5KL4A

Wilms tumor protein (wt1) znf2-4 q369h in complex with formylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
90
structure length
90
Chain Sequence
GSEKPYQCDFKDCERRFSRSDHLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wilms tumor protein
publication title Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 28
structure length 90
sequence length 90
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 5kl4A00
1X3CA 4R2EA 4FK5C 2MKNA 2ENHA 2EMCA 2EQ0A 4R2CA 2GHFA 2WBSA 2JPAA 1UBDC 5KL6A 2EOYA 2WBTA 4GZNC 1A1IA 2EM2A 2EJ4A 1A1GA 1MEYC 1RMDA 2E72A 2RPCA 2D9HA 1YSAC 2EMHA 2EM5A 2EMYA 3MHSC 2NABA 3VHTB 2EPPA 4F2JC 4IS1C 4F6NA 1DGCA 1X6FA 2EPAA 2A25A 2EM4A 2YRKA 2GLIA 2EOIA 2MDGA 2LVHA 1NCSA 2BB8A 2CSHA 2EQ1A 2I13A 2EOJA 5KL5A 2YTGA 2EMGA 2EOHA 3EPJA 2CTDA 2YTJA 3EPKA 4R2SA 2EMFA 1A1JA 1X6EA 5KL7A 2DRPA 5KL3A 2YTNA 2YRHA 3EPLA 1ZU1A 2EL6A 2YSOA 1TF6A 2EMLA 2YU5A 3M99B 2J7JA 2WBUA 1TN9A 2EOMA 2EMBA 2ENAA 5KL2A 2YSPA 2EMAA 2EORA 2EN3A 2EPCA 2M9AA 2YTDA 2DLKA 1YUIA 2EOZA 2YTPA 2EM8A 4R2QA 2YTIA 2VRDA 5KL4A 2DGCA 1LLMC 1BBOA 2YTQA 2WCC3 2RSIA 1X5WA 2EPZA 1JK1A 2LCEA 2MKDA 1YUJA 3UK3C 2EPUA 1JK2A 1A1FA 1AAYA 1P47A 1ZR9A 2EMKA 1F2IG 4R2RA 2EPRA 4WSGA 2YTFA 4R2DA 1TF3A 2EL4A 4M9VC 2EMZA 4IJDA 2ELZA 2EN1A 2EOSA 2EM6A 2EOOA 2DLQA 2EMWA 1UN6B 4X9JA 1WJPA 2CT1A 2YTEA 2EL5A 1G2DC 3EPHA 1Z1BA 2ENCA 2YU8A 2EQ3A 2EE8A 2EM9A 2EOXA 2R1FA 2DMIA 1ZAAC 2EN8A 2EM0A 2JP9A 2ELYA 2EPXA 2EOFA 3MHHC 2ADRA 2EN6A 2EN7A 2EOQA 2EN2A 2YTOA 2LO3A 1A1HA 1KJKA 1B69A 4F6MA 1X6HA 1G2FC 2YRMA 2HGHA 2LT7A 2LV2A 2PRTA 2EOEA 4R2AA 2EM3A 2EMXA 1A1KA 1BB8A 2EP3A 2EN4A 2EM7A 2EMIA 4R2PA 1A1LA
chains in the Genus database with same CATH superfamily
