5KL4A

Wilms tumor protein (wt1) znf2-4 q369h in complex with formylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
90
structure length
90
Chain Sequence
GSEKPYQCDFKDCERRFSRSDHLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wilms tumor protein
publication title Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 28
structure length 90
sequence length 90
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 5kl4A00
2EMBA 2EOEA 2LT7A 2EOJA 2EMXA 2EMHA 3EPLA 2EM3A 2EL4A 2EP3A 2YTEA 2MKNA 4R2EA 1NCSA 3VHTB 4R2SA 2NABA 4IS1C 2CTDA 2YTQA 1JK2A 1ZU1A 1BBOA 2RPCA 4R2DA 2LVHA 2D9HA 2EN4A 2EL5A 2YSOA 3UK3C 4R2AA 1A1KA 5KL7A 1RMDA 2EPXA 2DGCA 2MDGA 1G2DC 4F6NA 1DGCA 2J7JA 2ELZA 1TF3A 1Z1BA 2EMCA 2EMLA 1X6HA 2EOMA 2EMGA 2YTOA 1P47A 2EMYA 2YRMA 2E72A 1YUJA 2GLIA 2EQ0A 2EM2A 2EMFA 2YTPA 1X6EA 3EPKA 3EPHA 2JPAA 2RSIA 2EMAA 2EL6A 1TF6A 2YU5A 1A1HA 2EN2A 2LCEA 2YSPA 2YTJA 2YU8A 1A1LA 2EOQA 2EOOA 2CSHA 2ADRA 2EPCA 2EOSA 3MHHC 4R2RA 2MKDA 2LV2A 4GZNC 2JP9A 2DLKA 1X5WA 1BB8A 2YTDA 1G2FC 2YTFA 2M9AA 4IJDA 2EOYA 2EOZA 3MHSC 2YTGA 2DRPA 2EMKA 1F2IG 2YTNA 2R1FA 1A1IA 2EPPA 2I13A 1LLMC 2ENCA 2EM5A 2EE8A 5KL4A 1WJPA 2ENHA 2WBSA 2HGHA 2WCC3 1KJKA 1MEYC 1B69A 4F6MA 2EM6A 1YUIA 4FK5C 5KL2A 2EOHA 2YRHA 2PRTA 1X3CA 2EN1A 2YRKA 2EQ3A 4F2JC 2WBUA 1X6FA 2LO3A 2EQ1A 2EN3A 3M99B 2DLQA 2EOIA 2EOXA 2ELYA 2EPAA 2GHFA 4WSGA 1UBDC 3EPJA 2BB8A 1YSAC 2YTIA 1UN6B 2EPRA 2VRDA 2EMWA 2EM4A 1A1JA 4R2QA 2EMZA 1JK1A 4M9VC 1AAYA 1ZR9A 2EM7A 4R2PA 5KL6A 4X9JA 1A1GA 2A25A 2EPZA 2DMIA 2EM0A 2EN6A 2EN8A 1A1FA 2ENAA 2EM8A 2EN7A 1TN9A 2EM9A 2EJ4A 2EPUA 4R2CA 2EOFA 5KL5A 2CT1A 2EORA 2EMIA 2WBTA 5KL3A 1ZAAC
chains in the Genus database with same CATH superfamily
