5KL4A

Wilms tumor protein (wt1) znf2-4 q369h in complex with formylated dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
90
structure length
90
Chain Sequence
GSEKPYQCDFKDCERRFSRSDHLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords Wilms tumor protein
total genus 28
structure length 90
sequence length 90
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 5kl4A00
1ZU1A 2EJ4A 2EOYA 2DLQA 1ZAAC 4GZNC 4IS1C 2EMHA 3VHTB 1UBDC 2EM3A 1B69A 5KL3A 2ELYA 5KL6A 2EN6A 4R2QA 2EMFA 2YU5A 2A25A 1A1LA 4IJDA 2YTIA 2EMBA 2EOHA 2YTDA 3MHSC 2MDGA 1YUJA 2EPXA 2YTJA 3EPHA 2EM4A 1TF3A 2EOQA 2EMYA 2E72A 2EOXA 1TN9A 2D9HA 4F6NA 1G2FC 1X6EA 5KL2A 2GHFA 2DGCA 3EPLA 4M9VC 2EN7A 2MKNA 2EN8A 1X6HA 2EL6A 2EOSA 2EM0A 2RPCA 1BB8A 2YTPA 2EMZA 2PRTA 2YRKA 2ADRA 2WBSA 4FK5C 2LT7A 2CT1A 2EQ0A 2EMXA 2EM6A 2EMLA 2WBTA 4X9JA 2EN2A 1TF6A 2EM9A 2EOFA 1UN6B 2EPCA 2EORA 1YSAC 2EQ1A 1X6FA 2EN3A 2EOJA 2YRMA 4F2JC 2EN1A 1P47A 2EP3A 1LLMC 4R2EA 2LCEA 2EOEA 2MKDA 4R2RA 2NABA 2YTFA 2VRDA 2DRPA 2J7JA 2WCC3 1X5WA 2CTDA 2EMWA 2DLKA 2EM2A 2EN4A 5KL4A 1WJPA 2EPPA 4R2PA 2EMAA 3EPJA 2EM8A 2EOZA 2YU8A 2EM7A 3EPKA 2ENHA 2RSIA 2ENCA 3UK3C 4R2SA 2EOOA 2WBUA 3M99B 2ELZA 4F6MA 4WSGA 1ZR9A 2ENAA 2EMGA 3MHHC 2R1FA 2LVHA 1NCSA 2EMIA 2EL5A 2HGHA 2EPUA 2BB8A 1A1GA 5KL5A 2EMCA 2LO3A 2JP9A 4R2DA 2LV2A 2YRHA 2M9AA 1RMDA 5KL7A 1A1IA 1DGCA 2EOMA 1F2IG 2YSOA 2EPRA 1JK1A 2EOIA 1A1JA 1KJKA 1A1FA 2JPAA 2EE8A 2YTGA 2I13A 1X3CA 1A1HA 2YTEA 4R2AA 2EPZA 1AAYA 1G2DC 2YSPA 2YTOA 2GLIA 4R2CA 1A1KA 2EPAA 2EQ3A 1BBOA 1JK2A 2EL4A 2EM5A 2DMIA 1Z1BA 1YUIA 2YTQA 2CSHA 2EMKA 1MEYC 2YTNA
chains in the Genus database with same CATH superfamily
2EJ4A 1J5EE 1KYQA 4F9AB 1ZAAC 4GZNC 1YPNA 2RS7A 2EM3A 3P1XA 4WYQB 1B69A 3JU0A 2ZM6E 4DV1E 4WX9A 4IJDA 2K4VA 3H09A 4RHBB 3JAMC 3OMLA 2MDGA 2EPXA 4KZSA 2EMYA 1RQ0A 4OX9E 2EOXA 2L3JA 4DKKA 4F6NA 2LUQA 1X6EA 1G2FC 2MKNA 2L6MA 4WFTA 5AC4A 4ZYDA 4TUIA 2UXBE 2KHXA 2EOSA 5A6BA 2UUAE 4LF8E 1IQSA 4MLQA 2BBGA 