2MKNA 4BMJA 1WRJA 4DV0E 4DV6E 4YHHE 2WBTA 4GZNC 1EH8A 2DMYA 2EM2A 4R03A 4GKKE 1RMDA 2EMHA 4IS1C 2NABA 2EPPA 2LMZA 1XMQE 5IV8B 5AE3A 1YFHA 2EOJA 3THOB 2YTGA 2EMGA 5A69A 5LLQA 1J26A 2CTDA 4BBYA 4ZYGA 2EPMX 5IWAE 4KWYA 4DR3E 3T1YE 2JWOA 2GPIA 3JTZA 1IQSA 5KL3A 2YTNA 3DF6A 2NUFA 4LF5E 2JOXA 4JI7E 2YSOA 3ECRA 2WBUA 3C6MA 2YSPA 2HHHE 2EMAA 2M9AA 3JU0A 2M7QA 2YTDA 3KZYA 1T39A 1SR9A 2EM8A 2ODRD 4R2QA 4F9BB 5KL4A 2DGCA 1X5WA 4LF7E 2LCEA 3THNA 2YZTA 1YUJA 2FGGA 5ADZA 3F6HA 1FKAE 1P47A 4JI3E 1F2IG 4LU9A 5IXMB 1NEIA 1RQ0A 1ZBTA 3OMLA 2EL4A 1RC7A 2EMZA 3HQ1A 2EM6A 3JAMC 2EMWA 2L92A 3IWCA 1O0WA 2EL5A 2MDRA 3QG5C 4WX9A 1IQOA 2M1SA 4DR4E 2VF1A 2F8BA 2EE8A 2EOXA 4B3SE 2DMIA 1ZAAC 4BCAA 2ELYA 4M0VA 4LF4E 2ADRA 2EN6A 2H36X 4ZYDA 3BF2A 1N34E 2YTOA 2R76A 1X6HA 4F6MA 5A6JA 2FTXB 2LT7A 4R2AA 4KZSA 2UU9E 2LJHA 2VQFE 1N36E 2JXPA 2WBSA 4R2CA 2GHFA 3OTOE 5CFFE 2E5LE 4HTGA 5AE1A 2UUCE 4BS9A 1IMUA 1A1IA 1YZ9A 1EH7A 2YWQA 5FLXC 2JOBA 4DMIA 2E72A 4RH8A 2MC5A 4LF9E 2RPCA 1YSAC 4J8ZA 2EMYA 2EM5A 3HPSA 4F2JC 4F6NA 4DV4E 1X6FA 4DR7E 3L00A 2GLIA 1UILA 1NCSA 2HC5A 2CSHA 2EQ1A 2DB2A 2IHR1 2LTSA 3IWBA 1IBME 2LTRA 2LJUA 4JV5E 4R2SA 4HEIA 4DKKA 1A1JA 4L5NC 2YRHA 2EPLX 1TF6A 4F9CB 4DUZE 2K4VA 2EOMA 4WFTA 3J7Yp 1J5EE 2EORA 2EN3A 4X8WA 1WHNA 2DLKA 3F6GA 2EOZA 2LUPB 1T4LB 2M4IA 4DR6E 2YTQA 5DNYA 4JI1E 4LF6E 1PJSA 4X62E 1EH6A 5A6KA 4LTYA 2BBGA 3UK3C 1AAYA 2ODRC 3T1HE 1N32E 2L3CA 4N4RB 4LFBE 2L8TA 4F9AB 1TF3A 3EQ1A 4JI5E 2EOSA 1QNTA 1PJTA 2EOOA 2UXDE 2LE2A 4JI8E 1PKPA 1WJPA 3H09A 1G2DC 4O24A 3HTXA 2L2MA 2ENCA 4X64E 4OOGC 1HNWE 2R1FA 2EN8A 2EM0A 3ZOQB 2EPXA 4X65E 4ZYHA 2EN7A 4B3TE 2EOQA 2RS6A 2YT4A 2EPKX 2EN2A 3VYXA 4JI4E 4RHBB 2LO3A 2ZM6E 2E1MA 2L33A 2HGHA 2VE7C 1EKZA 2EZ6A 4GKJE 2PRTA 1IBKE 1T4NA 1KYQA 3ADIA 1A1KA 4BC9A 2B3TB 2EP3A 4NXME 3J81C 2EMIA 1X3CA 4FK5C 3C4TA 2KONA 2EQ0A 2LUQA 1UBDC 4O5GA 1T38A 5KL6A 1HR0E 2Q8UA 3KWRA 2V85A 2RSMA 4NZVA 2EJ4A 1N3GA 2EPNA 3J80C 3HXLA 2D9HA 4O43A 1DGCA 2UXBE 1ZBQA 3LLHA 2A25A 2EM4A 2YRKA 2MDGA 1HNXE 4P7DA 3C4BA 1AH5A 4JI2E 5KL5A 2EOHA 3EPJA 2NA2A 1XNRE 2CPNA 1FJGE 2YTJA 3EPKA 2UUBE 2EMFA 1X49A 5KL7A 2DRPA 4O4KA 4BC7A 2L2KB 2LRSA 3EPLA 1ZU1A 2EL6A 2EMLA 3M99B 1X47A 1TN9A 3BBGA 4L8NA 2UUAE 4LFCE 1N33E 2EMBA 5KL2A 2EPCA 4DV1E 1I94E 3ADLA 