2K4VA 2V85A 1PDAA 2EMXA 1HNZE 2EPLX 2NUGA 3THOB 4DR3E 2YTEA 2MKNA 4B3SE 2LMZA 2L8TA 4DMIA 1EKZA 2EZ6A 4B3RE 2CTDA 2RS6A 1XMQE 1ZU1A 2JVAA 2M1SA 5DNYA 2L2KB 3UK3C 1RMDA 1YYKA 2E5LE 2DGCA 1G2DC 4NXNE 4YY3E 2EMCA 3TQMA 1X6HA 1T38A 3ADJA 1UILA 2FTXB 4B3TE 2K7IA 3C4BA 4GEQB 2EMYA 5LMNE 3C6MA 2EMFA 2YTPA 1RC7A 1PKPA 3DF6A 2RQLA 2LUPB 5BR8E 3IWDA 1A1LA 1SFEA 4F54A 5LMUE 2EPCA 1PJTA 4HTGA 4LF7E 2MKDA 2LV2A 2DMYA 2VQEE 4HEIA 4X62E 4OX9E 4JI5E 3BF2A 4WX9A 2CPNA 1N3GA 4M30A 4P7DA 1KYQA 1X48A 1IQSA 2YTNA 5IT9C 3OTOE 2VE7C 1LLMC 1NEIA 3IWBA 1RQ0A 1WJPA 2KOUA 4NHRA 3HQ1A 4WXDA 2UU9E 2G7HA 4TUIA 2WBSA 1MEYC 4F6MA 3VYYA 5A6KA 5KL2A 2YRHA 4O5GA 4LF4E 2PRTA 4Q28A 1O0WA 2EN1A 1WHNA 2E1MA 2LO3A 3BBGA 4R8OA 2UUCE 2EOXA 2EOIA 1T4LB 2N8XA 2UXBE 4WSGA 4DR7E 1T4NA 2BBGA 1UN6B 4L5NC 4DV7E 2EM4A 4RHBB 2UXCE 3EQ1A 1AAYA 1ZR9A 3KZYA 2A25A 2EN6A 2EN8A 1A1FA 4JI4E 1N32E 1YZ9A 5T6JA 2EMIA 5KL3A 2M4IA 1ZBQA 2EPOA 2F4VE 2LT7A 2NUFA 2N3GA 2L33A 4BCAA 4OOGC 1HNWE 2EP3A 4DKKA 1IQOA 4R2SA 2VF1A 4ZYHA 2JR1A 1JK2A 1BBOA 4R2DA 5A6BA 1PJQA 2EN4A 2F8BA 2EL5A 2KONA 4M2ZA 4N4RB 1GTKA 4WSPA 5IV8B 3J7Yp 1TF3A 4F9CB 1Z1BA 5AE2A 2FV4B 1MGTA 2LBSB 2EMGA 3K6QA 1GQEA 2E72A 4BBYA 1UHZA 3EPHA 2RSIA 2YT4A 1TF6A 2YU5A 1DQ3A 3HXLA 2EN2A 2CSHA 2ADRA 3T1HE 1YYOA 5LLQA 4GZNC 1EH6A 1G2FC 3ADLA 3ADGA 1HR0E 3KWRA 2EOZA 5A6AA 2DRPA 1T4OA 2YZTA 4DV4E 2R1FA 2I13A 2EPMX 1SR9A 4DV5E 2KHXA 4DV6E 1KJKA 2L3JA 4BHBA 4JI3E 4DV1E 3AUZA 4FK5C 5AC4A 3T1YE 4DR2E 2R76A 1X3CA 2EQ3A 4F2JC 3BIDA 1X6FA 4Q35B 4DUZE 5AE3A 5AASA 4ZYEA 3J80C 1BBGA 5AE1A 3HPZA 5F3WA 3J81C 2RTXA 1IMUA 1YSAC 1QU6A 2JXPA 2EPRA 4DV2E 2EMWA 3BGHA 1J26A 3J7AG 2EM7A 3VK6A 5KL6A 1A1GA 2EPZA 4JI8E 2FGGA 1N33E 2ENAA 3AV0A 4DR5E 2NUEA 2EN7A 4JI0E 2EJ4A 2EPUA 4R2CA 2LRSA 2EOFA 2MDRA 4LFAE 4DV3E 4JI7E 2B7VA 2VQFE 3LLHA 1J5EE 1ZAAC 2EMBA 2ODRC 5CFFE 2L2MA 2N3HA 2V86A 3F6HA 3EPLA 5A2QC 2EM3A 2EL4A 4R2EA 2JY9A 3VHTB 4X66E 4WFTA 2MC6A 4DR6E 5TSEA 3LMLA 2LVHA 2L3CA 3HTXA 1XMOE 5A6JA 5KL7A 2UUAE 2EPXA 4LU9A 4F6NA 3ECRA 3OMLA 2J7JA 1I94E 2ELZA 4GKKE 4MLVA 1EH7A 4BC7A 1HNXE 4WYQB 1IBME 4JI1E 2IHR1 2EOMA 2M7QA 1P47A 2YRMA 3THNA 1YUJA 2GLIA 2EQ0A 4GKJE 5FLXC 2NA2A 1X6EA 4LF5E 1XNQE 1YYWA 1IBKE 1N34E 1A1HA 1L4SA 2YTJA 2YU8A 2EOQA 2EOOA 2EOSA 2V8QB 2L2NA 