2V89A 4O4KA 3IWCA 2EMXA 2G7HA 4M0VA 1IBME 3KZYA 2EM6A 3IWBA 2EN2A 4BBYA 4DR5E 2JOXA 1YSAC 5AE3A 2LJHA 4L8NA 2EOJA 3T1YE 4B3TE 4O43A 2EN1A 2EP3A 4LF9E 2L3CA 4M2ZA 3MSWA 4WXCA 4DV0E 2VQFE 2EPLX 3VYYA 5IT9C 2YTFA 1N34E 2DLKA 2I9IA 5AE2A 5KL4A 2YU8A 4JI5E 1HNXE 2ENCA 4F6MA 4BCAA 1ZR9A 2EMGA 2R1FA 1NCSA 4LF6E 3C6MA 4NZVA 2V88A 2M7QA 5KL5A 1A1GA 2LO3A 2JVAA 2LV2A 1ZBTA 2YRHA 2LTSA 2V83A 1RMDA 1A1IA 5IXMB 2EOMA 3AUZA 4BS9A 1N33E 1PDAA 3ECRA 1A1FA 4WXDA 3RMPA 1XMQE 3BF2A 2EE8A 2YTGA 4Q28A 4LFBE 4DR7E 3QG5C 1X3CA 1A1HA 2R76A 2YTEA 1G2DC 2L92A 3ADLA 2YSPA 2YTOA 4HTGA 1A1KA 1X48A 4JI6E 1ZBQA 2V8QB 1MGTA 3BBGA 4LF5E 1Z1BA 2N3HA 2V85A 4JYAE 5A6AA 2CSHA 1MEYC 2YTNA 1ZU1A 1IMUA 2EWLA 2DLQA 5KL3A 5KL6A 2FGGA 1N3GA 1QNTA 4R03A 2V87A 3JTZA 1SR9A 4J8ZA 2EPMX 2EMBA 2EOHA 5LMNE 2L33A 5A6KA 1YUJA 1EH8A 3EPHA 1STUA 1TF3A 1L4SA 2HHHE 2LBSB 5KL2A 2DGCA 3HXLA 1HNWE 3DJWA 1X6HA 2UUCE 4DR2E 1T4OA 1BB8A 4AQYE 5A6BD 3ADGA 2JOBA 2YRKA 1YZ9A 2ADRA 2EPOA 2MDRA 2VF1A 4DR6E 2CT1A 2RS6A 4DV2E 3VK6A 4DV3E 3HTXA 1UN6B 5T6JA 3OTOE 3BIDA 1O0WA 1P47A 1FJGE 4MLVA 1PJQA 5F3WA 4X64E 4R2EA 2LCEA 4JI7E 2NABA 4JI3E 4BHCA 3J7Yp 3F6HA 1HNZE 2B7TA 2EM2A 3HPSA 1WJPA 2LJUA 2EMAA 2GPIA 2EZ6A 2EM7A 1PJSA 5AC5A 4M30A 1GZ6A 4B3RE 1I94E 3J81C 4R2SA 2FTXB 2EOOA 2WBUA 1FKAE 3M99B 4B3ME 2ODRC 4JI1E 4BC9A 2EPKX 2LVHA 2EMIA 2EL5A 4R2DA 3IWDA 1XMOE 2YSOA 3C4TA 2NUGA 2UUBE 4Q35B 2N3GA 4F9BB 2JPAA 3TQMA 2HJJA 2YWQA 2DIXA 4DUYE 4WSPA 4BC7A 2EQ3A 1BBOA 2WZOA 2EL4A 2K7IA 2EM5A 5AASA 5IWAE 4BHBA 4R8OA 3J80C 1YUIA 2EMKA 4KWYA 3K6QA 4LF7E 3THOB 2V86A 4JI0E 2EOYA 4WPYA 4IS1C 2EMHA 1UBDC 2B9DA 2L2MA 4DR1E 2FV4B 5IV8B 2ELYA 5A2QC 2EN6A 2EMFA 2DSYA 3THNA 1X47A 1YYKA 3VYXA 2YTDA 3MHSC 4O24A 4TUGA 2EOQA 2KOUA 2NUEA 3BGHA 2E72A 4X66E 2KONA 1TN9A 3EQ1A 4OOGC 3ZOQB 2D9HA 1IBKE 2F4VE 4LTYA 4X8WA 2GHFA 1J26A 3EPLA 4M9VC 2EN7A 1IQOA 4P7DA 2EN8A 1RC7A 2EM0A 4LF4E 1SFEA 2PRTA 5TSEA 4ZYEA 2RQLA 2JWOA 2EQ0A 1XNRE 2RSMA 2EMLA 2WBTA 3KZZA 1UHZA 4X9JA 1YYOA 