2LMZA

Solution nmr structure of the novel conotoxin im23a from conus imperialis
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
42
structure length
42
Chain Sequence
IPYCGQTGAECYSWCIKQDLSKDWCCDFVKDIRMNPPADKCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conotoxin im17a
publication title A helical conotoxin from Conus imperialis has a novel cysteine framework and defiines a new superfamily
doi rcsb
source organism Conus imperialis
molecule tags Toxin
total genus 8
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2011-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.530 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2lmzA00
2LMZA
chains in the Genus database with same CATH superfamily
2MC6A 1N36E 2EN1A 1ZBTA 1JK1A 1YUIA 4YHHE 2YSOA 4HTGA 4JI6E 1B69A 3VYXA 5IWAE 2YRHA 2EPKX 1UILA 4R2SA 2N3GA 4BMJA 2L2KB 1ZBQA 1PJTA 1WRJA 4LFAE 2EMBA 5AC4A 4O5GA 3K6QA 2WZOA 2KHXA 4L5NC 4JI4E 2D9HA 4X66E 2JVAA 1XNRE 2VQEE 2EWLA 4F9CB 3VK6A 2EORA 3EPLA 4YY3E 2V86A 2M7QA 1A1HA 3DJWA 3EQ1A 2RS7A 2LT7A 1XMOE 5AE1A 1YPNA 2F8BA 2LBSB 4M2ZA 2EMXA 1EH6A 5A69A 4O24A 5F3WA 2JOBA 5IV8B 1IBLE 1GZ6A 4Q35B 4TUIA 1AH5A 2EN3A 2YTFA 4DR7E 2YRKA 4WSPA 1WHNA 5LLQA 1Z1BA 2LVHA 3DF6A 2UUBE 3OMLA 3HPSA 2MDRA 4GKKE 5KL4A 1DQ3A 2EL5A 2KOUA 2LUPB 4M9VC 4BCAA 1RC7A 2JPAA 2FV4B 1MEYC 1QU6A 1ZR9A 2EM8A 1T4OA 2DMYA 3MHSC 2CT1A 1P47A 4DR5E 4R2AA 1A1LA 4FK5C 1DI2A 1IQOA 2BBGA 2VF1A 4P7DA 5KL6A 3H09A 4F9BB 2YPNA 5A6KA 3IWCA 5LMNE 1L4SA 2JXPA 2NUGA 1WJPA 3HPZA 2LCEA 3ADIA 2EPOA 4ZYDA 2ENAA 2M1SA 2VQFE 1YFHA 1STUA 4JV5E 1WXRA 1EKZA 4O43A 2K4VA 4DKKA 2EOQA 4F6MA 4DMIA 2JY9A 4LF5E 2JOXA 4GEQB 3C6KA 2UXCE 2LUQA 3C4BA 4R2RA 5LL6R 2UUAE 4LFCE 2EJ4A 4DV4E 4X64E 2EN7A 2ZM6E 2UUCE 1A1FA 4DR2E 3EPJA 1PJQA 2EMLA 3THOB 1N34E 4OX9E 1RQ0A 1X5WA 2EMWA 3F6HA 2EQ0A 2JP9A 2YZTA 2DRPA 3J81C 2L33A 2RQLA 4LTYA 2EPPA 3AUZA 2FGGA 2L3JA 1YYWA 1GTKA 3KZZA 2YT4A 3J7Yp 4DV1E 3FIGA 3HXLA 2CSHA 2ELYA 2EPUA 2GPIA 1YUJA 2WBUA 2EPCA 1HNXE 2EOEA 2WBTA 3IWDA 1WHQA 2L6MA 2EMFA 4LU9A 4NHRA 4BC9A 3ADLA 4ZYEA 2EPRA 3KWRA 3EPHA 4J8ZA 2PRTA 