2YTPA 4M2ZA 4ZYEA 2VRDA 2N3GA 1LLMC 1IBLE 2WCC3 1XNQE 4DR1E 2RSIA 1WXRA 1JK1A 2MKDA 4TUIA 4B3RE 1DQ3A 1UHZA 2V88A 2EPUA 1A1FA 3BGHA 1ZR9A 2EMKA 2FV4B 2YTFA 4R2DA 5AC4A 3BIDA 2RS7A 4IJDA 2ELZA 2EN1A 2RTXA 4BHCA 2DLQA 2KOUA 4X9JA 4MLVA 2CT1A 4AQYE 2YPNA 4OX9E 4GEQB 2EQ3A 3ADGA 4YY3E 3KZZA 2B7VA 5A6AA 3MSWA 1A1HA 1KJKA 3ADJA 2B9DA 4R8OA 4JI6E 2EOEA 1PJQA 4DV3E 1DI2A 1YYOA 2EN4A 2EM7A 1STUA 2N8XA 1A1LA 4R2EA 5LL6R 2ENHA 2EMCA 5A6BA 2JPAA 3J7AG 5LMUE 2JR1A 5LMNE 2EOYA 4NHRA 2V87A 2DSYA 3HPZA 1A1GA 1MEYC 4DV5E 1BBGA 4JYAE 3MHSC 3VHTB 2EPAA 5BR8E 3VK6A 2WZOA 1X48A 2EOIA 2LVHA 4NXNE 2B7TA 4DR2E 2BB8A 2I13A 1GZ6A 5F3WA 3TQMA 4LF8E 1HNZE 4WXDA 3AUZA 1X6EA 3RMPA 2KHXA 5A6BD 4Q28A 2YU5A 4Q35B 2J7JA 2V83A 2V8QB 1XMOE 5IT9C 2ENAA 2N3HA 4F54A 4KHPE 2V89A 2VQEE 1YUIA 2YTIA 4WSPA 3P1XA 4DV7E 1BBOA 1GQEA 4K0KE 2UXCE 2L3JA 2EPZA 2HJJA 2EWLA 4M30A 2L6MA 5A2QC 4I8OA 1JK2A 2NUEA 4R2RA 2EPRA 4WSGA 4LFAE 3LMLA 2JYAA 2MC6A 4WPYA 2DIXA 5TSEA 4X66E 4DV2E 1YYKA 1QU6A 4M9VC 1YYWA 2I9IA 1PDAA 3C6KA 4WYQB 1GTKA 4MLQA 4B3ME 2K7IA 2F4VE 1UN6B 3FIGA 2YTEA 3IWDA 3EPHA 3K6QA 2EPOA 1Z1BA 2YU8A 5T6JA 2EM9A 3VYYA 4JI0E 4TUGA 2G7HA 1WHQA 1YPNA 2JP9A 5AASA 2NUGA 3MHHC 2EOFA 4DR5E 2JVAA 5AC5A 2L2NA 5AE2A 1T4OA 2LBSB 4BHBA 1B69A 1G2FC 2YRMA 3AV0A 4P78A 2LV2A 2RQLA 4WXCA 1L4SA 4DUYE 2EMXA 3DJWA 1BB8A 1SFEA 2JY9A 1MGTA 2V86A 2EM3A 4R2PA
chains in the Genus database with same CATH topology
1X3CA 4R2EA 4FK5C 2MKNA 2ENHA 2EMCA 2EQ0A 4R2CA 2GHFA 2WBSA 2JPAA 1UBDC 5KL6A 2EOYA 2WBTA 4GZNC 1A1IA 2EM2A 2EJ4A 1A1GA 1MEYC 1RMDA 2E72A 2RPCA 2D9HA 1YSAC 2EMHA 2EM5A 2EMYA 3MHSC 2NABA 3VHTB 2EPPA 4F2JC 4IS1C 4F6NA 1DGCA 1X6FA 2EPAA 2A25A 2EM4A 2YRKA 2GLIA 2EOIA 2MDGA 2LVHA 1NCSA 2BB8A 2CSHA 2EQ1A 2I13A 2EOJA 5KL5A 2YTGA 2EMGA 2EOHA 3EPJA 2CTDA 2YTJA 3EPKA 4R2SA 2EMFA 1A1JA 1X6EA 5KL7A 2DRPA 5KL3A 2YTNA 2YRHA 3EPLA 1ZU1A 2EL6A 2YSOA 1TF6A 2EMLA 2YU5A 3M99B 2J7JA 2WBUA 1TN9A 2EOMA 2EMBA 2ENAA 5KL2A 2YSPA 2EMAA 2EORA 2EN3A 2EPCA 