2EM9A 4K0KE 2EOFA 2JXPA 1EH6A 2EPCA 3F6GA 2EQ1A 5FLXC 2EN3A 4DR4E 1DQ3A 4DR3E 2NA2A 3ADIA 4JV5E 2LUPB 2EOEA 2VRDA 2J7JA 2WCC3 1X5WA 2H36X 2CTDA 2EMWA 1WHNA 5LL6R 1PJTA 2EPPA 3EPJA 2L8TA 2EOZA 3UK3C 1T39A 4ZYHA 2ENAA 3MHHC 2M1SA 2DMYA 2YPNA 1AH5A 2YZTA 2HGHA 1PKPA 1EKZA 2BB8A 2B7VA 2EMCA 4GKKE 2JP9A 2M9AA 4LU9A 1DGCA 3FIGA 4NXME 1F2IG 3C4BA 1JK1A 1EH7A 1KJKA 4DV7E 4LFCE 2VE7C 4P78A 2I13A 4R2AA 4YHHE 4N4RB 2RTXA 2LMZA 3ADJA 2IHR1 1WHQA 2GLIA 4R2CA 2MC6A 5AE1A 1JK2A 2DMIA 4YY3E 2YTQA 2JY9A 1N32E 1DI2A 3VHTB 2LE2A 4NHRA 2MC5A 4R2QA 1T38A 2YU5A 4JI8E 2A25A 1A1LA 2YTIA 5A6JA 1GTKA 2YTJA 4GEQB 2EM4A 5BR8E 2JR1A 3LLHA 4DV6E 1QU6A 2Q8UA 1HR0E 2EL6A 2UXDE 3J7AG 3L00A 2RPCA 2YTPA 2EMZA 3LMLA 2VQEE 2WBSA 4KHPE 4FK5C 2LT7A 4X62E 4F9CB 1TF6A 4B3SE 5DNYA 1BBGA 2EORA 1X6FA 2YRMA 4F2JC 2DB2A 3HPZA 1LLMC 2HC5A 1YYWA 4LFAE 2E1MA 2CPNA 2MKDA 2UU9E 4R2RA 4DV5E 2DRPA 1IBLE 2F8BA 2EN4A 4L5NC 4R2PA 1XNQE 2EM8A 2EPNA 4DUZE 1GQEA 3EPKA 2ENHA 2RSIA 2E5LE 2ELZA 1WRJA 2JYAA 1NEIA 4WSGA 1YFHA 3DF6A 5LLQA 1T4NA 5A69A 4DMIA 4X65E 2EPUA 2UXCE 1N36E 5CFFE 4BMJA 2LRSA 4DV4E 4JI4E 4JI2E 5KL7A 3T1HE 3AV0A 2EPRA 4HEIA 3HQ1A 1X49A 2EOIA 1A1JA 4ZYGA 4RH8A 2LTRA 4NXNE 2ODRD 3C6KA 2B3TB 2NUFA 2EPZA 1AAYA 5LMUE 2N8XA 4F54A 5ADZA 2M4IA 2EPAA 4I8OA 4O5GA 1WXRA 2YT4A 1T4LB 3KWRA 4GKJE 1UILA 2L2KB 2L2NA
chains in the Genus database with same CATH topology
1ZU1A 2EJ4A 2EOYA 2DLQA 1ZAAC 4GZNC 4IS1C 2EMHA 3VHTB 1UBDC 2EM3A 1B69A 5KL3A 2ELYA 5KL6A 2EN6A 4R2QA 2EMFA 2YU5A 2A25A 1A1LA 4IJDA 2YTIA 2EMBA 2EOHA 2YTDA 3MHSC 2MDGA 1YUJA 2EPXA 2YTJA 3EPHA 2EM4A 1TF3A 2EOQA 2EMYA 2E72A 2EOXA 1TN9A 2D9HA 4F6NA 1G2FC 1X6EA 5KL2A 2GHFA 2DGCA 3EPLA 4M9VC 2EN7A 2MKNA 2EN8A 1X6HA 2EL6A 2EOSA 2EM0A 2RPCA 1BB8A 2YTPA 2EMZA 2PRTA 2YRKA 2ADRA 2WBSA 4FK5C 2LT7A 2CT1A 2EQ0A 2EMXA 2EM6A 2EMLA 2WBTA 4X9JA 2EN2A 1TF6A 2EM9A 2EOFA 1UN6B 2EPCA 2EORA 1YSAC 2EQ1A 1X6FA 2EN3A 2EOJA 2YRMA 4F2JC 2EN1A 1P47A 2EP3A 1LLMC 4R2EA 2LCEA 2EOEA 2MKDA 