1GQEA 1IMUA 4BBYA 2EN2A 4MLQA 2JWOA 2V85A 2EOFA 1X6EA 2EMGA 2EPNA 2MKNA 1UHZA 5A6JA 4R2PA 1YZ9A 4LF6E 3T1YE 2EOIA 2YTPA 2EPLX 4DV6E 4IS1C 1N3GA 2MC5A 4WYQB 4WXDA 4JI0E 2V83A 2NA2A 2EMKA 1FJGE 2YTEA 3IWBA 2EM4A 2EMYA 2YTGA 2A25A 2EZ6A 2DB2A 2EMHA 3L00A 3THNA 3C4TA 3LMLA 2EMCA 3RMPA 2HC5A 1PKPA 2LJUA 4R03A 5A6AA 3HQ1A 3BGHA 2EQ1A 2ODRC 2YWQA 4IJDA 2ENCA 2MKDA 3VHTB 1X6FA 2VRDA 4KWYA 3ZOQB 2LRSA 3ADGA 1IBKE 4DR4E 2DLKA 2FTXB 2NUFA 5A2QC 1YSAC 2EL4A 4LFBE 2L8TA 2WBSA 2UU9E 5A6BD 4DV0E 1J26A 2LTSA 1XMQE 1BBOA 4DUYE 4JI8E 2IHR1 3QG5C 4LF7E 2B7VA 1JK2A 5T6JA 4F2JC 2EM3A 2J7JA 4ZYGA 2EOHA 2LE2A 2JYAA 5IXMB 4DV7E 2R76A 4F54A 4B3ME 2MDGA 4ZYHA 4B3TE 4R2QA 4M0VA 3UK3C 3J80C 1EH8A 1MGTA 2ODRD 2RSIA 4WFTA 1KYQA 2EMAA 4WXCA 4JYAE 3P1XA 4GZNC 3MSWA 2DMIA 2DSYA 2V88A 2EM7A 1F2IG 4R2EA 2F4VE 5DNYA 3ECRA 2EOZA 2EOOA 1UBDC 2RTXA 4DV2E 1T4LB 1A1KA 1ZAAC 4TUGA 2LV2A 4DR3E 5LMUE 2GLIA 2LJHA 4DV5E 5ADZA 2EM6A 3AV0A 4X8WA 4BC7A 1BB8A 2CTDA 5AE2A 2HJJA 1TN9A 2YU5A 3F6GA 2EP3A 1UN6B 4BHCA 2N3HA 4M30A 2B9DA 2HHHE 2WCC3 4B3SE 2EPMX 2DIXA 3JU0A 5TSEA 4R2CA 5BR8E 2EOYA 2YU8A 5KL2A 1X6HA 4K0KE 1HR0E 5KL3A 1I94E 1G2FC 5KL7A 4KHPE 4KZSA 2Q8UA 2EPXA 4X65E 4R8OA 2I13A 1TF6A 5IT9C 1N33E 1QNTA 4GKJE 2EM0A 1DGCA 2G7HA 2V89A 2N8XA 2YTIA 3TQMA 4WX9A 2EN4A 4DV3E 3BBGA 2HGHA 2NABA 2I9IA 2JR1A 4LF4E 2EL6A 2RS6A 2YRMA 1YYOA 3C6MA 1YYKA 1J5EE 2LMZA 2E1MA 4JI3E 3VYYA 1T4NA 2EM2A 2EM5A 2K7IA 3BF2A 1KJKA 5AE3A 5KL5A 1NCSA 2EOJA 4DUZE 1RMDA 2YTQA 3OTOE 1A1GA 2GHFA 2YTDA 1PDAA 2YSPA 1FKAE 4NZVA 4X62E 4OOGC 2L92A 2EMIA 2YTOA 3MHHC 4WSGA 4DR6E 1SFEA 2ENHA 2EPAA 4N4RB 4AQYE 3LLHA 2UXDE 2LO3A 4JI7E 3JAMC 4DR1E 2EOXA 4BS9A 4R2DA 2EE8A 4L8NA 1TF3A 4NXNE 2RSMA 4LF8E 4X9JA 1EH7A 1X47A 4WPYA 2EMZA 2B3TB 2M9AA 2BB8A 4P78A 2L2NA 4RH8A 3KZYA 4LF9E 1PJSA 2H36X 4BHBA 3T1HE 2LTRA 5AC5A 1O0WA 3HTXA 4F9AB 4JI5E 2B7TA 2DGCA 2R1FA 1ZU1A 4JI2E 2EQ3A 2L2MA 2M4IA 2KONA 4Q28A 2UXBE 2NUEA 2DLQA 1G2DC 2RPCA 1BBGA 1T39A 4F6NA 2EPZA 1X48A 1IQSA 4MLVA 1IBME 1X49A 1HNWE 2ELZA 3BIDA 1AAYA 2V8QB 1SR9A 4NXME 2E72A 3M99B 2CPNA 5A6BA 4I8OA 1X3CA 4O4KA 2V87A 3JTZA 2L3CA 2EOMA 5CFFE 4RHBB 2VE7C 1LLMC 2YTJA 4HEIA 3ADJA 1A1JA 5AASA 3J7AG 2E5LE 4JI1E 5FLXC 1T38A 1N32E 4B3RE 2EN6A 1NEIA 1XNQE 1HNZE 2EM9A 3EPKA 2EOSA 1A1IA 2EN8A 2ADRA 2YTNA
