;  2NUF A;  2FV4 B;  4WPY A;  2L3C A;  1N32 E;  1N36 E;  1PKP A;  2V85 A;  2NA2 A;  3C4B A;  4X62 E;  2UXD E;  2RSM A;  4JYA E;  4BC9 A;  2L33 A;  4X65 E;  1STU A;  2VQE E;  4F9C B;  5AE2 A;  3OTO E;  2M7Q A;  1YYW A;  1X48 A;  4JI3 E;  5FLX C;  4DV0 E;  3HPS A;  5LMU E;  4LF7 E;  1O0W A;  3LLH A;  4DV2 E;  3P1X A;  3JU0 A;  4BC7 A;  4M30 A;  4DV5 E;  1HR0 E;  4F54 A;  2UUC E;  4L5N C;  4WYQ B;  4JV5 E;  1J26 A;  1QU6 A;  3DF6 A;  1X47 A;  4M0V A;  4BCA A;  4DR6 E;  4NXM E;  1WHQ A;  2N3H A;  2YZT A;  2L92 A;  4L8N A;  1EKZ A;  2LRS A;  4B3S E;  2B9D A;  4DR7 E;  4YHH E;  3J81 C;  2EWL A;  4DV3 E;  3OML A;  4DR4 E;  4TUG A;  4BS9 A;  2RS7 A;  4F9B B;  2DB2 A;  3MSW A;  2L3J A;  2VQF E;  4X8W A;  2LUQ A;  4X64 E;  5F3W A;  3LML A;  1IBK E;  2H36 X;  4DV4 E;  2RTX A;  1YYK A;  3J7Y p;  3H09 A;  1UHZ A;  5AAS A;  5IWA E;  3IWC A;  1UIL A;  2B3T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...