4R2RA 2NABA 2YTFA 2VRDA 2DRPA 2J7JA 2WCC3 1X5WA 2CTDA 2EMWA 2DLKA 2EM2A 2EN4A 5KL4A 1WJPA 2EPPA 4R2PA 2EMAA 3EPJA 2EM8A 2EOZA 2YU8A 2EM7A 3EPKA 2ENHA 2RSIA 2ENCA 3UK3C 4R2SA 2EOOA 2WBUA 3M99B 2ELZA 4F6MA 4WSGA 1ZR9A 2ENAA 2EMGA 3MHHC 2R1FA 2LVHA 1NCSA 2EMIA 2EL5A 2HGHA 2EPUA 2BB8A 1A1GA 5KL5A 2EMCA 2LO3A 2JP9A 4R2DA 2LV2A 2YRHA 2M9AA 1RMDA 5KL7A 1A1IA 1DGCA 2EOMA 1F2IG 2YSOA 2EPRA 1JK1A 2EOIA 1A1JA 1KJKA 1A1FA 2JPAA 2EE8A 2YTGA 2I13A 1X3CA 1A1HA 2YTEA 4R2AA 2EPZA 1AAYA 1G2DC 2YSPA 2YTOA 2GLIA 4R2CA 1A1KA 2EPAA 2EQ3A 1BBOA 1JK2A 2EL4A 2EM5A 2DMIA 1Z1BA 1YUIA 2YTQA 2CSHA 2EMKA 1MEYC 2YTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZU1 A;  2EJ4 A;  2EOY A;  2DLQ A;  1ZAA C;  4GZN C;  4IS1 C;  2EMH A;  3VHT B;  1UBD C;  2EM3 A;  1B69 A;  5KL3 A;  2ELY A;  5KL6 A;  2EN6 A;  4R2Q A;  2EMF A;  2YU5 A;  2A25 A;  1A1L A;  4IJD A;  2YTI A;  2EMB A;  2EOH A;  2YTD A;  3MHS C;  2MDG A;  1YUJ A;  2EPX A;  2YTJ A;  3EPH A;  2EM4 A;  1TF3 A;  2EOQ A;  2EMY A;  2E72 A;  2EOX A;  1TN9 A;  2D9H A;  4F6N A;  1G2F C;  1X6E A;  5KL2 A;  2GHF A;  2DGC A;  3EPL A;  4M9V C;  2EN7 A;  2MKN A;  2EN8 A;  1X6H A;  2EL6 A;  2EOS A;  2EM0 A;  2RPC A;  1BB8 A;  2YTP A;  2EMZ A;  2PRT A;  2YRK A;  2ADR A;  2WBS A;  4FK5 C;  2LT7 A;  2CT1 A;  2EQ0 A;  2EMX A;  2EM6 A;  2EML A;  2WBT A;  4X9J A;  2EN2 A;  1TF6 A;  2EM9 A;  2EOF A;  1UN6 B;  2EPC A;  2EOR A;  1YSA C;  2EQ1 A;  1X6F A;  2EN3 A;  2EOJ A;  2YRM A;  4F2J C;  2EN1 A;  1P47 A;  2EP3 A;  1LLM C;  4R2E A;  2LCE A;  2EOE A;  2MKD A;  4R2R A;  2NAB A;  2YTF A;  2VRD A;  2DRP A;  2J7J A;  2WCC 3;  1X5W A;  2CTD A;  2EMW A;  2DLK A;  2EM2 A;  2EN4 A;  5KL4 A;  1WJP A;  2EPP A;  4R2P A;  2EMA A;  3EPJ A;  2EM8 A;  2EOZ A;  2YU8 A;  2EM7 A;  3EPK A;  2ENH A;  2RSI A;  2ENC A;  3UK3 C;  4R2S A;  2EOO A;  2WBU A;  3M99 B;  2ELZ A;  4F6M A;  4WSG A;  1ZR9 A;  2ENA A;  2EMG A;  3MHH C;  2R1F A;  2LVH A;  1NCS A;  2EMI A;  2EL5 A;  2HGH A;  2EPU A;  