3RMPA 2DLKA 1X5WA 2YTFA 2M9AA 2EOYA 3MHSC 4O4KA 2V88A 4L8NA 4JV5E 3F6GA 3JTZA 4DR4E 2EE8A 2HJJA 4JI6E 3KZZA 2YWQA 2HGHA 2WCC3 2H36X 2JOBA 2JWOA 1YUIA 3L00A 3MSWA 2V87A 1YPNA 2WBUA 1X49A 2EN3A 3M99B 4AQYE 2YPNA 5IXMB 4KZSA 4ZYDA 3FIGA 3C6KA 2B3TB 4ZYGA 4R2QA 4O43A 1JK1A 4M9VC 4R2PA 2HC5A 1EH8A 4X9JA 2EPKX 4O24A 4R03A 1TN9A 3IWCA 4WXCA 5KL5A 2CT1A 1STUA 2WBTA 1WXRA 4BS9A 2EOEA 2EOJA 3JAMC 2UUBE 4LTYA 2EMHA 4P78A 2MC5A 3QG5C 1NCSA 5A69A 1IBLE 2LTSA 2NABA 4IS1C 2YTQA 2LUQA 2EPNA 2RPCA 2ZM6E 2V89A 2D9HA 2YSOA 3P1XA 4R2AA 1A1KA 4BMJA 1T39A 4X64E 2MDGA 2Q8UA 2DSYA 1WRJA 1X47A 1DGCA 2EMLA 1FKAE 3HPSA 5ADZA 2YTOA 4LFCE 2LJHA 4K0KE 4F9AB 2EM2A 2LTRA 3EPKA 2L6MA 4DUYE 2I9IA 2JPAA 2EMAA 4YHHE 2EL6A 3ADIA 2LCEA 2YSPA 1GZ6A 4LFBE 4J8ZA 2HHHE 2B9DA 3MHHC 4R2RA 2JP9A 3H09A 1BB8A 2YTDA 2JYAA 4NZVA 1WHQA 4IJDA 4JI2E 2LE2A 4KWYA 4M0VA 2YTGA 4KHPE 2JOXA 2EMKA 5AC5A 2DB2A 5LL6R 1F2IG 4NXME 4RH8A 4MLQA 2RS7A 4BC9A 1A1IA 2EPPA 4WPYA 1XNRE 2ENCA 5IWAE 2EM5A 5KL4A 2ENHA 2GPIA 1B69A 1QNTA 1PJSA 2EM6A 4LF9E 4TUGA 4BHCA 1N36E 2EOHA 2UXDE 2YRKA 1DI2A 4F9BB 2RSMA 2EQ1A 3C4TA 5A6BD 2DLQA 2B7TA 2ELYA 2EPAA 2GHFA 3VYXA 2LJUA 4X8WA 1UBDC 2WZOA 4X65E 3EPJA 2EWLA 2BB8A 2ODRD 4I8OA 2YTIA 1YFHA 1AH5A 4JYAE 2VRDA 2L92A 1A1JA 4LF8E 2EMZA 3DJWA 2DMIA 2EM0A 1FJGE 4DR1E 4DV0E 2EM8A 1ZBTA 3ZOQB 4LF6E 4B3ME 2EM9A 3JU0A 2EORA 2DIXA 2V83A
chains in the Genus database with same CATH topology
2EMBA 2EOEA 2LT7A 2EOJA 2EMXA 2EMHA 3EPLA 2EM3A 2EL4A 2EP3A 2YTEA 2MKNA 4R2EA 1NCSA 3VHTB 4R2SA 2NABA 4IS1C 2CTDA 2YTQA 1JK2A 1ZU1A 1BBOA 2RPCA 4R2DA 2LVHA 2D9HA 2EN4A 2EL5A 2YSOA 3UK3C 4R2AA 1A1KA 5KL7A 1RMDA 2EPXA 2DGCA 2MDGA 1G2DC 4F6NA 1DGCA 2J7JA 2ELZA 1TF3A 1Z1BA 2EMCA 2EMLA 1X6HA 2EOMA 2EMGA 2YTOA 1P47A 2EMYA 2YRMA 2E72A 1YUJA 2GLIA 2EQ0A 2EM2A 2EMFA 2YTPA 1X6EA 3EPKA 3EPHA 2JPAA 2RSIA 2EMAA 2EL6A 1TF6A 2YU5A 1A1HA 2EN2A 2LCEA 2YSPA 2YTJA 2YU8A 1A1LA 2EOQA 2EOOA 2CSHA 2ADRA 2EPCA 2EOSA 3MHHC 4R2RA 2MKDA 2LV2A 4GZNC 2JP9A 