chains in the Genus database with same CATH topology
2MC6A 1N36E 4M0VA 1ZBTA 4YHHE 3J80C 4DV4E 4X64E 4JI6E 4DUZE 2ZM6E 3OTOE 5IWAE 2UUCE 2ODRD 4DR2E 3VYXA 4WFTA 1N34E 4OX9E 1UILA 1RQ0A 2N3GA 3F6HA 5LL6R 1FKAE 4BMJA 2YZTA 3P1XA 4JYAE 4X62E 3J81C 3MSWA 2L2KB 1ZBQA 2DSYA 4OOGC 2L33A 4LFAE 2V88A 4LTYA 3AUZA 5DNYA 2L92A 2FGGA 3K6QA 2L3JA 1YYWA 2WZOA 2KHXA 2F4VE 4L5NC 4DR6E 4JI4E 2RTXA 4X66E 2JVAA 4DV2E 1T4LB 2YT4A 4AQYE 4TUGA 3LLHA 3J7Yp 2VQEE 1XNRE 2EWLA 4DR3E 4DV1E 3FIGA 2UXDE 4F9CB 3HXLA 3VK6A 5LMUE 4JI7E 3JAMC 2LJHA 4DR1E 4YY3E 2V86A 2M7QA 4L8NA 4BS9A 5ADZA 4DV5E 3AV0A 3DJWA 2RSMA 1HNXE 4NXNE 4LF8E 3IWDA 2RS7A 4X8WA 1X47A 4BC7A 4WPYA 1XMOE 1WHQA 2L6MA 4LU9A 5AE2A 2B3TB 5AE1A 4BC9A 3ADLA 2F8BA 4P78A 2LBSB 3KWRA 4M2ZA 2L2NA 3F6GA 4J8ZA 1GQEA 4LF9E 4BBYA 2H36X 2JWOA 2N3HA 4M30A 5F3WA 2JOBA 2B9DA 2HHHE 2V85A 1IBLE 3T1HE 1GZ6A 4TUIA 2LTRA 1O0WA 1UHZA 3HTXA 1YZ9A 4DR7E 4F9AB 4B3SE 4LF6E 4WSPA 1WHNA 2DIXA 3T1YE 4B3ME 4JI5E 2B7TA 3JU0A 4DV6E 4LFCE 4JI2E 2L2MA 2M4IA 3DF6A 2MC5A 5BR8E 2KONA 3OMLA 4Q28A 4WYQB 2UUBE 4JI0E 2V83A 2NA2A 1FJGE 3HPSA 2UXBE 2MDRA 3IWBA 2NUEA 4GKKE 4K0KE 1DQ3A 2EZ6A 2KOUA 2DB2A 1I94E 1HR0E 2LUPB 4KHPE 4BCAA 1RC7A 2FV4B 1QU6A 4KZSA 3C4TA 1T4OA 4X65E 3LMLA 2DMYA 4R8OA 3RMPA 4DR5E 1PKPA 1X48A 4R03A 1IBME 1X49A 5IT9C 1HNWE 3HQ1A 1N33E 2V8QB 1SR9A 2ODRC 1DI2A 4NXME 2VF1A 4GKJE 2G7HA 2V89A 4P7DA 2CPNA 3H09A 4F9BB 3ZOQB 4I8OA 2LRSA 3ADGA 1IBKE 3IWCA 4DR4E 5LMNE 2FTXB 2NUGA 2V87A 2NUFA 3JTZA 5A2QC 4DV3E 3HPZA 2L3CA 4LFBE 3ADIA 5CFFE 2L8TA 4LF4E 2M1SA 2VQFE 2RS6A 2VE7C 1STUA 3ADJA 5AASA 3J7AG 4JV5E 2UU9E 1WXRA 1EKZA 2E5LE 4DV0E 1J26A 2LTSA 1XMQE 1YYOA 4JI1E 2K4VA 5FLXC 4DUYE 1N32E 4DKKA 4B3RE 4JI8E 2IHR1 4DMIA 4LF7E 2B7VA 2JY9A 5T6JA 1J5EE 4LF5E 1XNQE 1HNZE 1YYKA 2LMZA 2E1MA 2JOXA 2LE2A 4GEQB 4JI3E 2UXCE 2LUQA 3VYYA 1T4NA 4DV7E 3C4BA 4F54A 2JR1A 5AE3A 2UUAE 4B3TE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LMZ A; 