2BB8 A;  1A1G A;  5KL5 A;  2EMC A;  2LO3 A;  2JP9 A;  4R2D A;  2LV2 A;  2YRH A;  2M9A A;  1RMD A;  5KL7 A;  1A1I A;  1DGC A;  2EOM A;  1F2I G;  2YSO A;  2EPR A;  1JK1 A;  2EOI A;  1A1J A;  1KJK A;  1A1F A;  2JPA A;  2EE8 A;  2YTG A;  2I13 A;  1X3C A;  1A1H A;  2YTE A;  4R2A A;  2EPZ A;  1AAY A;  1G2D C;  2YSP A;  2YTO A;  2GLI A;  4R2C A;  1A1K A;  2EPA A;  2EQ3 A;  1BBO A;  1JK2 A;  2EL4 A;  2EM5 A;  2DMI A;  1Z1B A;  1YUI A;  2YTQ A;  2CSH A;  2EMK A;  1MEY C;  2YTN A; 
#chains in the Genus database with same CATH topology
 2EJ4 A;  1J5E E;  1KYQ A;  4F9A B;  1ZAA C;  4GZN C;  1YPN A;  2RS7 A;  2EM3 A;  3P1X A;  4WYQ B;  1B69 A;  3JU0 A;  2ZM6 E;  4DV1 E;  4WX9 A;  4IJD A;  2K4V A;  3H09 A;  4RHB B;  3JAM C;  3OML A;  2MDG A;  2EPX A;  4KZS A;  2EMY A;  1RQ0 A;  4OX9 E;  2EOX A;  2L3J A;  4DKK A;  4F6N A;  2LUQ A;  1X6E A;  1G2F C;  2MKN A;  2L6M A;  4WFT A;  5AC4 A;  4ZYD A;  4TUI A;  2UXB E;  2KHX A;  2EOS A;  5A6B A;  2UUA E;  4LF8 E;  1IQS A;  4MLQ A;  2BBG A;  2V89 A;  4O4K A;  3IWC A;  2EMX A;  2G7H A;  4M0V A;  1IBM E;  3KZY A;  2EM6 A;  3IWB A;  2EN2 A;  4BBY A;  4DR5 E;  2JOX A;  1YSA C;  5AE3 A;  2LJH A;  4L8N A;  2EOJ A;  3T1Y E;  4B3T E;  4O43 A;  2EN1 A;  2EP3 A;  4LF9 E;  2L3C A;  4M2Z A;  3MSW A;  4WXC A;  4DV0 E;  2VQF E;  2EPL X;  3VYY A;  5IT9 C;  2YTF A;  1N34 E;  2DLK A;  2I9I A;  5AE2 A;  5KL4 A;  2YU8 A;  4JI5 E;  1HNX E;  2ENC A;  4F6M A;  4BCA A;  1ZR9 A;  2EMG A;  2R1F A;  1NCS A;  4LF6 E;  3C6M A;  4NZV A;  2V88 A;  2M7Q A;  5KL5 A;  1A1G A;  2LO3 A;  2JVA A;  2LV2 A;  1ZBT A;  2YRH A;  2LTS A;  2V83 A;  1RMD A;  1A1I A;  5IXM B;  2EOM A;  3AUZ A;  4BS9 A;  1N33 E;  1PDA A;  3ECR A;  1A1F A;  4WXD A;  3RMP A;  1XMQ E;  3BF2 A;  2EE8 A;  2YTG A;  4Q28 A;  4LFB E;  4DR7 E;  3QG5 C;  1X3C A;  1A1H A;  2R76 A;  2YTE A;  1G2D C;  2L92 A;  3ADL A;  2YSP A;  2YTO A;  4HTG A;  1A1K A;  1X48 A;  4JI6 E;  1ZBQ A;  2V8Q B;  1MGT A;  3BBG A;  4LF5 