2M9AA 2YTDA 2DLKA 1YUIA 2EOZA 2YTPA 2EM8A 4R2QA 2YTIA 2VRDA 5KL4A 2DGCA 1LLMC 1BBOA 2YTQA 2WCC3 2RSIA 1X5WA 2EPZA 1JK1A 2LCEA 2MKDA 1YUJA 3UK3C 2EPUA 1JK2A 1A1FA 1AAYA 1P47A 1ZR9A 2EMKA 1F2IG 4R2RA 2EPRA 4WSGA 2YTFA 4R2DA 1TF3A 2EL4A 4M9VC 2EMZA 4IJDA 2ELZA 2EN1A 2EOSA 2EM6A 2EOOA 2DLQA 2EMWA 1UN6B 4X9JA 1WJPA 2CT1A 2YTEA 2EL5A 1G2DC 3EPHA 1Z1BA 2ENCA 2YU8A 2EQ3A 2EE8A 2EM9A 2EOXA 2R1FA 2DMIA 1ZAAC 2EN8A 2EM0A 2JP9A 2ELYA 2EPXA 2EOFA 3MHHC 2ADRA 2EN6A 2EN7A 2EOQA 2EN2A 2YTOA 2LO3A 1A1HA 1KJKA 1B69A 4F6MA 1X6HA 1G2FC 2YRMA 2HGHA 2LT7A 2LV2A 2PRTA 2EOEA 4R2AA 2EM3A 2EMXA 1A1KA 1BB8A 2EP3A 2EN4A 2EM7A 2EMIA 4R2PA 1A1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3C A;  4R2E A;  4FK5 C;  2MKN A;  2ENH A;  2EMC A;  2EQ0 A;  4R2C A;  2GHF A;  2WBS A;  2JPA A;  1UBD C;  5KL6 A;  2EOY A;  2WBT A;  4GZN C;  1A1I A;  2EM2 A;  2EJ4 A;  1A1G A;  1MEY C;  1RMD A;  2E72 A;  2RPC A;  2D9H A;  1YSA C;  2EMH A;  2EM5 A;  2EMY A;  3MHS C;  2NAB A;  3VHT B;  2EPP A;  4F2J C;  4IS1 C;  4F6N A;  1DGC A;  1X6F A;  2EPA A;  2A25 A;  2EM4 A;  2YRK A;  2GLI A;  2EOI A;  2MDG A;  2LVH A;  1NCS A;  2BB8 A;  2CSH A;  2EQ1 A;  2I13 A;  2EOJ A;  5KL5 A;  2YTG A;  2EMG A;  2EOH A;  3EPJ A;  2CTD A;  2YTJ A;  3EPK A;  4R2S A;  2EMF A;  1A1J A;  1X6E A;  5KL7 A;  2DRP A;  5KL3 A;  2YTN A;  2YRH A;  3EPL A;  1ZU1 A;  2EL6 A;  2YSO A;  1TF6 A;  2EML A;  2YU5 A;  3M99 B;  2J7J A;  2WBU A;  1TN9 A;  2EOM A;  2EMB A;  2ENA A;  5KL2 A;  2YSP A;  2EMA A;  2EOR A;  2EN3 A;  2EPC A;  2M9A A;  2YTD A;  2DLK A;  1YUI A;  2EOZ A;  2YTP A;  2EM8 A;  4R2Q A;  2YTI A;  2VRD A;  5KL4 A;  2DGC A;  1LLM C;  1BBO A;  2YTQ A;  2WCC 3;  2RSI A;  1X5W A;  2EPZ A;  1JK1 A;  2LCE A;  2MKD A;  1YUJ A;  3UK3 C;  2EPU A;  1JK2 A;  1A1F A;  1AAY A;  1P47 A;  1ZR9 A;  2EMK A;  1F2I G;  4R2R A;  2EPR A;  4WSG A;  2YTF A;  4R2D A;  1TF3 A;  2EL4 A;  4M9V C;  2EMZ A;  4IJD A;  2ELZ A;  2EN1 A;  2EOS A;  2EM6 A;  2EOO A;  2DLQ A;  