#chains in the Genus database with same CATH topology
 2MC6 A;  1N36 E;  2EN1 A;  1ZBT A;  1JK1 A;  1YUI A;  4YHH E;  2YSO A;  4HTG A;  4JI6 E;  1B69 A;  3VYX A;  5IWA E;  2YRH A;  2EPK X;  1UIL A;  4R2S A;  2N3G A;  4BMJ A;  2L2K B;  1ZBQ A;  1PJT A;  1WRJ A;  4LFA E;  2EMB A;  5AC4 A;  4O5G A;  3K6Q A;  2WZO A;  2KHX A;  4L5N C;  4JI4 E;  2D9H A;  4X66 E;  2JVA A;  1XNR E;  2VQE E;  2EWL A;  4F9C B;  3VK6 A;  2EOR A;  3EPL A;  4YY3 E;  2V86 A;  2M7Q A;  1A1H A;  3DJW A;  3EQ1 A;  2RS7 A;  2LT7 A;  1XMO E;  5AE1 A;  1YPN A;  2F8B A;  2LBS B;  4M2Z A;  2EMX A;  1EH6 A;  5A69 A;  4O24 A;  5F3W A;  2JOB A;  5IV8 B;  1IBL E;  1GZ6 A;  4Q35 B;  4TUI A;  1AH5 A;  2EN3 A;  2YTF A;  4DR7 E;  2YRK A;  4WSP A;  1WHN A;  5LLQ A;  1Z1B A;  2LVH A;  3DF6 A;  2UUB E;  3OML A;  3HPS A;  2MDR A;  4GKK E;  5KL4 A;  1DQ3 A;  2EL5 A;  2KOU A;  2LUP B;  4M9V C;  4BCA A;  1RC7 A;  2JPA A;  2FV4 B;  1MEY C;  1QU6 A;  1ZR9 A;  2EM8 A;  1T4O A;  2DMY A;  3MHS C;  2CT1 A;  1P47 A;  4DR5 E;  4R2A A;  1A1L A;  4FK5 C;  1DI2 A;  1IQO A;  2BBG A;  2VF1 A;  4P7D A;  5KL6 A;  3H09 A;  4F9B B;  2YPN A;  5A6K A;  3IWC A;  5LMN E;  1L4S A;  2JXP A;  2NUG A;  1WJP A;  3HPZ A;  2LCE A;  3ADI A;  2EPO A;  4ZYD A;  2ENA A;  2M1S A;  2VQF E;  1YFH A;  1STU A;  4JV5 E;  1WXR A;  1EKZ A;  4O43 A;  2K4V A;  4DKK A;  2EOQ A;  4F6M A;  4DMI A;  2JY9 A;  4LF5 E;  2JOX A;  4GEQ B;  3C6K A;  2UXC E;  2LUQ A;  3C4B A;  4R2R A;  5LL6 R;  2UUA E;  4LFC E;  2EJ4 A;  4DV4 E;  4X64 E;  2EN7 A;  2ZM6 E;  2UUC E;  1A1F A;  4DR2 E;  3EPJ A;  1PJQ A;  2EML A;  3THO B;  1N34 E;  4OX9 E;  1RQ0 A;  1X5W A;  2EMW A;  3F6H A;  2EQ0 A;  2JP9 A;  2YZT A;  2DRP A;  3J81 C;  2L33 A;  2RQL A;  4LTY A;  2EPP A;  3AUZ A;  2FGG A;  2L3J A;  1YYW A;  1GTK A;  3KZZ A;  2YT4 A;  3J7Y p;  4DV1 E;  3FIG A;  3HXL A;  2CSH A;  2ELY A;  2EPU A;  2GPI A;  1YUJ A;  2WBU A;  2EPC A;  1HNX E;  2EOE A;  2WBT A;  3IWD A;  1WHQ A;  2L6M A;  2EMF A;  4LU9 A;  4NHR A;  4BC9 A;  3ADL A;  4ZYE A;  2EPR A;  3KWR A;  3EPH A;  4J8Z