2DLKA 1X5WA 1BB8A 2YTDA 1G2FC 2YTFA 2M9AA 4IJDA 2EOYA 2EOZA 3MHSC 2YTGA 2DRPA 2EMKA 1F2IG 2YTNA 2R1FA 1A1IA 2EPPA 2I13A 1LLMC 2ENCA 2EM5A 2EE8A 5KL4A 1WJPA 2ENHA 2WBSA 2HGHA 2WCC3 1KJKA 1MEYC 1B69A 4F6MA 2EM6A 1YUIA 4FK5C 5KL2A 2EOHA 2YRHA 2PRTA 1X3CA 2EN1A 2YRKA 2EQ3A 4F2JC 2WBUA 1X6FA 2LO3A 2EQ1A 2EN3A 3M99B 2DLQA 2EOIA 2EOXA 2ELYA 2EPAA 2GHFA 4WSGA 1UBDC 3EPJA 2BB8A 1YSAC 2YTIA 1UN6B 2EPRA 2VRDA 2EMWA 2EM4A 1A1JA 4R2QA 2EMZA 1JK1A 4M9VC 1AAYA 1ZR9A 2EM7A 4R2PA 5KL6A 4X9JA 1A1GA 2A25A 2EPZA 2DMIA 2EM0A 2EN6A 2EN8A 1A1FA 2ENAA 2EM8A 2EN7A 1TN9A 2EM9A 2EJ4A 2EPUA 4R2CA 2EOFA 5KL5A 2CT1A 2EORA 2EMIA 2WBTA 5KL3A 1ZAAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMB A;  2EOE A;  2LT7 A;  2EOJ A;  2EMX A;  2EMH A;  3EPL A;  2EM3 A;  2EL4 A;  2EP3 A;  2YTE A;  2MKN A;  4R2E A;  1NCS A;  3VHT B;  4R2S A;  2NAB A;  4IS1 C;  2CTD A;  2YTQ A;  1JK2 A;  1ZU1 A;  1BBO A;  2RPC A;  4R2D A;  2LVH A;  2D9H A;  2EN4 A;  2EL5 A;  2YSO A;  3UK3 C;  4R2A A;  1A1K A;  5KL7 A;  1RMD A;  2EPX A;  2DGC A;  2MDG A;  1G2D C;  4F6N A;  1DGC A;  2J7J A;  2ELZ A;  1TF3 A;  1Z1B A;  2EMC A;  2EML A;  1X6H A;  2EOM A;  2EMG A;  2YTO A;  1P47 A;  2EMY A;  2YRM A;  2E72 A;  1YUJ A;  2GLI A;  2EQ0 A;  2EM2 A;  2EMF A;  2YTP A;  1X6E A;  3EPK A;  3EPH A;  2JPA A;  2RSI A;  2EMA A;  2EL6 A;  1TF6 A;  2YU5 A;  1A1H A;  2EN2 A;  2LCE A;  2YSP A;  2YTJ A;  2YU8 A;  1A1L A;  2EOQ A;  2EOO A;  2CSH A;  2ADR A;  2EPC A;  2EOS A;  3MHH C;  4R2R A;  2MKD A;  2LV2 A;  4GZN C;  2JP9 A;  2DLK A;  1X5W A;  1BB8 A;  2YTD A;  1G2F C;  2YTF A;  2M9A A;  4IJD A;  2EOY A;  2EOZ A;  3MHS C;  2YTG A;  2DRP A;  2EMK A;  1F2I G;  2YTN A;  2R1F A;  1A1I A;  2EPP A;  2I13 A;  1LLM C;  2ENC A;  2EM5 A;  2EE8 A;  5KL4 A;  1WJP A;  2ENH A;  2WBS A;  2HGH A;  2WCC 3;  1KJK A;  1MEY C;  1B69 A;  4F6M A;  2EM6 A;  1YUI A;  4FK5 C;  5KL2 A;  2EOH A;  2YRH A;  2PRT A;  1X3C A;  2EN1 A;  2YRK A;  2EQ3 A;  4F2J C;  2WBU A;  1X6F A;  