E;  1Z1B A;  2N3H A;  2V85 A;  4JYA E;  5A6A A;  2CSH A;  1MEY C;  2YTN A;  1ZU1 A;  1IMU A;  2EWL A;  2DLQ A;  5KL3 A;  5KL6 A;  2FGG A;  1N3G A;  1QNT A;  4R03 A;  2V87 A;  3JTZ A;  1SR9 A;  4J8Z A;  2EPM X;  2EMB A;  2EOH A;  5LMN E;  2L33 A;  5A6K A;  1YUJ A;  1EH8 A;  3EPH A;  1STU A;  1TF3 A;  1L4S A;  2HHH E;  2LBS B;  5KL2 A;  2DGC A;  3HXL A;  1HNW E;  3DJW A;  1X6H A;  2UUC E;  4DR2 E;  1T4O A;  1BB8 A;  4AQY E;  5A6B D;  3ADG A;  2JOB A;  2YRK A;  1YZ9 A;  2ADR A;  2EPO A;  2MDR A;  2VF1 A;  4DR6 E;  2CT1 A;  2RS6 A;  4DV2 E;  3VK6 A;  4DV3 E;  3HTX A;  1UN6 B;  5T6J A;  3OTO E;  3BID A;  1O0W A;  1P47 A;  1FJG E;  4MLV A;  1PJQ A;  5F3W A;  4X64 E;  4R2E A;  2LCE A;  4JI7 E;  2NAB A;  4JI3 E;  4BHC A;  3J7Y p;  3F6H A;  1HNZ E;  2B7T A;  2EM2 A;  3HPS A;  1WJP A;  2LJU A;  2EMA A;  2GPI A;  2EZ6 A;  2EM7 A;  1PJS A;  5AC5 A;  4M30 A;  1GZ6 A;  4B3R E;  1I94 E;  3J81 C;  4R2S A;  2FTX B;  2EOO A;  2WBU A;  1FKA E;  3M99 B;  4B3M E;  2ODR C;  4JI1 E;  4BC9 A;  2EPK X;  2LVH A;  2EMI A;  2EL5 A;  4R2D A;  3IWD A;  1XMO E;  2YSO A;  3C4T A;  2NUG A;  2UUB E;  4Q35 B;  2N3G A;  4F9B B;  2JPA A;  3TQM A;  2HJJ A;  2YWQ A;  2DIX A;  4DUY E;  4WSP A;  4BC7 A;  2EQ3 A;  1BBO A;  2WZO A;  2EL4 A;  2K7I A;  2EM5 A;  5AAS A;  5IWA E;  4BHB A;  4R8O A;  3J80 C;  1YUI A;  2EMK A;  4KWY A;  3K6Q A;  4LF7 E;  3THO B;  2V86 A;  4JI0 E;  2EOY A;  4WPY A;  4IS1 C;  2EMH A;  1UBD C;  2B9D A;  2L2M A;  4DR1 E;  2FV4 B;  5IV8 B;  2ELY A;  5A2Q C;  2EN6 A;  2EMF A;  2DSY A;  3THN A;  1X47 A;  1YYK A;  3VYX A;  2YTD A;  3MHS C;  4O24 A;  4TUG A;  2EOQ A;  2KOU A;  2NUE A;  3BGH A;  2E72 A;  4X66 E;  2KON A;  1TN9 A;  3EQ1 A;  4OOG C;  3ZOQ B;  2D9H A;  1IBK E;  2F4V E;  4LTY A;  4X8W A;  2GHF A;  1J26 A;  3EPL A;  4M9V C;  2EN7 A;  1IQO A;  4P7D A;  2EN8 A;  1RC7 A;  2EM0 A;  4LF4 E;  1SFE A;  2PRT A;  5TSE A;  4ZYE A;  2RQL A;  2JWO A;  2EQ0 A;  1XNR E;  2RSM A;  2EML A;  2WBT