A;  2PRT A;  1GQE A;  1IMU A;  4BBY A;  2EN2 A;  4MLQ A;  2JWO A;  2V85 A;  2EOF A;  1X6E A;  2EMG A;  2EPN A;  2MKN A;  1UHZ A;  5A6J A;  4R2P A;  1YZ9 A;  4LF6 E;  3T1Y E;  2EOI A;  2YTP A;  2EPL X;  4DV6 E;  4IS1 C;  1N3G A;  2MC5 A;  4WYQ B;  4WXD A;  4JI0 E;  2V83 A;  2NA2 A;  2EMK A;  1FJG E;  2YTE A;  3IWB A;  2EM4 A;  2EMY A;  2YTG A;  2A25 A;  2EZ6 A;  2DB2 A;  2EMH A;  3L00 A;  3THN A;  3C4T A;  3LML A;  2EMC A;  3RMP A;  2HC5 A;  1PKP A;  2LJU A;  4R03 A;  5A6A A;  3HQ1 A;  3BGH A;  2EQ1 A;  2ODR C;  2YWQ A;  4IJD A;  2ENC A;  2MKD A;  3VHT B;  1X6F A;  2VRD A;  4KWY A;  3ZOQ B;  2LRS A;  3ADG A;  1IBK E;  4DR4 E;  2DLK A;  2FTX B;  2NUF A;  5A2Q C;  1YSA C;  2EL4 A;  4LFB E;  2L8T A;  2WBS A;  2UU9 E;  5A6B D;  4DV0 E;  1J26 A;  2LTS A;  1XMQ E;  1BBO A;  4DUY E;  4JI8 E;  2IHR 1;  3QG5 C;  4LF7 E;  2B7V A;  1JK2 A;  5T6J A;  4F2J C;  2EM3 A;  2J7J A;  4ZYG A;  2EOH A;  2LE2 A;  2JYA A;  5IXM B;  4DV7 E;  2R76 A;  4F54 A;  4B3M E;  2MDG A;  4ZYH A;  4B3T E;  4R2Q A;  4M0V A;  3UK3 C;  3J80 C;  1EH8 A;  1MGT A;  2ODR D;  2RSI A;  4WFT A;  1KYQ A;  2EMA A;  4WXC A;  4JYA E;  3P1X A;  4GZN C;  3MSW A;  2DMI A;  2DSY A;  2V88 A;  2EM7 A;  1F2I G;  4R2E A;  2F4V E;  5DNY A;  3ECR A;  2EOZ A;  2EOO A;  1UBD C;  2RTX A;  4DV2 E;  1T4L B;  1A1K A;  1ZAA C;  4TUG A;  2LV2 A;  4DR3 E;  5LMU E;  2GLI A;  2LJH A;  4DV5 E;  5ADZ A;  2EM6 A;  3AV0 A;  4X8W A;  4BC7 A;  1BB8 A;  2CTD A;  5AE2 A;  2HJJ A;  1TN9 A;  2YU5 A;  3F6G A;  2EP3 A;  1UN6 B;  4BHC A;  2N3H A;  4M30 A;  2B9D A;  2HHH E;  2WCC 3;  4B3S E;  2EPM X;  2DIX A;  3JU0 A;  5TSE A;  4R2C A;  5BR8 E;  2EOY A;  2YU8 A;  5KL2 A;  1X6H A;  4K0K E;  1HR0 E;  5KL3 A;  1I94 E;  1G2F C;  5KL7 A;  4KHP E;  4KZS A;  2Q8U A;  2EPX A;  4X65 E;  4R8O A;  2I13 A;  1TF6 A;  5IT9 C;  1N33 E;  1QNT A;  4GKJ E;  2EM0 A;  1DGC A;  2G7H A;  2V89 A;  2N8X A;  2YTI A;  3TQM A;  4WX9 A;  2EN4 A;  4DV3 E;  3BBG A;  2HGH A;  2NAB A;  2I9I A;  2JR1 A;  4LF4 E;  2EL6 A;  2RS6 A;  2YRM A;  1YYO A;  3C6M A;  1YYK A;  1J5E E;  2LMZ A;  2E1M