2EMW A;  1UN6 B;  4X9J A;  1WJP A;  2CT1 A;  2YTE A;  2EL5 A;  1G2D C;  3EPH A;  1Z1B A;  2ENC A;  2YU8 A;  2EQ3 A;  2EE8 A;  2EM9 A;  2EOX A;  2R1F A;  2DMI A;  1ZAA C;  2EN8 A;  2EM0 A;  2JP9 A;  2ELY A;  2EPX A;  2EOF A;  3MHH C;  2ADR A;  2EN6 A;  2EN7 A;  2EOQ A;  2EN2 A;  2YTO A;  2LO3 A;  1A1H A;  1KJK A;  1B69 A;  4F6M A;  1X6H A;  1G2F C;  2YRM A;  2HGH A;  2LT7 A;  2LV2 A;  2PRT A;  2EOE A;  4R2A A;  2EM3 A;  2EMX A;  1A1K A;  1BB8 A;  2EP3 A;  2EN4 A;  2EM7 A;  2EMI A;  4R2P A;  1A1L A; 
#chains in the Genus database with same CATH topology
 2MKN A;  4BMJ A;  1WRJ A;  4DV0 E;  4DV6 E;  4YHH E;  2WBT A;  4GZN C;  1EH8 A;  2DMY A;  2EM2 A;  4R03 A;  4GKK E;  1RMD A;  2EMH A;  4IS1 C;  2NAB A;  2EPP A;  2LMZ A;  1XMQ E;  5IV8 B;  5AE3 A;  1YFH A;  2EOJ A;  3THO B;  2YTG A;  2EMG A;  5A69 A;  5LLQ A;  1J26 A;  2CTD A;  4BBY A;  4ZYG A;  2EPM X;  5IWA E;  4KWY A;  4DR3 E;  3T1Y E;  2JWO A;  2GPI A;  3JTZ A;  1IQS A;  5KL3 A;  2YTN A;  3DF6 A;  2NUF A;  4LF5 E;  2JOX A;  4JI7 E;  2YSO A;  3ECR A;  2WBU A;  3C6M A;  2YSP A;  2HHH E;  2EMA A;  2M9A A;  3JU0 A;  2M7Q A;  2YTD A;  3KZY A;  1T39 A;  1SR9 A;  2EM8 A;  2ODR D;  4R2Q A;  4F9B B;  5KL4 A;  2DGC A;  1X5W A;  4LF7 E;  2LCE A;  3THN A;  2YZT A;  1YUJ A;  2FGG A;  5ADZ A;  3F6H A;  1FKA E;  1P47 A;  4JI3 E;  1F2I G;  4LU9 A;  5IXM B;  1NEI A;  1RQ0 A;  1ZBT A;  3OML A;  2EL4 A;  1RC7 A;  2EMZ A;  3HQ1 A;  2EM6 A;  3JAM C;  2EMW A;  2L92 A;  3IWC A;  1O0W A;  2EL5 A;  2MDR A;  3QG5 C;  4WX9 A;  1IQO A;  2M1S A;  4DR4 E;  2VF1 A;  2F8B A;  2EE8 A;  2EOX A;  4B3S E;  2DMI A;  1ZAA C;  4BCA A;  2ELY A;  4M0V A;  4LF4 E;  2ADR A;  2EN6 A;  2H36 X;  4ZYD A;  3BF2 A;  1N34 E;  2YTO A;  2R76 A;  1X6H A;  4F6M A;  5A6J A;  2FTX B;  2LT7 A;  4R2A A;  4KZS A;  2UU9 E;  2LJH A;  2VQF E;  1N36 E;  2JXP A;  2WBS A;  4R2C A;  2GHF A;  3OTO E;  5CFF E;  2E5L E;  4HTG A;  5AE1 A;  2UUC E;  4BS9 A;  1IMU A;  1A1I A;  1YZ9 A;  1EH7 