2LO3 A;  2EQ1 A;  2EN3 A;  3M99 B;  2DLQ A;  2EOI A;  2EOX A;  2ELY A;  2EPA A;  2GHF A;  4WSG A;  1UBD C;  3EPJ A;  2BB8 A;  1YSA C;  2YTI A;  1UN6 B;  2EPR A;  2VRD A;  2EMW A;  2EM4 A;  1A1J A;  4R2Q A;  2EMZ A;  1JK1 A;  4M9V C;  1AAY A;  1ZR9 A;  2EM7 A;  4R2P A;  5KL6 A;  4X9J A;  1A1G A;  2A25 A;  2EPZ A;  2DMI A;  2EM0 A;  2EN6 A;  2EN8 A;  1A1F A;  2ENA A;  2EM8 A;  2EN7 A;  1TN9 A;  2EM9 A;  2EJ4 A;  2EPU A;  4R2C A;  2EOF A;  5KL5 A;  2CT1 A;  2EOR A;  2EMI A;  2WBT A;  5KL3 A;  1ZAA C; 
#chains in the Genus database with same CATH topology
 2K4V A;  2V85 A;  1PDA A;  2EMX A;  1HNZ E;  2EPL X;  2NUG A;  3THO B;  4DR3 E;  2YTE A;  2MKN A;  4B3S E;  2LMZ A;  2L8T A;  4DMI A;  1EKZ A;  2EZ6 A;  4B3R E;  2CTD A;  2RS6 A;  1XMQ E;  1ZU1 A;  2JVA A;  2M1S A;  5DNY A;  2L2K B;  3UK3 C;  1RMD A;  1YYK A;  2E5L E;  2DGC A;  1G2D C;  4NXN E;  4YY3 E;  2EMC A;  3TQM A;  1X6H A;  1T38 A;  3ADJ A;  1UIL A;  2FTX B;  4B3T E;  2K7I A;  3C4B A;  4GEQ B;  2EMY A;  5LMN E;  3C6M A;  2EMF A;  2YTP A;  1RC7 A;  1PKP A;  3DF6 A;  2RQL A;  2LUP B;  5BR8 E;  3IWD A;  1A1L A;  1SFE A;  4F54 A;  5LMU E;  2EPC A;  1PJT A;  4HTG A;  4LF7 E;  2MKD A;  2LV2 A;  2DMY A;  2VQE E;  4HEI A;  4X62 E;  4OX9 E;  4JI5 E;  3BF2 A;  4WX9 A;  2CPN A;  1N3G A;  4M30 A;  4P7D A;  1KYQ A;  1X48 A;  1IQS A;  2YTN A;  5IT9 C;  3OTO E;  2VE7 C;  1LLM C;  1NEI A;  3IWB A;  1RQ0 A;  1WJP A;  2KOU A;  4NHR A;  3HQ1 A;  4WXD A;  2UU9 E;  2G7H A;  4TUI A;  2WBS A;  1MEY C;  4F6M A;  3VYY A;  5A6K A;  5KL2 A;  2YRH A;  4O5G A;  4LF4 E;  2PRT A;  4Q28 A;  1O0W A;  2EN1 A;  1WHN A;  2E1M A;  2LO3 A;  3BBG A;  4R8O A;  2UUC E;  2EOX A;  2EOI A;  1T4L B;  2N8X A;  2UXB E;  4WSG A;  4DR7 E;  1T4N A;  2BBG A;  1UN6 B;  4L5N C;  4DV7 E;  2EM4 A;  4RHB B;  2UXC E;  3EQ1 A;  1AAY A;  1ZR9 A;  3KZY A;  2A25 A;  2EN6 A;  2EN8 A;  1A1F A;  4JI4 E;  1N32 E;  1YZ9 A;  5T6J A;  2EMI A;  5KL3 A;  2M4I A;  1ZBQ A;  2EPO A;  2F4V