A;  3KZZ A;  1UHZ A;  4X9J A;  1YYO A;  2EM9 A;  4K0K E;  2EOF A;  2JXP A;  1EH6 A;  2EPC A;  3F6G A;  2EQ1 A;  5FLX C;  2EN3 A;  4DR4 E;  1DQ3 A;  4DR3 E;  2NA2 A;  3ADI A;  4JV5 E;  2LUP B;  2EOE A;  2VRD A;  2J7J A;  2WCC 3;  1X5W A;  2H36 X;  2CTD A;  2EMW A;  1WHN A;  5LL6 R;  1PJT A;  2EPP A;  3EPJ A;  2L8T A;  2EOZ A;  3UK3 C;  1T39 A;  4ZYH A;  2ENA A;  3MHH C;  2M1S A;  2DMY A;  2YPN A;  1AH5 A;  2YZT A;  2HGH A;  1PKP A;  1EKZ A;  2BB8 A;  2B7V A;  2EMC A;  4GKK E;  2JP9 A;  2M9A A;  4LU9 A;  1DGC A;  3FIG A;  4NXM E;  1F2I G;  3C4B A;  1JK1 A;  1EH7 A;  1KJK A;  4DV7 E;  4LFC E;  2VE7 C;  4P78 A;  2I13 A;  4R2A A;  4YHH E;  4N4R B;  2RTX A;  2LMZ A;  3ADJ A;  2IHR 1;  1WHQ A;  2GLI A;  4R2C A;  2MC6 A;  5AE1 A;  1JK2 A;  2DMI A;  4YY3 E;  2YTQ A;  2JY9 A;  1N32 E;  1DI2 A;  3VHT B;  2LE2 A;  4NHR A;  2MC5 A;  4R2Q A;  1T38 A;  2YU5 A;  4JI8 E;  2A25 A;  1A1L A;  2YTI A;  5A6J A;  1GTK A;  2YTJ A;  4GEQ B;  2EM4 A;  5BR8 E;  2JR1 A;  3LLH A;  4DV6 E;  1QU6 A;  2Q8U A;  1HR0 E;  2EL6 A;  2UXD E;  3J7A G;  3L00 A;  2RPC A;  2YTP A;  2EMZ A;  3LML A;  2VQE E;  2WBS A;  4KHP E;  4FK5 C;  2LT7 A;  4X62 E;  4F9C B;  1TF6 A;  4B3S E;  5DNY A;  1BBG A;  2EOR A;  1X6F A;  2YRM A;  4F2J C;  2DB2 A;  3HPZ A;  1LLM C;  2HC5 A;  1YYW A;  4LFA E;  2E1M A;  2CPN A;  2MKD A;  2UU9 E;  4R2R A;  4DV5 E;  2DRP A;  1IBL E;  2F8B A;  2EN4 A;  4L5N C;  4R2P A;  1XNQ E;  2EM8 A;  2EPN A;  4DUZ E;  1GQE A;  3EPK A;  2ENH A;  2RSI A;  2E5L E;  2ELZ A;  1WRJ A;  2JYA A;  1NEI A;  4WSG A;  1YFH A;  3DF6 A;  5LLQ A;  1T4N A;  5A69 A;  4DMI A;  4X65 E;  2EPU A;  2UXC E;  1N36 E;  5CFF E;  4BMJ A;  2LRS A;  4DV4 E;  4JI4 E;  4JI2 E;  5KL7 A;  3T1H E;  3AV0 A;  2EPR A;  4HEI A;  3HQ1 A;  1X49 A;  2EOI A;  1A1J A;  4ZYG A;  4RH8 A;  2LTR A;  4NXN E;  2ODR D;  3C6K A;  2B3T B;  2NUF A;  2EPZ A;  1AAY A;  5LMU E;  2N8X A;  4F54 A;  5ADZ A;  2M4I A;  2EPA A;  4I8O A;  4O5G A;  1WXR A;  2YT4 A;  1T4L B;  3KWR A;  4GKJ E;  1UIL A;  2L2K B;  2L2N A; 