A;  2YWQ A;  5FLX C;  2JOB A;  4DMI A;  2E72 A;  4RH8 A;  2MC5 A;  4LF9 E;  2RPC A;  1YSA C;  4J8Z A;  2EMY A;  2EM5 A;  3HPS A;  4F2J C;  4F6N A;  4DV4 E;  1X6F A;  4DR7 E;  3L00 A;  2GLI A;  1UIL A;  1NCS A;  2HC5 A;  2CSH A;  2EQ1 A;  2DB2 A;  2IHR 1;  2LTS A;  3IWB A;  1IBM E;  2LTR A;  2LJU A;  4JV5 E;  4R2S A;  4HEI A;  4DKK A;  1A1J A;  4L5N C;  2YRH A;  2EPL X;  1TF6 A;  4F9C B;  4DUZ E;  2K4V A;  2EOM A;  4WFT A;  3J7Y p;  1J5E E;  2EOR A;  2EN3 A;  4X8W A;  1WHN A;  2DLK A;  3F6G A;  2EOZ A;  2LUP B;  1T4L B;  2M4I A;  4DR6 E;  2YTQ A;  5DNY A;  4JI1 E;  4LF6 E;  1PJS A;  4X62 E;  1EH6 A;  5A6K A;  4LTY A;  2BBG A;  3UK3 C;  1AAY A;  2ODR C;  3T1H E;  1N32 E;  2L3C A;  4N4R B;  4LFB E;  2L8T A;  4F9A B;  1TF3 A;  3EQ1 A;  4JI5 E;  2EOS A;  1QNT A;  1PJT A;  2EOO A;  2UXD E;  2LE2 A;  4JI8 E;  1PKP A;  1WJP A;  3H09 A;  1G2D C;  4O24 A;  3HTX A;  2L2M A;  2ENC A;  4X64 E;  4OOG C;  1HNW E;  2R1F A;  2EN8 A;  2EM0 A;  3ZOQ B;  2EPX A;  4X65 E;  4ZYH A;  2EN7 A;  4B3T E;  2EOQ A;  2RS6 A;  2YT4 A;  2EPK X;  2EN2 A;  3VYX A;  4JI4 E;  4RHB B;  2LO3 A;  2ZM6 E;  2E1M A;  2L33 A;  2HGH A;  2VE7 C;  1EKZ A;  2EZ6 A;  4GKJ E;  2PRT A;  1IBK E;  1T4N A;  1KYQ A;  3ADI A;  1A1K A;  4BC9 A;  2B3T B;  2EP3 A;  4NXM E;  3J81 C;  2EMI A;  1X3C A;  4FK5 C;  3C4T A;  2KON A;  2EQ0 A;  2LUQ A;  1UBD C;  4O5G A;  1T38 A;  5KL6 A;  1HR0 E;  2Q8U A;  3KWR A;  2V85 A;  2RSM A;  4NZV A;  2EJ4 A;  1N3G A;  2EPN A;  3J80 C;  3HXL A;  2D9H A;  4O43 A;  1DGC A;  2UXB E;  1ZBQ A;  3LLH A;  2A25 A;  2EM4 A;  2YRK A;  2MDG A;  1HNX E;  4P7D A;  3C4B A;  1AH5 A;  4JI2 E;  5KL5 A;  2EOH A;  3EPJ A;  2NA2 A;  1XNR E;  2CPN A;  1FJG E;  2YTJ A;  3EPK A;  2UUB E;  2EMF A;  1X49 A;  5KL7 A;  2DRP A;  4O4K A;  4BC7 A;  2L2K B;  2LRS A;  3EPL A;  1ZU1 A;  2EL6 A;  2EML A;  3M99 B;  1X47 A;  1TN9 A;  3BBG A;  4L8N A;  2UUA E;  4LFC E;  1N33 E;  2EMB A;  5KL2 A;  2EPC A;  4DV1 E;  1I94 E;  3ADL A;  2YTP