E;  2LT7 A;  2NUF A;  2N3G A;  2L33 A;  4BCA A;  4OOG C;  1HNW E;  2EP3 A;  4DKK A;  1IQO A;  4R2S A;  2VF1 A;  4ZYH A;  2JR1 A;  1JK2 A;  1BBO A;  4R2D A;  5A6B A;  1PJQ A;  2EN4 A;  2F8B A;  2EL5 A;  2KON A;  4M2Z A;  4N4R B;  1GTK A;  4WSP A;  5IV8 B;  3J7Y p;  1TF3 A;  4F9C B;  1Z1B A;  5AE2 A;  2FV4 B;  1MGT A;  2LBS B;  2EMG A;  3K6Q A;  1GQE A;  2E72 A;  4BBY A;  1UHZ A;  3EPH A;  2RSI A;  2YT4 A;  1TF6 A;  2YU5 A;  1DQ3 A;  3HXL A;  2EN2 A;  2CSH A;  2ADR A;  3T1H E;  1YYO A;  5LLQ A;  4GZN C;  1EH6 A;  1G2F C;  3ADL A;  3ADG A;  1HR0 E;  3KWR A;  2EOZ A;  5A6A A;  2DRP A;  1T4O A;  2YZT A;  4DV4 E;  2R1F A;  2I13 A;  2EPM X;  1SR9 A;  4DV5 E;  2KHX A;  4DV6 E;  1KJK A;  2L3J A;  4BHB A;  4JI3 E;  4DV1 E;  3AUZ A;  4FK5 C;  5AC4 A;  3T1Y E;  4DR2 E;  2R76 A;  1X3C A;  2EQ3 A;  4F2J C;  3BID A;  1X6F A;  4Q35 B;  4DUZ E;  5AE3 A;  5AAS A;  4ZYE A;  3J80 C;  1BBG A;  5AE1 A;  3HPZ A;  5F3W A;  3J81 C;  2RTX A;  1IMU A;  1YSA C;  1QU6 A;  2JXP A;  2EPR A;  4DV2 E;  2EMW A;  3BGH A;  1J26 A;  3J7A G;  2EM7 A;  3VK6 A;  5KL6 A;  1A1G A;  2EPZ A;  4JI8 E;  2FGG A;  1N33 E;  2ENA A;  3AV0 A;  4DR5 E;  2NUE A;  2EN7 A;  4JI0 E;  2EJ4 A;  2EPU A;  4R2C A;  2LRS A;  2EOF A;  2MDR A;  4LFA E;  4DV3 E;  4JI7 E;  2B7V A;  2VQF E;  3LLH A;  1J5E E;  1ZAA C;  2EMB A;  2ODR C;  5CFF E;  2L2M A;  2N3H A;  2V86 A;  3F6H A;  3EPL A;  5A2Q C;  2EM3 A;  2EL4 A;  4R2E A;  2JY9 A;  3VHT B;  4X66 E;  4WFT A;  2MC6 A;  4DR6 E;  5TSE A;  3LML A;  2LVH A;  2L3C A;  3HTX A;  1XMO E;  5A6J A;  5KL7 A;  2UUA E;  2EPX A;  4LU9 A;  4F6N A;  3ECR A;  3OML A;  2J7J A;  1I94 E;  2ELZ A;  4GKK E;  4MLV A;  1EH7 A;  4BC7 A;  1HNX E;  4WYQ B;  1IBM E;  4JI1 E;  2IHR 1;  2EOM A;  2M7Q A;  1P47 A;  2YRM A;  3THN A;  1YUJ A;  2GLI A;  2EQ0 A;  4GKJ E;  5FLX C;  2NA2 A;  1X6E A;  4LF5 E;  1XNQ E;  1YYW A;  1IBK E;  1N34 E;  1A1H A;  1L4S A;  2YTJ A;  2YU8 A;  2EOQ A;  2EOO A;  2EOS A;  2V8Q B;  2L2N A;  3RMP