#chains in the Genus database with same CATH homology
 1ZU1 A;  2EJ4 A;  2EOY A;  2DLQ A;  1ZAA C;  4GZN C;  4IS1 C;  2EMH A;  3VHT B;  1UBD C;  2EM3 A;  1B69 A;  5KL3 A;  2ELY A;  5KL6 A;  2EN6 A;  4R2Q A;  2EMF A;  2YU5 A;  2A25 A;  1A1L A;  4IJD A;  2YTI A;  2EMB A;  2EOH A;  2YTD A;  3MHS C;  2MDG A;  1YUJ A;  2EPX A;  2YTJ A;  3EPH A;  2EM4 A;  1TF3 A;  2EOQ A;  2EMY A;  2E72 A;  2EOX A;  1TN9 A;  2D9H A;  4F6N A;  1G2F C;  1X6E A;  5KL2 A;  2GHF A;  2DGC A;  3EPL A;  4M9V C;  2EN7 A;  2MKN A;  2EN8 A;  1X6H A;  2EL6 A;  2EOS A;  2EM0 A;  2RPC A;  1BB8 A;  2YTP A;  2EMZ A;  2PRT A;  2YRK A;  2ADR A;  2WBS A;  4FK5 C;  2LT7 A;  2CT1 A;  2EQ0 A;  2EMX A;  2EM6 A;  2EML A;  2WBT A;  4X9J A;  2EN2 A;  1TF6 A;  2EM9 A;  2EOF A;  1UN6 B;  2EPC A;  2EOR A;  1YSA C;  2EQ1 A;  1X6F A;  2EN3 A;  2EOJ A;  2YRM A;  4F2J C;  2EN1 A;  1P47 A;  2EP3 A;  1LLM C;  4R2E A;  2LCE A;  2EOE A;  2MKD A;  4R2R A;  2NAB A;  2YTF A;  2VRD A;  2DRP A;  2J7J A;  2WCC 3;  1X5W A;  2CTD A;  2EMW A;  2DLK A;  2EM2 A;  2EN4 A;  5KL4 A;  1WJP A;  2EPP A;  4R2P A;  2EMA A;  3EPJ A;  2EM8 A;  2EOZ A;  2YU8 A;  2EM7 A;  3EPK A;  2ENH A;  2RSI A;  2ENC A;  3UK3 C;  4R2S A;  2EOO A;  2WBU A;  3M99 B;  2ELZ A;  4F6M A;  4WSG A;  1ZR9 A;  2ENA A;  2EMG A;  3MHH C;  2R1F A;  2LVH A;  1NCS A;  2EMI A;  2EL5 A;  2HGH A;  2EPU A;  2BB8 A;  1A1G A;  5KL5 A;  2EMC A;  2LO3 A;  2JP9 A;  4R2D A;  2LV2 A;  2YRH A;  2M9A A;  1RMD A;  5KL7 A;  1A1I A;  1DGC A;  2EOM A;  1F2I G;  2YSO A;  2EPR A;  1JK1 A;  2EOI A;  1A1J A;  1KJK A;  1A1F A;  2JPA A;  2EE8 A;  2YTG A;  2I13 A;  1X3C A;  1A1H A;  2YTE A;  4R2A A;  2EPZ A;  1AAY A;  1G2D C;  2YSP A;  2YTO A;  2GLI A;  4R2C A;  1A1K A;  2EPA A;  2EQ3 A;  1BBO A;  1JK2 A;  2EL4 A;  2EM5 A;  2DMI A;  1Z1B A;  1YUI A;  2YTQ A;  2CSH A;  2EMK A;  1MEY C;  2YTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...