A;  4JI3 E;  3VYY A;  1T4N A;  2EM2 A;  2EM5 A;  2K7I A;  3BF2 A;  1KJK A;  5AE3 A;  5KL5 A;  1NCS A;  2EOJ A;  4DUZ E;  1RMD A;  2YTQ A;  3OTO E;  1A1G A;  2GHF A;  2YTD A;  1PDA A;  2YSP A;  1FKA E;  4NZV A;  4X62 E;  4OOG C;  2L92 A;  2EMI A;  2YTO A;  3MHH C;  4WSG A;  4DR6 E;  1SFE A;  2ENH A;  2EPA A;  4N4R B;  4AQY E;  3LLH A;  2UXD E;  2LO3 A;  4JI7 E;  3JAM C;  4DR1 E;  2EOX A;  4BS9 A;  4R2D A;  2EE8 A;  4L8N A;  1TF3 A;  4NXN E;  2RSM A;  4LF8 E;  4X9J A;  1EH7 A;  1X47 A;  4WPY A;  2EMZ A;  2B3T B;  2M9A A;  2BB8 A;  4P78 A;  2L2N A;  4RH8 A;  3KZY A;  4LF9 E;  1PJS A;  2H36 X;  4BHB A;  3T1H E;  2LTR A;  5AC5 A;  1O0W A;  3HTX A;  4F9A B;  4JI5 E;  2B7T A;  2DGC A;  2R1F A;  1ZU1 A;  4JI2 E;  2EQ3 A;  2L2M A;  2M4I A;  2KON A;  4Q28 A;  2UXB E;  2NUE A;  2DLQ A;  1G2D C;  2RPC A;  1BBG A;  1T39 A;  4F6N A;  2EPZ A;  1X48 A;  1IQS A;  4MLV A;  1IBM E;  1X49 A;  1HNW E;  2ELZ A;  3BID A;  1AAY A;  2V8Q B;  1SR9 A;  4NXM E;  2E72 A;  3M99 B;  2CPN A;  5A6B A;  4I8O A;  1X3C A;  4O4K A;  2V87 A;  3JTZ A;  2L3C A;  2EOM A;  5CFF E;  4RHB B;  2VE7 C;  1LLM C;  2YTJ A;  4HEI A;  3ADJ A;  1A1J A;  5AAS A;  3J7A G;  2E5L E;  4JI1 E;  5FLX C;  1T38 A;  1N32 E;  4B3R E;  2EN6 A;  1NEI A;  1XNQ E;  1HNZ E;  2EM9 A;  3EPK A;  2EOS A;  1A1I A;  2EN8 A;  2ADR A;  2YTN A; 
#chains in the Genus database with same CATH homology
 2MC6 A;  1N36 E;  4M0V A;  1ZBT A;  4YHH E;  3J80 C;  4DV4 E;  4X64 E;  4JI6 E;  4DUZ E;  2ZM6 E;  3OTO E;  5IWA E;  2UUC E;  2ODR D;  4DR2 E;  3VYX A;  4WFT A;  1N34 E;  4OX9 E;  1UIL A;  1RQ0 A;  2N3G A;  3F6H A;  5LL6 R;  1FKA E;  4BMJ A;  2YZT A;  3P1X A;  4JYA E;  4X62 E;  3J81 C;  3MSW A;  2L2K B;  1ZBQ A;  2DSY A;  4OOG C;  2L33 A;  4LFA E;  2V88 A;  4LTY A;  3AUZ A;  5DNY A;  2L92 A;  2FGG A;  3K6Q A;  2L3J A;  1YYW A;  2WZO A;  2KHX A;  2F4V E;  4L5N C;  4DR6 E;  4JI4 E;  2RTX A;  4X66 E;  2JVA A;  4DV2 E;  1T4L B;  2YT4 A;  4AQY E;  4TUG A;  3LLH A;  3J7Y p;  2VQE E;  1XNR E;  2EWL A;  4DR3 E;  4DV1 E;  3FIG A;  2UXD E;  4F9C B;  3HXL A;  3VK6 