A;  4M2Z A;  4ZYE A;  2VRD A;  2N3G A;  1LLM C;  1IBL E;  2WCC 3;  1XNQ E;  4DR1 E;  2RSI A;  1WXR A;  1JK1 A;  2MKD A;  4TUI A;  4B3R E;  1DQ3 A;  1UHZ A;  2V88 A;  2EPU A;  1A1F A;  3BGH A;  1ZR9 A;  2EMK A;  2FV4 B;  2YTF A;  4R2D A;  5AC4 A;  3BID A;  2RS7 A;  4IJD A;  2ELZ A;  2EN1 A;  2RTX A;  4BHC A;  2DLQ A;  2KOU A;  4X9J A;  4MLV A;  2CT1 A;  4AQY E;  2YPN A;  4OX9 E;  4GEQ B;  2EQ3 A;  3ADG A;  4YY3 E;  3KZZ A;  2B7V A;  5A6A A;  3MSW A;  1A1H A;  1KJK A;  3ADJ A;  2B9D A;  4R8O A;  4JI6 E;  2EOE A;  1PJQ A;  4DV3 E;  1DI2 A;  1YYO A;  2EN4 A;  2EM7 A;  1STU A;  2N8X A;  1A1L A;  4R2E A;  5LL6 R;  2ENH A;  2EMC A;  5A6B A;  2JPA A;  3J7A G;  5LMU E;  2JR1 A;  5LMN E;  2EOY A;  4NHR A;  2V87 A;  2DSY A;  3HPZ A;  1A1G A;  1MEY C;  4DV5 E;  1BBG A;  4JYA E;  3MHS C;  3VHT B;  2EPA A;  5BR8 E;  3VK6 A;  2WZO A;  1X48 A;  2EOI A;  2LVH A;  4NXN E;  2B7T A;  4DR2 E;  2BB8 A;  2I13 A;  1GZ6 A;  5F3W A;  3TQM A;  4LF8 E;  1HNZ E;  4WXD A;  3AUZ A;  1X6E A;  3RMP A;  2KHX A;  5A6B D;  4Q28 A;  2YU5 A;  4Q35 B;  2J7J A;  2V83 A;  2V8Q B;  1XMO E;  5IT9 C;  2ENA A;  2N3H A;  4F54 A;  4KHP E;  2V89 A;  2VQE E;  1YUI A;  2YTI A;  4WSP A;  3P1X A;  4DV7 E;  1BBO A;  1GQE A;  4K0K E;  2UXC E;  2L3J A;  2EPZ A;  2HJJ A;  2EWL A;  4M30 A;  2L6M A;  5A2Q C;  4I8O A;  1JK2 A;  2NUE A;  4R2R A;  2EPR A;  4WSG A;  4LFA E;  3LML A;  2JYA A;  2MC6 A;  4WPY A;  2DIX A;  5TSE A;  4X66 E;  4DV2 E;  1YYK A;  1QU6 A;  4M9V C;  1YYW A;  2I9I A;  1PDA A;  3C6K A;  4WYQ B;  1GTK A;  4MLQ A;  4B3M E;  2K7I A;  2F4V E;  1UN6 B;  3FIG A;  2YTE A;  3IWD A;  3EPH A;  3K6Q A;  2EPO A;  1Z1B A;  2YU8 A;  5T6J A;  2EM9 A;  3VYY A;  4JI0 E;  4TUG A;  2G7H A;  1WHQ A;  1YPN A;  2JP9 A;  5AAS A;  2NUG A;  3MHH C;  2EOF A;  4DR5 E;  2JVA A;  5AC5 A;  2L2N A;  5AE2 A;  1T4O A;  2LBS B;  4BHB A;  1B69 A;  1G2F C;  2YRM A;  3AV0 A;  4P78 A;  2LV2 A;  2RQL A;  4WXC A;  1L4S A;  4DUY E;  2EMX A;  3DJW A;  1BB8 A;  1SFE A;  2JY9 A;  1MGT A;  2V86 A;  2EM3 A;  4R2P A; 