A;  2DLK A;  1X5W A;  2YTF A;  2M9A A;  2EOY A;  3MHS C;  4O4K A;  2V88 A;  4L8N A;  4JV5 E;  3F6G A;  3JTZ A;  4DR4 E;  2EE8 A;  2HJJ A;  4JI6 E;  3KZZ A;  2YWQ A;  2HGH A;  2WCC 3;  2H36 X;  2JOB A;  2JWO A;  1YUI A;  3L00 A;  3MSW A;  2V87 A;  1YPN A;  2WBU A;  1X49 A;  2EN3 A;  3M99 B;  4AQY E;  2YPN A;  5IXM B;  4KZS A;  4ZYD A;  3FIG A;  3C6K A;  2B3T B;  4ZYG A;  4R2Q A;  4O43 A;  1JK1 A;  4M9V C;  4R2P A;  2HC5 A;  1EH8 A;  4X9J A;  2EPK X;  4O24 A;  4R03 A;  1TN9 A;  3IWC A;  4WXC A;  5KL5 A;  2CT1 A;  1STU A;  2WBT A;  1WXR A;  4BS9 A;  2EOE A;  2EOJ A;  3JAM C;  2UUB E;  4LTY A;  2EMH A;  4P78 A;  2MC5 A;  3QG5 C;  1NCS A;  5A69 A;  1IBL E;  2LTS A;  2NAB A;  4IS1 C;  2YTQ A;  2LUQ A;  2EPN A;  2RPC A;  2ZM6 E;  2V89 A;  2D9H A;  2YSO A;  3P1X A;  4R2A A;  1A1K A;  4BMJ A;  1T39 A;  4X64 E;  2MDG A;  2Q8U A;  2DSY A;  1WRJ A;  1X47 A;  1DGC A;  2EML A;  1FKA E;  3HPS A;  5ADZ A;  2YTO A;  4LFC E;  2LJH A;  4K0K E;  4F9A B;  2EM2 A;  2LTR A;  3EPK A;  2L6M A;  4DUY E;  2I9I A;  2JPA A;  2EMA A;  4YHH E;  2EL6 A;  3ADI A;  2LCE A;  2YSP A;  1GZ6 A;  4LFB E;  4J8Z A;  2HHH E;  2B9D A;  3MHH C;  4R2R A;  2JP9 A;  3H09 A;  1BB8 A;  2YTD A;  2JYA A;  4NZV A;  1WHQ A;  4IJD A;  4JI2 E;  2LE2 A;  4KWY A;  4M0V A;  2YTG A;  4KHP E;  2JOX A;  2EMK A;  5AC5 A;  2DB2 A;  5LL6 R;  1F2I G;  4NXM E;  4RH8 A;  4MLQ A;  2RS7 A;  4BC9 A;  1A1I A;  2EPP A;  4WPY A;  1XNR E;  2ENC A;  5IWA E;  2EM5 A;  5KL4 A;  2ENH A;  2GPI A;  1B69 A;  1QNT A;  1PJS A;  2EM6 A;  4LF9 E;  4TUG A;  4BHC A;  1N36 E;  2EOH A;  2UXD E;  2YRK A;  1DI2 A;  4F9B B;  2RSM A;  2EQ1 A;  3C4T A;  5A6B D;  2DLQ A;  2B7T A;  2ELY A;  2EPA A;  2GHF A;  3VYX A;  2LJU A;  4X8W A;  1UBD C;  2WZO A;  4X65 E;  3EPJ A;  2EWL A;  2BB8 A;  2ODR D;  4I8O A;  2YTI A;  1YFH A;  1AH5 A;  4JYA E;  2VRD A;  2L92 A;  1A1J A;  4LF8 E;  2EMZ A;  3DJW A;  2DMI A;  2EM0 A;  1FJG E;  4DR1 E;  4DV0 E;  2EM8 A;  1ZBT A;  3ZOQ B;  4LF6 E;  4B3M E;  2EM9 A;  3JU0 A;  2EOR A;  2DIX A;  2V83 A; 