A;  5LMU E;  4JI7 E;  3JAM C;  2LJH A;  4DR1 E;  4YY3 E;  2V86 A;  2M7Q A;  4L8N A;  4BS9 A;  5ADZ A;  4DV5 E;  3AV0 A;  3DJW A;  2RSM A;  1HNX E;  4NXN E;  4LF8 E;  3IWD A;  2RS7 A;  4X8W A;  1X47 A;  4BC7 A;  4WPY A;  1XMO E;  1WHQ A;  2L6M A;  4LU9 A;  5AE2 A;  2B3T B;  5AE1 A;  4BC9 A;  3ADL A;  2F8B A;  4P78 A;  2LBS B;  3KWR A;  4M2Z A;  2L2N A;  3F6G A;  4J8Z A;  1GQE A;  4LF9 E;  4BBY A;  2H36 X;  2JWO A;  2N3H A;  4M30 A;  5F3W A;  2JOB A;  2B9D A;  2HHH E;  2V85 A;  1IBL E;  3T1H E;  1GZ6 A;  4TUI A;  2LTR A;  1O0W A;  1UHZ A;  3HTX A;  1YZ9 A;  4DR7 E;  4F9A B;  4B3S E;  4LF6 E;  4WSP A;  1WHN A;  2DIX A;  3T1Y E;  4B3M E;  4JI5 E;  2B7T A;  3JU0 A;  4DV6 E;  4LFC E;  4JI2 E;  2L2M A;  2M4I A;  3DF6 A;  2MC5 A;  5BR8 E;  2KON A;  3OML A;  4Q28 A;  4WYQ B;  2UUB E;  4JI0 E;  2V83 A;  2NA2 A;  1FJG E;  3HPS A;  2UXB E;  2MDR A;  3IWB A;  2NUE A;  4GKK E;  4K0K E;  1DQ3 A;  2EZ6 A;  2KOU A;  2DB2 A;  1I94 E;  1HR0 E;  2LUP B;  4KHP E;  4BCA A;  1RC7 A;  2FV4 B;  1QU6 A;  4KZS A;  3C4T A;  1T4O A;  4X65 E;  3LML A;  2DMY A;  4R8O A;  3RMP A;  4DR5 E;  1PKP A;  1X48 A;  4R03 A;  1IBM E;  1X49 A;  5IT9 C;  1HNW E;  3HQ1 A;  1N33 E;  2V8Q B;  1SR9 A;  2ODR C;  1DI2 A;  4NXM E;  2VF1 A;  4GKJ E;  2G7H A;  2V89 A;  4P7D A;  2CPN A;  3H09 A;  4F9B B;  3ZOQ B;  4I8O A;  2LRS A;  3ADG A;  1IBK E;  3IWC A;  4DR4 E;  5LMN E;  2FTX B;  2NUG A;  2V87 A;  2NUF A;  3JTZ A;  5A2Q C;  4DV3 E;  3HPZ A;  2L3C A;  4LFB E;  3ADI A;  5CFF E;  2L8T A;  4LF4 E;  2M1S A;  2VQF E;  2RS6 A;  2VE7 C;  1STU A;  3ADJ A;  5AAS A;  3J7A G;  4JV5 E;  2UU9 E;  1WXR A;  1EKZ A;  2E5L E;  4DV0 E;  1J26 A;  2LTS A;  1XMQ E;  1YYO A;  4JI1 E;  2K4V A;  5FLX C;  4DUY E;  1N32 E;  4DKK A;  4B3R E;  4JI8 E;  2IHR 1;  4DMI A;  4LF7 E;  2B7V A;  2JY9 A;  5T6J A;  1J5E E;  4LF5 E;  1XNQ E;  1HNZ E;  1YYK A;  2LMZ A;  2E1M A;  2JOX A;  2LE2 A;  4GEQ B;  4JI3 E;  2UXC E;  2LUQ A;  3VYY A;  1T4N A;  4DV7 E;  3C4B A;  4F54 A;  2JR1 A;  5AE3 A;  2UUA E;  4B3T E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...