#chains in the Genus database with same CATH homology
 1X3C A;  4R2E A;  4FK5 C;  2MKN A;  2ENH A;  2EMC A;  2EQ0 A;  4R2C A;  2GHF A;  2WBS A;  2JPA A;  1UBD C;  5KL6 A;  2EOY A;  2WBT A;  4GZN C;  1A1I A;  2EM2 A;  2EJ4 A;  1A1G A;  1MEY C;  1RMD A;  2E72 A;  2RPC A;  2D9H A;  1YSA C;  2EMH A;  2EM5 A;  2EMY A;  3MHS C;  2NAB A;  3VHT B;  2EPP A;  4F2J C;  4IS1 C;  4F6N A;  1DGC A;  1X6F A;  2EPA A;  2A25 A;  2EM4 A;  2YRK A;  2GLI A;  2EOI A;  2MDG A;  2LVH A;  1NCS A;  2BB8 A;  2CSH A;  2EQ1 A;  2I13 A;  2EOJ A;  5KL5 A;  2YTG A;  2EMG A;  2EOH A;  3EPJ A;  2CTD A;  2YTJ A;  3EPK A;  4R2S A;  2EMF A;  1A1J A;  1X6E A;  5KL7 A;  2DRP A;  5KL3 A;  2YTN A;  2YRH A;  3EPL A;  1ZU1 A;  2EL6 A;  2YSO A;  1TF6 A;  2EML A;  2YU5 A;  3M99 B;  2J7J A;  2WBU A;  1TN9 A;  2EOM A;  2EMB A;  2ENA A;  5KL2 A;  2YSP A;  2EMA A;  2EOR A;  2EN3 A;  2EPC A;  2M9A A;  2YTD A;  2DLK A;  1YUI A;  2EOZ A;  2YTP A;  2EM8 A;  4R2Q A;  2YTI A;  2VRD A;  5KL4 A;  2DGC A;  1LLM C;  1BBO A;  2YTQ A;  2WCC 3;  2RSI A;  1X5W A;  2EPZ A;  1JK1 A;  2LCE A;  2MKD A;  1YUJ A;  3UK3 C;  2EPU A;  1JK2 A;  1A1F A;  1AAY A;  1P47 A;  1ZR9 A;  2EMK A;  1F2I G;  4R2R A;  2EPR A;  4WSG A;  2YTF A;  4R2D A;  1TF3 A;  2EL4 A;  4M9V C;  2EMZ A;  4IJD A;  2ELZ A;  2EN1 A;  2EOS A;  2EM6 A;  2EOO A;  2DLQ A;  2EMW A;  1UN6 B;  4X9J A;  1WJP A;  2CT1 A;  2YTE A;  2EL5 A;  1G2D C;  3EPH A;  1Z1B A;  2ENC A;  2YU8 A;  2EQ3 A;  2EE8 A;  2EM9 A;  2EOX A;  2R1F A;  2DMI A;  1ZAA C;  2EN8 A;  2EM0 A;  2JP9 A;  2ELY A;  2EPX A;  2EOF A;  3MHH C;  2ADR A;  2EN6 A;  2EN7 A;  2EOQ A;  2EN2 A;  2YTO A;  2LO3 A;  1A1H A;  1KJK A;  1B69 A;  4F6M A;  1X6H A;  1G2F C;  2YRM A;  2HGH A;  2LT7 A;  2LV2 A;  2PRT A;  2EOE A;  4R2A A;  2EM3 A;  2EMX A;  1A1K A;  1BB8 A;  2EP3 A;  2EN4 A;  2EM7 A;  2EMI A;  4R2P A;  1A1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...