#chains in the Genus database with same CATH homology
 2EMB A;  2EOE A;  2LT7 A;  2EOJ A;  2EMX A;  2EMH A;  3EPL A;  2EM3 A;  2EL4 A;  2EP3 A;  2YTE A;  2MKN A;  4R2E A;  1NCS A;  3VHT B;  4R2S A;  2NAB A;  4IS1 C;  2CTD A;  2YTQ A;  1JK2 A;  1ZU1 A;  1BBO A;  2RPC A;  4R2D A;  2LVH A;  2D9H A;  2EN4 A;  2EL5 A;  2YSO A;  3UK3 C;  4R2A A;  1A1K A;  5KL7 A;  1RMD A;  2EPX A;  2DGC A;  2MDG A;  1G2D C;  4F6N A;  1DGC A;  2J7J A;  2ELZ A;  1TF3 A;  1Z1B A;  2EMC A;  2EML A;  1X6H A;  2EOM A;  2EMG A;  2YTO A;  1P47 A;  2EMY A;  2YRM A;  2E72 A;  1YUJ A;  2GLI A;  2EQ0 A;  2EM2 A;  2EMF A;  2YTP A;  1X6E A;  3EPK A;  3EPH A;  2JPA A;  2RSI A;  2EMA A;  2EL6 A;  1TF6 A;  2YU5 A;  1A1H A;  2EN2 A;  2LCE A;  2YSP A;  2YTJ A;  2YU8 A;  1A1L A;  2EOQ A;  2EOO A;  2CSH A;  2ADR A;  2EPC A;  2EOS A;  3MHH C;  4R2R A;  2MKD A;  2LV2 A;  4GZN C;  2JP9 A;  2DLK A;  1X5W A;  1BB8 A;  2YTD A;  1G2F C;  2YTF A;  2M9A A;  4IJD A;  2EOY A;  2EOZ A;  3MHS C;  2YTG A;  2DRP A;  2EMK A;  1F2I G;  2YTN A;  2R1F A;  1A1I A;  2EPP A;  2I13 A;  1LLM C;  2ENC A;  2EM5 A;  2EE8 A;  5KL4 A;  1WJP A;  2ENH A;  2WBS A;  2HGH A;  2WCC 3;  1KJK A;  1MEY C;  1B69 A;  4F6M A;  2EM6 A;  1YUI A;  4FK5 C;  5KL2 A;  2EOH A;  2YRH A;  2PRT A;  1X3C A;  2EN1 A;  2YRK A;  2EQ3 A;  4F2J C;  2WBU A;  1X6F A;  2LO3 A;  2EQ1 A;  2EN3 A;  3M99 B;  2DLQ A;  2EOI A;  2EOX A;  2ELY A;  2EPA A;  2GHF A;  4WSG A;  1UBD C;  3EPJ A;  2BB8 A;  1YSA C;  2YTI A;  1UN6 B;  2EPR A;  2VRD A;  2EMW A;  2EM4 A;  1A1J A;  4R2Q A;  2EMZ A;  1JK1 A;  4M9V C;  1AAY A;  1ZR9 A;  2EM7 A;  4R2P A;  5KL6 A;  4X9J A;  1A1G A;  2A25 A;  2EPZ A;  2DMI A;  2EM0 A;  2EN6 A;  2EN8 A;  1A1F A;  2ENA A;  2EM8 A;  2EN7 A;  1TN9 A;  2EM9 A;  2EJ4 A;  2EPU A;  4R2C A;  2EOF A;  5KL5 A;  2CT1 A;  2EOR A;  2EMI A;  2WBT A;  5KL3 A;  1ZAA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...